F475898
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 697 | 404 | 676 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10085898|Ga0307515_100858982 |
| Length | 303 |
| Sequence | VSRLNDDTPLAAYGKRPSQGHEEAPAWPGVGPCLGRPGAAARPAVKHIARKRFGQHFLTDGAIIDAIIDAIAPKPGEALIEIGPGLGAMTHPLVARCEQLTVIELDRDLAQRLRGRPGLEVIEADVLQVDFDALAQARGQRLRVVGNLPYNISSPILFHLLGSAARVVDQHFMLQKEVVERMAAGPGTKDYGRLSVMLQWRYDIESVLDVPPESFDPPPRVDSAVVRMLPLPDAPGIEPALLSELVRVAFSQRRKLLRHTLGRWLDERGFAGEFDVQRRAEEVPVADYLALAASVKGAEAKGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 8 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 9 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 10 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 11 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 12 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 13 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 14 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 15 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 16 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 17 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 18 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 19 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 20 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 21 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 22 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 23 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 24 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 25 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 26 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 27 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 28 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 29 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 33 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 34 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 35 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 36 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 48 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 119 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 206 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 209 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 221 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 222 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 223 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 236 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 237 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 238 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 239 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 249 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 250 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 251 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 252 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 253 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 254 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 255 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 256 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 257 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 258 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 259 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 260 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 261 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 262 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 263 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 264 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 265 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 266 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 267 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 268 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 269 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 270 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 271 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 272 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 273 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 274 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 278 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 279 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 280 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 281 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 314 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 315 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 316 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 318 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 319 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 320 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 321 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 343 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 344 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 345 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 348 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 349 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 350 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 356 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 357 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 365 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 377 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 379 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 380 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 381 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 382 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 384 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 385 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 386 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 388 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 389 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 390 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 391 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 392 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 394 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 395 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 396 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 397 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 399 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 404 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.84 |
| Metatranscriptomes | 0.14 |
| Isolates | 3.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.39 |
| Nodule | 0.29 |
| Rhizoplane | 2.73 |
| Rhizosphere | 63.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005939 | 3300001979 | Bacteria | 5112 |
| 2 | JGI25155J39150_1000092 | 3300002704 | Bacteria | 51808 |
| 3 | JGI25156J39149_1000067 | 3300002705 | Bacteria | 82796 |
| 4 | JGI25154J39366_1000089 | 3300002738 | Bacteria | 82796 |
| 5 | JGI25157J39369_1000084 | 3300002741 | Bacteria | 82796 |
| 6 | JGI25152J39213_1002247 | 3300002773 | Bacteria | 7468 |
| 7 | JGI25150J39212_1004135 | 3300002774 | Bacteria | 3272 |
| 8 | JGI25150J39212_1013536 | 3300002774 | Bacteria | 1410 |
| 9 | JGI25159J45721_1000151 | 3300002987 | Bacteria | 32346 |
| 10 | JGI25159J45721_1001940 | 3300002987 | Bacteria | 8242 |
| 11 | JGI25151J46595_10008194 | 3300003187 | Bacteria | 5048 |
| 12 | JGI25151J46595_10019356 | 3300003187 | Bacteria | 2893 |
| 13 | JGI25151J46595_10053949 | 3300003187 | Bacteria | 1338 |
| 14 | JGI25153J46596_10001482 | 3300003215 | Bacteria | 13987 |
| 15 | JGI25153J46596_10002052 | 3300003215 | Bacteria | 11868 |
| 16 | JGI25153J46596_10003533 | 3300003215 | Bacteria | 8720 |
| 17 | rootL2_10027772 | 3300003322 | Bacteria | 6501 |
| 18 | rootL2_10041726 | 3300003322 | Bacteria | 1266 |
| 19 | rootH1_10026256 | 3300003323 | Bacteria | 1965 |
| 20 | JGI25160J50197_1000076 | 3300003354 | Bacteria | 102318 |
| 21 | JGI25160J50197_1015714 | 3300003354 | Bacteria | 2473 |
| 22 | JGI25161J50226_1000058 | 3300003374 | Bacteria | 102318 |
| 23 | Ga0055525_1000056 | 3300003759 | Bacteria | 212321 |
| 24 | Ga0055526_1002345 | 3300003771 | Bacteria | 12862 |
| 25 | Ga0055526_1015985 | 3300003771 | Bacteria | 2974 |
| 26 | Ga0055526_1027784 | 3300003771 | Bacteria | 1735 |
| 27 | Ga0055537_1000207 | 3300003773 | Bacteria | 44154 |
| 28 | Ga0055524_1000033 | 3300003775 | Bacteria | 180833 |
| 29 | Ga0055524_1000303 | 3300003775 | Bacteria | 47193 |
| 30 | Ga0055536_1002799 | 3300003781 | Bacteria | 9638 |
| 31 | Ga0055534_1004926 | 3300003784 | Bacteria | 3728 |
| 32 | Ga0055528_1000468 | 3300003790 | Bacteria | 32324 |
| 33 | Ga0055530_10000449 | 3300003791 | Bacteria | 36583 |
| 34 | Ga0055530_10001419 | 3300003791 | Bacteria | 17587 |
| 35 | Ga0055530_10017939 | 3300003791 | Bacteria | 2200 |
| 36 | Ga0055540_1000088 | 3300003792 | Bacteria | 102236 |
| 37 | Ga0055540_1000184 | 3300003792 | Bacteria | 60646 |
| 38 | Ga0055531_10001550 | 3300003794 | Bacteria | 16828 |
| 39 | Ga0055531_10001635 | 3300003794 | Bacteria | 16229 |
| 40 | Ga0055531_10007861 | 3300003794 | Bacteria | 5733 |
| 41 | Ga0055531_10013435 | 3300003794 | Bacteria | 3772 |
| 42 | Ga0055531_10045105 | 3300003794 | Bacteria | 1228 |
| 43 | Ga0055543_1003345 | 3300004625 | Bacteria | 4781 |
| 44 | Ga0065165_1003497 | 3300005262 | Bacteria | 10954 |
| 45 | Ga0065165_1024375 | 3300005262 | Bacteria | 2033 |
| 46 | Ga0065165_1026081 | 3300005262 | Bacteria | 1929 |
| 47 | Ga0070676_10007740 | 3300005328 | Bacteria | 5768 |
| 48 | Ga0070676_10011204 | 3300005328 | Bacteria | 4874 |
| 49 | Ga0070676_10368599 | 3300005328 | Bacteria | 991 |
| 50 | Ga0070670_100047187 | 3300005331 | Bacteria | 3705 |
| 51 | Ga0070670_100089314 | 3300005331 | Bacteria | 2649 |
| 52 | Ga0070670_100600763 | 3300005331 | Bacteria | 984 |
| 53 | Ga0070677_10015480 | 3300005333 | Bacteria | 2702 |
| 54 | Ga0068869_100007433 | 3300005334 | Bacteria | 7004 |
| 55 | Ga0068868_100078694 | 3300005338 | Bacteria | 2640 |
| 56 | Ga0068868_100274651 | 3300005338 | Bacteria | 1425 |
| 57 | Ga0070661_100002070 | 3300005344 | Bacteria | 13804 |
| 58 | Ga0070669_100210306 | 3300005353 | Bacteria | 1534 |
| 59 | Ga0070675_100001642 | 3300005354 | Bacteria | 16524 |
| 60 | Ga0070675_100108089 | 3300005354 | Bacteria | 2349 |
| 61 | Ga0070671_100001451 | 3300005355 | Bacteria | 17703 |
| 62 | Ga0070671_100001946 | 3300005355 | Bacteria | 15842 |
| 63 | Ga0070671_100016402 | 3300005355 | Bacteria | 5990 |
| 64 | Ga0070671_100043544 | 3300005355 | Bacteria | 3730 |
| 65 | Ga0070671_100161407 | 3300005355 | Bacteria | 1894 |
| 66 | Ga0070671_100378509 | 3300005355 | Bacteria | 1210 |
| 67 | Ga0070674_100073993 | 3300005356 | Bacteria | 2416 |
| 68 | Ga0070673_100039125 | 3300005364 | Bacteria | 3627 |
| 69 | Ga0070673_100046472 | 3300005364 | Bacteria | 3372 |
| 70 | Ga0070673_100296809 | 3300005364 | Bacteria | 1422 |
| 71 | Ga0070659_100004522 | 3300005366 | Bacteria | 9935 |
| 72 | Ga0070667_100011551 | 3300005367 | Bacteria | 7301 |
| 73 | Ga0070663_100000177 | 3300005455 | Bacteria | 32482 |
| 74 | Ga0070663_100029061 | 3300005455 | Bacteria | 3772 |
| 75 | Ga0070678_100083161 | 3300005456 | Bacteria | 2433 |
| 76 | Ga0070678_100204351 | 3300005456 | Bacteria | 1632 |
| 77 | Ga0070662_100011436 | 3300005457 | Bacteria | 5858 |
| 78 | Ga0070662_100043764 | 3300005457 | Bacteria | 3205 |
| 79 | Ga0070662_100056616 | 3300005457 | Bacteria | 2847 |
| 80 | Ga0068867_100002539 | 3300005459 | Bacteria | 12853 |
| 81 | Ga0068867_100011407 | 3300005459 | Bacteria | 6270 |
| 82 | Ga0070698_100131030 | 3300005471 | Bacteria | 2463 |
| 83 | Ga0068853_100299540 | 3300005539 | Bacteria | 1486 |
| 84 | Ga0068853_100530173 | 3300005539 | Bacteria | 1114 |
| 85 | Ga0070672_100089458 | 3300005543 | Bacteria | 2481 |
| 86 | Ga0070665_100007442 | 3300005548 | Bacteria | 11136 |
| 87 | Ga0070665_100243266 | 3300005548 | Bacteria | 1800 |
| 88 | Ga0070664_100004129 | 3300005564 | Bacteria | 11663 |
| 89 | Ga0068857_100045761 | 3300005577 | Bacteria | 3883 |
| 90 | Ga0068857_100233714 | 3300005577 | Bacteria | 1682 |
| 91 | Ga0068857_100322260 | 3300005577 | Bacteria | 1427 |
| 92 | Ga0068854_100024279 | 3300005578 | Bacteria | 4148 |
| 93 | Ga0068854_100070468 | 3300005578 | Bacteria | 2555 |
| 94 | Ga0068854_100272447 | 3300005578 | Bacteria | 1360 |
| 95 | Ga0068852_100062752 | 3300005616 | Bacteria | 3233 |
| 96 | Ga0068852_100068114 | 3300005616 | Bacteria | 3114 |
| 97 | Ga0068859_100394865 | 3300005617 | Bacteria | 1479 |
