F475898

General Info

Members Datasets Scaffolds Average Seq Length
697 404 676 258

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10085898|Ga0307515_100858982
Length 303
Sequence VSRLNDDTPLAAYGKRPSQGHEEAPAWPGVGPCLGRPGAAARPAVKHIARKRFGQHFLTDGAIIDAIIDAIAPKPGEALIEIGPGLGAMTHPLVARCEQLTVIELDRDLAQRLRGRPGLEVIEADVLQVDFDALAQARGQRLRVVGNLPYNISSPILFHLLGSAARVVDQHFMLQKEVVERMAAGPGTKDYGRLSVMLQWRYDIESVLDVPPESFDPPPRVDSAVVRMLPLPDAPGIEPALLSELVRVAFSQRRKLLRHTLGRWLDERGFAGEFDVQRRAEEVPVADYLALAASVKGAEAKGA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
11 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
12 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
13 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
14 2643221656 Pelomonas sp. Root405 Isolate Unclassified
15 2643221660 Methylibium sp. Root1272 Isolate Unclassified
16 2738541337 Pelomonas sp. BT06 Isolate Unclassified
17 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
18 2842733646 Variovorax sp. R-72446 Isolate Unclassified
19 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
20 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
21 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
36 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
42 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
120 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
181 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
222 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
223 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
226 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
237 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
238 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
239 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
240 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
241 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
242 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
243 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
244 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
245 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
246 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
247 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
248 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
249 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
250 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
251 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
252 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
255 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
256 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
257 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
258 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
259 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
260 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
261 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
262 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
263 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
264 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
265 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
266 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
267 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
268 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
269 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
270 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
271 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
272 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
273 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
274 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
285 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
296 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
316 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
318 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
319 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
320 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
335 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
336 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
337 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
343 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
344 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
345 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
346 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
347 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
348 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
349 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
350 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
356 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
357 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
362 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
365 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
366 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
376 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
377 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
378 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
379 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
380 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
381 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
382 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
383 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
384 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
385 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
388 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
389 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
390 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
391 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
392 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
393 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
394 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
395 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
396 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
397 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
398 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
399 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
400 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
403 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
404 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.84
Metatranscriptomes 0.14
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.39
Nodule 0.29
Rhizoplane 2.73
Rhizosphere 63.56
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005939 3300001979 Bacteria 5112
2 JGI25155J39150_1000092 3300002704 Bacteria 51808
3 JGI25156J39149_1000067 3300002705 Bacteria 82796
4 JGI25154J39366_1000089 3300002738 Bacteria 82796
5 JGI25157J39369_1000084 3300002741 Bacteria 82796
6 JGI25152J39213_1002247 3300002773 Bacteria 7468
7 JGI25150J39212_1004135 3300002774 Bacteria 3272
8 JGI25150J39212_1013536 3300002774 Bacteria 1410
9 JGI25159J45721_1000151 3300002987 Bacteria 32346
10 JGI25159J45721_1001940 3300002987 Bacteria 8242
11 JGI25151J46595_10008194 3300003187 Bacteria 5048
12 JGI25151J46595_10019356 3300003187 Bacteria 2893
13 JGI25151J46595_10053949 3300003187 Bacteria 1338
14 JGI25153J46596_10001482 3300003215 Bacteria 13987
15 JGI25153J46596_10002052 3300003215 Bacteria 11868
16 JGI25153J46596_10003533 3300003215 Bacteria 8720
17 rootL2_10027772 3300003322 Bacteria 6501
18 rootL2_10041726 3300003322 Bacteria 1266
19 rootH1_10026256 3300003323 Bacteria 1965
20 JGI25160J50197_1000076 3300003354 Bacteria 102318
21 JGI25160J50197_1015714 3300003354 Bacteria 2473
22 JGI25161J50226_1000058 3300003374 Bacteria 102318
23 Ga0055525_1000056 3300003759 Bacteria 212321
24 Ga0055526_1002345 3300003771 Bacteria 12862
25 Ga0055526_1015985 3300003771 Bacteria 2974
26 Ga0055526_1027784 3300003771 Bacteria 1735
27 Ga0055537_1000207 3300003773 Bacteria 44154
28 Ga0055524_1000033 3300003775 Bacteria 180833
29 Ga0055524_1000303 3300003775 Bacteria 47193
30 Ga0055536_1002799 3300003781 Bacteria 9638
31 Ga0055534_1004926 3300003784 Bacteria 3728
32 Ga0055528_1000468 3300003790 Bacteria 32324