| 98 | Ga0068864_100014887 | 3300005618 | Bacteria | 6462 |
| 99 | Ga0068864_100029189 | 3300005618 | Bacteria | 4667 |
| 100 | Ga0068861_100046976 | 3300005719 | Bacteria | 3257 |
| 101 | Ga0068863_100025738 | 3300005841 | Bacteria | 5612 |
| 102 | Ga0068863_100371966 | 3300005841 | Bacteria | 1395 |
| 103 | Ga0068860_100052637 | 3300005843 | Bacteria | 3872 |
| 104 | Ga0068860_100152450 | 3300005843 | Bacteria | 2226 |
| 105 | Ga0068862_100157457 | 3300005844 | Bacteria | 2026 |
| 106 | Ga0075365_10005601 | 3300006038 | Bacteria | 6794 |
| 107 | Ga0075368_10066297 | 3300006042 | Bacteria | 1451 |
| 108 | Ga0075363_100009419 | 3300006048 | Bacteria | 4591 |
| 109 | Ga0075363_100017797 | 3300006048 | Bacteria | 3530 |
| 110 | Ga0075363_100040513 | 3300006048 | Bacteria | 2455 |
| 111 | Ga0075364_10014008 | 3300006051 | Bacteria | 4944 |
| 112 | Ga0075364_10026448 | 3300006051 | Bacteria | 3702 |
| 113 | Ga0075364_10147209 | 3300006051 | Bacteria | 1586 |
| 114 | Ga0075362_10009878 | 3300006177 | Bacteria | 3706 |
| 115 | Ga0075362_10052784 | 3300006177 | Bacteria | 1823 |
| 116 | Ga0075362_10094765 | 3300006177 | Bacteria | 1389 |
| 117 | Ga0075362_10129575 | 3300006177 | Bacteria | 1199 |
| 118 | Ga0075367_10058767 | 3300006178 | Bacteria | 2288 |
| 119 | Ga0075367_10134981 | 3300006178 | Bacteria | 1526 |
| 120 | Ga0075366_10010218 | 3300006195 | Bacteria | 5265 |
| 121 | Ga0075366_10027638 | 3300006195 | Bacteria | 3329 |
| 122 | Ga0075366_10037610 | 3300006195 | Bacteria | 2858 |
| 123 | Ga0075366_10038492 | 3300006195 | Bacteria | 2824 |
| 124 | Ga0075366_10048103 | 3300006195 | Bacteria | 2528 |
| 125 | Ga0097621_100085974 | 3300006237 | Bacteria | 2624 |
| 126 | Ga0097621_100162159 | 3300006237 | Bacteria | 1922 |
| 127 | Ga0097621_100191014 | 3300006237 | Bacteria | 1773 |
| 128 | Ga0075370_10002305 | 3300006353 | Bacteria | 8801 |
| 129 | Ga0075370_10018093 | 3300006353 | Bacteria | 3818 |
| 130 | Ga0075370_10094514 | 3300006353 | Bacteria | 1726 |
| 131 | Ga0068871_100010211 | 3300006358 | Bacteria | 6839 |
| 132 | Ga0075428_100014646 | 3300006844 | Bacteria | 8708 |
| 133 | Ga0075430_100043881 | 3300006846 | Bacteria | 3781 |
| 134 | Ga0075431_100226001 | 3300006847 | Bacteria | 1908 |
| 135 | Ga0075433_10005691 | 3300006852 | Bacteria | 9798 |
| 136 | Ga0075434_100000099 | 3300006871 | Bacteria | 48394 |
| 137 | Ga0075429_100010563 | 3300006880 | Bacteria | 7984 |
| 138 | Ga0075429_100305696 | 3300006880 | Bacteria | 1392 |
| 139 | Ga0068865_100222175 | 3300006881 | Bacteria | 1477 |
| 140 | Ga0097620_100394849 | 3300006931 | Bacteria | 1479 |
| 141 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 142 | Ga0075435_100010581 | 3300007076 | Bacteria | 6751 |
| 143 | Ga0105240_10093898 | 3300009093 | Bacteria | 3661 |
| 144 | Ga0111539_10007187 | 3300009094 | Bacteria | 14272 |
| 145 | Ga0111539_10049751 | 3300009094 | Bacteria | 4996 |
| 146 | Ga0105245_10062486 | 3300009098 | Bacteria | 3360 |
| 147 | Ga0114129_10043073 | 3300009147 | Bacteria | 6353 |
| 148 | Ga0114129_10101901 | 3300009147 | Bacteria | 3971 |
| 149 | Ga0114129_10466474 | 3300009147 | Bacteria | 1654 |
| 150 | Ga0105243_10097400 | 3300009148 | Bacteria | 2435 |
| 151 | Ga0105243_10243143 | 3300009148 | Bacteria | 1603 |
| 152 | Ga0105248_10000345 | 3300009177 | Bacteria | 54458 |
| 153 | Ga0105248_10016463 | 3300009177 | Bacteria | 8138 |
| 154 | Ga0105248_10386550 | 3300009177 | Bacteria | 1575 |
| 155 | Ga0105237_10000372 | 3300009545 | Bacteria | 63675 |
| 156 | Ga0105237_10029616 | 3300009545 | Bacteria | 5563 |
| 157 | Ga0105239_10000623 | 3300010375 | Bacteria | 50370 |
| 158 | Ga0105239_10022914 | 3300010375 | Bacteria | 6884 |
| 159 | Ga0157374_10093533 | 3300013296 | Bacteria | 2870 |
| 160 | Ga0157378_10233668 | 3300013297 | Bacteria | 1753 |
| 161 | Ga0163162_10299748 | 3300013306 | Bacteria | 1739 |
| 162 | Ga0157375_10082583 | 3300013308 | Bacteria | 3255 |
| 163 | Ga0157375_10330179 | 3300013308 | Bacteria | 1690 |
| 164 | Ga0163163_10258308 | 3300014325 | Bacteria | 1793 |
| 165 | Ga0163163_10651398 | 3300014325 | Bacteria | 1117 |
| 166 | Ga0157380_10031068 | 3300014326 | Bacteria | 4097 |
| 167 | Ga0157380_10035763 | 3300014326 | Bacteria | 3838 |
| 168 | Ga0157380_10594228 | 3300014326 | Bacteria | 1094 |
| 169 | Ga0182008_10052156 | 3300014497 | Bacteria | 2028 |
| 170 | Ga0157377_10270033 | 3300014745 | Bacteria | 1110 |
| 171 | Ga0157379_10048254 | 3300014968 | Bacteria | 3800 |
| 172 | Ga0157379_10769547 | 3300014968 | Bacteria | 907 |
| 173 | Ga0157376_10518467 | 3300014969 | Bacteria | 1174 |
| 174 | Ga0163161_10005830 | 3300017792 | Bacteria | 8535 |
| 175 | Ga0213872_10000066 | 3300021361 | Bacteria | 93052 |
| 176 | Ga0213872_10000208 | 3300021361 | Bacteria | 52289 |
| 177 | Ga0213872_10011812 | 3300021361 | Bacteria | 4127 |
| 178 | Ga0213872_10018486 | 3300021361 | Bacteria | 3215 |
| 179 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 180 | Ga0209436_104260 | 3300025208 | Bacteria | 3570 |
| 181 | Ga0209674_105588 | 3300025226 | Bacteria | 1829 |
| 182 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 183 | Ga0207425_1001448 | 3300025245 | Bacteria | 9912 |
| 184 | Ga0207425_1004208 | 3300025245 | Bacteria | 4373 |
| 185 | Ga0207425_1005008 | 3300025245 | Bacteria | 3854 |
| 186 | Ga0209646_1000029 | 3300025246 | Bacteria | 386414 |
| 187 | Ga0209026_1000016 | 3300025250 | Bacteria | 386457 |
| 188 | Ga0209759_1000016 | 3300025256 | Bacteria | 386414 |
| 189 | Ga0209129_1000309 | 3300025258 | Bacteria | 44354 |
| 190 | Ga0209129_1019880 | 3300025258 | Bacteria | 1260 |
| 191 | Ga0209565_1000061 | 3300025263 | Bacteria | 185308 |
| 192 | Ga0209565_1001035 | 3300025263 | Bacteria | 14126 |
| 193 | Ga0209565_1008463 | 3300025263 | Bacteria | 2687 |
| 194 | Ga0209673_1000492 | 3300025273 | Bacteria | 65573 |
| 195 | Ga0209673_1015184 | 3300025273 | Bacteria | 2940 |
| 196 | Ga0209673_1017905 | 3300025273 | Bacteria | 2597 |
| 197 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 198 | Ga0209130_1000411 | 3300025284 | Bacteria | 46681 |
| 199 | Ga0209675_1003237 | 3300025291 | Bacteria | 7857 |
| 200 | Ga0209675_1014235 | 3300025291 | Bacteria | 2432 |
| 201 | Ga0209675_1027991 | 3300025291 | Bacteria | 1377 |
| 202 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 203 | Ga0209676_1000153 | 3300025292 | Bacteria | 166393 |
| 204 | Ga0209676_1003964 | 3300025292 | Bacteria | 8557 |
| 205 | Ga0209025_1002161 | 3300025294 | Bacteria | 21908 |
| 206 | Ga0209025_1022311 | 3300025294 | Bacteria | 3364 |
| 207 | Ga0209025_1063236 | 3300025294 | Bacteria | 1367 |
| 208 | Ga0209564_1000162 | 3300025295 | Bacteria | 162265 |
| 209 | Ga0209564_1001101 | 3300025295 | Bacteria | 32085 |
| 210 | Ga0209564_1001248 | 3300025295 | Bacteria | 28296 |
| 211 | Ga0209758_1000152 | 3300025297 | Bacteria | 162418 |
| 212 | Ga0209758_1000969 | 3300025297 | Bacteria | 38697 |
| 213 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 214 | Ga0209050_1000202 | 3300025298 | Bacteria | 133468 |
| 215 | Ga0209050_1001318 | 3300025298 | Bacteria | 27770 |
| 216 | Ga0209050_1009519 | 3300025298 | Bacteria | 4955 |
| 217 | Ga0209050_1014764 | 3300025298 | Bacteria | 3336 |
| 218 | Ga0209050_1036703 | 3300025298 | Bacteria | 1426 |
| 219 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 220 | Ga0209256_1000039 | 3300025299 | Bacteria | 372337 |
| 221 | Ga0209256_1032607 | 3300025299 | Bacteria | 1411 |
| 222 | Ga0207426_1000174 | 3300025302 | Bacteria | 160877 |
| 223 | Ga0207426_1003159 | 3300025302 | Bacteria | 9318 |
| 224 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 225 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 226 | Ga0209051_1000351 | 3300025303 | Bacteria | 68445 |
| 227 | Ga0209051_1006113 | 3300025303 | Bacteria | 6849 |
| 228 | Ga0209051_1018306 | 3300025303 | Bacteria | 3102 |
| 229 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 230 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 231 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 232 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 233 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 234 | Ga0209257_1010422 | 3300025304 | Bacteria | 4707 |
| 235 | Ga0209257_1018761 | 3300025304 | Bacteria | 2641 |
| 236 | Ga0207697_10010847 | 3300025315 | Bacteria | 3876 |
| 237 | Ga0207656_10085542 | 3300025321 | Bacteria | 1424 |
| 238 | Ga0207682_10002340 | 3300025893 | Bacteria | 8545 |
| 239 | Ga0207645_10008271 | 3300025907 | Bacteria | 7272 |
| 240 | Ga0207643_10163511 | 3300025908 | Bacteria | 1340 |
| 241 | Ga0207695_10006330 | 3300025913 | Bacteria | 15399 |
| 242 | Ga0207671_10002794 | 3300025914 | Bacteria | 18202 |
| 243 | Ga0207657_10085031 | 3300025919 | Bacteria | 2651 |
| 244 | Ga0207649_10002913 | 3300025920 | Bacteria | 9423 |
| 245 | Ga0207681_10233082 | 3300025923 | Bacteria | 1430 |
| 246 | Ga0207681_10233874 | 3300025923 | Bacteria | 1427 |
| 247 | Ga0207650_10048144 | 3300025925 | Bacteria | 3143 |
| 248 | Ga0207650_10088606 | 3300025925 | Bacteria | 2360 |
| 249 | Ga0207650_10333308 | 3300025925 | Bacteria | 1245 |
| 250 | Ga0207659_10000693 | 3300025926 | Bacteria | 19984 |
| 251 | Ga0207659_10014169 | 3300025926 | Bacteria | 5134 |
| 252 | Ga0207659_10115990 | 3300025926 | Bacteria | 2044 |
| 253 | Ga0207687_10098913 | 3300025927 | Bacteria | 2142 |
| 254 | Ga0207687_10336154 | 3300025927 | Bacteria | 1227 |
| 255 | Ga0207644_10013979 | 3300025931 | Bacteria | 5364 |
| 256 | Ga0207644_10015446 | 3300025931 | Bacteria | 5125 |
| 257 | Ga0207644_10066152 | 3300025931 | Bacteria | 2630 |
| 258 | Ga0207644_10108505 | 3300025931 | Bacteria | 2096 |
| 259 | Ga0207644_10334264 | 3300025931 | Bacteria | 1227 |
| 260 | Ga0207690_10052076 | 3300025932 | Bacteria | 2740 |
| 261 | Ga0207706_10001423 | 3300025933 | Bacteria | 23955 |
| 262 | Ga0207706_10092080 | 3300025933 | Bacteria | 2665 |
| 263 | Ga0207706_10108523 | 3300025933 | Bacteria | 2442 |
| 264 | Ga0207706_10498954 | 3300025933 | Bacteria | 1051 |
| 265 | Ga0207709_10010914 | 3300025935 | Bacteria | 5006 |
| 266 | Ga0207669_10017244 | 3300025937 | Bacteria | 3698 |
| 267 | Ga0207704_10123775 | 3300025938 | Bacteria | 1776 |
| 268 | Ga0207704_10208527 | 3300025938 | Bacteria | 1436 |
| 269 | Ga0207704_10495579 | 3300025938 | Bacteria | 984 |
| 270 | Ga0207691_10001450 | 3300025940 | Bacteria | 23610 |
| 271 | Ga0207691_10048851 | 3300025940 | Bacteria | 3877 |
| 272 | Ga0207711_10034564 | 3300025941 | Bacteria | 4280 |
| 273 | Ga0207689_10009834 | 3300025942 | Bacteria | 8243 |
| 274 | Ga0207679_10001298 | 3300025945 | Bacteria | 15795 |
| 275 | Ga0207679_10134632 | 3300025945 | Bacteria | 1988 |
| 276 | Ga0207667_10133601 | 3300025949 | Bacteria | 2556 |
| 277 | Ga0207651_10014050 | 3300025960 | Bacteria | 4609 |
| 278 | Ga0207668_10121606 | 3300025972 | Bacteria | 1978 |
| 279 | Ga0207640_10029096 | 3300025981 | Bacteria | 3386 |
| 280 | Ga0207640_10139728 | 3300025981 | Bacteria | 1764 |
| 281 | Ga0207658_10059759 | 3300025986 | Bacteria | 2841 |
| 282 | Ga0207677_10019618 | 3300026023 | Bacteria | 4088 |
| 283 | Ga0207677_10052419 | 3300026023 | Bacteria | 2772 |
| 284 | Ga0207677_10405544 | 3300026023 | Bacteria | 1157 |
| 285 | Ga0207703_10746877 | 3300026035 | Bacteria | 932 |
| 286 | Ga0207639_10477981 | 3300026041 | Bacteria | 1135 |
| 287 | Ga0207678_10000060 | 3300026067 | Bacteria | 85708 |
| 288 | Ga0207678_10044882 | 3300026067 | Bacteria | 3822 |
| 289 | Ga0207641_10030294 | 3300026088 | Bacteria | 4482 |
| 290 | Ga0207641_10236833 | 3300026088 | Bacteria | 1699 |
| 291 | Ga0207641_10323864 | 3300026088 | Bacteria | 1462 |
| 292 | Ga0207648_10014273 | 3300026089 | Bacteria | 7343 |
| 293 | Ga0207648_10014457 | 3300026089 | Bacteria | 7293 |
| 294 | Ga0207648_10091781 | 3300026089 | Bacteria | 2655 |
| 295 | Ga0207648_10369569 | 3300026089 | Bacteria | 1295 |
| 296 | Ga0207648_10626723 | 3300026089 | Bacteria | 993 |
| 297 | Ga0207676_10024500 | 3300026095 | Bacteria | 4466 |
| 298 | Ga0207676_10205964 | 3300026095 | Bacteria | 1741 |
| 299 | Ga0207674_10008673 | 3300026116 | Bacteria | 11707 |
| 300 | Ga0207674_10102163 | 3300026116 | Bacteria | 2847 |
| 301 | Ga0207674_10154411 | 3300026116 | Bacteria | 2251 |
| 302 | Ga0207675_100419214 | 3300026118 | Bacteria | 1322 |
| 303 | Ga0207675_100572309 | 3300026118 | Bacteria | 1130 |
| 304 | Ga0207683_10007662 | 3300026121 | Bacteria | 9244 |
| 305 | Ga0207683_10035305 | 3300026121 | Bacteria | 4347 |