33 Ga0055530_10000449 3300003791 Bacteria 36583
34 Ga0055530_10001419 3300003791 Bacteria 17587
35 Ga0055530_10017939 3300003791 Bacteria 2200
36 Ga0055540_1000088 3300003792 Bacteria 102236
37 Ga0055540_1000184 3300003792 Bacteria 60646
38 Ga0055531_10001550 3300003794 Bacteria 16828
39 Ga0055531_10001635 3300003794 Bacteria 16229
40 Ga0055531_10007861 3300003794 Bacteria 5733
41 Ga0055531_10013435 3300003794 Bacteria 3772
42 Ga0055531_10045105 3300003794 Bacteria 1228
43 Ga0055543_1003345 3300004625 Bacteria 4781
44 Ga0065165_1003497 3300005262 Bacteria 10954
45 Ga0065165_1024375 3300005262 Bacteria 2033
46 Ga0065165_1026081 3300005262 Bacteria 1929
47 Ga0070676_10007740 3300005328 Bacteria 5768
48 Ga0070676_10011204 3300005328 Bacteria 4874
49 Ga0070676_10368599 3300005328 Bacteria 991
50 Ga0070670_100047187 3300005331 Bacteria 3705
51 Ga0070670_100089314 3300005331 Bacteria 2649
52 Ga0070670_100600763 3300005331 Bacteria 984
53 Ga0070677_10015480 3300005333 Bacteria 2702
54 Ga0068869_100007433 3300005334 Bacteria 7004
55 Ga0068868_100078694 3300005338 Bacteria 2640
56 Ga0068868_100274651 3300005338 Bacteria 1425
57 Ga0070661_100002070 3300005344 Bacteria 13804
58 Ga0070669_100210306 3300005353 Bacteria 1534
59 Ga0070675_100001642 3300005354 Bacteria 16524
60 Ga0070675_100108089 3300005354 Bacteria 2349
61 Ga0070671_100001451 3300005355 Bacteria 17703
62 Ga0070671_100001946 3300005355 Bacteria 15842
63 Ga0070671_100016402 3300005355 Bacteria 5990
64 Ga0070671_100043544 3300005355 Bacteria 3730
65 Ga0070671_100161407 3300005355 Bacteria 1894
66 Ga0070671_100378509 3300005355 Bacteria 1210
67 Ga0070674_100073993 3300005356 Bacteria 2416
68 Ga0070673_100039125 3300005364 Bacteria 3627
69 Ga0070673_100046472 3300005364 Bacteria 3372
70 Ga0070673_100296809 3300005364 Bacteria 1422
71 Ga0070659_100004522 3300005366 Bacteria 9935
72 Ga0070667_100011551 3300005367 Bacteria 7301
73 Ga0070663_100000177 3300005455 Bacteria 32482
74 Ga0070663_100029061 3300005455 Bacteria 3772
75 Ga0070678_100083161 3300005456 Bacteria 2433
76 Ga0070678_100204351 3300005456 Bacteria 1632
77 Ga0070662_100011436 3300005457 Bacteria 5858
78 Ga0070662_100043764 3300005457 Bacteria 3205
79 Ga0070662_100056616 3300005457 Bacteria 2847
80 Ga0068867_100002539 3300005459 Bacteria 12853
81 Ga0068867_100011407 3300005459 Bacteria 6270
82 Ga0070698_100131030 3300005471 Bacteria 2463
83 Ga0068853_100299540 3300005539 Bacteria 1486
84 Ga0068853_100530173 3300005539 Bacteria 1114
85 Ga0070672_100089458 3300005543 Bacteria 2481
86 Ga0070665_100007442 3300005548 Bacteria 11136
87 Ga0070665_100243266 3300005548 Bacteria 1800
88 Ga0070664_100004129 3300005564 Bacteria 11663
89 Ga0068857_100045761 3300005577 Bacteria 3883
90 Ga0068857_100233714 3300005577 Bacteria 1682
91 Ga0068857_100322260 3300005577 Bacteria 1427
92 Ga0068854_100024279 3300005578 Bacteria 4148
93 Ga0068854_100070468 3300005578 Bacteria 2555
94 Ga0068854_100272447 3300005578 Bacteria 1360
95 Ga0068852_100062752 3300005616 Bacteria 3233
96 Ga0068852_100068114 3300005616 Bacteria 3114
97 Ga0068859_100394865 3300005617 Bacteria 1479
98 Ga0068864_100014887 3300005618 Bacteria 6462
99 Ga0068864_100029189 3300005618 Bacteria 4667
100 Ga0068861_100046976 3300005719 Bacteria 3257
101 Ga0068863_100025738 3300005841 Bacteria 5612
102 Ga0068863_100371966 3300005841 Bacteria 1395
103 Ga0068860_100052637 3300005843 Bacteria 3872
104 Ga0068860_100152450 3300005843 Bacteria 2226
105 Ga0068862_100157457 3300005844 Bacteria 2026
106 Ga0075365_10005601 3300006038 Bacteria 6794
107 Ga0075368_10066297 3300006042 Bacteria 1451
108 Ga0075363_100009419 3300006048 Bacteria 4591
109 Ga0075363_100017797 3300006048 Bacteria 3530
110 Ga0075363_100040513 3300006048 Bacteria 2455
111 Ga0075364_10014008 3300006051 Bacteria 4944
112 Ga0075364_10026448 3300006051 Bacteria 3702
113 Ga0075364_10147209 3300006051 Bacteria 1586
114 Ga0075362_10009878 3300006177 Bacteria 3706
115 Ga0075362_10052784 3300006177 Bacteria 1823
116 Ga0075362_10094765 3300006177 Bacteria 1389
117 Ga0075362_10129575 3300006177 Bacteria 1199
118 Ga0075367_10058767 3300006178 Bacteria 2288
119 Ga0075367_10134981 3300006178 Bacteria 1526
120 Ga0075366_10010218 3300006195 Bacteria 5265
121 Ga0075366_10027638 3300006195 Bacteria 3329
122 Ga0075366_10037610 3300006195 Bacteria 2858
123 Ga0075366_10038492 3300006195 Bacteria 2824
124 Ga0075366_10048103 3300006195 Bacteria 2528
125 Ga0097621_100085974 3300006237 Bacteria 2624
126 Ga0097621_100162159 3300006237 Bacteria 1922
127 Ga0097621_100191014 3300006237 Bacteria 1773
128 Ga0075370_10002305 3300006353 Bacteria 8801
129 Ga0075370_10018093 3300006353 Bacteria 3818
130 Ga0075370_10094514 3300006353 Bacteria 1726
131 Ga0068871_100010211 3300006358 Bacteria 6839
132 Ga0075428_100014646 3300006844 Bacteria 8708
133 Ga0075430_100043881 3300006846 Bacteria 3781
134 Ga0075431_100226001 3300006847 Bacteria 1908
135 Ga0075433_10005691 3300006852 Bacteria 9798
136 Ga0075434_100000099 3300006871 Bacteria 48394
137 Ga0075429_100010563 3300006880 Bacteria 7984
138 Ga0075429_100305696 3300006880 Bacteria 1392
139 Ga0068865_100222175 3300006881 Bacteria 1477
140 Ga0097620_100394849 3300006931 Bacteria 1479
141 Ga0079104_1000009 3300006946 Bacteria 367015
142 Ga0075435_100010581 3300007076 Bacteria 6751
143 Ga0105240_10093898 3300009093 Bacteria 3661
144 Ga0111539_10007187 3300009094 Bacteria 14272
145 Ga0111539_10049751 3300009094 Bacteria 4996
146 Ga0105245_10062486 3300009098 Bacteria 3360
147 Ga0114129_10043073 3300009147 Bacteria 6353
148 Ga0114129_10101901 3300009147 Bacteria 3971
149 Ga0114129_10466474 3300009147 Bacteria 1654
150 Ga0105243_10097400 3300009148 Bacteria 2435
151 Ga0105243_10243143 3300009148 Bacteria 1603
152 Ga0105248_10000345 3300009177 Bacteria 54458
153 Ga0105248_10016463 3300009177 Bacteria 8138
154 Ga0105248_10386550 3300009177 Bacteria 1575
155 Ga0105237_10000372 3300009545 Bacteria 63675
156 Ga0105237_10029616 3300009545 Bacteria 5563
157 Ga0105239_10000623 3300010375 Bacteria 50370
158 Ga0105239_10022914 3300010375 Bacteria 6884
159 Ga0157374_10093533 3300013296 Bacteria 2870
160 Ga0157378_10233668 3300013297 Bacteria 1753
161 Ga0163162_10299748 3300013306 Bacteria 1739
162 Ga0157375_10082583 3300013308 Bacteria 3255
163 Ga0157375_10330179 3300013308 Bacteria 1690
164 Ga0163163_10258308 3300014325 Bacteria 1793
165 Ga0163163_10651398 3300014325 Bacteria 1117
166 Ga0157380_10031068 3300014326 Bacteria 4097
167 Ga0157380_10035763 3300014326 Bacteria 3838
168 Ga0157380_10594228 3300014326 Bacteria 1094
169 Ga0182008_10052156 3300014497 Bacteria 2028
170 Ga0157377_10270033 3300014745 Bacteria 1110
171 Ga0157379_10048254 3300014968 Bacteria 3800
172 Ga0157379_10769547 3300014968 Bacteria 907
173 Ga0157376_10518467 3300014969 Bacteria 1174
174 Ga0163161_10005830 3300017792 Bacteria 8535
175 Ga0213872_10000066 3300021361 Bacteria 93052
176 Ga0213872_10000208 3300021361 Bacteria 52289
177 Ga0213872_10011812 3300021361 Bacteria 4127
178 Ga0213872_10018486 3300021361 Bacteria 3215
179 Ga0209435_100008 3300025206 Bacteria 503644
180 Ga0209436_104260 3300025208 Bacteria 3570
181 Ga0209674_105588 3300025226 Bacteria 1829
182 Ga0209563_100014 3300025230 Bacteria 940582
183 Ga0207425_1001448 3300025245 Bacteria 9912
184 Ga0207425_1004208 3300025245 Bacteria 4373
185 Ga0207425_1005008 3300025245 Bacteria 3854
186 Ga0209646_1000029 3300025246 Bacteria 386414
187 Ga0209026_1000016 3300025250 Bacteria 386457
188 Ga0209759_1000016 3300025256 Bacteria 386414
189 Ga0209129_1000309 3300025258 Bacteria 44354
190 Ga0209129_1019880 3300025258 Bacteria 1260
191 Ga0209565_1000061 3300025263 Bacteria 185308
192 Ga0209565_1001035 3300025263 Bacteria 14126
193 Ga0209565_1008463 3300025263 Bacteria 2687
194 Ga0209673_1000492 3300025273 Bacteria 65573
195 Ga0209673_1015184 3300025273 Bacteria 2940
196 Ga0209673_1017905 3300025273 Bacteria 2597
197 Ga0209130_1000014 3300025284 Bacteria 412039
198 Ga0209130_1000411 3300025284 Bacteria 46681
199 Ga0209675_1003237 3300025291 Bacteria 7857
200 Ga0209675_1014235 3300025291 Bacteria 2432
201 Ga0209675_1027991 3300025291 Bacteria 1377