| 306 | Ga0207683_10081877 | 3300026121 | Bacteria | 2866 |
| 307 | Ga0207683_10355119 | 3300026121 | Bacteria | 1346 |
| 308 | Ga0207683_10497374 | 3300026121 | Bacteria | 1126 |
| 309 | Ga0207698_10029862 | 3300026142 | Bacteria | 3911 |
| 310 | Ga0207698_10064761 | 3300026142 | Bacteria | 2867 |
| 311 | Ga0207698_10079133 | 3300026142 | Bacteria | 2643 |
| 312 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 313 | Ga0209969_1000326 | 3300027360 | Bacteria | 6343 |
| 314 | Ga0209967_1000410 | 3300027364 | Bacteria | 5637 |
| 315 | Ga0210000_1000765 | 3300027462 | Bacteria | 4449 |
| 316 | Ga0209971_1010877 | 3300027682 | Bacteria | 2155 |
| 317 | Ga0209998_10003959 | 3300027717 | Bacteria | 3188 |
| 318 | Ga0209813_10101128 | 3300027866 | Bacteria | 981 |
| 319 | Ga0209974_10001306 | 3300027876 | Bacteria | 8962 |
| 320 | Ga0209974_10004900 | 3300027876 | Bacteria | 4735 |
| 321 | Ga0268266_10100631 | 3300028379 | Bacteria | 2546 |
| 322 | Ga0268266_10607650 | 3300028379 | Bacteria | 1051 |
| 323 | Ga0268264_10190110 | 3300028381 | Bacteria | 1871 |
| 324 | Ga0265334_10024041 | 3300028573 | Bacteria | 2474 |
| 325 | Ga0265336_10056708 | 3300028666 | Bacteria | 1177 |
| 326 | Ga0307517_10021062 | 3300028786 | Bacteria | 8264 |
| 327 | Ga0307517_10059532 | 3300028786 | Bacteria | 3655 |
| 328 | Ga0307517_10133568 | 3300028786 | Bacteria | 1775 |
| 329 | Ga0307515_10000058 | 3300028794 | Bacteria | 259680 |
| 330 | Ga0307515_10001320 | 3300028794 | Bacteria | 56334 |
| 331 | Ga0307515_10001649 | 3300028794 | Bacteria | 49654 |
| 332 | Ga0307515_10042404 | 3300028794 | Bacteria | 7119 |
| 333 | Ga0307515_10059341 | 3300028794 | Bacteria | 5484 |
| 334 | Ga0307515_10085898 | 3300028794 | Bacteria | 4019 |
| 335 | Ga0307515_10099441 | 3300028794 | Bacteria | 3532 |
| 336 | Ga0307515_10147242 | 3300028794 | Bacteria | 2486 |
| 337 | Ga0307512_10014330 | 3300030522 | Bacteria | 7389 |
| 338 | Ga0307512_10022820 | 3300030522 | Bacteria | 5609 |
| 339 | Ga0307512_10174447 | 3300030522 | Bacteria | 1224 |
| 340 | Ga0265330_10000037 | 3300031235 | Bacteria | 120957 |
| 341 | Ga0265332_10000008 | 3300031238 | Bacteria | 301609 |
| 342 | Ga0265328_10021819 | 3300031239 | Bacteria | 2440 |
| 343 | Ga0265325_10009265 | 3300031241 | Bacteria | 5755 |
| 344 | Ga0265340_10012082 | 3300031247 | Bacteria | 4567 |
| 345 | Ga0265327_10000020 | 3300031251 | Bacteria | 424552 |
| 346 | Ga0265327_10002065 | 3300031251 | Bacteria | 22495 |
| 347 | Ga0265316_10193217 | 3300031344 | Bacteria | 1511 |
| 348 | Ga0307513_10004000 | 3300031456 | Bacteria | 19785 |
| 349 | Ga0307513_10037189 | 3300031456 | Bacteria | 5420 |
| 350 | Ga0307509_10000139 | 3300031507 | Bacteria | 108589 |
| 351 | Ga0307509_10054727 | 3300031507 | Bacteria | 4245 |
| 352 | Ga0307509_10074015 | 3300031507 | Bacteria | 3545 |
| 353 | Ga0307408_100000006 | 3300031548 | Bacteria | 472824 |
| 354 | Ga0307408_100018270 | 3300031548 | Bacteria | 4706 |
| 355 | Ga0307408_100087568 | 3300031548 | Bacteria | 2344 |
| 356 | Ga0307408_100172785 | 3300031548 | Bacteria | 1727 |
| 357 | Ga0307408_100193846 | 3300031548 | Bacteria | 1639 |
| 358 | Ga0307408_100208547 | 3300031548 | Bacteria | 1586 |
| 359 | Ga0307408_100298983 | 3300031548 | Bacteria | 1347 |
| 360 | Ga0307508_10000291 | 3300031616 | Bacteria | 61434 |
| 361 | Ga0307508_10001439 | 3300031616 | Bacteria | 26811 |
| 362 | Ga0307508_10003842 | 3300031616 | Bacteria | 14961 |
| 363 | Ga0307514_10011572 | 3300031649 | Bacteria | 7333 |
| 364 | Ga0307514_10059697 | 3300031649 | Bacteria | 2913 |
| 365 | Ga0265314_10000065 | 3300031711 | Bacteria | 158383 |
| 366 | Ga0265314_10084971 | 3300031711 | Bacteria | 2076 |
| 367 | Ga0265314_10095785 | 3300031711 | Bacteria | 1921 |
| 368 | Ga0307516_10001769 | 3300031730 | Bacteria | 29705 |
| 369 | Ga0307516_10004526 | 3300031730 | Bacteria | 17100 |
| 370 | Ga0307516_10281994 | 3300031730 | Bacteria | 1343 |
| 371 | Ga0307405_10021875 | 3300031731 | Bacteria | 3603 |
| 372 | Ga0307405_10147142 | 3300031731 | Bacteria | 1652 |
| 373 | Ga0316577_10215725 | 3300031733 | Bacteria | 1085 |
| 374 | Ga0307413_10014137 | 3300031824 | Bacteria | 4041 |
| 375 | Ga0307413_10026147 | 3300031824 | Bacteria | 3212 |
| 376 | Ga0307410_10107408 | 3300031852 | Bacteria | 2013 |
| 377 | Ga0307410_10159421 | 3300031852 | Bacteria | 1689 |
| 378 | Ga0307406_10046009 | 3300031901 | Bacteria | 2743 |
| 379 | Ga0307406_10168643 | 3300031901 | Bacteria | 1582 |
| 380 | Ga0307407_10049587 | 3300031903 | Bacteria | 2397 |
| 381 | Ga0307412_10009949 | 3300031911 | Bacteria | 5471 |
| 382 | Ga0307412_10091368 | 3300031911 | Bacteria | 2131 |
| 383 | Ga0307412_10220479 | 3300031911 | Bacteria | 1453 |
| 384 | Ga0307412_10307843 | 3300031911 | Bacteria | 1255 |
| 385 | Ga0307412_10511887 | 3300031911 | Bacteria | 1001 |
| 386 | Ga0307409_100048505 | 3300031995 | Bacteria | 3232 |
| 387 | Ga0307409_100384763 | 3300031995 | Bacteria | 1335 |
| 388 | Ga0307416_100002539 | 3300032002 | Bacteria | 10509 |
| 389 | Ga0307416_100086283 | 3300032002 | Bacteria | 2675 |
| 390 | Ga0307416_100133700 | 3300032002 | Bacteria | 2239 |
| 391 | Ga0307416_100301441 | 3300032002 | Bacteria | 1593 |
| 392 | Ga0307416_100465706 | 3300032002 | Bacteria | 1320 |
| 393 | Ga0307416_100670161 | 3300032002 | Bacteria | 1124 |
| 394 | Ga0307414_10032558 | 3300032004 | Bacteria | 3434 |
| 395 | Ga0307414_10049634 | 3300032004 | Bacteria | 2903 |
| 396 | Ga0307411_10112936 | 3300032005 | Bacteria | 1948 |
| 397 | Ga0307411_10119709 | 3300032005 | Bacteria | 1902 |
| 398 | Ga0307415_100016027 | 3300032126 | Bacteria | 4454 |
| 399 | Ga0307507_10031105 | 3300033179 | Bacteria | 5610 |
| 400 | Ga0307510_10001714 | 3300033180 | Bacteria | 24366 |
| 401 | Ga0307510_10098490 | 3300033180 | Bacteria | 2728 |
| 402 | Ga0307510_10254897 | 3300033180 | Bacteria | 1239 |
| 403 | Ga0373951_0004581 | 3300035091 | Bacteria | 3274 |
| 404 | Ga0373939_0000034 | 3300035114 | Bacteria | 49433 |
| 405 | Ga0373945_0110880 | 3300035116 | Bacteria | 1083 |
| 406 | Ga0373960_0012498 | 3300035121 | Bacteria | 2111 |
| 407 | Ga0373962_0024087 | 3300035242 | Bacteria | 1625 |
| 408 | Ga0373931_0000318 | 3300035691 | Bacteria | 20228 |
| 409 | Ga0373931_0139762 | 3300035691 | Bacteria | 1401 |
| 410 | Ga0373947_0026980 | 3300035725 | Bacteria | 3360 |
| 411 | Ga0373937_0031785 | 3300036401 | Bacteria | 4785 |
| 412 | Ga0373925_0088108 | 3300037068 | Bacteria | 2370 |
| 413 | Ga0395900_0000692 | 3300037418 | Bacteria | 44929 |
| 414 | Ga0395900_0317175 | 3300037418 | Bacteria | 1540 |
| 415 | Ga0395898_0000990 | 3300037466 | Bacteria | 44660 |
| 416 | Ga0395898_0290257 | 3300037466 | Bacteria | 1560 |
| 417 | Ga0395905_0000047 | 3300037471 | Bacteria | 237582 |
| 418 | Ga0395905_0004019 | 3300037471 | Bacteria | 15438 |
| 419 | Ga0395905_0011760 | 3300037471 | Bacteria | 8449 |
| 420 | Ga0395905_0016646 | 3300037471 | Bacteria | 6989 |
| 421 | Ga0395905_0019486 | 3300037471 | Bacteria | 6430 |
| 422 | Ga0395905_0037629 | 3300037471 | Bacteria | 4541 |
| 423 | Ga0436361_0074986 | 3300039447 | Bacteria | 19532 |
| 424 | Ga0436361_0872778 | 3300039447 | Bacteria | 3182 |
| 425 | Ga0436361_1125703 | 3300039447 | Bacteria | 66289 |
| 426 | Ga0439453_0023123 | 3300041408 | Bacteria | 1132 |
| 427 | Ga0439461_0012680 | 3300041410 | Bacteria | 1581 |
| 428 | Ga0439465_0010920 | 3300041413 | Bacteria | 2849 |
| 429 | Ga0451789_0041207 | 3300041443 | Bacteria | 5036 |
| 430 | Ga0451793_1186227 | 3300041452 | Bacteria | 2381 |
| 431 | Ga0451797_0112310 | 3300041453 | Bacteria | 2393 |
| 432 | Ga0451795_0100487 | 3300041456 | Bacteria | 3178 |
| 433 | Ga0451798_0473492 | 3300041458 | Bacteria | 4930 |
| 434 | Ga0451800_1357952 | 3300041459 | Bacteria | 5656 |
| 435 | Ga0451802_1279546 | 3300041460 | Bacteria | 1598 |
| 436 | Ga0451804_0262210 | 3300041463 | Bacteria | 3327 |
| 437 | Ga0451807_2694204 | 3300041486 | Bacteria | 2373 |
| 438 | Ga0451855_1521696 | 3300041511 | Bacteria | 1138 |
| 439 | Ga0451853_3999752 | 3300041512 | Bacteria | 1817 |
| 440 | Ga0439433_0009231 | 3300041999 | Bacteria | 2146 |
| 441 | Ga0439433_0029112 | 3300041999 | Bacteria | 1259 |
| 442 | Ga0439441_000681 | 3300042001 | Bacteria | 3917 |
| 443 | Ga0439443_004215 | 3300042003 | Bacteria | 1859 |
| 444 | Ga0439448_0031445 | 3300042005 | Bacteria | 1686 |
| 445 | Ga0439448_0096513 | 3300042005 | Bacteria | 1002 |
| 446 | Ga0450917_000803 | 3300042120 | Bacteria | 2312 |
| 447 | Ga0450920_001174 | 3300042122 | Bacteria | 4298 |
| 448 | Ga0450923_003799 | 3300042125 | Bacteria | 2318 |
| 449 | Ga0450890_001764 | 3300042127 | Bacteria | 3064 |
| 450 | Ga0450892_001407 | 3300042130 | Bacteria | 2362 |
| 451 | Ga0450894_002628 | 3300042131 | Bacteria | 2392 |
| 452 | Ga0450896_000143 | 3300042133 | Bacteria | 5596 |
| 453 | Ga0450896_005609 | 3300042133 | Bacteria | 1713 |
| 454 | Ga0450898_004229 | 3300042134 | Bacteria | 2109 |
| 455 | Ga0450898_005537 | 3300042134 | Bacteria | 1912 |
| 456 | Ga0450898_015669 | 3300042134 | Bacteria | 1286 |
| 457 | Ga0450910_002657 | 3300042147 | Bacteria | 2350 |
| 458 | Ga0439446_0001410 | 3300042156 | Bacteria | 5460 |
| 459 | Ga0439446_0012231 | 3300042156 | Bacteria | 2342 |
| 460 | Ga0439446_0025654 | 3300042156 | Bacteria | 1685 |
| 461 | Ga0439446_0032700 | 3300042156 | Bacteria | 1510 |
| 462 | Ga0439446_0032744 | 3300042156 | Bacteria | 1509 |
| 463 | Ga0450908_013244 | 3300042184 | Bacteria | 1488 |
| 464 | Ga0439434_0005027 | 3300042435 | Bacteria | 3865 |
| 465 | Ga0439434_0039296 | 3300042435 | Bacteria | 1452 |
| 466 | Ga0439434_0043546 | 3300042435 | Bacteria | 1382 |
| 467 | Ga0439435_0001374 | 3300042436 | Bacteria | 4462 |
| 468 | Ga0439444_0000509 | 3300042437 | Bacteria | 4367 |
| 469 | Ga0439460_0002310 | 3300042461 | Bacteria | 4586 |
| 470 | Ga0439460_0048531 | 3300042461 | Bacteria | 1267 |
| 471 | Ga0450893_0005881 | 3300042532 | Bacteria | 1976 |
| 472 | Ga0450893_0014529 | 3300042532 | Bacteria | 1321 |
| 473 | Ga0451577_0000093 | 3300042876 | Bacteria | 196838 |
| 474 | Ga0451577_0006366 | 3300042876 | Bacteria | 11788 |
| 475 | Ga0451577_0025368 | 3300042876 | Bacteria | 5378 |
| 476 | Ga0451577_0049307 | 3300042876 | Bacteria | 3760 |
| 477 | Ga0451577_0260846 | 3300042876 | Bacteria | 1569 |
| 478 | Ga0466969_0000186 | 3300044656 | Bacteria | 33421 |
| 479 | Ga0466969_0032135 | 3300044656 | Bacteria | 2669 |
| 480 | Ga0466972_0000314 | 3300044658 | Bacteria | 27904 |
| 481 | Ga0453683_0009689 | 3300044673 | Bacteria | 6423 |
| 482 | Ga0466965_0027239 | 3300044683 | Bacteria | 2773 |
| 483 | Ga0466965_0036893 | 3300044683 | Bacteria | 2399 |
| 484 | Ga0466965_0040210 | 3300044683 | Bacteria | 2301 |
| 485 | Ga0466965_0077393 | 3300044683 | Bacteria | 1680 |
| 486 | Ga0466965_0101691 | 3300044683 | Bacteria | 1470 |
| 487 | Ga0466965_0235215 | 3300044683 | Bacteria | 979 |
| 488 | Ga0466966_0046318 | 3300044684 | Bacteria | 2777 |
| 489 | Ga0466961_0081273 | 3300044693 | Bacteria | 2050 |
| 490 | Ga0466961_0258706 | 3300044693 | Bacteria | 1068 |
| 491 | Ga0466964_0024355 | 3300044706 | Bacteria | 2359 |
| 492 | Ga0453684_0026331 | 3300044712 | Bacteria | 8407 |
| 493 | Ga0466971_0088634 | 3300044719 | Bacteria | 1415 |
| 494 | Ga0466957_0018901 | 3300044842 | Bacteria | 4050 |
| 495 | Ga0466960_0043092 | 3300044901 | Bacteria | 2145 |
| 496 | Ga0466959_0006956 | 3300045049 | Bacteria | 7903 |
| 497 | Ga0451576_0003213 | 3300045051 | Bacteria | 22785 |
| 498 | Ga0451576_0004656 | 3300045051 | Bacteria | 17688 |
| 499 | Ga0451576_0052444 | 3300045051 | Bacteria | 4273 |
| 500 | Ga0451576_0059748 | 3300045051 | Bacteria | 3979 |
| 501 | Ga0451576_0060850 | 3300045051 | Bacteria | 3938 |
| 502 | Ga0451576_0110943 | 3300045051 | Bacteria | 2854 |
| 503 | Ga0451576_0658339 | 3300045051 | Bacteria | 1100 |
| 504 | Ga0451576_0776535 | 3300045051 | Bacteria | 1006 |
| 505 | Ga0495592_0000578 | 3300046454 | Bacteria | 25993 |
| 506 | Ga0495590_0000944 | 3300046457 | Bacteria | 12859 |
| 507 | Ga0495638_0043850 | 3300046460 | Bacteria | 2820 |
| 508 | Ga0495638_0292799 | 3300046460 | Bacteria | 880 |
| 509 | Ga0495650_0004224 | 3300046471 | Bacteria | 9947 |
| 510 | Ga0495606_0170761 | 3300046507 | Bacteria | 1262 |
| 511 | Ga0495610_0036251 | 3300046512 | Bacteria | 2522 |
| 512 | Ga0495620_0069865 | 3300046515 | Bacteria | 1439 |
| 513 | Ga0495628_0055764 | 3300046516 | Bacteria | 3112 |
| 514 | Ga0495630_0503508 | 3300046517 | Bacteria | 929 |