202 Ga0209676_1000013 3300025292 Bacteria 816080
203 Ga0209676_1000153 3300025292 Bacteria 166393
204 Ga0209676_1003964 3300025292 Bacteria 8557
205 Ga0209025_1002161 3300025294 Bacteria 21908
206 Ga0209025_1022311 3300025294 Bacteria 3364
207 Ga0209025_1063236 3300025294 Bacteria 1367
208 Ga0209564_1000162 3300025295 Bacteria 162265
209 Ga0209564_1001101 3300025295 Bacteria 32085
210 Ga0209564_1001248 3300025295 Bacteria 28296
211 Ga0209758_1000152 3300025297 Bacteria 162418
212 Ga0209758_1000969 3300025297 Bacteria 38697
213 Ga0209050_1000008 3300025298 Bacteria 1144179
214 Ga0209050_1000202 3300025298 Bacteria 133468
215 Ga0209050_1001318 3300025298 Bacteria 27770
216 Ga0209050_1009519 3300025298 Bacteria 4955
217 Ga0209050_1014764 3300025298 Bacteria 3336
218 Ga0209050_1036703 3300025298 Bacteria 1426
219 Ga0209256_1000019 3300025299 Bacteria 558627
220 Ga0209256_1000039 3300025299 Bacteria 372337
221 Ga0209256_1032607 3300025299 Bacteria 1411
222 Ga0207426_1000174 3300025302 Bacteria 160877
223 Ga0207426_1003159 3300025302 Bacteria 9318
224 Ga0209051_1000004 3300025303 Bacteria 1155596
225 Ga0209051_1000005 3300025303 Bacteria 1142353
226 Ga0209051_1000351 3300025303 Bacteria 68445
227 Ga0209051_1006113 3300025303 Bacteria 6849
228 Ga0209051_1018306 3300025303 Bacteria 3102
229 Ga0209257_1000015 3300025304 Bacteria 908141
230 Ga0209257_1000016 3300025304 Bacteria 908015
231 Ga0209257_1000031 3300025304 Bacteria 688770
232 Ga0209257_1000038 3300025304 Bacteria 609032
233 Ga0209257_1000044 3300025304 Bacteria 486709
234 Ga0209257_1010422 3300025304 Bacteria 4707
235 Ga0209257_1018761 3300025304 Bacteria 2641
236 Ga0207697_10010847 3300025315 Bacteria 3876
237 Ga0207656_10085542 3300025321 Bacteria 1424
238 Ga0207682_10002340 3300025893 Bacteria 8545
239 Ga0207645_10008271 3300025907 Bacteria 7272
240 Ga0207643_10163511 3300025908 Bacteria 1340
241 Ga0207695_10006330 3300025913 Bacteria 15399
242 Ga0207671_10002794 3300025914 Bacteria 18202
243 Ga0207657_10085031 3300025919 Bacteria 2651
244 Ga0207649_10002913 3300025920 Bacteria 9423
245 Ga0207681_10233082 3300025923 Bacteria 1430
246 Ga0207681_10233874 3300025923 Bacteria 1427
247 Ga0207650_10048144 3300025925 Bacteria 3143
248 Ga0207650_10088606 3300025925 Bacteria 2360
249 Ga0207650_10333308 3300025925 Bacteria 1245
250 Ga0207659_10000693 3300025926 Bacteria 19984
251 Ga0207659_10014169 3300025926 Bacteria 5134
252 Ga0207659_10115990 3300025926 Bacteria 2044
253 Ga0207687_10098913 3300025927 Bacteria 2142
254 Ga0207687_10336154 3300025927 Bacteria 1227
255 Ga0207644_10013979 3300025931 Bacteria 5364
256 Ga0207644_10015446 3300025931 Bacteria 5125
257 Ga0207644_10066152 3300025931 Bacteria 2630
258 Ga0207644_10108505 3300025931 Bacteria 2096
259 Ga0207644_10334264 3300025931 Bacteria 1227
260 Ga0207690_10052076 3300025932 Bacteria 2740
261 Ga0207706_10001423 3300025933 Bacteria 23955
262 Ga0207706_10092080 3300025933 Bacteria 2665
263 Ga0207706_10108523 3300025933 Bacteria 2442
264 Ga0207706_10498954 3300025933 Bacteria 1051
265 Ga0207709_10010914 3300025935 Bacteria 5006
266 Ga0207669_10017244 3300025937 Bacteria 3698
267 Ga0207704_10123775 3300025938 Bacteria 1776
268 Ga0207704_10208527 3300025938 Bacteria 1436
269 Ga0207704_10495579 3300025938 Bacteria 984
270 Ga0207691_10001450 3300025940 Bacteria 23610
271 Ga0207691_10048851 3300025940 Bacteria 3877
272 Ga0207711_10034564 3300025941 Bacteria 4280
273 Ga0207689_10009834 3300025942 Bacteria 8243
274 Ga0207679_10001298 3300025945 Bacteria 15795
275 Ga0207679_10134632 3300025945 Bacteria 1988
276 Ga0207667_10133601 3300025949 Bacteria 2556
277 Ga0207651_10014050 3300025960 Bacteria 4609
278 Ga0207668_10121606 3300025972 Bacteria 1978
279 Ga0207640_10029096 3300025981 Bacteria 3386
280 Ga0207640_10139728 3300025981 Bacteria 1764
281 Ga0207658_10059759 3300025986 Bacteria 2841
282 Ga0207677_10019618 3300026023 Bacteria 4088
283 Ga0207677_10052419 3300026023 Bacteria 2772
284 Ga0207677_10405544 3300026023 Bacteria 1157
285 Ga0207703_10746877 3300026035 Bacteria 932
286 Ga0207639_10477981 3300026041 Bacteria 1135
287 Ga0207678_10000060 3300026067 Bacteria 85708
288 Ga0207678_10044882 3300026067 Bacteria 3822
289 Ga0207641_10030294 3300026088 Bacteria 4482
290 Ga0207641_10236833 3300026088 Bacteria 1699
291 Ga0207641_10323864 3300026088 Bacteria 1462
292 Ga0207648_10014273 3300026089 Bacteria 7343
293 Ga0207648_10014457 3300026089 Bacteria 7293
294 Ga0207648_10091781 3300026089 Bacteria 2655
295 Ga0207648_10369569 3300026089 Bacteria 1295
296 Ga0207648_10626723 3300026089 Bacteria 993
297 Ga0207676_10024500 3300026095 Bacteria 4466
298 Ga0207676_10205964 3300026095 Bacteria 1741
299 Ga0207674_10008673 3300026116 Bacteria 11707
300 Ga0207674_10102163 3300026116 Bacteria 2847
301 Ga0207674_10154411 3300026116 Bacteria 2251
302 Ga0207675_100419214 3300026118 Bacteria 1322
303 Ga0207675_100572309 3300026118 Bacteria 1130
304 Ga0207683_10007662 3300026121 Bacteria 9244
305 Ga0207683_10035305 3300026121 Bacteria 4347
306 Ga0207683_10081877 3300026121 Bacteria 2866
307 Ga0207683_10355119 3300026121 Bacteria 1346
308 Ga0207683_10497374 3300026121 Bacteria 1126
309 Ga0207698_10029862 3300026142 Bacteria 3911
310 Ga0207698_10064761 3300026142 Bacteria 2867
311 Ga0207698_10079133 3300026142 Bacteria 2643
312 Ga0209281_1000023 3300027111 Bacteria 519955
313 Ga0209969_1000326 3300027360 Bacteria 6343
314 Ga0209967_1000410 3300027364 Bacteria 5637
315 Ga0210000_1000765 3300027462 Bacteria 4449
316 Ga0209971_1010877 3300027682 Bacteria 2155
317 Ga0209998_10003959 3300027717 Bacteria 3188
318 Ga0209813_10101128 3300027866 Bacteria 981
319 Ga0209974_10001306 3300027876 Bacteria 8962
320 Ga0209974_10004900 3300027876 Bacteria 4735
321 Ga0268266_10100631 3300028379 Bacteria 2546
322 Ga0268266_10607650 3300028379 Bacteria 1051
323 Ga0268264_10190110 3300028381 Bacteria 1871
324 Ga0265334_10024041 3300028573 Bacteria 2474
325 Ga0265336_10056708 3300028666 Bacteria 1177
326 Ga0307517_10021062 3300028786 Bacteria 8264
327 Ga0307517_10059532 3300028786 Bacteria 3655
328 Ga0307517_10133568 3300028786 Bacteria 1775
329 Ga0307515_10000058 3300028794 Bacteria 259680
330 Ga0307515_10001320 3300028794 Bacteria 56334
331 Ga0307515_10001649 3300028794 Bacteria 49654
332 Ga0307515_10042404 3300028794 Bacteria 7119
333 Ga0307515_10059341 3300028794 Bacteria 5484
334 Ga0307515_10085898 3300028794 Bacteria 4019
335 Ga0307515_10099441 3300028794 Bacteria 3532
336 Ga0307515_10147242 3300028794 Bacteria 2486
337 Ga0307512_10014330 3300030522 Bacteria 7389
338 Ga0307512_10022820 3300030522 Bacteria 5609
339 Ga0307512_10174447 3300030522 Bacteria 1224
340 Ga0265330_10000037 3300031235 Bacteria 120957
341 Ga0265332_10000008 3300031238 Bacteria 301609
342 Ga0265328_10021819 3300031239 Bacteria 2440
343 Ga0265325_10009265 3300031241 Bacteria 5755
344 Ga0265340_10012082 3300031247 Bacteria 4567
345 Ga0265327_10000020 3300031251 Bacteria 424552
346 Ga0265327_10002065 3300031251 Bacteria 22495
347 Ga0265316_10193217 3300031344 Bacteria 1511
348 Ga0307513_10004000 3300031456 Bacteria 19785
349 Ga0307513_10037189 3300031456 Bacteria 5420
350 Ga0307509_10000139 3300031507 Bacteria 108589
351 Ga0307509_10054727 3300031507 Bacteria 4245
352 Ga0307509_10074015 3300031507 Bacteria 3545
353 Ga0307408_100000006 3300031548 Bacteria 472824
354 Ga0307408_100018270 3300031548 Bacteria 4706
355 Ga0307408_100087568 3300031548 Bacteria 2344
356 Ga0307408_100172785 3300031548 Bacteria 1727
357 Ga0307408_100193846 3300031548 Bacteria 1639
358 Ga0307408_100208547 3300031548 Bacteria 1586
359 Ga0307408_100298983 3300031548 Bacteria 1347
360 Ga0307508_10000291 3300031616 Bacteria 61434
361 Ga0307508_10001439 3300031616 Bacteria 26811
362 Ga0307508_10003842 3300031616 Bacteria 14961
363 Ga0307514_10011572 3300031649 Bacteria 7333
364 Ga0307514_10059697 3300031649 Bacteria 2913
365 Ga0265314_10000065 3300031711 Bacteria 158383
366 Ga0265314_10084971 3300031711 Bacteria 2076
367 Ga0265314_10095785 3300031711 Bacteria 1921
368 Ga0307516_10001769 3300031730 Bacteria 29705
369 Ga0307516_10004526 3300031730 Bacteria 17100
370 Ga0307516_10281994 3300031730 Bacteria 1343
371 Ga0307405_10021875 3300031731 Bacteria 3603
372 Ga0307405_10147142 3300031731 Bacteria 1652
373 Ga0316577_10215725 3300031733 Bacteria 1085
374 Ga0307413_10014137 3300031824 Bacteria 4041
375 Ga0307413_10026147 3300031824 Bacteria 3212
376 Ga0307410_10107408 3300031852 Bacteria 2013
377 Ga0307410_10159421 3300031852 Bacteria 1689
378 Ga0307406_10046009 3300031901 Bacteria 2743
379 Ga0307406_10168643 3300031901 Bacteria 1582
380 Ga0307407_10049587 3300031903 Bacteria 2397
381 Ga0307412_10009949 3300031911 Bacteria 5471
382 Ga0307412_10091368 3300031911 Bacteria 2131
383 Ga0307412_10220479 3300031911 Bacteria 1453
384 Ga0307412_10307843 3300031911 Bacteria 1255
385 Ga0307412_10511887 3300031911 Bacteria 1001
386 Ga0307409_100048505 3300031995 Bacteria 3232
387 Ga0307409_100384763 3300031995 Bacteria 1335
388 Ga0307416_100002539 3300032002 Bacteria 10509
389 Ga0307416_100086283 3300032002 Bacteria 2675
390 Ga0307416_100133700 3300032002 Bacteria 2239
391 Ga0307416_100301441 3300032002 Bacteria 1593
392 Ga0307416_100465706 3300032002 Bacteria 1320
393 Ga0307416_100670161 3300032002 Bacteria 1124
394 Ga0307414_10032558 3300032004 Bacteria 3434
395 Ga0307414_10049634 3300032004 Bacteria 2903
396 Ga0307411_10112936 3300032005 Bacteria 1948
397 Ga0307411_10119709 3300032005 Bacteria 1902
398 Ga0307415_100016027 3300032126 Bacteria 4454
399 Ga0307507_10031105 3300033179 Bacteria 5610
400 Ga0307510_10001714 3300033180 Bacteria 24366
401 Ga0307510_10098490 3300033180 Bacteria 2728
402 Ga0307510_10254897 3300033180 Bacteria 1239
403 Ga0373951_0004581 3300035091 Bacteria 3274
404 Ga0373939_0000034 3300035114 Bacteria 49433
405 Ga0373945_0110880 3300035116 Bacteria 1083
406 Ga0373960_0012498 3300035121 Bacteria 2111
407 Ga0373962_0024087 3300035242 Bacteria 1625
408 Ga0373931_0000318 3300035691 Bacteria 20228
409 Ga0373931_0139762 3300035691 Bacteria 1401
410 Ga0373947_0026980 3300035725 Bacteria 3360
411 Ga0373937_0031785 3300036401 Bacteria 4785
412 Ga0373925_0088108 3300037068 Bacteria 2370
413 Ga0395900_0000692 3300037418 Bacteria 44929
414 Ga0395900_0317175 3300037418 Bacteria 1540
415 Ga0395898_0000990 3300037466 Bacteria 44660
416 Ga0395898_0290257 3300037466 Bacteria 1560
417 Ga0395905_0000047 3300037471 Bacteria 237582
418 Ga0395905_0004019 3300037471 Bacteria 15438
419 Ga0395905_0011760 3300037471 Bacteria 8449
420 Ga0395905_0016646 3300037471 Bacteria 6989
421 Ga0395905_0019486 3300037471 Bacteria 6430
422 Ga0395905_0037629 3300037471 Bacteria 4541
423 Ga0436361_0074986 3300039447 Bacteria 19532
424 Ga0436361_0872778 3300039447 Bacteria 3182
425 Ga0436361_1125703 3300039447 Bacteria 66289
426 Ga0439453_0023123 3300041408 Bacteria 1132
427 Ga0439461_0012680 3300041410 Bacteria 1581
428 Ga0439465_0010920 3300041413 Bacteria 2849
429 Ga0451789_0041207 3300041443 Bacteria 5036
430 Ga0451793_1186227 3300041452 Bacteria 2381
431 Ga0451797_0112310 3300041453 Bacteria 2393
432 Ga0451795_0100487 3300041456 Bacteria 3178
433 Ga0451798_0473492 3300041458 Bacteria 4930
434 Ga0451800_1357952 3300041459 Bacteria 5656
435 Ga0451802_1279546 3300041460 Bacteria 1598
436 Ga0451804_0262210 3300041463 Bacteria 3327
437 Ga0451807_2694204 3300041486 Bacteria 2373
438 Ga0451855_1521696 3300041511 Bacteria 1138
439 Ga0451853_3999752 3300041512 Bacteria 1817
440 Ga0439433_0009231 3300041999 Bacteria 2146
441 Ga0439433_0029112 3300041999 Bacteria 1259
442 Ga0439441_000681 3300042001 Bacteria 3917
443 Ga0439443_004215 3300042003 Bacteria 1859
444 Ga0439448_0031445 3300042005 Bacteria 1686
445 Ga0439448_0096513 3300042005 Bacteria 1002
446 Ga0450917_000803 3300042120 Bacteria 2312
447 Ga0450920_001174 3300042122 Bacteria 4298
448 Ga0450923_003799 3300042125 Bacteria 2318
449 Ga0450890_001764 3300042127 Bacteria 3064
450 Ga0450892_001407 3300042130 Bacteria 2362
451 Ga0450894_002628 3300042131 Bacteria 2392
452 Ga0450896_000143 3300042133 Bacteria 5596
453 Ga0450896_005609 3300042133 Bacteria 1713
454 Ga0450898_004229 3300042134 Bacteria 2109
455 Ga0450898_005537 3300042134 Bacteria 1912
456 Ga0450898_015669 3300042134 Bacteria 1286
457 Ga0450910_002657 3300042147 Bacteria 2350
458 Ga0439446_0001410 3300042156 Bacteria 5460
459 Ga0439446_0012231 3300042156 Bacteria 2342
460 Ga0439446_0025654 3300042156 Bacteria 1685
461 Ga0439446_0032700 3300042156 Bacteria 1510
462 Ga0439446_0032744 3300042156 Bacteria 1509
463 Ga0450908_013244 3300042184 Bacteria 1488
464 Ga0439434_0005027 3300042435 Bacteria 3865
465 Ga0439434_0039296 3300042435 Bacteria 1452
466 Ga0439434_0043546 3300042435 Bacteria 1382
467 Ga0439435_0001374 3300042436 Bacteria 4462
468 Ga0439444_0000509 3300042437 Bacteria 4367
469 Ga0439460_0002310 3300042461 Bacteria 4586
470 Ga0439460_0048531 3300042461 Bacteria 1267
471 Ga0450893_0005881 3300042532 Bacteria 1976
472 Ga0450893_0014529 3300042532 Bacteria 1321
473 Ga0451577_0000093 3300042876 Bacteria 196838
474 Ga0451577_0006366 3300042876 Bacteria 11788
475 Ga0451577_0025368 3300042876 Bacteria 5378
476 Ga0451577_0049307 3300042876 Bacteria 3760
477 Ga0451577_0260846 3300042876 Bacteria 1569
478 Ga0466969_0000186 3300044656 Bacteria 33421
479 Ga0466969_0032135 3300044656 Bacteria 2669
480 Ga0466972_0000314 3300044658 Bacteria 27904
481 Ga0453683_0009689 3300044673 Bacteria 6423
482 Ga0466965_0027239 3300044683 Bacteria 2773
483 Ga0466965_0036893 3300044683 Bacteria 2399
484 Ga0466965_0040210 3300044683 Bacteria 2301
485 Ga0466965_0077393 3300044683 Bacteria 1680
486 Ga0466965_0101691 3300044683 Bacteria 1470
487 Ga0466965_0235215 3300044683 Bacteria 979
488 Ga0466966_0046318 3300044684 Bacteria 2777
489 Ga0466961_0081273 3300044693 Bacteria 2050
490 Ga0466961_0258706 3300044693 Bacteria 1068
491 Ga0466964_0024355 3300044706 Bacteria 2359
492 Ga0453684_0026331 3300044712 Bacteria 8407
493 Ga0466971_0088634 3300044719 Bacteria 1415
494 Ga0466957_0018901 3300044842 Bacteria 4050
495 Ga0466960_0043092 3300044901 Bacteria 2145
496 Ga0466959_0006956 3300045049 Bacteria 7903
497 Ga0451576_0003213 3300045051 Bacteria 22785
498 Ga0451576_0004656 3300045051 Bacteria 17688
499 Ga0451576_0052444 3300045051 Bacteria 4273
500 Ga0451576_0059748 3300045051 Bacteria 3979
501 Ga0451576_0060850 3300045051 Bacteria 3938
502 Ga0451576_0110943 3300045051 Bacteria 2854
503 Ga0451576_0658339 3300045051 Bacteria 1100
504 Ga0451576_0776535 3300045051 Bacteria 1006
505 Ga0495592_0000578 3300046454 Bacteria 25993
506 Ga0495590_0000944 3300046457 Bacteria 12859
507 Ga0495638_0043850 3300046460 Bacteria 2820
508 Ga0495638_0292799 3300046460 Bacteria 880
509 Ga0495650_0004224 3300046471 Bacteria 9947
510 Ga0495606_0170761 3300046507 Bacteria 1262
511 Ga0495610_0036251 3300046512 Bacteria 2522
512 Ga0495620_0069865 3300046515 Bacteria 1439
513 Ga0495628_0055764 3300046516 Bacteria 3112
514 Ga0495630_0503508 3300046517 Bacteria 929
515 Ga0495632_0002824 3300046519 Bacteria 12856
516 Ga0495632_0008760 3300046519 Bacteria 6165
517 Ga0495643_0033357 3300046522 Bacteria 2849
518 Ga0495654_0000307 3300046530 Bacteria 43179
519 Ga0495621_0013815 3300046539 Bacteria 2544
520 Ga0495649_0001758 3300046694 Bacteria 15969
521 Ga0495660_0011436 3300046810 Bacteria 5150
522 Ga0495674_0025097 3300047319 Bacteria 5470
523 Ga0495687_000070 3300047443 Bacteria 159227
524 Ga0495686_0000014 3300047472 Bacteria 474014
525 Ga0495686_0034645 3300047472 Bacteria 3250
526 Ga0495626_0128465 3300048091 Bacteria 1084
527 Ga0496102_0001663 3300048905 Bacteria 19552
528 Ga0496102_0001807 3300048905 Bacteria 18514
529 Ga0496104_0047632 3300048907 Bacteria 4040
530 Ga0496105_0065262 3300048908 Bacteria 3005
531 Ga0496106_0128729 3300048909 Bacteria 1984
532 Ga0496108_0052367 3300048911 Bacteria 3420
533 Ga0496110_0142705 3300048913 Bacteria 2165
534 Ga0496112_0009409 3300048915 Bacteria 8801
535 Ga0496113_0002188 3300048916 Bacteria 11277
536 Ga0496114_0054689 3300048917 Bacteria 3329
537 Ga0496117_0000085 3300048920 Bacteria 213887
538 Ga0496121_0009721 3300048924 Bacteria 11004
539 Ga0496124_0000479 3300048927 Bacteria 68855
540 Ga0496125_0011683 3300048928 Bacteria 8761
541 Ga0501310_000481 3300049130 Bacteria 3489
542 Ga0501292_005419 3300049515 Bacteria 1778