| 515 | Ga0495632_0002824 | 3300046519 | Bacteria | 12856 |
| 516 | Ga0495632_0008760 | 3300046519 | Bacteria | 6165 |
| 517 | Ga0495643_0033357 | 3300046522 | Bacteria | 2849 |
| 518 | Ga0495654_0000307 | 3300046530 | Bacteria | 43179 |
| 519 | Ga0495621_0013815 | 3300046539 | Bacteria | 2544 |
| 520 | Ga0495649_0001758 | 3300046694 | Bacteria | 15969 |
| 521 | Ga0495660_0011436 | 3300046810 | Bacteria | 5150 |
| 522 | Ga0495674_0025097 | 3300047319 | Bacteria | 5470 |
| 523 | Ga0495687_000070 | 3300047443 | Bacteria | 159227 |
| 524 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 525 | Ga0495686_0034645 | 3300047472 | Bacteria | 3250 |
| 526 | Ga0495626_0128465 | 3300048091 | Bacteria | 1084 |
| 527 | Ga0496102_0001663 | 3300048905 | Bacteria | 19552 |
| 528 | Ga0496102_0001807 | 3300048905 | Bacteria | 18514 |
| 529 | Ga0496104_0047632 | 3300048907 | Bacteria | 4040 |
| 530 | Ga0496105_0065262 | 3300048908 | Bacteria | 3005 |
| 531 | Ga0496106_0128729 | 3300048909 | Bacteria | 1984 |
| 532 | Ga0496108_0052367 | 3300048911 | Bacteria | 3420 |
| 533 | Ga0496110_0142705 | 3300048913 | Bacteria | 2165 |
| 534 | Ga0496112_0009409 | 3300048915 | Bacteria | 8801 |
| 535 | Ga0496113_0002188 | 3300048916 | Bacteria | 11277 |
| 536 | Ga0496114_0054689 | 3300048917 | Bacteria | 3329 |
| 537 | Ga0496117_0000085 | 3300048920 | Bacteria | 213887 |
| 538 | Ga0496121_0009721 | 3300048924 | Bacteria | 11004 |
| 539 | Ga0496124_0000479 | 3300048927 | Bacteria | 68855 |
| 540 | Ga0496125_0011683 | 3300048928 | Bacteria | 8761 |
| 541 | Ga0501310_000481 | 3300049130 | Bacteria | 3489 |
| 542 | Ga0501292_005419 | 3300049515 | Bacteria | 1778 |
| 543 | Ga0501294_003779 | 3300049517 | Bacteria | 1428 |
| 544 | Ga0501298_015820 | 3300049521 | Bacteria | 1362 |
| 545 | Ga0501300_002128 | 3300049523 | Bacteria | 2950 |
| 546 | Ga0501032_0044898 | 3300049569 | Bacteria | 2990 |
| 547 | Ga0501033_0286523 | 3300049570 | Bacteria | 1162 |
| 548 | Ga0501034_0137146 | 3300049571 | Bacteria | 2427 |
| 549 | Ga0501034_0210116 | 3300049571 | Bacteria | 1902 |
| 550 | Ga0501034_0283495 | 3300049571 | Bacteria | 1596 |
| 551 | Ga0501037_0019729 | 3300049573 | Bacteria | 4974 |
| 552 | Ga0501038_0035410 | 3300049574 | Bacteria | 4383 |
| 553 | Ga0501039_0080986 | 3300049575 | Bacteria | 2527 |
| 554 | Ga0501040_0005587 | 3300049576 | Bacteria | 8132 |
| 555 | Ga0501041_0083649 | 3300049577 | Bacteria | 1967 |
| 556 | Ga0501041_0084140 | 3300049577 | Bacteria | 1961 |
| 557 | Ga0501042_0014561 | 3300049578 | Bacteria | 5371 |
| 558 | Ga0501043_0000018 | 3300049579 | Bacteria | 161101 |
| 559 | Ga0501046_0000042 | 3300049580 | Bacteria | 151850 |
| 560 | Ga0501046_0144958 | 3300049580 | Bacteria | 1794 |
| 561 | Ga0501047_0000052 | 3300049581 | Bacteria | 153448 |
| 562 | Ga0501047_0151305 | 3300049581 | Bacteria | 2196 |
| 563 | Ga0501048_0000099 | 3300049582 | Bacteria | 47309 |
| 564 | Ga0501048_0014480 | 3300049582 | Bacteria | 5839 |
| 565 | Ga0501068_0103976 | 3300049584 | Bacteria | 1762 |
| 566 | Ga0501069_0035737 | 3300049585 | Bacteria | 2738 |
| 567 | Ga0501069_0039806 | 3300049585 | Bacteria | 2597 |
| 568 | Ga0501071_0002579 | 3300049587 | Bacteria | 11061 |
| 569 | Ga0501071_0023055 | 3300049587 | Bacteria | 4344 |
| 570 | Ga0501072_0001990 | 3300049588 | Bacteria | 15222 |
| 571 | Ga0501072_0138150 | 3300049588 | Bacteria | 1943 |
| 572 | Ga0501073_0104398 | 3300049589 | Bacteria | 1967 |
| 573 | Ga0501074_0431334 | 3300049590 | Bacteria | 935 |
| 574 | Ga0501075_0034141 | 3300049591 | Bacteria | 3786 |
| 575 | Ga0501076_0213548 | 3300049592 | Bacteria | 1577 |
| 576 | Ga0501206_001942 | 3300049653 | Bacteria | 2606 |
| 577 | Ga0501211_001555 | 3300049658 | Bacteria | 2457 |
| 578 | Ga0501222_019752 | 3300049662 | Bacteria | 900 |
| 579 | Ga0501223_012599 | 3300049663 | Bacteria | 1690 |
| 580 | Ga0501236_009277 | 3300049670 | Bacteria | 1267 |
| 581 | Ga0501255_000513 | 3300049684 | Bacteria | 2690 |
| 582 | Ga0501221_000182 | 3300049704 | Bacteria | 8808 |
| 583 | Ga0501225_0014601 | 3300049705 | Bacteria | 2192 |
| 584 | Ga0501229_004084 | 3300049706 | Bacteria | 1767 |
| 585 | Ga0501079_0128825 | 3300049741 | Bacteria | 1969 |
| 586 | Ga0501079_0328242 | 3300049741 | Bacteria | 1198 |
| 587 | Ga0501080_0297810 | 3300049742 | Bacteria | 1463 |
| 588 | Ga0501081_0022246 | 3300049743 | Bacteria | 4240 |
| 589 | Ga0501081_0047762 | 3300049743 | Bacteria | 2945 |
| 590 | Ga0501083_0001215 | 3300049744 | Bacteria | 17446 |
| 591 | Ga0501265_002363 | 3300049762 | Bacteria | 2142 |
| 592 | Ga0501267_000425 | 3300049764 | Bacteria | 3246 |
| 593 | Ga0501272_000204 | 3300049769 | Bacteria | 4832 |
| 594 | Ga0501035_0076294 | 3300049822 | Bacteria | 2964 |
| 595 | Ga0501035_0132382 | 3300049822 | Bacteria | 2173 |
| 596 | Ga0501035_0177031 | 3300049822 | Bacteria | 1839 |
| 597 | Ga0501035_0351317 | 3300049822 | Bacteria | 1233 |
| 598 | Ga0501044_0018909 | 3300049823 | Bacteria | 7375 |
| 599 | Ga0501045_0007930 | 3300049824 | Bacteria | 7393 |
| 600 | Ga0501045_0008070 | 3300049824 | Bacteria | 7334 |
| 601 | Ga0501045_0086493 | 3300049824 | Bacteria | 2314 |
| 602 | nmdc:mga03683_149056_c1 | 3300050489 | Bacteria | 1055 |
| 603 | nmdc:mga03683_75299_c1 | 3300050489 | Bacteria | 1449 |
| 604 | nmdc:mga03n38_170852_c1 | 3300050490 | Bacteria | 1107 |
| 605 | nmdc:mga03n38_229110_c1 | 3300050490 | Bacteria | 973 |
| 606 | nmdc:mga03n38_58321_c1 | 3300050490 | Bacteria | 1749 |
| 607 | nmdc:mga00v17_106768_c1 | 3300050491 | Bacteria | 1773 |
| 608 | nmdc:mga00v17_21453_c1 | 3300050491 | Bacteria | 3713 |
| 609 | nmdc:mga0k408_10992_c1 | 3300050493 | Bacteria | 4914 |
| 610 | nmdc:mga0k408_12914_c1 | 3300050493 | Bacteria | 4574 |
| 611 | nmdc:mga0k408_161578_c1 | 3300050493 | Bacteria | 1335 |
| 612 | nmdc:mga0k408_2030_c1 | 3300050493 | Bacteria | 10833 |
| 613 | nmdc:mga0k408_213385_c1 | 3300050493 | Bacteria | 1153 |
| 614 | nmdc:mga0k408_2319_c1 | 3300050493 | Bacteria | 10128 |
| 615 | nmdc:mga0k408_47951_c1 | 3300050493 | Bacteria | 2470 |
| 616 | nmdc:mga06z11_26014_c1 | 3300050494 | Bacteria | 2781 |
| 617 | nmdc:mga06z11_42242_c1 | 3300050494 | Bacteria | 2286 |
| 618 | nmdc:mga06z11_58222_c1 | 3300050494 | Bacteria | 2004 |
| 619 | nmdc:mga04h51_38198_c1 | 3300050495 | Bacteria | 1553 |
| 620 | nmdc:mga07m45_104485_c1 | 3300050496 | Bacteria | 1629 |
| 621 | nmdc:mga07m45_1074_c1 | 3300050496 | Bacteria | 12178 |
| 622 | nmdc:mga07m45_360385_c1 | 3300050496 | Bacteria | 845 |
| 623 | nmdc:mga07m45_50399_c1 | 3300050496 | Bacteria | 2346 |
| 624 | nmdc:mga07m45_58316_c1 | 3300050496 | Bacteria | 2184 |
| 625 | nmdc:mga05p37_519181_c1 | 3300050507 | Bacteria | 1363 |
| 626 | nmdc:mga05p37_81267_c1 | 3300050507 | Bacteria | 3992 |
| 627 | nmdc:mga09592_1681_c1 | 3300050508 | Bacteria | 17836 |
| 628 | nmdc:mga09592_297736_c1 | 3300050508 | Bacteria | 1399 |
| 629 | nmdc:mga09592_366346_c1 | 3300050508 | Bacteria | 1246 |
| 630 | nmdc:mga0qj67_30455_c1 | 3300050509 | Bacteria | 4201 |
| 631 | nmdc:mga06r32_124540_c1 | 3300050510 | Bacteria | 1781 |
| 632 | nmdc:mga08y16_216578_c1 | 3300050511 | Bacteria | 1983 |
| 633 | nmdc:mga08y16_91584_c1 | 3300050511 | Bacteria | 3168 |
| 634 | nmdc:mga0n895_2719_c1 | 3300050512 | Bacteria | 13950 |
| 635 | nmdc:mga0rr50_40917_c1 | 3300050513 | Bacteria | 3372 |
| 636 | nmdc:mga0a205_1062_c1 | 3300050515 | Bacteria | 22864 |
| 637 | Ga0500578_0000327 | 3300053086 | Bacteria | 57988 |
| 638 | Ga0500644_0046335 | 3300053088 | Bacteria | 1469 |
| 639 | Ga0500644_0093150 | 3300053088 | Bacteria | 1132 |
| 640 | Ga0500646_0006060 | 3300053090 | Bacteria | 3067 |
| 641 | Ga0500647_0029466 | 3300053091 | Bacteria | 2604 |
| 642 | Ga0500583_0011347 | 3300053092 | Bacteria | 3353 |
| 643 | Ga0500651_0013545 | 3300053093 | Bacteria | 4971 |
| 644 | Ga0500566_0083496 | 3300053094 | Bacteria | 1774 |
| 645 | Ga0500562_075914 | 3300053108 | Bacteria | 908 |
| 646 | Ga0500593_000148 | 3300053117 | Bacteria | 28026 |
| 647 | Ga0500593_000543 | 3300053117 | Bacteria | 14648 |
| 648 | Ga0500594_0010790 | 3300053118 | Bacteria | 2124 |
| 649 | Ga0500595_000008 | 3300053119 | Bacteria | 284388 |
| 650 | Ga0500608_009592 | 3300053122 | Bacteria | 4118 |
| 651 | Ga0500614_015044 | 3300053123 | Bacteria | 1722 |
| 652 | Ga0500628_001869 | 3300053129 | Bacteria | 3551 |
| 653 | Ga0500642_0002001 | 3300053130 | Bacteria | 5917 |
| 654 | Ga0500642_0034312 | 3300053130 | Bacteria | 2146 |
| 655 | Ga0500652_001201 | 3300053131 | Bacteria | 8259 |
| 656 | Ga0500652_013883 | 3300053131 | Bacteria | 2865 |
| 657 | Ga0500658_0015780 | 3300053134 | Bacteria | 2809 |
| 658 | Ga0500658_0089174 | 3300053134 | Bacteria | 1331 |
| 659 | Ga0500559_0000252 | 3300053136 | Bacteria | 42525 |
| 660 | Ga0500568_0006974 | 3300053139 | Bacteria | 5597 |
| 661 | Ga0500590_002538 | 3300053148 | Bacteria | 8146 |
| 662 | Ga0500622_0000300 | 3300053156 | Bacteria | 50701 |
| 663 | Ga0500622_0000695 | 3300053156 | Bacteria | 29628 |
| 664 | Ga0500622_0009907 | 3300053156 | Bacteria | 5258 |
| 665 | Ga0500636_0017380 | 3300053177 | Bacteria | 4248 |
| 666 | Ga0500570_060144 | 3300053724 | Bacteria | 1845 |
| 667 | Ga0500645_007175 | 3300053730 | Bacteria | 3910 |
| 668 | Ga0500587_006074 | 3300053739 | Bacteria | 1613 |
| 669 | Ga0500587_006109 | 3300053739 | Bacteria | 1608 |
| 670 | Ga0501084_0108442 | 3300054114 | Bacteria | 2333 |
| 671 | Ga0501082_0158607 | 3300060353 | Bacteria | 1966 |
| 672 | Ga0501082_0344199 | 3300060353 | Bacteria | 1299 |
| 673 | Ga0501082_0379582 | 3300060353 | Bacteria | 1233 |
| 674 | Ga0466962_0010965 | 3300061719 | Bacteria | 4361 |
| 675 | Ga0530510_0129970 | 3300061734 | Bacteria | 1852 |
| 676 | Ga0530510_0236276 | 3300061734 | Bacteria | 1360 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0011760 | Ga0395905_0011760_392_1060 | 222 |
| 2 | 3300049574 | Ga0501038_0035410 | Ga0501038_0035410_3668_4369 | 226 |
| 3 | 3300005719 | Ga0068861_100046976 | Ga0068861_1000469762 | 231 |
| 4 | 3300006844 | Ga0075428_100014646 | Ga0075428_1000146465 | 231 |
| 5 | 3300009094 | Ga0111539_10007187 | Ga0111539_100071879 | 231 |
| 6 | 3300009147 | Ga0114129_10043073 | Ga0114129_100430738 | 231 |
| 7 | 3300014326 | Ga0157380_10035763 | Ga0157380_100357636 | 231 |
| 8 | 3300050507 | nmdc:mga05p37_519181_c1 | nmdc:mga05p37_519181_c1_447_1163 | 231 |
| 9 | 3300049517 | Ga0501294_003779 | Ga0501294_003779_388_1128 | 234 |
| 10 | 3300005457 | Ga0070662_100011436 | Ga0070662_1000114362 | 239 |
| 11 | 3300025933 | Ga0207706_10001423 | Ga0207706_100014239 | 239 |
| 12 | 3300021361 | Ga0213872_10018486 | Ga0213872_100184863 | 241 |
| 13 | 3300039447 | Ga0436361_0872778 | Ga0436361_0872778_1502_2260 | 241 |
| 14 | 3300021361 | Ga0213872_10000066 | Ga0213872_1000006669 | 242 |
| 15 | 3300039447 | Ga0436361_1125703 | Ga0436361_1125703_34612_35379 | 242 |
| 16 | 3300044658 | Ga0466972_0000314 | Ga0466972_0000314_24492_25259 | 243 |
| 17 | 3300044683 | Ga0466965_0101691 | Ga0466965_0101691_679_1446 | 243 |
| 18 | 3300044693 | Ga0466961_0258706 | Ga0466961_0258706_160_927 | 243 |
| 19 | 3300014325 | Ga0163163_10258308 | Ga0163163_102583083 | 244 |
| 20 | 3300036401 | Ga0373937_0031785 | Ga0373937_0031785_3732_4511 | 244 |
| 21 | 3300037471 | Ga0395905_0037629 | Ga0395905_0037629_72_833 | 244 |
| 22 | 3300006048 | Ga0075363_100009419 | Ga0075363_1000094193 | 246 |
| 23 | 3300006195 | Ga0075366_10010218 | Ga0075366_100102185 | 246 |
| 24 | 3300006353 | Ga0075370_10018093 | Ga0075370_100180935 | 246 |
| 25 | 3300025931 | Ga0207644_10013979 | Ga0207644_100139796 | 246 |
| 26 | 3300026121 | Ga0207683_10007662 | Ga0207683_1000766211 | 246 |
| 27 | 3300045051 | Ga0451576_0003213 | Ga0451576_0003213_1366_2130 | 246 |
| 28 | 3300050493 | nmdc:mga0k408_12914_c1 | nmdc:mga0k408_12914_c1_2411_3184 | 246 |
| 29 | 3300050496 | nmdc:mga07m45_104485_c1 | nmdc:mga07m45_104485_c1_22_795 | 246 |
| 30 | 3300005355 | Ga0070671_100001946 | Ga0070671_1000019466 | 247 |
| 31 | 3300031852 | Ga0307410_10159421 | Ga0307410_101594212 | 247 |
| 32 | 3300044683 | Ga0466965_0027239 | Ga0466965_0027239_426_1199 | 247 |
| 33 | 3300044901 | Ga0466960_0043092 | Ga0466960_0043092_432_1205 | 247 |
| 34 | 3300005364 | Ga0070673_100296809 | Ga0070673_1002968092 | 248 |
| 35 | 3300006852 | Ga0075433_10005691 | Ga0075433_100056915 | 248 |
| 36 | 3300006871 | Ga0075434_100000099 | Ga0075434_10000009929 | 248 |
| 37 | 3300007076 | Ga0075435_100010581 | Ga0075435_1000105818 | 248 |