543 Ga0501294_003779 3300049517 Bacteria 1428
544 Ga0501298_015820 3300049521 Bacteria 1362
545 Ga0501300_002128 3300049523 Bacteria 2950
546 Ga0501032_0044898 3300049569 Bacteria 2990
547 Ga0501033_0286523 3300049570 Bacteria 1162
548 Ga0501034_0137146 3300049571 Bacteria 2427
549 Ga0501034_0210116 3300049571 Bacteria 1902
550 Ga0501034_0283495 3300049571 Bacteria 1596
551 Ga0501037_0019729 3300049573 Bacteria 4974
552 Ga0501038_0035410 3300049574 Bacteria 4383
553 Ga0501039_0080986 3300049575 Bacteria 2527
554 Ga0501040_0005587 3300049576 Bacteria 8132
555 Ga0501041_0083649 3300049577 Bacteria 1967
556 Ga0501041_0084140 3300049577 Bacteria 1961
557 Ga0501042_0014561 3300049578 Bacteria 5371
558 Ga0501043_0000018 3300049579 Bacteria 161101
559 Ga0501046_0000042 3300049580 Bacteria 151850
560 Ga0501046_0144958 3300049580 Bacteria 1794
561 Ga0501047_0000052 3300049581 Bacteria 153448
562 Ga0501047_0151305 3300049581 Bacteria 2196
563 Ga0501048_0000099 3300049582 Bacteria 47309
564 Ga0501048_0014480 3300049582 Bacteria 5839
565 Ga0501068_0103976 3300049584 Bacteria 1762
566 Ga0501069_0035737 3300049585 Bacteria 2738
567 Ga0501069_0039806 3300049585 Bacteria 2597
568 Ga0501071_0002579 3300049587 Bacteria 11061
569 Ga0501071_0023055 3300049587 Bacteria 4344
570 Ga0501072_0001990 3300049588 Bacteria 15222
571 Ga0501072_0138150 3300049588 Bacteria 1943
572 Ga0501073_0104398 3300049589 Bacteria 1967
573 Ga0501074_0431334 3300049590 Bacteria 935
574 Ga0501075_0034141 3300049591 Bacteria 3786
575 Ga0501076_0213548 3300049592 Bacteria 1577
576 Ga0501206_001942 3300049653 Bacteria 2606
577 Ga0501211_001555 3300049658 Bacteria 2457
578 Ga0501222_019752 3300049662 Bacteria 900
579 Ga0501223_012599 3300049663 Bacteria 1690
580 Ga0501236_009277 3300049670 Bacteria 1267
581 Ga0501255_000513 3300049684 Bacteria 2690
582 Ga0501221_000182 3300049704 Bacteria 8808
583 Ga0501225_0014601 3300049705 Bacteria 2192
584 Ga0501229_004084 3300049706 Bacteria 1767
585 Ga0501079_0128825 3300049741 Bacteria 1969
586 Ga0501079_0328242 3300049741 Bacteria 1198
587 Ga0501080_0297810 3300049742 Bacteria 1463
588 Ga0501081_0022246 3300049743 Bacteria 4240
589 Ga0501081_0047762 3300049743 Bacteria 2945
590 Ga0501083_0001215 3300049744 Bacteria 17446
591 Ga0501265_002363 3300049762 Bacteria 2142
592 Ga0501267_000425 3300049764 Bacteria 3246
593 Ga0501272_000204 3300049769 Bacteria 4832
594 Ga0501035_0076294 3300049822 Bacteria 2964
595 Ga0501035_0132382 3300049822 Bacteria 2173
596 Ga0501035_0177031 3300049822 Bacteria 1839
597 Ga0501035_0351317 3300049822 Bacteria 1233
598 Ga0501044_0018909 3300049823 Bacteria 7375
599 Ga0501045_0007930 3300049824 Bacteria 7393
600 Ga0501045_0008070 3300049824 Bacteria 7334
601 Ga0501045_0086493 3300049824 Bacteria 2314
602 nmdc:mga03683_149056_c1 3300050489 Bacteria 1055
603 nmdc:mga03683_75299_c1 3300050489 Bacteria 1449
604 nmdc:mga03n38_170852_c1 3300050490 Bacteria 1107
605 nmdc:mga03n38_229110_c1 3300050490 Bacteria 973
606 nmdc:mga03n38_58321_c1 3300050490 Bacteria 1749
607 nmdc:mga00v17_106768_c1 3300050491 Bacteria 1773
608 nmdc:mga00v17_21453_c1 3300050491 Bacteria 3713
609 nmdc:mga0k408_10992_c1 3300050493 Bacteria 4914
610 nmdc:mga0k408_12914_c1 3300050493 Bacteria 4574
611 nmdc:mga0k408_161578_c1 3300050493 Bacteria 1335
612 nmdc:mga0k408_2030_c1 3300050493 Bacteria 10833
613 nmdc:mga0k408_213385_c1 3300050493 Bacteria 1153
614 nmdc:mga0k408_2319_c1 3300050493 Bacteria 10128
615 nmdc:mga0k408_47951_c1 3300050493 Bacteria 2470
616 nmdc:mga06z11_26014_c1 3300050494 Bacteria 2781
617 nmdc:mga06z11_42242_c1 3300050494 Bacteria 2286
618 nmdc:mga06z11_58222_c1 3300050494 Bacteria 2004
619 nmdc:mga04h51_38198_c1 3300050495 Bacteria 1553
620 nmdc:mga07m45_104485_c1 3300050496 Bacteria 1629
621 nmdc:mga07m45_1074_c1 3300050496 Bacteria 12178
622 nmdc:mga07m45_360385_c1 3300050496 Bacteria 845
623 nmdc:mga07m45_50399_c1 3300050496 Bacteria 2346
624 nmdc:mga07m45_58316_c1 3300050496 Bacteria 2184
625 nmdc:mga05p37_519181_c1 3300050507 Bacteria 1363
626 nmdc:mga05p37_81267_c1 3300050507 Bacteria 3992
627 nmdc:mga09592_1681_c1 3300050508 Bacteria 17836
628 nmdc:mga09592_297736_c1 3300050508 Bacteria 1399
629 nmdc:mga09592_366346_c1 3300050508 Bacteria 1246
630 nmdc:mga0qj67_30455_c1 3300050509 Bacteria 4201
631 nmdc:mga06r32_124540_c1 3300050510 Bacteria 1781
632 nmdc:mga08y16_216578_c1 3300050511 Bacteria 1983
633 nmdc:mga08y16_91584_c1 3300050511 Bacteria 3168
634 nmdc:mga0n895_2719_c1 3300050512 Bacteria 13950
635 nmdc:mga0rr50_40917_c1 3300050513 Bacteria 3372
636 nmdc:mga0a205_1062_c1 3300050515 Bacteria 22864
637 Ga0500578_0000327 3300053086 Bacteria 57988
638 Ga0500644_0046335 3300053088 Bacteria 1469
639 Ga0500644_0093150 3300053088 Bacteria 1132
640 Ga0500646_0006060 3300053090 Bacteria 3067
641 Ga0500647_0029466 3300053091 Bacteria 2604
642 Ga0500583_0011347 3300053092 Bacteria 3353
643 Ga0500651_0013545 3300053093 Bacteria 4971
644 Ga0500566_0083496 3300053094 Bacteria 1774
645 Ga0500562_075914 3300053108 Bacteria 908
646 Ga0500593_000148 3300053117 Bacteria 28026
647 Ga0500593_000543 3300053117 Bacteria 14648
648 Ga0500594_0010790 3300053118 Bacteria 2124
649 Ga0500595_000008 3300053119 Bacteria 284388
650 Ga0500608_009592 3300053122 Bacteria 4118
651 Ga0500614_015044 3300053123 Bacteria 1722
652 Ga0500628_001869 3300053129 Bacteria 3551
653 Ga0500642_0002001 3300053130 Bacteria 5917
654 Ga0500642_0034312 3300053130 Bacteria 2146
655 Ga0500652_001201 3300053131 Bacteria 8259
656 Ga0500652_013883 3300053131 Bacteria 2865
657 Ga0500658_0015780 3300053134 Bacteria 2809
658 Ga0500658_0089174 3300053134 Bacteria 1331
659 Ga0500559_0000252 3300053136 Bacteria 42525
660 Ga0500568_0006974 3300053139 Bacteria 5597
661 Ga0500590_002538 3300053148 Bacteria 8146
662 Ga0500622_0000300 3300053156 Bacteria 50701
663 Ga0500622_0000695 3300053156 Bacteria 29628
664 Ga0500622_0009907 3300053156 Bacteria 5258
665 Ga0500636_0017380 3300053177 Bacteria 4248
666 Ga0500570_060144 3300053724 Bacteria 1845
667 Ga0500645_007175 3300053730 Bacteria 3910
668 Ga0500587_006074 3300053739 Bacteria 1613
669 Ga0500587_006109 3300053739 Bacteria 1608
670 Ga0501084_0108442 3300054114 Bacteria 2333
671 Ga0501082_0158607 3300060353 Bacteria 1966
672 Ga0501082_0344199 3300060353 Bacteria 1299
673 Ga0501082_0379582 3300060353 Bacteria 1233
674 Ga0466962_0010965 3300061719 Bacteria 4361
675 Ga0530510_0129970 3300061734 Bacteria 1852
676 Ga0530510_0236276 3300061734 Bacteria 1360

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0011760 Ga0395905_0011760_392_1060 222
2 3300049574 Ga0501038_0035410 Ga0501038_0035410_3668_4369 226
3 3300005719 Ga0068861_100046976 Ga0068861_1000469762 231
4 3300006844 Ga0075428_100014646 Ga0075428_1000146465 231
5 3300009094 Ga0111539_10007187 Ga0111539_100071879 231
6 3300009147 Ga0114129_10043073 Ga0114129_100430738 231
7 3300014326 Ga0157380_10035763 Ga0157380_100357636 231
8 3300050507 nmdc:mga05p37_519181_c1 nmdc:mga05p37_519181_c1_447_1163 231
9 3300049517 Ga0501294_003779 Ga0501294_003779_388_1128 234
10 3300005457 Ga0070662_100011436 Ga0070662_1000114362 239
11 3300025933 Ga0207706_10001423 Ga0207706_100014239 239
12 3300021361 Ga0213872_10018486 Ga0213872_100184863 241
13 3300039447 Ga0436361_0872778 Ga0436361_0872778_1502_2260 241
14 3300021361 Ga0213872_10000066 Ga0213872_1000006669 242
15 3300039447 Ga0436361_1125703 Ga0436361_1125703_34612_35379 242
16 3300044658 Ga0466972_0000314 Ga0466972_0000314_24492_25259 243
17 3300044683 Ga0466965_0101691 Ga0466965_0101691_679_1446 243
18 3300044693 Ga0466961_0258706 Ga0466961_0258706_160_927 243
19 3300014325 Ga0163163_10258308 Ga0163163_102583083 244
20 3300036401 Ga0373937_0031785 Ga0373937_0031785_3732_4511 244
21 3300037471 Ga0395905_0037629 Ga0395905_0037629_72_833 244
22 3300006048 Ga0075363_100009419 Ga0075363_1000094193 246
23 3300006195 Ga0075366_10010218 Ga0075366_100102185 246
24 3300006353 Ga0075370_10018093 Ga0075370_100180935 246
25 3300025931 Ga0207644_10013979 Ga0207644_100139796 246
26 3300026121 Ga0207683_10007662 Ga0207683_1000766211 246
27 3300045051 Ga0451576_0003213 Ga0451576_0003213_1366_2130 246
28 3300050493 nmdc:mga0k408_12914_c1 nmdc:mga0k408_12914_c1_2411_3184 246
29 3300050496 nmdc:mga07m45_104485_c1 nmdc:mga07m45_104485_c1_22_795 246
30 3300005355 Ga0070671_100001946 Ga0070671_1000019466 247
31 3300031852 Ga0307410_10159421 Ga0307410_101594212 247
32 3300044683 Ga0466965_0027239 Ga0466965_0027239_426_1199 247
33 3300044901 Ga0466960_0043092 Ga0466960_0043092_432_1205 247
34 3300005364 Ga0070673_100296809 Ga0070673_1002968092 248
35 3300006852 Ga0075433_10005691 Ga0075433_100056915 248
36 3300006871 Ga0075434_100000099 Ga0075434_10000009929 248
37 3300007076 Ga0075435_100010581 Ga0075435_1000105818 248
38 3300009094 Ga0111539_10049751 Ga0111539_100497516 248
39 3300014326 Ga0157380_10031068 Ga0157380_100310684 248
40 3300014745 Ga0157377_10270033 Ga0157377_102700332 248
41 3300025926 Ga0207659_10014169 Ga0207659_100141693 248
42 3300025938 Ga0207704_10495579 Ga0207704_104955791 248
43 3300026089 Ga0207648_10091781 Ga0207648_100917812 248
44 3300027717 Ga0209998_10003959 Ga0209998_100039595 248
45 3300031548 Ga0307408_100087568 Ga0307408_1000875684 248
46 3300031731 Ga0307405_10021875 Ga0307405_100218753 248
47 3300031824 Ga0307413_10026147 Ga0307413_100261475 248
48 3300031901 Ga0307406_10046009 Ga0307406_100460092 248
49 3300032002 Ga0307416_100002539 Ga0307416_1000025398 248
50 3300032004 Ga0307414_10032558 Ga0307414_100325583 248
51 3300032005 Ga0307411_10112936 Ga0307411_101129362 248
52 3300032126 Ga0307415_100016027 Ga0307415_1000160272 248
53 3300041408 Ga0439453_0023123 Ga0439453_0023123_78_851 248
54 3300041410 Ga0439461_0012680 Ga0439461_0012680_645_1412 248
55 3300041999 Ga0439433_0029112 Ga0439433_0029112_195_962 248
56 3300042001 Ga0439441_000681 Ga0439441_000681_2690_3457 248
57 3300042003 Ga0439443_004215 Ga0439443_004215_867_1634 248
58 3300042122 Ga0450920_001174 Ga0450920_001174_153_920 248
59 3300042125 Ga0450923_003799 Ga0450923_003799_47_814 248
60 3300042131 Ga0450894_002628 Ga0450894_002628_1052_1819 248
61 3300042133 Ga0450896_000143 Ga0450896_000143_778_1545 248
62 3300042134 Ga0450898_005537 Ga0450898_005537_921_1688 248
63 3300042147 Ga0450910_002657 Ga0450910_002657_1422_2189 248
64 3300042156 Ga0439446_0001410 Ga0439446_0001410_4612_5379 248
65 3300042156 Ga0439446_0025654 Ga0439446_0025654_221_988 248
66 3300042156 Ga0439446_0032700 Ga0439446_0032700_200_967 248
67 3300042156 Ga0439446_0032744 Ga0439446_0032744_389_1156 248
68 3300042184 Ga0450908_013244 Ga0450908_013244_678_1445 248
69 3300042435 Ga0439434_0005027 Ga0439434_0005027_2606_3373 248
70 3300042436 Ga0439435_0001374 Ga0439435_0001374_2893_3660 248
71 3300042437 Ga0439444_0000509 Ga0439444_0000509_1022_1789 248
72 3300042461 Ga0439460_0002310 Ga0439460_0002310_1160_1927 248
73 3300048920 Ga0496117_0000085 Ga0496117_0000085_163308_164078 248
74 3300049569 Ga0501032_0044898 Ga0501032_0044898_1175_1942 248
75 3300049570 Ga0501033_0286523 Ga0501033_0286523_98_865 248
76 3300049571 Ga0501034_0210116 Ga0501034_0210116_1063_1830 248
77 3300049573 Ga0501037_0019729 Ga0501037_0019729_1136_1903 248
78 3300049575 Ga0501039_0080986 Ga0501039_0080986_477_1244 248
79 3300049576 Ga0501040_0005587 Ga0501040_0005587_3697_4464 248
80 3300049577 Ga0501041_0083649 Ga0501041_0083649_398_1165 248
81 3300049577 Ga0501041_0084140 Ga0501041_0084140_1093_1875 248
82 3300049578 Ga0501042_0014561 Ga0501042_0014561_3938_4705 248
83 3300049582 Ga0501048_0014480 Ga0501048_0014480_4716_5483 248
84 3300049584 Ga0501068_0103976 Ga0501068_0103976_497_1264 248
85 3300049585 Ga0501069_0039806 Ga0501069_0039806_1126_1944 248
86 3300049587 Ga0501071_0002579 Ga0501071_0002579_4124_4891 248
87 3300049587 Ga0501071_0023055 Ga0501071_0023055_269_1051 248
88 3300049588 Ga0501072_0001990 Ga0501072_0001990_12734_13501 248
89 3300049588 Ga0501072_0138150 Ga0501072_0138150_1140_1922 248
90 3300049589 Ga0501073_0104398 Ga0501073_0104398_513_1280 248
91 3300049590 Ga0501074_0431334 Ga0501074_0431334_22_789 248
92 3300049591 Ga0501075_0034141 Ga0501075_0034141_1888_2655 248
93 3300049592 Ga0501076_0213548 Ga0501076_0213548_240_1022 248
94 3300049741 Ga0501079_0128825 Ga0501079_0128825_238_1005 248
95 3300049742 Ga0501080_0297810 Ga0501080_0297810_348_1115 248
96 3300049743 Ga0501081_0022246 Ga0501081_0022246_1130_1897 248
97 3300049743 Ga0501081_0047762 Ga0501081_0047762_1055_1837 248
98 3300049744 Ga0501083_0001215 Ga0501083_0001215_11831_12649 248
99 3300049822 Ga0501035_0177031 Ga0501035_0177031_167_934 248
100 3300049824 Ga0501045_0008070 Ga0501045_0008070_319_1086 248
101 3300049824 Ga0501045_0086493 Ga0501045_0086493_982_1749 248
102 3300050511 nmdc:mga08y16_91584_c1 nmdc:mga08y16_91584_c1_1417_2184 248
103 3300050512 nmdc:mga0n895_2719_c1 nmdc:mga0n895_2719_c1_2782_3549 248
104 3300050513 nmdc:mga0rr50_40917_c1 nmdc:mga0rr50_40917_c1_238_1005 248
105 3300050515 nmdc:mga0a205_1062_c1 nmdc:mga0a205_1062_c1_18305_19072 248
106 3300054114 Ga0501084_0108442 Ga0501084_0108442_385_1152 248
107 3300060353 Ga0501082_0344199 Ga0501082_0344199_336_1103 248
108 3300061734 Ga0530510_0236276 Ga0530510_0236276_527_1294 248
109 iso_pu_bacteria 2585428062 2587758161 248
110 3300021361 Ga0213872_10000208 Ga0213872_1000020832 249
111 3300031239 Ga0265328_10021819 Ga0265328_100218193 249
112 3300031251 Ga0265327_10000020 Ga0265327_10000020161 249
113 3300039447 Ga0436361_0074986 Ga0436361_0074986_11013_11786 249
114 3300053119 Ga0500595_000008 Ga0500595_000008_249626_250462 249
115 iso_pu_bacteria 2881101125 2881104447 249
116 iso_pu_bacteria 2974320154 2974321536 249
117 3300003759 Ga0055525_1000056 Ga0055525_100005673 250
118 3300005338 Ga0068868_100078694 Ga0068868_1000786941 250
119 3300005548 Ga0070665_100007442 Ga0070665_1000074422 250
120 3300005618 Ga0068864_100029189 Ga0068864_1000291893 250
121 3300005841 Ga0068863_100025738 Ga0068863_1000257385 250
122 3300009098 Ga0105245_10062486 Ga0105245_100624863 250
123 3300013297 Ga0157378_10233668 Ga0157378_102336682 250
124 3300013306 Ga0163162_10299748 Ga0163162_102997482 250
125 3300014968 Ga0157379_10048254 Ga0157379_100482542 250
126 3300025226 Ga0209674_105588 Ga0209674_1055882 250
127 3300025230 Ga0209563_100014 Ga0209563_100014121 250
128 3300025925 Ga0207650_10333308 Ga0207650_103333082 250
129 3300025927 Ga0207687_10336154 Ga0207687_103361541 250
130 3300026023 Ga0207677_10019618 Ga0207677_100196182 250
131 3300026035 Ga0207703_10746877 Ga0207703_107468771 250
132 3300026088 Ga0207641_10030294 Ga0207641_100302945 250
133 3300026095 Ga0207676_10205964 Ga0207676_102059643 250
134 3300028379 Ga0268266_10100631 Ga0268266_101006313 250
135 iso_pu_bacteria 2585428058 2587732505 250
136 iso_pu_bacteria 2588253510 2588291890 250
137 iso_pu_bacteria 2643221592 2643971456 250
138 iso_pu_bacteria 2643221625 2644140991 250
139 iso_pu_bacteria 2643221648 2644276783 250
140 iso_pu_bacteria 2643221654 2644303720 250
141 iso_pu_bacteria 2643221660 2644339724 250
142 iso_pu_bacteria 2842718218 2842720732 250
143 3300005328 Ga0070676_10368599 Ga0070676_103685992 251
144 3300006847 Ga0075431_100226001 Ga0075431_1002260012 251
145 3300006880 Ga0075429_100305696 Ga0075429_1003056962 251
146 3300026089 Ga0207648_10369569 Ga0207648_103695692 251
147 3300031731 Ga0307405_10147142 Ga0307405_101471422 251
148 3300031901 Ga0307406_10168643 Ga0307406_101686432 251
149 3300031911 Ga0307412_10220479 Ga0307412_102204791 251
150 3300035116 Ga0373945_0110880 Ga0373945_0110880_130_969 251
151 3300035725 Ga0373947_0026980 Ga0373947_0026980_2151_2990 251
152 3300042876 Ga0451577_0049307 Ga0451577_0049307_304_1059 251
153 3300045051 Ga0451576_0658339 Ga0451576_0658339_25_780 251
154 3300046460 Ga0495638_0043850 Ga0495638_0043850_1090_1920 251
155 3300046517 Ga0495630_0503508 Ga0495630_0503508_41_880 251
156 3300047319 Ga0495674_0025097 Ga0495674_0025097_3511_4350 251
157 3300049579 Ga0501043_0000018 Ga0501043_0000018_97227_97982 251
158 3300049580 Ga0501046_0000042 Ga0501046_0000042_97227_97982 251
159 3300049581 Ga0501047_0000052 Ga0501047_0000052_55467_56222 251
160 3300049582 Ga0501048_0000099 Ga0501048_0000099_24441_25196 251
161 3300049824 Ga0501045_0007930 Ga0501045_0007930_3385_4140 251