| 38 | 3300009094 | Ga0111539_10049751 | Ga0111539_100497516 | 248 |
| 39 | 3300014326 | Ga0157380_10031068 | Ga0157380_100310684 | 248 |
| 40 | 3300014745 | Ga0157377_10270033 | Ga0157377_102700332 | 248 |
| 41 | 3300025926 | Ga0207659_10014169 | Ga0207659_100141693 | 248 |
| 42 | 3300025938 | Ga0207704_10495579 | Ga0207704_104955791 | 248 |
| 43 | 3300026089 | Ga0207648_10091781 | Ga0207648_100917812 | 248 |
| 44 | 3300027717 | Ga0209998_10003959 | Ga0209998_100039595 | 248 |
| 45 | 3300031548 | Ga0307408_100087568 | Ga0307408_1000875684 | 248 |
| 46 | 3300031731 | Ga0307405_10021875 | Ga0307405_100218753 | 248 |
| 47 | 3300031824 | Ga0307413_10026147 | Ga0307413_100261475 | 248 |
| 48 | 3300031901 | Ga0307406_10046009 | Ga0307406_100460092 | 248 |
| 49 | 3300032002 | Ga0307416_100002539 | Ga0307416_1000025398 | 248 |
| 50 | 3300032004 | Ga0307414_10032558 | Ga0307414_100325583 | 248 |
| 51 | 3300032005 | Ga0307411_10112936 | Ga0307411_101129362 | 248 |
| 52 | 3300032126 | Ga0307415_100016027 | Ga0307415_1000160272 | 248 |
| 53 | 3300041408 | Ga0439453_0023123 | Ga0439453_0023123_78_851 | 248 |
| 54 | 3300041410 | Ga0439461_0012680 | Ga0439461_0012680_645_1412 | 248 |
| 55 | 3300041999 | Ga0439433_0029112 | Ga0439433_0029112_195_962 | 248 |
| 56 | 3300042001 | Ga0439441_000681 | Ga0439441_000681_2690_3457 | 248 |
| 57 | 3300042003 | Ga0439443_004215 | Ga0439443_004215_867_1634 | 248 |
| 58 | 3300042122 | Ga0450920_001174 | Ga0450920_001174_153_920 | 248 |
| 59 | 3300042125 | Ga0450923_003799 | Ga0450923_003799_47_814 | 248 |
| 60 | 3300042131 | Ga0450894_002628 | Ga0450894_002628_1052_1819 | 248 |
| 61 | 3300042133 | Ga0450896_000143 | Ga0450896_000143_778_1545 | 248 |
| 62 | 3300042134 | Ga0450898_005537 | Ga0450898_005537_921_1688 | 248 |
| 63 | 3300042147 | Ga0450910_002657 | Ga0450910_002657_1422_2189 | 248 |
| 64 | 3300042156 | Ga0439446_0001410 | Ga0439446_0001410_4612_5379 | 248 |
| 65 | 3300042156 | Ga0439446_0025654 | Ga0439446_0025654_221_988 | 248 |
| 66 | 3300042156 | Ga0439446_0032700 | Ga0439446_0032700_200_967 | 248 |
| 67 | 3300042156 | Ga0439446_0032744 | Ga0439446_0032744_389_1156 | 248 |
| 68 | 3300042184 | Ga0450908_013244 | Ga0450908_013244_678_1445 | 248 |
| 69 | 3300042435 | Ga0439434_0005027 | Ga0439434_0005027_2606_3373 | 248 |
| 70 | 3300042436 | Ga0439435_0001374 | Ga0439435_0001374_2893_3660 | 248 |
| 71 | 3300042437 | Ga0439444_0000509 | Ga0439444_0000509_1022_1789 | 248 |
| 72 | 3300042461 | Ga0439460_0002310 | Ga0439460_0002310_1160_1927 | 248 |
| 73 | 3300048920 | Ga0496117_0000085 | Ga0496117_0000085_163308_164078 | 248 |
| 74 | 3300049569 | Ga0501032_0044898 | Ga0501032_0044898_1175_1942 | 248 |
| 75 | 3300049570 | Ga0501033_0286523 | Ga0501033_0286523_98_865 | 248 |
| 76 | 3300049571 | Ga0501034_0210116 | Ga0501034_0210116_1063_1830 | 248 |
| 77 | 3300049573 | Ga0501037_0019729 | Ga0501037_0019729_1136_1903 | 248 |
| 78 | 3300049575 | Ga0501039_0080986 | Ga0501039_0080986_477_1244 | 248 |
| 79 | 3300049576 | Ga0501040_0005587 | Ga0501040_0005587_3697_4464 | 248 |
| 80 | 3300049577 | Ga0501041_0083649 | Ga0501041_0083649_398_1165 | 248 |
| 81 | 3300049577 | Ga0501041_0084140 | Ga0501041_0084140_1093_1875 | 248 |
| 82 | 3300049578 | Ga0501042_0014561 | Ga0501042_0014561_3938_4705 | 248 |
| 83 | 3300049582 | Ga0501048_0014480 | Ga0501048_0014480_4716_5483 | 248 |
| 84 | 3300049584 | Ga0501068_0103976 | Ga0501068_0103976_497_1264 | 248 |
| 85 | 3300049585 | Ga0501069_0039806 | Ga0501069_0039806_1126_1944 | 248 |
| 86 | 3300049587 | Ga0501071_0002579 | Ga0501071_0002579_4124_4891 | 248 |
| 87 | 3300049587 | Ga0501071_0023055 | Ga0501071_0023055_269_1051 | 248 |
| 88 | 3300049588 | Ga0501072_0001990 | Ga0501072_0001990_12734_13501 | 248 |
| 89 | 3300049588 | Ga0501072_0138150 | Ga0501072_0138150_1140_1922 | 248 |
| 90 | 3300049589 | Ga0501073_0104398 | Ga0501073_0104398_513_1280 | 248 |
| 91 | 3300049590 | Ga0501074_0431334 | Ga0501074_0431334_22_789 | 248 |
| 92 | 3300049591 | Ga0501075_0034141 | Ga0501075_0034141_1888_2655 | 248 |
| 93 | 3300049592 | Ga0501076_0213548 | Ga0501076_0213548_240_1022 | 248 |
| 94 | 3300049741 | Ga0501079_0128825 | Ga0501079_0128825_238_1005 | 248 |
| 95 | 3300049742 | Ga0501080_0297810 | Ga0501080_0297810_348_1115 | 248 |
| 96 | 3300049743 | Ga0501081_0022246 | Ga0501081_0022246_1130_1897 | 248 |
| 97 | 3300049743 | Ga0501081_0047762 | Ga0501081_0047762_1055_1837 | 248 |
| 98 | 3300049744 | Ga0501083_0001215 | Ga0501083_0001215_11831_12649 | 248 |
| 99 | 3300049822 | Ga0501035_0177031 | Ga0501035_0177031_167_934 | 248 |
| 100 | 3300049824 | Ga0501045_0008070 | Ga0501045_0008070_319_1086 | 248 |
| 101 | 3300049824 | Ga0501045_0086493 | Ga0501045_0086493_982_1749 | 248 |
| 102 | 3300050511 | nmdc:mga08y16_91584_c1 | nmdc:mga08y16_91584_c1_1417_2184 | 248 |
| 103 | 3300050512 | nmdc:mga0n895_2719_c1 | nmdc:mga0n895_2719_c1_2782_3549 | 248 |
| 104 | 3300050513 | nmdc:mga0rr50_40917_c1 | nmdc:mga0rr50_40917_c1_238_1005 | 248 |
| 105 | 3300050515 | nmdc:mga0a205_1062_c1 | nmdc:mga0a205_1062_c1_18305_19072 | 248 |
| 106 | 3300054114 | Ga0501084_0108442 | Ga0501084_0108442_385_1152 | 248 |
| 107 | 3300060353 | Ga0501082_0344199 | Ga0501082_0344199_336_1103 | 248 |
| 108 | 3300061734 | Ga0530510_0236276 | Ga0530510_0236276_527_1294 | 248 |
| 109 | iso_pu_bacteria | 2585428062 | 2587758161 | 248 |
| 110 | 3300021361 | Ga0213872_10000208 | Ga0213872_1000020832 | 249 |
| 111 | 3300031239 | Ga0265328_10021819 | Ga0265328_100218193 | 249 |
| 112 | 3300031251 | Ga0265327_10000020 | Ga0265327_10000020161 | 249 |
| 113 | 3300039447 | Ga0436361_0074986 | Ga0436361_0074986_11013_11786 | 249 |
| 114 | 3300053119 | Ga0500595_000008 | Ga0500595_000008_249626_250462 | 249 |
| 115 | iso_pu_bacteria | 2881101125 | 2881104447 | 249 |
| 116 | iso_pu_bacteria | 2974320154 | 2974321536 | 249 |
| 117 | 3300003759 | Ga0055525_1000056 | Ga0055525_100005673 | 250 |
| 118 | 3300005338 | Ga0068868_100078694 | Ga0068868_1000786941 | 250 |
| 119 | 3300005548 | Ga0070665_100007442 | Ga0070665_1000074422 | 250 |
| 120 | 3300005618 | Ga0068864_100029189 | Ga0068864_1000291893 | 250 |
| 121 | 3300005841 | Ga0068863_100025738 | Ga0068863_1000257385 | 250 |
| 122 | 3300009098 | Ga0105245_10062486 | Ga0105245_100624863 | 250 |
| 123 | 3300013297 | Ga0157378_10233668 | Ga0157378_102336682 | 250 |
| 124 | 3300013306 | Ga0163162_10299748 | Ga0163162_102997482 | 250 |
| 125 | 3300014968 | Ga0157379_10048254 | Ga0157379_100482542 | 250 |
| 126 | 3300025226 | Ga0209674_105588 | Ga0209674_1055882 | 250 |
| 127 | 3300025230 | Ga0209563_100014 | Ga0209563_100014121 | 250 |
| 128 | 3300025925 | Ga0207650_10333308 | Ga0207650_103333082 | 250 |
| 129 | 3300025927 | Ga0207687_10336154 | Ga0207687_103361541 | 250 |
| 130 | 3300026023 | Ga0207677_10019618 | Ga0207677_100196182 | 250 |
| 131 | 3300026035 | Ga0207703_10746877 | Ga0207703_107468771 | 250 |
| 132 | 3300026088 | Ga0207641_10030294 | Ga0207641_100302945 | 250 |
| 133 | 3300026095 | Ga0207676_10205964 | Ga0207676_102059643 | 250 |
| 134 | 3300028379 | Ga0268266_10100631 | Ga0268266_101006313 | 250 |
| 135 | iso_pu_bacteria | 2585428058 | 2587732505 | 250 |
| 136 | iso_pu_bacteria | 2588253510 | 2588291890 | 250 |
| 137 | iso_pu_bacteria | 2643221592 | 2643971456 | 250 |
| 138 | iso_pu_bacteria | 2643221625 | 2644140991 | 250 |
| 139 | iso_pu_bacteria | 2643221648 | 2644276783 | 250 |
| 140 | iso_pu_bacteria | 2643221654 | 2644303720 | 250 |
| 141 | iso_pu_bacteria | 2643221660 | 2644339724 | 250 |
| 142 | iso_pu_bacteria | 2842718218 | 2842720732 | 250 |
| 143 | 3300005328 | Ga0070676_10368599 | Ga0070676_103685992 | 251 |
| 144 | 3300006847 | Ga0075431_100226001 | Ga0075431_1002260012 | 251 |
| 145 | 3300006880 | Ga0075429_100305696 | Ga0075429_1003056962 | 251 |
| 146 | 3300026089 | Ga0207648_10369569 | Ga0207648_103695692 | 251 |
| 147 | 3300031731 | Ga0307405_10147142 | Ga0307405_101471422 | 251 |
| 148 | 3300031901 | Ga0307406_10168643 | Ga0307406_101686432 | 251 |
| 149 | 3300031911 | Ga0307412_10220479 | Ga0307412_102204791 | 251 |
| 150 | 3300035116 | Ga0373945_0110880 | Ga0373945_0110880_130_969 | 251 |
| 151 | 3300035725 | Ga0373947_0026980 | Ga0373947_0026980_2151_2990 | 251 |
| 152 | 3300042876 | Ga0451577_0049307 | Ga0451577_0049307_304_1059 | 251 |
| 153 | 3300045051 | Ga0451576_0658339 | Ga0451576_0658339_25_780 | 251 |
| 154 | 3300046460 | Ga0495638_0043850 | Ga0495638_0043850_1090_1920 | 251 |
| 155 | 3300046517 | Ga0495630_0503508 | Ga0495630_0503508_41_880 | 251 |
| 156 | 3300047319 | Ga0495674_0025097 | Ga0495674_0025097_3511_4350 | 251 |
| 157 | 3300049579 | Ga0501043_0000018 | Ga0501043_0000018_97227_97982 | 251 |
| 158 | 3300049580 | Ga0501046_0000042 | Ga0501046_0000042_97227_97982 | 251 |
| 159 | 3300049581 | Ga0501047_0000052 | Ga0501047_0000052_55467_56222 | 251 |
| 160 | 3300049582 | Ga0501048_0000099 | Ga0501048_0000099_24441_25196 | 251 |
| 161 | 3300049824 | Ga0501045_0007930 | Ga0501045_0007930_3385_4140 | 251 |
| 162 | 3300050508 | nmdc:mga09592_297736_c1 | nmdc:mga09592_297736_c1_165_941 | 251 |
| 163 | 3300050508 | nmdc:mga09592_366346_c1 | nmdc:mga09592_366346_c1_230_985 | 251 |
| 164 | 3300050510 | nmdc:mga06r32_124540_c1 | nmdc:mga06r32_124540_c1_494_1270 | 251 |
| 165 | 3300053122 | Ga0500608_009592 | Ga0500608_009592_1849_2679 | 251 |
| 166 | 3300053156 | Ga0500622_0000695 | Ga0500622_0000695_14245_15075 | 251 |
| 167 | iso_pu_bacteria | 2585428057 | 2587728536 | 251 |
| 168 | 3300005843 | Ga0068860_100052637 | Ga0068860_1000526375 | 252 |
| 169 | 3300006177 | Ga0075362_10094765 | Ga0075362_100947652 | 252 |
| 170 | 3300006178 | Ga0075367_10134981 | Ga0075367_101349812 | 252 |
| 171 | 3300006195 | Ga0075366_10038492 | Ga0075366_100384922 | 252 |
| 172 | 3300009545 | Ga0105237_10000372 | Ga0105237_1000037252 | 252 |
| 173 | 3300009545 | Ga0105237_10029616 | Ga0105237_100296163 | 252 |
| 174 | 3300010375 | Ga0105239_10000623 | Ga0105239_1000062319 | 252 |
| 175 | 3300025913 | Ga0207695_10006330 | Ga0207695_100063305 | 252 |
| 176 | 3300025914 | Ga0207671_10002794 | Ga0207671_1000279411 | 252 |
| 177 | 3300026088 | Ga0207641_10323864 | Ga0207641_103238643 | 252 |
| 178 | 3300027866 | Ga0209813_10101128 | Ga0209813_101011282 | 252 |
| 179 | 3300028379 | Ga0268266_10607650 | Ga0268266_106076502 | 252 |
| 180 | 3300028381 | Ga0268264_10190110 | Ga0268264_101901102 | 252 |
| 181 | 3300028573 | Ga0265334_10024041 | Ga0265334_100240412 | 252 |
| 182 | 3300028666 | Ga0265336_10056708 | Ga0265336_100567082 | 252 |
| 183 | 3300028786 | Ga0307517_10021062 | Ga0307517_100210627 | 252 |
| 184 | 3300028794 | Ga0307515_10001649 | Ga0307515_1000164922 | 252 |
| 185 | 3300030522 | Ga0307512_10022820 | Ga0307512_100228204 | 252 |
| 186 | 3300031235 | Ga0265330_10000037 | Ga0265330_1000003765 | 252 |
| 187 | 3300031238 | Ga0265332_10000008 | Ga0265332_1000000847 | 252 |
| 188 | 3300031241 | Ga0265325_10009265 | Ga0265325_100092653 | 252 |
| 189 | 3300031247 | Ga0265340_10012082 | Ga0265340_100120823 | 252 |
| 190 | 3300031344 | Ga0265316_10193217 | Ga0265316_101932172 | 252 |
| 191 | 3300031507 | Ga0307509_10074015 | Ga0307509_100740155 | 252 |
| 192 | 3300031616 | Ga0307508_10001439 | Ga0307508_100014391 | 252 |
| 193 | 3300031616 | Ga0307508_10003842 | Ga0307508_100038425 | 252 |
| 194 | 3300031649 | Ga0307514_10059697 | Ga0307514_100596972 | 252 |
| 195 | 3300031711 | Ga0265314_10000065 | Ga0265314_1000006599 | 252 |
| 196 | 3300031711 | Ga0265314_10095785 | Ga0265314_100957853 | 252 |
| 197 | 3300031730 | Ga0307516_10001769 | Ga0307516_1000176925 | 252 |
| 198 | 3300033179 | Ga0307507_10031105 | Ga0307507_100311054 | 252 |
| 199 | 3300033180 | Ga0307510_10001714 | Ga0307510_1000171412 | 252 |
| 200 | 3300037418 | Ga0395900_0317175 | Ga0395900_0317175_749_1507 | 252 |
| 201 | 3300037466 | Ga0395898_0290257 | Ga0395898_0290257_766_1524 | 252 |
| 202 | 3300041511 | Ga0451855_1521696 | Ga0451855_1521696_172_930 | 252 |
| 203 | 3300041512 | Ga0451853_3999752 | Ga0451853_3999752_70_828 | 252 |
| 204 | 3300044656 | Ga0466969_0000186 | Ga0466969_0000186_15431_16189 | 252 |
| 205 | 3300044656 | Ga0466969_0032135 | Ga0466969_0032135_1324_2082 | 252 |
| 206 | 3300044683 | Ga0466965_0077393 | Ga0466965_0077393_544_1302 | 252 |
| 207 | 3300045051 | Ga0451576_0110943 | Ga0451576_0110943_823_1611 | 252 |
| 208 | 3300046471 | Ga0495650_0004224 | Ga0495650_0004224_1930_2688 | 252 |
| 209 | 3300046512 | Ga0495610_0036251 | Ga0495610_0036251_1419_2177 | 252 |