162 3300050508 nmdc:mga09592_297736_c1 nmdc:mga09592_297736_c1_165_941 251
163 3300050508 nmdc:mga09592_366346_c1 nmdc:mga09592_366346_c1_230_985 251
164 3300050510 nmdc:mga06r32_124540_c1 nmdc:mga06r32_124540_c1_494_1270 251
165 3300053122 Ga0500608_009592 Ga0500608_009592_1849_2679 251
166 3300053156 Ga0500622_0000695 Ga0500622_0000695_14245_15075 251
167 iso_pu_bacteria 2585428057 2587728536 251
168 3300005843 Ga0068860_100052637 Ga0068860_1000526375 252
169 3300006177 Ga0075362_10094765 Ga0075362_100947652 252
170 3300006178 Ga0075367_10134981 Ga0075367_101349812 252
171 3300006195 Ga0075366_10038492 Ga0075366_100384922 252
172 3300009545 Ga0105237_10000372 Ga0105237_1000037252 252
173 3300009545 Ga0105237_10029616 Ga0105237_100296163 252
174 3300010375 Ga0105239_10000623 Ga0105239_1000062319 252
175 3300025913 Ga0207695_10006330 Ga0207695_100063305 252
176 3300025914 Ga0207671_10002794 Ga0207671_1000279411 252
177 3300026088 Ga0207641_10323864 Ga0207641_103238643 252
178 3300027866 Ga0209813_10101128 Ga0209813_101011282 252
179 3300028379 Ga0268266_10607650 Ga0268266_106076502 252
180 3300028381 Ga0268264_10190110 Ga0268264_101901102 252
181 3300028573 Ga0265334_10024041 Ga0265334_100240412 252
182 3300028666 Ga0265336_10056708 Ga0265336_100567082 252
183 3300028786 Ga0307517_10021062 Ga0307517_100210627 252
184 3300028794 Ga0307515_10001649 Ga0307515_1000164922 252
185 3300030522 Ga0307512_10022820 Ga0307512_100228204 252
186 3300031235 Ga0265330_10000037 Ga0265330_1000003765 252
187 3300031238 Ga0265332_10000008 Ga0265332_1000000847 252
188 3300031241 Ga0265325_10009265 Ga0265325_100092653 252
189 3300031247 Ga0265340_10012082 Ga0265340_100120823 252
190 3300031344 Ga0265316_10193217 Ga0265316_101932172 252
191 3300031507 Ga0307509_10074015 Ga0307509_100740155 252
192 3300031616 Ga0307508_10001439 Ga0307508_100014391 252
193 3300031616 Ga0307508_10003842 Ga0307508_100038425 252
194 3300031649 Ga0307514_10059697 Ga0307514_100596972 252
195 3300031711 Ga0265314_10000065 Ga0265314_1000006599 252
196 3300031711 Ga0265314_10095785 Ga0265314_100957853 252
197 3300031730 Ga0307516_10001769 Ga0307516_1000176925 252
198 3300033179 Ga0307507_10031105 Ga0307507_100311054 252
199 3300033180 Ga0307510_10001714 Ga0307510_1000171412 252
200 3300037418 Ga0395900_0317175 Ga0395900_0317175_749_1507 252
201 3300037466 Ga0395898_0290257 Ga0395898_0290257_766_1524 252
202 3300041511 Ga0451855_1521696 Ga0451855_1521696_172_930 252
203 3300041512 Ga0451853_3999752 Ga0451853_3999752_70_828 252
204 3300044656 Ga0466969_0000186 Ga0466969_0000186_15431_16189 252
205 3300044656 Ga0466969_0032135 Ga0466969_0032135_1324_2082 252
206 3300044683 Ga0466965_0077393 Ga0466965_0077393_544_1302 252
207 3300045051 Ga0451576_0110943 Ga0451576_0110943_823_1611 252
208 3300046471 Ga0495650_0004224 Ga0495650_0004224_1930_2688 252
209 3300046512 Ga0495610_0036251 Ga0495610_0036251_1419_2177 252
210 3300046515 Ga0495620_0069865 Ga0495620_0069865_181_939 252
211 3300046522 Ga0495643_0033357 Ga0495643_0033357_1984_2742 252
212 3300048924 Ga0496121_0009721 Ga0496121_0009721_5732_6490 252
213 3300048927 Ga0496124_0000479 Ga0496124_0000479_63196_63954 252
214 3300048928 Ga0496125_0011683 Ga0496125_0011683_2334_3092 252
215 3300049515 Ga0501292_005419 Ga0501292_005419_239_997 252
216 3300049521 Ga0501298_015820 Ga0501298_015820_17_775 252
217 3300049653 Ga0501206_001942 Ga0501206_001942_1272_2030 252
218 3300049762 Ga0501265_002363 Ga0501265_002363_638_1396 252
219 3300050489 nmdc:mga03683_75299_c1 nmdc:mga03683_75299_c1_489_1247 252
220 3300050493 nmdc:mga0k408_213385_c1 nmdc:mga0k408_213385_c1_256_1014 252
221 3300050494 nmdc:mga06z11_26014_c1 nmdc:mga06z11_26014_c1_1781_2539 252
222 3300050496 nmdc:mga07m45_360385_c1 nmdc:mga07m45_360385_c1_40_798 252
223 3300050496 nmdc:mga07m45_50399_c1 nmdc:mga07m45_50399_c1_1309_2067 252
224 3300053091 Ga0500647_0029466 Ga0500647_0029466_1467_2225 252
225 3300053092 Ga0500583_0011347 Ga0500583_0011347_608_1366 252
226 3300053094 Ga0500566_0083496 Ga0500566_0083496_481_1239 252
227 3300053131 Ga0500652_013883 Ga0500652_013883_121_879 252
228 3300053134 Ga0500658_0015780 Ga0500658_0015780_605_1363 252
229 3300053739 Ga0500587_006074 Ga0500587_006074_300_1058 252
230 iso_pu_bacteria 2643221544 2643741777 252
231 iso_pu_bacteria 2643221639 2644220324 252
232 iso_pu_bacteria 2738541337 2739053515 252
233 iso_pu_bacteria 2928115317 2928118903 252
234 3300003794 Ga0055531_10001635 Ga0055531_100016355 253
235 3300003794 Ga0055531_10007861 Ga0055531_100078613 253
236 3300005578 Ga0068854_100272447 Ga0068854_1002724472 253
237 3300005618 Ga0068864_100014887 Ga0068864_1000148873 253
238 3300006051 Ga0075364_10026448 Ga0075364_100264484 253
239 3300006846 Ga0075430_100043881 Ga0075430_1000438813 253
240 3300006880 Ga0075429_100010563 Ga0075429_1000105634 253
241 3300009147 Ga0114129_10101901 Ga0114129_101019012 253
242 3300009147 Ga0114129_10466474 Ga0114129_104664741 253
243 3300009148 Ga0105243_10243143 Ga0105243_102431432 253
244 3300009177 Ga0105248_10000345 Ga0105248_1000034533 253
245 3300014968 Ga0157379_10769547 Ga0157379_107695471 253
246 3300025273 Ga0209673_1015184 Ga0209673_10151842 253
247 3300025303 Ga0209051_1000351 Ga0209051_10003515 253
248 3300025303 Ga0209051_1006113 Ga0209051_10061133 253
249 3300025304 Ga0209257_1000015 Ga0209257_1000015247 253
250 3300025304 Ga0209257_1000016 Ga0209257_1000016417 253
251 3300025931 Ga0207644_10108505 Ga0207644_101085052 253
252 3300026095 Ga0207676_10024500 Ga0207676_100245002 253
253 3300027360 Ga0209969_1000326 Ga0209969_10003264 253
254 3300027364 Ga0209967_1000410 Ga0209967_10004104 253
255 3300027462 Ga0210000_1000765 Ga0210000_10007654 253
256 3300027682 Ga0209971_1010877 Ga0209971_10108772 253
257 3300027876 Ga0209974_10001306 Ga0209974_100013063 253
258 3300028786 Ga0307517_10059532 Ga0307517_100595323 253
259 3300031251 Ga0265327_10002065 Ga0265327_1000206513 253
260 3300031548 Ga0307408_100172785 Ga0307408_1001727851 253
261 3300031548 Ga0307408_100193846 Ga0307408_1001938462 253
262 3300031548 Ga0307408_100298983 Ga0307408_1002989832 253
263 3300031911 Ga0307412_10091368 Ga0307412_100913682 253
264 3300031911 Ga0307412_10511887 Ga0307412_105118871 253
265 3300032002 Ga0307416_100465706 Ga0307416_1004657062 253
266 3300032005 Ga0307411_10119709 Ga0307411_101197093 253
267 3300042005 Ga0439448_0031445 Ga0439448_0031445_784_1545 253
268 3300042461 Ga0439460_0048531 Ga0439460_0048531_284_1045 253
269 3300044683 Ga0466965_0036893 Ga0466965_0036893_226_987 253
270 3300044684 Ga0466966_0046318 Ga0466966_0046318_319_1080 253
271 3300044693 Ga0466961_0081273 Ga0466961_0081273_1201_1962 253
272 3300044706 Ga0466964_0024355 Ga0466964_0024355_1239_2000 253
273 3300044719 Ga0466971_0088634 Ga0466971_0088634_243_1004 253
274 3300044842 Ga0466957_0018901 Ga0466957_0018901_1957_2718 253
275 3300045049 Ga0466959_0006956 Ga0466959_0006956_391_1152 253
276 3300045051 Ga0451576_0776535 Ga0451576_0776535_126_893 253
277 3300046507 Ga0495606_0170761 Ga0495606_0170761_234_995 253
278 3300047472 Ga0495686_0034645 Ga0495686_0034645_1227_1988 253
279 3300048907 Ga0496104_0047632 Ga0496104_0047632_846_1607 253
280 3300048908 Ga0496105_0065262 Ga0496105_0065262_346_1107 253
281 3300048909 Ga0496106_0128729 Ga0496106_0128729_731_1492 253
282 3300048911 Ga0496108_0052367 Ga0496108_0052367_1011_1772 253
283 3300048913 Ga0496110_0142705 Ga0496110_0142705_952_1740 253
284 3300048915 Ga0496112_0009409 Ga0496112_0009409_7598_8359 253
285 3300048916 Ga0496113_0002188 Ga0496113_0002188_7989_8750 253
286 3300049130 Ga0501310_000481 Ga0501310_000481_1072_1869 253
287 3300049523 Ga0501300_002128 Ga0501300_002128_1336_2133 253
288 3300049571 Ga0501034_0137146 Ga0501034_0137146_506_1267 253
289 3300049581 Ga0501047_0151305 Ga0501047_0151305_1179_1940 253
290 3300049658 Ga0501211_001555 Ga0501211_001555_74_871 253
291 3300049663 Ga0501223_012599 Ga0501223_012599_94_891 253
292 3300049670 Ga0501236_009277 Ga0501236_009277_441_1238 253
293 3300049684 Ga0501255_000513 Ga0501255_000513_983_1780 253
294 3300049704 Ga0501221_000182 Ga0501221_000182_3622_4419 253
295 3300049705 Ga0501225_0014601 Ga0501225_0014601_57_854 253
296 3300049706 Ga0501229_004084 Ga0501229_004084_316_1113 253
297 3300049764 Ga0501267_000425 Ga0501267_000425_1279_2076 253
298 3300049769 Ga0501272_000204 Ga0501272_000204_3072_3869 253
299 3300049822 Ga0501035_0076294 Ga0501035_0076294_2059_2820 253
300 3300049822 Ga0501035_0132382 Ga0501035_0132382_368_1132 253
301 3300049822 Ga0501035_0351317 Ga0501035_0351317_454_1215 253
302 3300049823 Ga0501044_0018909 Ga0501044_0018909_4287_5048 253
303 3300050491 nmdc:mga00v17_21453_c1 nmdc:mga00v17_21453_c1_1071_1832 253
304 3300050493 nmdc:mga0k408_2030_c1 nmdc:mga0k408_2030_c1_3486_4250 253
305 3300050507 nmdc:mga05p37_81267_c1 nmdc:mga05p37_81267_c1_2613_3374 253
306 3300050508 nmdc:mga09592_1681_c1 nmdc:mga09592_1681_c1_2376_3137 253
307 3300050509 nmdc:mga0qj67_30455_c1 nmdc:mga0qj67_30455_c1_1330_2091 253
308 3300053108 Ga0500562_075914 Ga0500562_075914_115_876 253
309 3300053730 Ga0500645_007175 Ga0500645_007175_1210_1971 253
310 3300061719 Ga0466962_0010965 Ga0466962_0010965_86_847 253
311 iso_pu_bacteria 2643221585 2643935048 253
312 iso_pu_bacteria 2643221609 2644058095 253
313 iso_pu_bacteria 2643221611 2644073131 253
314 iso_pu_bacteria 2643221656 2644316535 253
315 3300003215 JGI25153J46596_10002052 JGI25153J46596_100020523 254
316 3300003215 JGI25153J46596_10003533 JGI25153J46596_100035335 254
317 3300003791 Ga0055530_10017939 Ga0055530_100179393 254
318 3300005262 Ga0065165_1003497 Ga0065165_10034977 254
319 3300005328 Ga0070676_10011204 Ga0070676_100112043 254
320 3300005331 Ga0070670_100089314 Ga0070670_1000893142 254
321 3300005334 Ga0068869_100007433 Ga0068869_1000074334 254
322 3300005353 Ga0070669_100210306 Ga0070669_1002103062 254
323 3300005355 Ga0070671_100016402 Ga0070671_1000164023 254
324 3300005364 Ga0070673_100046472 Ga0070673_1000464722 254
325 3300005455 Ga0070663_100000177 Ga0070663_10000017714 254
326 3300005456 Ga0070678_100083161 Ga0070678_1000831613 254
327 3300005457 Ga0070662_100043764 Ga0070662_1000437643 254
328 3300005459 Ga0068867_100002539 Ga0068867_1000025397 254
329 3300005543 Ga0070672_100089458 Ga0070672_1000894584 254
330 3300005577 Ga0068857_100322260 Ga0068857_1003222602 254
331 3300005617 Ga0068859_100394865 Ga0068859_1003948651 254
332 3300006038 Ga0075365_10005601 Ga0075365_100056012 254
333 3300006177 Ga0075362_10129575 Ga0075362_101295752 254
334 3300006178 Ga0075367_10058767 Ga0075367_100587671 254
335 3300006195 Ga0075366_10027638 Ga0075366_100276383 254
336 3300006195 Ga0075366_10037610 Ga0075366_100376105 254
337 3300006195 Ga0075366_10048103 Ga0075366_100481032 254
338 3300006353 Ga0075370_10002305 Ga0075370_100023055 254
339 3300006881 Ga0068865_100222175 Ga0068865_1002221752 254
340 3300006931 Ga0097620_100394849 Ga0097620_1003948491 254
341 3300013308 Ga0157375_10082583 Ga0157375_100825833 254
342 3300014497 Ga0182008_10052156 Ga0182008_100521563 254
343 3300025258 Ga0209129_1019880 Ga0209129_10198802 254
344 3300025297 Ga0209758_1000969 Ga0209758_100096925 254
345 3300025298 Ga0209050_1000202 Ga0209050_100020241 254
346 3300025303 Ga0209051_1018306 Ga0209051_10183062 254
347 3300025908 Ga0207643_10163511 Ga0207643_101635112 254
348 3300025923 Ga0207681_10233082 Ga0207681_102330822 254
349 3300025925 Ga0207650_10088606 Ga0207650_100886064 254
350 3300025931 Ga0207644_10015446 Ga0207644_100154463 254
351 3300025933 Ga0207706_10108523 Ga0207706_101085232 254
352 3300025938 Ga0207704_10208527 Ga0207704_102085271 254
353 3300025940 Ga0207691_10048851 Ga0207691_100488512 254
354 3300025942 Ga0207689_10009834 Ga0207689_100098343 254
355 3300025945 Ga0207679_10134632 Ga0207679_101346323 254
356 3300026067 Ga0207678_10000060 Ga0207678_1000006022 254
357 3300026116 Ga0207674_10154411 Ga0207674_101544113 254
358 3300026118 Ga0207675_100419214 Ga0207675_1004192142 254
359 3300026121 Ga0207683_10081877 Ga0207683_100818774 254
360 3300026121 Ga0207683_10497374 Ga0207683_104973741 254
361 3300028794 Ga0307515_10000058 Ga0307515_10000058166 254
362 3300028794 Ga0307515_10001320 Ga0307515_1000132039 254
363 3300028794 Ga0307515_10042404 Ga0307515_100424045 254
364 3300028794 Ga0307515_10147242 Ga0307515_101472421 254
365 3300031456 Ga0307513_10037189 Ga0307513_100371893 254
366 3300031507 Ga0307509_10054727 Ga0307509_100547273 254
367 3300031548 Ga0307408_100000006 Ga0307408_100000006253 254
368 3300031616 Ga0307508_10000291 Ga0307508_1000029140 254
369 3300031711 Ga0265314_10084971 Ga0265314_100849712 254
370 3300031730 Ga0307516_10004526 Ga0307516_1000452610 254
371 3300031733 Ga0316577_10215725 Ga0316577_102157252 254
372 3300032002 Ga0307416_100670161 Ga0307416_1006701612 254
373 3300033180 Ga0307510_10254897 Ga0307510_102548972 254
374 3300037068 Ga0373925_0088108 Ga0373925_0088108_337_1101 254
375 3300037418 Ga0395900_0000692 Ga0395900_0000692_34362_35126 254
376 3300037466 Ga0395898_0000990 Ga0395898_0000990_9847_10611 254
377 3300041413 Ga0439465_0010920 Ga0439465_0010920_377_1144 254
378 3300041443 Ga0451789_0041207 Ga0451789_0041207_2253_3017 254
379 3300041452 Ga0451793_1186227 Ga0451793_1186227_1128_1892 254
380 3300041453 Ga0451797_0112310 Ga0451797_0112310_147_911 254
381 3300041456 Ga0451795_0100487 Ga0451795_0100487_661_1425 254
382 3300041458 Ga0451798_0473492 Ga0451798_0473492_520_1284 254
383 3300041459 Ga0451800_1357952 Ga0451800_1357952_2613_3377 254
384 3300041460 Ga0451802_1279546 Ga0451802_1279546_782_1546 254
385 3300041463 Ga0451804_0262210 Ga0451804_0262210_207_971 254
386 3300041486 Ga0451807_2694204 Ga0451807_2694204_1434_2198 254
387 3300042435 Ga0439434_0039296 Ga0439434_0039296_483_1247 254
388 3300042532 Ga0450893_0014529 Ga0450893_0014529_172_939 254
389 3300044683 Ga0466965_0040210 Ga0466965_0040210_115_879 254
390 3300044683 Ga0466965_0235215 Ga0466965_0235215_155_919 254
391 3300046460 Ga0495638_0292799 Ga0495638_0292799_12_776 254
392 3300046519 Ga0495632_0002824 Ga0495632_0002824_3844_4608 254
393 3300046530 Ga0495654_0000307 Ga0495654_0000307_22095_22874 254
394 3300049585 Ga0501069_0035737 Ga0501069_0035737_88_936 254
395 3300049662 Ga0501222_019752 Ga0501222_019752_95_862 254
396 3300049741 Ga0501079_0328242 Ga0501079_0328242_158_949 254
397 3300050489 nmdc:mga03683_149056_c1 nmdc:mga03683_149056_c1_95_865 254
398 3300050490 nmdc:mga03n38_229110_c1 nmdc:mga03n38_229110_c1_37_801 254
399 3300050493 nmdc:mga0k408_10992_c1 nmdc:mga0k408_10992_c1_2570_3337 254
400 3300050493 nmdc:mga0k408_161578_c1 nmdc:mga0k408_161578_c1_232_1008 254
401 3300050494 nmdc:mga06z11_42242_c1 nmdc:mga06z11_42242_c1_170_949 254
402 3300050494 nmdc:mga06z11_58222_c1 nmdc:mga06z11_58222_c1_721_1485 254
403 3300050496 nmdc:mga07m45_1074_c1 nmdc:mga07m45_1074_c1_4420_5184 254
404 3300053086 Ga0500578_0000327 Ga0500578_0000327_55909_56673 254
405 3300053088 Ga0500644_0093150 Ga0500644_0093150_12_776 254
406 3300053090 Ga0500646_0006060 Ga0500646_0006060_437_1201 254
407 3300053117 Ga0500593_000148 Ga0500593_000148_19814_20587 254
408 3300053117 Ga0500593_000543 Ga0500593_000543_1557_2321 254
409 3300053129 Ga0500628_001869 Ga0500628_001869_836_1600 254
410 3300053130 Ga0500642_0002001 Ga0500642_0002001_2515_3279 254
411 3300053130 Ga0500642_0034312 Ga0500642_0034312_757_1521 254
412 3300053131 Ga0500652_001201 Ga0500652_001201_4461_5225 254
413 3300053134 Ga0500658_0089174 Ga0500658_0089174_357_1121 254
414 3300053139 Ga0500568_0006974 Ga0500568_0006974_4752_5516 254
415 3300053156 Ga0500622_0000300 Ga0500622_0000300_35689_36453 254
416 3300053724 Ga0500570_060144 Ga0500570_060144_252_1016 254
417 3300060353 Ga0501082_0158607 Ga0501082_0158607_1130_1921 254
418 3300060353 Ga0501082_0379582 Ga0501082_0379582_13_861 254
419 3300003322 rootL2_10027772 rootL2_100277726 255
420 3300003322 rootL2_10041726 rootL2_100417262 255
421 3300003323 rootH1_10026256 rootH1_100262562 255
422 3300003775 Ga0055524_1000033 Ga0055524_1000033102 255
423 3300005355 Ga0070671_100161407 Ga0070671_1001614071 255
424 3300005455 Ga0070663_100029061 Ga0070663_1000290615 255
425 3300005457 Ga0070662_100056616 Ga0070662_1000566164 255
426 3300005471 Ga0070698_100131030 Ga0070698_1001310302 255
427 3300005539 Ga0068853_100530173 Ga0068