| 210 | 3300046515 | Ga0495620_0069865 | Ga0495620_0069865_181_939 | 252 |
| 211 | 3300046522 | Ga0495643_0033357 | Ga0495643_0033357_1984_2742 | 252 |
| 212 | 3300048924 | Ga0496121_0009721 | Ga0496121_0009721_5732_6490 | 252 |
| 213 | 3300048927 | Ga0496124_0000479 | Ga0496124_0000479_63196_63954 | 252 |
| 214 | 3300048928 | Ga0496125_0011683 | Ga0496125_0011683_2334_3092 | 252 |
| 215 | 3300049515 | Ga0501292_005419 | Ga0501292_005419_239_997 | 252 |
| 216 | 3300049521 | Ga0501298_015820 | Ga0501298_015820_17_775 | 252 |
| 217 | 3300049653 | Ga0501206_001942 | Ga0501206_001942_1272_2030 | 252 |
| 218 | 3300049762 | Ga0501265_002363 | Ga0501265_002363_638_1396 | 252 |
| 219 | 3300050489 | nmdc:mga03683_75299_c1 | nmdc:mga03683_75299_c1_489_1247 | 252 |
| 220 | 3300050493 | nmdc:mga0k408_213385_c1 | nmdc:mga0k408_213385_c1_256_1014 | 252 |
| 221 | 3300050494 | nmdc:mga06z11_26014_c1 | nmdc:mga06z11_26014_c1_1781_2539 | 252 |
| 222 | 3300050496 | nmdc:mga07m45_360385_c1 | nmdc:mga07m45_360385_c1_40_798 | 252 |
| 223 | 3300050496 | nmdc:mga07m45_50399_c1 | nmdc:mga07m45_50399_c1_1309_2067 | 252 |
| 224 | 3300053091 | Ga0500647_0029466 | Ga0500647_0029466_1467_2225 | 252 |
| 225 | 3300053092 | Ga0500583_0011347 | Ga0500583_0011347_608_1366 | 252 |
| 226 | 3300053094 | Ga0500566_0083496 | Ga0500566_0083496_481_1239 | 252 |
| 227 | 3300053131 | Ga0500652_013883 | Ga0500652_013883_121_879 | 252 |
| 228 | 3300053134 | Ga0500658_0015780 | Ga0500658_0015780_605_1363 | 252 |
| 229 | 3300053739 | Ga0500587_006074 | Ga0500587_006074_300_1058 | 252 |
| 230 | iso_pu_bacteria | 2643221544 | 2643741777 | 252 |
| 231 | iso_pu_bacteria | 2643221639 | 2644220324 | 252 |
| 232 | iso_pu_bacteria | 2738541337 | 2739053515 | 252 |
| 233 | iso_pu_bacteria | 2928115317 | 2928118903 | 252 |
| 234 | 3300003794 | Ga0055531_10001635 | Ga0055531_100016355 | 253 |
| 235 | 3300003794 | Ga0055531_10007861 | Ga0055531_100078613 | 253 |
| 236 | 3300005578 | Ga0068854_100272447 | Ga0068854_1002724472 | 253 |
| 237 | 3300005618 | Ga0068864_100014887 | Ga0068864_1000148873 | 253 |
| 238 | 3300006051 | Ga0075364_10026448 | Ga0075364_100264484 | 253 |
| 239 | 3300006846 | Ga0075430_100043881 | Ga0075430_1000438813 | 253 |
| 240 | 3300006880 | Ga0075429_100010563 | Ga0075429_1000105634 | 253 |
| 241 | 3300009147 | Ga0114129_10101901 | Ga0114129_101019012 | 253 |
| 242 | 3300009147 | Ga0114129_10466474 | Ga0114129_104664741 | 253 |
| 243 | 3300009148 | Ga0105243_10243143 | Ga0105243_102431432 | 253 |
| 244 | 3300009177 | Ga0105248_10000345 | Ga0105248_1000034533 | 253 |
| 245 | 3300014968 | Ga0157379_10769547 | Ga0157379_107695471 | 253 |
| 246 | 3300025273 | Ga0209673_1015184 | Ga0209673_10151842 | 253 |
| 247 | 3300025303 | Ga0209051_1000351 | Ga0209051_10003515 | 253 |
| 248 | 3300025303 | Ga0209051_1006113 | Ga0209051_10061133 | 253 |
| 249 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015247 | 253 |
| 250 | 3300025304 | Ga0209257_1000016 | Ga0209257_1000016417 | 253 |
| 251 | 3300025931 | Ga0207644_10108505 | Ga0207644_101085052 | 253 |
| 252 | 3300026095 | Ga0207676_10024500 | Ga0207676_100245002 | 253 |
| 253 | 3300027360 | Ga0209969_1000326 | Ga0209969_10003264 | 253 |
| 254 | 3300027364 | Ga0209967_1000410 | Ga0209967_10004104 | 253 |
| 255 | 3300027462 | Ga0210000_1000765 | Ga0210000_10007654 | 253 |
| 256 | 3300027682 | Ga0209971_1010877 | Ga0209971_10108772 | 253 |
| 257 | 3300027876 | Ga0209974_10001306 | Ga0209974_100013063 | 253 |
| 258 | 3300028786 | Ga0307517_10059532 | Ga0307517_100595323 | 253 |
| 259 | 3300031251 | Ga0265327_10002065 | Ga0265327_1000206513 | 253 |
| 260 | 3300031548 | Ga0307408_100172785 | Ga0307408_1001727851 | 253 |
| 261 | 3300031548 | Ga0307408_100193846 | Ga0307408_1001938462 | 253 |
| 262 | 3300031548 | Ga0307408_100298983 | Ga0307408_1002989832 | 253 |
| 263 | 3300031911 | Ga0307412_10091368 | Ga0307412_100913682 | 253 |
| 264 | 3300031911 | Ga0307412_10511887 | Ga0307412_105118871 | 253 |
| 265 | 3300032002 | Ga0307416_100465706 | Ga0307416_1004657062 | 253 |
| 266 | 3300032005 | Ga0307411_10119709 | Ga0307411_101197093 | 253 |
| 267 | 3300042005 | Ga0439448_0031445 | Ga0439448_0031445_784_1545 | 253 |
| 268 | 3300042461 | Ga0439460_0048531 | Ga0439460_0048531_284_1045 | 253 |
| 269 | 3300044683 | Ga0466965_0036893 | Ga0466965_0036893_226_987 | 253 |
| 270 | 3300044684 | Ga0466966_0046318 | Ga0466966_0046318_319_1080 | 253 |
| 271 | 3300044693 | Ga0466961_0081273 | Ga0466961_0081273_1201_1962 | 253 |
| 272 | 3300044706 | Ga0466964_0024355 | Ga0466964_0024355_1239_2000 | 253 |
| 273 | 3300044719 | Ga0466971_0088634 | Ga0466971_0088634_243_1004 | 253 |
| 274 | 3300044842 | Ga0466957_0018901 | Ga0466957_0018901_1957_2718 | 253 |
| 275 | 3300045049 | Ga0466959_0006956 | Ga0466959_0006956_391_1152 | 253 |
| 276 | 3300045051 | Ga0451576_0776535 | Ga0451576_0776535_126_893 | 253 |
| 277 | 3300046507 | Ga0495606_0170761 | Ga0495606_0170761_234_995 | 253 |
| 278 | 3300047472 | Ga0495686_0034645 | Ga0495686_0034645_1227_1988 | 253 |
| 279 | 3300048907 | Ga0496104_0047632 | Ga0496104_0047632_846_1607 | 253 |
| 280 | 3300048908 | Ga0496105_0065262 | Ga0496105_0065262_346_1107 | 253 |
| 281 | 3300048909 | Ga0496106_0128729 | Ga0496106_0128729_731_1492 | 253 |
| 282 | 3300048911 | Ga0496108_0052367 | Ga0496108_0052367_1011_1772 | 253 |
| 283 | 3300048913 | Ga0496110_0142705 | Ga0496110_0142705_952_1740 | 253 |
| 284 | 3300048915 | Ga0496112_0009409 | Ga0496112_0009409_7598_8359 | 253 |
| 285 | 3300048916 | Ga0496113_0002188 | Ga0496113_0002188_7989_8750 | 253 |
| 286 | 3300049130 | Ga0501310_000481 | Ga0501310_000481_1072_1869 | 253 |
| 287 | 3300049523 | Ga0501300_002128 | Ga0501300_002128_1336_2133 | 253 |
| 288 | 3300049571 | Ga0501034_0137146 | Ga0501034_0137146_506_1267 | 253 |
| 289 | 3300049581 | Ga0501047_0151305 | Ga0501047_0151305_1179_1940 | 253 |
| 290 | 3300049658 | Ga0501211_001555 | Ga0501211_001555_74_871 | 253 |
| 291 | 3300049663 | Ga0501223_012599 | Ga0501223_012599_94_891 | 253 |
| 292 | 3300049670 | Ga0501236_009277 | Ga0501236_009277_441_1238 | 253 |
| 293 | 3300049684 | Ga0501255_000513 | Ga0501255_000513_983_1780 | 253 |
| 294 | 3300049704 | Ga0501221_000182 | Ga0501221_000182_3622_4419 | 253 |
| 295 | 3300049705 | Ga0501225_0014601 | Ga0501225_0014601_57_854 | 253 |
| 296 | 3300049706 | Ga0501229_004084 | Ga0501229_004084_316_1113 | 253 |
| 297 | 3300049764 | Ga0501267_000425 | Ga0501267_000425_1279_2076 | 253 |
| 298 | 3300049769 | Ga0501272_000204 | Ga0501272_000204_3072_3869 | 253 |
| 299 | 3300049822 | Ga0501035_0076294 | Ga0501035_0076294_2059_2820 | 253 |
| 300 | 3300049822 | Ga0501035_0132382 | Ga0501035_0132382_368_1132 | 253 |
| 301 | 3300049822 | Ga0501035_0351317 | Ga0501035_0351317_454_1215 | 253 |
| 302 | 3300049823 | Ga0501044_0018909 | Ga0501044_0018909_4287_5048 | 253 |
| 303 | 3300050491 | nmdc:mga00v17_21453_c1 | nmdc:mga00v17_21453_c1_1071_1832 | 253 |
| 304 | 3300050493 | nmdc:mga0k408_2030_c1 | nmdc:mga0k408_2030_c1_3486_4250 | 253 |
| 305 | 3300050507 | nmdc:mga05p37_81267_c1 | nmdc:mga05p37_81267_c1_2613_3374 | 253 |
| 306 | 3300050508 | nmdc:mga09592_1681_c1 | nmdc:mga09592_1681_c1_2376_3137 | 253 |
| 307 | 3300050509 | nmdc:mga0qj67_30455_c1 | nmdc:mga0qj67_30455_c1_1330_2091 | 253 |
| 308 | 3300053108 | Ga0500562_075914 | Ga0500562_075914_115_876 | 253 |
| 309 | 3300053730 | Ga0500645_007175 | Ga0500645_007175_1210_1971 | 253 |
| 310 | 3300061719 | Ga0466962_0010965 | Ga0466962_0010965_86_847 | 253 |
| 311 | iso_pu_bacteria | 2643221585 | 2643935048 | 253 |
| 312 | iso_pu_bacteria | 2643221609 | 2644058095 | 253 |
| 313 | iso_pu_bacteria | 2643221611 | 2644073131 | 253 |
| 314 | iso_pu_bacteria | 2643221656 | 2644316535 | 253 |
| 315 | 3300003215 | JGI25153J46596_10002052 | JGI25153J46596_100020523 | 254 |
| 316 | 3300003215 | JGI25153J46596_10003533 | JGI25153J46596_100035335 | 254 |
| 317 | 3300003791 | Ga0055530_10017939 | Ga0055530_100179393 | 254 |
| 318 | 3300005262 | Ga0065165_1003497 | Ga0065165_10034977 | 254 |
| 319 | 3300005328 | Ga0070676_10011204 | Ga0070676_100112043 | 254 |
| 320 | 3300005331 | Ga0070670_100089314 | Ga0070670_1000893142 | 254 |
| 321 | 3300005334 | Ga0068869_100007433 | Ga0068869_1000074334 | 254 |
| 322 | 3300005353 | Ga0070669_100210306 | Ga0070669_1002103062 | 254 |
| 323 | 3300005355 | Ga0070671_100016402 | Ga0070671_1000164023 | 254 |
| 324 | 3300005364 | Ga0070673_100046472 | Ga0070673_1000464722 | 254 |
| 325 | 3300005455 | Ga0070663_100000177 | Ga0070663_10000017714 | 254 |
| 326 | 3300005456 | Ga0070678_100083161 | Ga0070678_1000831613 | 254 |
| 327 | 3300005457 | Ga0070662_100043764 | Ga0070662_1000437643 | 254 |
| 328 | 3300005459 | Ga0068867_100002539 | Ga0068867_1000025397 | 254 |
| 329 | 3300005543 | Ga0070672_100089458 | Ga0070672_1000894584 | 254 |
| 330 | 3300005577 | Ga0068857_100322260 | Ga0068857_1003222602 | 254 |
| 331 | 3300005617 | Ga0068859_100394865 | Ga0068859_1003948651 | 254 |
| 332 | 3300006038 | Ga0075365_10005601 | Ga0075365_100056012 | 254 |
| 333 | 3300006177 | Ga0075362_10129575 | Ga0075362_101295752 | 254 |
| 334 | 3300006178 | Ga0075367_10058767 | Ga0075367_100587671 | 254 |
| 335 | 3300006195 | Ga0075366_10027638 | Ga0075366_100276383 | 254 |
| 336 | 3300006195 | Ga0075366_10037610 | Ga0075366_100376105 | 254 |
| 337 | 3300006195 | Ga0075366_10048103 | Ga0075366_100481032 | 254 |
| 338 | 3300006353 | Ga0075370_10002305 | Ga0075370_100023055 | 254 |
| 339 | 3300006881 | Ga0068865_100222175 | Ga0068865_1002221752 | 254 |
| 340 | 3300006931 | Ga0097620_100394849 | Ga0097620_1003948491 | 254 |
| 341 | 3300013308 | Ga0157375_10082583 | Ga0157375_100825833 | 254 |
| 342 | 3300014497 | Ga0182008_10052156 | Ga0182008_100521563 | 254 |
| 343 | 3300025258 | Ga0209129_1019880 | Ga0209129_10198802 | 254 |
| 344 | 3300025297 | Ga0209758_1000969 | Ga0209758_100096925 | 254 |
| 345 | 3300025298 | Ga0209050_1000202 | Ga0209050_100020241 | 254 |
| 346 | 3300025303 | Ga0209051_1018306 | Ga0209051_10183062 | 254 |
| 347 | 3300025908 | Ga0207643_10163511 | Ga0207643_101635112 | 254 |
| 348 | 3300025923 | Ga0207681_10233082 | Ga0207681_102330822 | 254 |
| 349 | 3300025925 | Ga0207650_10088606 | Ga0207650_100886064 | 254 |
| 350 | 3300025931 | Ga0207644_10015446 | Ga0207644_100154463 | 254 |
| 351 | 3300025933 | Ga0207706_10108523 | Ga0207706_101085232 | 254 |
| 352 | 3300025938 | Ga0207704_10208527 | Ga0207704_102085271 | 254 |
| 353 | 3300025940 | Ga0207691_10048851 | Ga0207691_100488512 | 254 |
| 354 | 3300025942 | Ga0207689_10009834 | Ga0207689_100098343 | 254 |
| 355 | 3300025945 | Ga0207679_10134632 | Ga0207679_101346323 | 254 |
| 356 | 3300026067 | Ga0207678_10000060 | Ga0207678_1000006022 | 254 |
| 357 | 3300026116 | Ga0207674_10154411 | Ga0207674_101544113 | 254 |
| 358 | 3300026118 | Ga0207675_100419214 | Ga0207675_1004192142 | 254 |
| 359 | 3300026121 | Ga0207683_10081877 | Ga0207683_100818774 | 254 |
| 360 | 3300026121 | Ga0207683_10497374 | Ga0207683_104973741 | 254 |
| 361 | 3300028794 | Ga0307515_10000058 | Ga0307515_10000058166 | 254 |
| 362 | 3300028794 | Ga0307515_10001320 | Ga0307515_1000132039 | 254 |
| 363 | 3300028794 | Ga0307515_10042404 | Ga0307515_100424045 | 254 |
| 364 | 3300028794 | Ga0307515_10147242 | Ga0307515_101472421 | 254 |
| 365 | 3300031456 | Ga0307513_10037189 | Ga0307513_100371893 | 254 |
| 366 | 3300031507 | Ga0307509_10054727 | Ga0307509_100547273 | 254 |
| 367 | 3300031548 | Ga0307408_100000006 | Ga0307408_100000006253 | 254 |
| 368 | 3300031616 | Ga0307508_10000291 | Ga0307508_1000029140 | 254 |
| 369 | 3300031711 | Ga0265314_10084971 | Ga0265314_100849712 | 254 |
| 370 | 3300031730 | Ga0307516_10004526 | Ga0307516_1000452610 | 254 |
| 371 | 3300031733 | Ga0316577_10215725 | Ga0316577_102157252 | 254 |
| 372 | 3300032002 | Ga0307416_100670161 | Ga0307416_1006701612 | 254 |
| 373 | 3300033180 | Ga0307510_10254897 | Ga0307510_102548972 | 254 |
| 374 | 3300037068 | Ga0373925_0088108 | Ga0373925_0088108_337_1101 | 254 |
| 375 | 3300037418 | Ga0395900_0000692 | Ga0395900_0000692_34362_35126 | 254 |
| 376 | 3300037466 | Ga0395898_0000990 | Ga0395898_0000990_9847_10611 | 254 |
| 377 | 3300041413 | Ga0439465_0010920 | Ga0439465_0010920_377_1144 | 254 |
| 378 | 3300041443 | Ga0451789_0041207 | Ga0451789_0041207_2253_3017 | 254 |
| 379 | 3300041452 | Ga0451793_1186227 | Ga0451793_1186227_1128_1892 | 254 |
| 380 | 3300041453 | Ga0451797_0112310 | Ga0451797_0112310_147_911 | 254 |
| 381 | 3300041456 | Ga0451795_0100487 | Ga0451795_0100487_661_1425 | 254 |
| 382 | 3300041458 | Ga0451798_0473492 | Ga0451798_0473492_520_1284 | 254 |
| 383 | 3300041459 | Ga0451800_1357952 | Ga0451800_1357952_2613_3377 | 254 |
| 384 | 3300041460 | Ga0451802_1279546 | Ga0451802_1279546_782_1546 | 254 |
| 385 | 3300041463 | Ga0451804_0262210 | Ga0451804_0262210_207_971 | 254 |
| 386 | 3300041486 | Ga0451807_2694204 | Ga0451807_2694204_1434_2198 | 254 |
| 387 | 3300042435 | Ga0439434_0039296 | Ga0439434_0039296_483_1247 | 254 |
| 388 | 3300042532 | Ga0450893_0014529 | Ga0450893_0014529_172_939 | 254 |
| 389 | 3300044683 | Ga0466965_0040210 | Ga0466965_0040210_115_879 | 254 |
| 390 | 3300044683 | Ga0466965_0235215 | Ga0466965_0235215_155_919 | 254 |
| 391 | 3300046460 | Ga0495638_0292799 | Ga0495638_0292799_12_776 | 254 |
| 392 | 3300046519 | Ga0495632_0002824 | Ga0495632_0002824_3844_4608 | 254 |
| 393 | 3300046530 | Ga0495654_0000307 | Ga0495654_0000307_22095_22874 | 254 |
| 394 | 3300049585 | Ga0501069_0035737 | Ga0501069_0035737_88_936 | 254 |
| 395 | 3300049662 | Ga0501222_019752 | Ga0501222_019752_95_862 | 254 |
| 396 | 3300049741 | Ga0501079_0328242 | Ga0501079_0328242_158_949 | 254 |
| 397 | 3300050489 | nmdc:mga03683_149056_c1 | nmdc:mga03683_149056_c1_95_865 | 254 |
| 398 | 3300050490 | nmdc:mga03n38_229110_c1 | nmdc:mga03n38_229110_c1_37_801 | 254 |
| 399 | 3300050493 | nmdc:mga0k408_10992_c1 | nmdc:mga0k408_10992_c1_2570_3337 | 254 |
| 400 | 3300050493 | nmdc:mga0k408_161578_c1 | nmdc:mga0k408_161578_c1_232_1008 | 254 |
| 401 | 3300050494 | nmdc:mga06z11_42242_c1 | nmdc:mga06z11_42242_c1_170_949 | 254 |
| 402 | 3300050494 | nmdc:mga06z11_58222_c1 | nmdc:mga06z11_58222_c1_721_1485 | 254 |
| 403 | 3300050496 | nmdc:mga07m45_1074_c1 | nmdc:mga07m45_1074_c1_4420_5184 | 254 |
| 404 | 3300053086 | Ga0500578_0000327 | Ga0500578_0000327_55909_56673 | 254 |
| 405 | 3300053088 | Ga0500644_0093150 | Ga0500644_0093150_12_776 | 254 |
| 406 | 3300053090 | Ga0500646_0006060 | Ga0500646_0006060_437_1201 | 254 |
| 407 | 3300053117 | Ga0500593_000148 | Ga0500593_000148_19814_20587 | 254 |
| 408 | 3300053117 | Ga0500593_000543 | Ga0500593_000543_1557_2321 | 254 |
| 409 | 3300053129 | Ga0500628_001869 | Ga0500628_001869_836_1600 | 254 |
| 410 | 3300053130 | Ga0500642_0002001 | Ga0500642_0002001_2515_3279 | 254 |
| 411 | 3300053130 | Ga0500642_0034312 | Ga0500642_0034312_757_1521 | 254 |
| 412 | 3300053131 | Ga0500652_001201 | Ga0500652_001201_4461_5225 | 254 |
| 413 | 3300053134 | Ga0500658_0089174 | Ga0500658_0089174_357_1121 | 254 |
| 414 | 3300053139 | Ga0500568_0006974 | Ga0500568_0006974_4752_5516 | 254 |
| 415 | 3300053156 | Ga0500622_0000300 | Ga0500622_0000300_35689_36453 | 254 |
| 416 | 3300053724 | Ga0500570_060144 | Ga0500570_060144_252_1016 | 254 |
| 417 | 3300060353 | Ga0501082_0158607 | Ga0501082_0158607_1130_1921 | 254 |
| 418 | 3300060353 | Ga0501082_0379582 | Ga0501082_0379582_13_861 | 254 |
| 419 | 3300003322 | rootL2_10027772 | rootL2_100277726 | 255 |
| 420 | 3300003322 | rootL2_10041726 | rootL2_100417262 | 255 |
| 421 | 3300003323 | rootH1_10026256 | rootH1_100262562 | 255 |
| 422 | 3300003775 | Ga0055524_1000033 | Ga0055524_1000033102 | 255 |
| 423 | 3300005355 | Ga0070671_100161407 | Ga0070671_1001614071 | 255 |
| 424 | 3300005455 | Ga0070663_100029061 | Ga0070663_1000290615 | 255 |
| 425 | 3300005457 | Ga0070662_100056616 | Ga0070662_1000566164 | 255 |
| 426 | 3300005471 | Ga0070698_100131030 | Ga0070698_1001310302 | 255 |
| 427 | 3300005539 | Ga0068853_100530173 | Ga0068853_1005301732 | 255 |
| 428 | 3300005577 | Ga0068857_100045761 | Ga0068857_1000457615 | 255 |
| 429 | 3300005577 | Ga0068857_100233714 | Ga0068857_1002337142 | 255 |
| 430 | 3300005616 | Ga0068852_100068114 | Ga0068852_1000681144 | 255 |
| 431 | 3300005843 | Ga0068860_100152450 | Ga0068860_1001524501 | 255 |
| 432 | 3300006042 | Ga0075368_10066297 | Ga0075368_100662972 | 255 |
| 433 | 3300006048 | Ga0075363_100017797 | Ga0075363_1000177972 | 255 |
| 434 | 3300006051 | Ga0075364_10147209 | Ga0075364_101472093 | 255 |
| 435 | 3300006177 | Ga0075362_10009878 | Ga0075362_100098782 | 255 |
| 436 | 3300006353 | Ga0075370_10094514 | Ga0075370_100945142 | 255 |
| 437 | 3300006946 | Ga0079104_1000009 | Ga0079104_1000009317 | 255 |
| 438 | 3300009093 | Ga0105240_10093898 | Ga0105240_100938982 | 255 |
| 439 | 3300009148 | Ga0105243_10097400 | Ga0105243_100974002 | 255 |
| 440 | 3300010375 | Ga0105239_10022914 | Ga0105239_100229144 | 255 |
| 441 | 3300025298 | Ga0209050_1036703 | Ga0209050_10367032 | 255 |
| 442 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019379 | 255 |
| 443 | 3300025321 | Ga0207656_10085542 | Ga0207656_100855423 | 255 |
| 444 | 3300025933 | Ga0207706_10092080 | Ga0207706_100920803 | 255 |
| 445 | 3300025935 | Ga0207709_10010914 | Ga0207709_100109143 | 255 |
| 446 | 3300025981 | Ga0207640_10139728 | Ga0207640_101397283 | 255 |
| 447 | 3300026067 | Ga0207678_10044882 | Ga0207678_100448822 | 255 |
| 448 | 3300026116 | Ga0207674_10008673 | Ga0207674_100086733 | 255 |
| 449 | 3300026116 | Ga0207674_10102163 | Ga0207674_101021633 | 255 |
| 450 | 3300026142 | Ga0207698_10029862 | Ga0207698_100298623 | 255 |
| 451 | 3300027111 | Ga0209281_1000023 | Ga0209281_100002370 | 255 |
| 452 | 3300028786 | Ga0307517_10133568 | Ga0307517_101335684 | 255 |
| 453 | 3300035091 | Ga0373951_0004581 | Ga0373951_0004581_232_1026 | 255 |
| 454 | 3300035114 | Ga0373939_0000034 | Ga0373939_0000034_45283_46077 | 255 |
| 455 | 3300035121 | Ga0373960_0012498 | Ga0373960_0012498_804_1598 | 255 |
| 456 | 3300035242 | Ga0373962_0024087 | Ga0373962_0024087_674_1468 | 255 |
| 457 | 3300035691 | Ga0373931_0000318 | Ga0373931_0000318_15629_16423 | 255 |
| 458 | 3300037471 | Ga0395905_0019486 | Ga0395905_0019486_5552_6319 | 255 |
| 459 | 3300042120 | Ga0450917_000803 | Ga0450917_000803_378_1148 | 255 |
| 460 | 3300042127 | Ga0450890_001764 | Ga0450890_001764_1198_1968 | 255 |
| 461 | 3300042130 | Ga0450892_001407 | Ga0450892_001407_1494_2264 | 255 |
| 462 | 3300042532 | Ga0450893_0005881 | Ga0450893_0005881_110_880 | 255 |
| 463 | 3300045051 | Ga0451576_0060850 | Ga0451576_0060850_1965_2747 | 255 |
| 464 | 3300046519 | Ga0495632_0008760 | Ga0495632_0008760_4145_4912 | 255 |
| 465 | 3300046694 | Ga0495649_0001758 | Ga0495649_0001758_8968_9735 | 255 |
| 466 | 3300047443 | Ga0495687_000070 | Ga0495687_000070_110748_111518 | 255 |
| 467 | 3300048091 | Ga0495626_0128465 | Ga0495626_0128465_236_1003 | 255 |
| 468 | 3300048917 | Ga0496114_0054689 | Ga0496114_0054689_2426_3196 | 255 |
| 469 | 3300049571 | Ga0501034_0283495 | Ga0501034_0283495_598_1473 | 255 |
| 470 | 3300050490 | nmdc:mga03n38_58321_c1 | nmdc:mga03n38_58321_c1_170_937 | 255 |
| 471 | 3300050493 | nmdc:mga0k408_2319_c1 | nmdc:mga0k408_2319_c1_618_1385 | 255 |
| 472 | 3300050495 | nmdc:mga04h51_38198_c1 | nmdc:mga04h51_38198_c1_54_821 | 255 |
| 473 | 3300050496 | nmdc:mga07m45_58316_c1 | nmdc:mga07m45_58316_c1_796_1578 | 255 |
| 474 | 3300061734 | Ga0530510_0129970 | Ga0530510_0129970_353_1213 | 255 |
| 475 | iso_pu_bacteria | 2842733646 | 2842737142 | 255 |
| 476 | 3300002704 | JGI25155J39150_1000092 | JGI25155J39150_100009230 | 256 |
| 477 | 3300002705 | JGI25156J39149_1000067 | JGI25156J39149_100006716 | 256 |
| 478 | 3300002738 | JGI25154J39366_1000089 | JGI25154J39366_100008964 | 256 |
| 479 | 3300002741 | JGI25157J39369_1000084 | JGI25157J39369_100008416 | 256 |
| 480 | 3300002774 | JGI25150J39212_1004135 | JGI25150J39212_10041354 | 256 |
| 481 | 3300002987 | JGI25159J45721_1000151 | JGI25159J45721_100015131 | 256 |
| 482 | 3300002987 | JGI25159J45721_1001940 | JGI25159J45721_10019403 | 256 |
| 483 | 3300003187 | JGI25151J46595_10008194 | JGI25151J46595_100081943 | 256 |
| 484 | 3300003187 | JGI25151J46595_10019356 | JGI25151J46595_100193561 | 256 |
| 485 | 3300003187 | JGI25151J46595_10053949 | JGI25151J46595_100539492 | 256 |
| 486 | 3300003354 | JGI25160J50197_1000076 | JGI25160J50197_100007639 | 256 |
| 487 | 3300003354 | JGI25160J50197_1015714 | JGI25160J50197_10157143 | 256 |
| 488 | 3300003374 | JGI25161J50226_1000058 | JGI25161J50226_100005854 | 256 |
| 489 | 3300003771 | Ga0055526_1002345 | Ga0055526_100234510 | 256 |
| 490 | 3300003771 | Ga0055526_1027784 | Ga0055526_10277842 | 256 |
| 491 | 3300003773 | Ga0055537_1000207 | Ga0055537_10002079 | 256 |
| 492 | 3300003775 | Ga0055524_1000303 | Ga0055524_10003033 | 256 |
| 493 | 3300003781 | Ga0055536_1002799 | Ga0055536_10027991 | 256 |
| 494 | 3300003784 | Ga0055534_1004926 | Ga0055534_10049263 | 256 |
| 495 | 3300003790 | Ga0055528_1000468 | Ga0055528_10004688 | 256 |
| 496 | 3300003791 | Ga0055530_10000449 | Ga0055530_100004493 | 256 |
| 497 | 3300003791 | Ga0055530_10001419 | Ga0055530_1000141913 | 256 |
| 498 | 3300003792 | Ga0055540_1000088 | Ga0055540_100008885 | 256 |
| 499 | 3300003792 | Ga0055540_1000184 | Ga0055540_100018433 | 256 |
| 500 | 3300003794 | Ga0055531_10001550 | Ga0055531_100015509 | 256 |
| 501 | 3300003794 | Ga0055531_10013435 | Ga0055531_100134354 | 256 |
| 502 | 3300003794 | Ga0055531_10045105 | Ga0055531_100451051 | 256 |
| 503 | 3300004625 | Ga0055543_1003345 | Ga0055543_10033454 | 256 |
| 504 | 3300005262 | Ga0065165_1024375 | Ga0065165_10243752 | 256 |
| 505 | 3300005262 | Ga0065165_1026081 | Ga0065165_10260812 | 256 |
| 506 | 3300005331 | Ga0070670_100047187 | Ga0070670_1000471872 | 256 |
| 507 | 3300005338 | Ga0068868_100274651 | Ga0068868_1002746513 | 256 |
| 508 | 3300005539 | Ga0068853_100299540 | Ga0068853_1002995401 | 256 |
| 509 | 3300005578 | Ga0068854_100070468 | Ga0068854_1000704682 | 256 |
| 510 | 3300005616 | Ga0068852_100062752 | Ga0068852_1000627522 | 256 |
| 511 | 3300006048 | Ga0075363_100040513 | Ga0075363_1000405131 | 256 |
| 512 | 3300006051 | Ga0075364_10014008 | Ga0075364_100140084 | 256 |
| 513 | 3300006237 | Ga0097621_100085974 | Ga0097621_1000859743 | 256 |
| 514 | 3300006358 | Ga0068871_100010211 | Ga0068871_1000102112 | 256 |
| 515 | 3300009177 | Ga0105248_10016463 | Ga0105248_100164635 | 256 |
| 516 | 3300013296 | Ga0157374_10093533 | Ga0157374_100935335 | 256 |
| 517 | 3300014326 | Ga0157380_10594228 | Ga0157380_105942282 | 256 |
| 518 | 3300025206 | Ga0209435_100008 | Ga0209435_100008192 | 256 |
| 519 | 3300025208 | Ga0209436_104260 | Ga0209436_1042605 | 256 |
| 520 | 3300025245 | Ga0207425_1004208 | Ga0207425_10042082 | 256 |
| 521 | 3300025245 | Ga0207425_1005008 | Ga0207425_10050084 | 256 |
| 522 | 3300025246 | Ga0209646_1000029 | Ga0209646_100002987 | 256 |
| 523 | 3300025250 | Ga0209026_1000016 | Ga0209026_100001687 | 256 |
| 524 | 3300025256 | Ga0209759_1000016 | Ga0209759_100001687 | 256 |
| 525 | 3300025263 | Ga0209565_1000061 | Ga0209565_10000619 | 256 |
| 526 | 3300025263 | Ga0209565_1001035 | Ga0209565_100103513 | 256 |
| 527 | 3300025273 | Ga0209673_1000492 | Ga0209673_100049240 | 256 |
| 528 | 3300025284 | Ga0209130_1000014 | Ga0209130_1000014280 | 256 |
| 529 | 3300025284 | Ga0209130_1000411 | Ga0209130_10004119 | 256 |
| 530 | 3300025291 | Ga0209675_1003237 | Ga0209675_10032372 | 256 |
| 531 | 3300025291 | Ga0209675_1014235 | Ga0209675_10142351 | 256 |
| 532 | 3300025291 | Ga0209675_1027991 | Ga0209675_10279912 | 256 |
| 533 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013472 | 256 |
| 534 | 3300025292 | Ga0209676_1000153 | Ga0209676_100015342 | 256 |
| 535 | 3300025292 | Ga0209676_1003964 | Ga0209676_10039642 | 256 |
| 536 | 3300025294 | Ga0209025_1002161 | Ga0209025_100216119 | 256 |
| 537 | 3300025294 | Ga0209025_1022311 | Ga0209025_10223112 | 256 |
| 538 | 3300025294 | Ga0209025_1063236 | Ga0209025_10632362 | 256 |
| 539 | 3300025295 | Ga0209564_1001101 | Ga0209564_100110130 | 256 |
| 540 | 3300025295 | Ga0209564_1001248 | Ga0209564_100124826 | 256 |
| 541 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008472 | 256 |
| 542 | 3300025298 | Ga0209050_1001318 | Ga0209050_100131824 | 256 |
| 543 | 3300025298 | Ga0209050_1009519 | Ga0209050_10095193 | 256 |
| 544 | 3300025298 | Ga0209050_1014764 | Ga0209050_10147644 | 256 |
| 545 | 3300025299 | Ga0209256_1000039 | Ga0209256_100003972 | 256 |
| 546 | 3300025299 | Ga0209256_1032607 | Ga0209256_10326072 | 256 |
| 547 | 3300025302 | Ga0207426_1000174 | Ga0207426_1000174111 | 256 |
| 548 | 3300025302 | Ga0207426_1003159 | Ga0207426_10031593 | 256 |
| 549 | 3300025303 | Ga0209051_1000004 | Ga0209051_100000422 | 256 |
| 550 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005472 | 256 |
| 551 | 3300025304 | Ga0209257_1000031 | Ga0209257_100003162 | 256 |
| 552 | 3300025304 | Ga0209257_1000038 | Ga0209257_1000038156 | 256 |
| 553 | 3300025304 | Ga0209257_1000044 | Ga0209257_1000044404 | 256 |
| 554 | 3300025304 | Ga0209257_1010422 | Ga0209257_10104223 | 256 |
| 555 | 3300025925 | Ga0207650_10048144 | Ga0207650_100481445 | 256 |
| 556 | 3300025937 | Ga0207669_10017244 | Ga0207669_100172442 | 256 |
| 557 | 3300025938 | Ga0207704_10123775 | Ga0207704_101237752 | 256 |
| 558 | 3300025941 | Ga0207711_10034564 | Ga0207711_100345645 | 256 |
| 559 | 3300025981 | Ga0207640_10029096 | Ga0207640_100290962 | 256 |
| 560 | 3300026041 | Ga0207639_10477981 | Ga0207639_104779812 | 256 |
| 561 | 3300026142 | Ga0207698_10064761 | Ga0207698_100647613 | 256 |
| 562 | 3300031456 | Ga0307513_10004000 | Ga0307513_100040001 | 256 |
| 563 | 3300031548 | Ga0307408_100018270 | Ga0307408_1000182703 | 256 |
| 564 | 3300031548 | Ga0307408_100208547 | Ga0307408_1002085472 | 256 |
| 565 | 3300031824 | Ga0307413_10014137 | Ga0307413_100141375 | 256 |
| 566 | 3300031852 | Ga0307410_10107408 | Ga0307410_101074084 | 256 |
| 567 | 3300031995 | Ga0307409_100048505 | Ga0307409_1000485055 | 256 |
| 568 | 3300031995 | Ga0307409_100384763 | Ga0307409_1003847632 | 256 |
| 569 | 3300032002 | Ga0307416_100301441 | Ga0307416_1003014413 | 256 |
| 570 | 3300037471 | Ga0395905_0016646 | Ga0395905_0016646_4305_5075 | 256 |
| 571 | 3300042133 | Ga0450896_005609 | Ga0450896_005609_718_1494 | 256 |
| 572 | 3300042435 | Ga0439434_0043546 | Ga0439434_0043546_379_1152 | 256 |
| 573 | 3300048905 | Ga0496102_0001663 | Ga0496102_0001663_2712_3566 | 256 |
| 574 | 3300050490 | nmdc:mga03n38_170852_c1 | nmdc:mga03n38_170852_c1_251_1021 | 256 |
| 575 | 3300050491 | nmdc:mga00v17_106768_c1 | nmdc:mga00v17_106768_c1_791_1561 | 256 |
| 576 | 3300050493 | nmdc:mga0k408_47951_c1 | nmdc:mga0k408_47951_c1_224_994 | 256 |
| 577 | 3300053088 | Ga0500644_0046335 | Ga0500644_0046335_295_1077 | 256 |
| 578 | 3300002773 | JGI25152J39213_1002247 | JGI25152J39213_10022476 | 257 |
| 579 | 3300002774 | JGI25150J39212_1013536 | JGI25150J39212_10135362 | 257 |
| 580 | 3300003215 | JGI25153J46596_10001482 | JGI25153J46596_1000148211 | 257 |
| 581 | 3300003771 | Ga0055526_1015985 | Ga0055526_10159852 | 257 |
| 582 | 3300005328 | Ga0070676_10007740 | Ga0070676_100077405 | 257 |
| 583 | 3300005331 | Ga0070670_100600763 | Ga0070670_1006007631 | 257 |
| 584 | 3300005333 | Ga0070677_10015480 | Ga0070677_100154803 | 257 |
| 585 | 3300005344 | Ga0070661_100002070 | Ga0070661_1000020705 | 257 |
| 586 | 3300005354 | Ga0070675_100001642 | Ga0070675_10000164220 | 257 |
| 587 | 3300005355 | Ga0070671_100001451 | Ga0070671_1000014514 | 257 |
| 588 | 3300005355 | Ga0070671_100043544 | Ga0070671_1000435442 | 257 |
| 589 | 3300005356 | Ga0070674_100073993 | Ga0070674_1000739934 | 257 |
| 590 | 3300005364 | Ga0070673_100039125 | Ga0070673_1000391253 | 257 |
| 591 | 3300005366 | Ga0070659_100004522 | Ga0070659_1000045226 | 257 |
| 592 | 3300005367 | Ga0070667_100011551 | Ga0070667_1000115515 | 257 |
| 593 | 3300005456 | Ga0070678_100204351 | Ga0070678_1002043513 | 257 |
| 594 | 3300005459 | Ga0068867_100011407 | Ga0068867_1000114075 | 257 |
| 595 | 3300005548 | Ga0070665_100243266 | Ga0070665_1002432662 | 257 |
| 596 | 3300005564 | Ga0070664_100004129 | Ga0070664_1000041293 | 257 |
| 597 | 3300005578 | Ga0068854_100024279 | Ga0068854_1000242793 | 257 |
| 598 | 3300005844 | Ga0068862_100157457 | Ga0068862_1001574572 | 257 |
| 599 | 3300006177 | Ga0075362_10052784 | Ga0075362_100527844 | 257 |
| 600 | 3300006237 | Ga0097621_100162159 | Ga0097621_1001621592 | 257 |
| 601 | 3300013308 | Ga0157375_10330179 | Ga0157375_103301793 | 257 |
| 602 | 3300014325 | Ga0163163_10651398 | Ga0163163_106513982 | 257 |
| 603 | 3300014969 | Ga0157376_10518467 | Ga0157376_105184672 | 257 |
| 604 | 3300017792 | Ga0163161_10005830 | Ga0163161_1000583010 | 257 |
| 605 | 3300021361 | Ga0213872_10011812 | Ga0213872_100118121 | 257 |
| 606 | 3300025304 | Ga0209257_1018761 | Ga0209257_10187612 | 257 |
| 607 | 3300025315 | Ga0207697_10010847 | Ga0207697_100108473 | 257 |
| 608 | 3300025893 | Ga0207682_10002340 | Ga0207682_100023402 | 257 |
| 609 | 3300025907 | Ga0207645_10008271 | Ga0207645_100082714 | 257 |
| 610 | 3300025919 | Ga0207657_10085031 | Ga0207657_100850314 | 257 |
| 611 | 3300025920 | Ga0207649_10002913 | Ga0207649_100029132 | 257 |
| 612 | 3300025923 | Ga0207681_10233874 | Ga0207681_102338742 | 257 |
| 613 | 3300025926 | Ga0207659_10000693 | Ga0207659_1000069312 | 257 |
| 614 | 3300025927 | Ga0207687_10098913 | Ga0207687_100989132 | 257 |
| 615 | 3300025931 | Ga0207644_10066152 | Ga0207644_100661522 | 257 |
| 616 | 3300025932 | Ga0207690_10052076 | Ga0207690_100520763 | 257 |
| 617 | 3300025940 | Ga0207691_10001450 | Ga0207691_100014504 | 257 |
| 618 | 3300025945 | Ga0207679_10001298 | Ga0207679_100012987 | 257 |
| 619 | 3300025960 | Ga0207651_10014050 | Ga0207651_100140504 | 257 |
| 620 | 3300025972 | Ga0207668_10121606 | Ga0207668_101216062 | 257 |
| 621 | 3300025986 | Ga0207658_10059759 | Ga0207658_100597592 | 257 |
| 622 | 3300026023 | Ga0207677_10052419 | Ga0207677_100524193 | 257 |
| 623 | 3300026023 | Ga0207677_10405544 | Ga0207677_104055442 | 257 |
| 624 | 3300026089 | Ga0207648_10014273 | Ga0207648_100142733 | 257 |
| 625 | 3300026089 | Ga0207648_10014457 | Ga0207648_100144575 | 257 |
| 626 | 3300026118 | Ga0207675_100572309 | Ga0207675_1005723091 | 257 |
| 627 | 3300026121 | Ga0207683_10035305 | Ga0207683_100353055 | 257 |
| 628 | 3300026121 | Ga0207683_10355119 | Ga0207683_103551192 | 257 |
| 629 | 3300028794 | Ga0307515_10099441 | Ga0307515_100994415 | 257 |
| 630 | 3300030522 | Ga0307512_10014330 | Ga0307512_100143305 | 257 |
| 631 | 3300030522 | Ga0307512_10174447 | Ga0307512_101744472 | 257 |
| 632 | 3300031507 | Ga0307509_10000139 | Ga0307509_1000013972 | 257 |
| 633 | 3300031649 | Ga0307514_10011572 | Ga0307514_100115726 | 257 |
| 634 | 3300033180 | Ga0307510_10098490 | Ga0307510_100984903 | 257 |
| 635 | 3300035691 | Ga0373931_0139762 | Ga0373931_0139762_419_1195 | 257 |
| 636 | 3300041999 | Ga0439433_0009231 | Ga0439433_0009231_1225_2004 | 257 |
| 637 | 3300042134 | Ga0450898_004229 | Ga0450898_004229_1156_1944 | 257 |
| 638 | 3300042134 | Ga0450898_015669 | Ga0450898_015669_311_1096 | 257 |
| 639 | 3300042156 | Ga0439446_0012231 | Ga0439446_0012231_873_1661 | 257 |
| 640 | 3300042876 | Ga0451577_0000093 | Ga0451577_0000093_39437_40237 | 257 |
| 641 | 3300042876 | Ga0451577_0006366 | Ga0451577_0006366_9927_10706 | 257 |
| 642 | 3300042876 | Ga0451577_0025368 | Ga0451577_0025368_347_1120 | 257 |
| 643 | 3300042876 | Ga0451577_0260846 | Ga0451577_0260846_13_819 | 257 |
| 644 | 3300044673 | Ga0453683_0009689 | Ga0453683_0009689_4965_5744 | 257 |
| 645 | 3300044712 | Ga0453684_0026331 | Ga0453684_0026331_6546_7325 | 257 |
| 646 | 3300045051 | Ga0451576_0004656 | Ga0451576_0004656_6774_7559 | 257 |
| 647 | 3300045051 | Ga0451576_0052444 | Ga0451576_0052444_870_1649 | 257 |
| 648 | 3300045051 | Ga0451576_0059748 | Ga0451576_0059748_2685_3464 | 257 |
| 649 | 3300046454 | Ga0495592_0000578 | Ga0495592_0000578_23968_24741 | 257 |
| 650 | 3300046516 | Ga0495628_0055764 | Ga0495628_0055764_131_949 | 257 |
| 651 | 3300047472 | Ga0495686_0000014 | Ga0495686_0000014_405692_406510 | 257 |
| 652 | 3300048905 | Ga0496102_0001807 | Ga0496102_0001807_2642_3415 | 257 |
| 653 | 3300053093 | Ga0500651_0013545 | Ga0500651_0013545_1101_1880 | 257 |
| 654 | 3300053118 | Ga0500594_0010790 | Ga0500594_0010790_899_1672 | 257 |
| 655 | 3300053123 | Ga0500614_015044 | Ga0500614_015044_159_932 | 257 |
| 656 | 3300053136 | Ga0500559_0000252 | Ga0500559_0000252_30778_31551 | 257 |
| 657 | 3300053148 | Ga0500590_002538 | Ga0500590_002538_7042_7830 | 257 |
| 658 | 3300053156 | Ga0500622_0009907 | Ga0500622_0009907_1265_2044 | 257 |
| 659 | 3300053177 | Ga0500636_0017380 | Ga0500636_0017380_2661_3434 | 257 |
| 660 | 3300053739 | Ga0500587_006109 | Ga0500587_006109_299_1078 | 257 |
| 661 | 3300005355 | Ga0070671_100378509 | Ga0070671_1003785092 | 258 |
| 662 | 3300005841 | Ga0068863_100371966 | Ga0068863_1003719662 | 258 |
| 663 | 3300006237 | Ga0097621_100191014 | Ga0097621_1001910144 | 258 |
| 664 | 3300009177 | Ga0105248_10386550 | Ga0105248_103865503 | 258 |
| 665 | 3300025931 | Ga0207644_10334264 | Ga0207644_103342642 | 258 |
| 666 | 3300026088 | Ga0207641_10236833 | Ga0207641_102368332 | 258 |
| 667 | 3300037471 | Ga0395905_0000047 | Ga0395905_0000047_79993_80775 | 258 |
| 668 | 3300037471 | Ga0395905_0004019 | Ga0395905_0004019_9713_10495 | 259 |
| 669 | 3300046457 | Ga0495590_0000944 | Ga0495590_0000944_6538_7320 | 259 |
| 670 | 3300046810 | Ga0495660_0011436 | Ga0495660_0011436_1914_2696 | 259 |
| 671 | 3300005354 | Ga0070675_100108089 | Ga0070675_1001080892 | 261 |
| 672 | 3300025926 | Ga0207659_10115990 | Ga0207659_101159902 | 261 |
| 673 | 3300025933 | Ga0207706_10498954 | Ga0207706_104989541 | 261 |
| 674 | 3300046539 | Ga0495621_0013815 | Ga0495621_0013815_1668_2480 | 261 |
| 675 | 3300050511 | nmdc:mga08y16_216578_c1 | nmdc:mga08y16_216578_c1_1157_1969 | 261 |
| 676 | 3300027876 | Ga0209974_10004900 | Ga0209974_100049003 | 262 |
| 677 | 3300042005 | Ga0439448_0096513 | Ga0439448_0096513_97_936 | 262 |
| 678 | 3300026089 | Ga0207648_10626723 | Ga0207648_106267231 | 263 |
| 679 | 3300031903 | Ga0307407_10049587 | Ga0307407_100495872 | 263 |
| 680 | 3300031911 | Ga0307412_10009949 | Ga0307412_100099496 | 263 |
| 681 | 3300031911 | Ga0307412_10307843 | Ga0307412_103078432 | 263 |
| 682 | 3300032002 | Ga0307416_100086283 | Ga0307416_1000862834 | 263 |
| 683 | 3300032004 | Ga0307414_10049634 | Ga0307414_100496345 | 263 |
| 684 | 3300049580 | Ga0501046_0144958 | Ga0501046_0144958_906_1703 | 263 |
| 685 | 3300025245 | Ga0207425_1001448 | Ga0207425_10014488 | 264 |
| 686 | 3300025258 | Ga0209129_1000309 | Ga0209129_100030921 | 264 |
| 687 | 3300025263 | Ga0209565_1008463 | Ga0209565_10084632 | 264 |
| 688 | 3300025273 | Ga0209673_1017905 | Ga0209673_10179052 | 264 |
| 689 | 3300025295 | Ga0209564_1000162 | Ga0209564_100016221 | 264 |
| 690 | 3300025297 | Ga0209758_1000152 | Ga0209758_1000152133 | 264 |
| 691 | 3300032002 | Ga0307416_100133700 | Ga0307416_1001337002 | 264 |
| 692 | 3300031730 | Ga0307516_10281994 | Ga0307516_102819942 | 265 |
| 693 | 3300028794 | Ga0307515_10059341 | Ga0307515_100593413 | 266 |
| 694 | 3300028794 | Ga0307515_10085898 | Ga0307515_100858982 | 268 |
| 695 | 3300025949 | Ga0207667_10133601 | Ga0207667_101336014 | 275 |
| 696 | 3300026142 | Ga0207698_10079133 | Ga0207698_100791331 | 275 |
| 697 | 3300001979 | JGI24740J21852_10005939 | JGI24740J21852_100059394 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fte-assembly1.cif.gz_A | crystal structure of a. aeolicus ksga in complex with rna | 0.8931 | 30 | 268 |
| 3tqs-assembly2.cif.gz_B | structure of the dimethyladenosine transferase (ksga) from coxiella burnetii | 0.8868 | 24 | 270 |
| 6ifv-assembly2.cif.gz_B | c-terminal truncated ksga from bacillus subtilis 168 | 0.8835 | 24 | 206 |
| 3tpz-assembly1.cif.gz_A | 2.1 angstrom crystal structure of the l114p mutant of e. coli ksga | 0.8787 | 21 | 273 |
| 3uzu-assembly1.cif.gz_A | the structure of the ribosomal rna small subunit methyltransferase a from burkholderia pseudomallei | 0.8766 | 19 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1qyrB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9174 | 24 | 209 | 3.40.50.150 |
| 3fteA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9151 | 30 | 207 | 3.40.50.150 |
| af_A0A144A0V8_364_547_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9083 | 46 | 205 | 3.40.50.150 |
| 1qyrB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9078 | 24 | 209 | 3.40.50.150 |
| 3fteA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8947 | 30 | 207 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5Q6L7-F1-model_v4 | 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase | 0.9891 | 122 | 206 |
GO:0000179
GO:0003723 GO:0005829 |
| AF-A0A645FEW7-F1-model_v4 | Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) | 0.9709 | 142 | 270 |
GO:0003723
GO:0005829 GO:0052908 |
| AF-A0A4R4GC92-F1-model_v4 | deleted | 0.964 | 142 | 206 |
|
| AF-A0A3P8M4N2-F1-model_v4 | Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) | 0.9601 | 115 | 213 |
GO:0003723
GO:0005829 GO:0052908 |
| AF-A0A855K800-F1-model_v4 | 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase | 0.9568 | 143 | 213 |
GO:0000179
GO:0003723 GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar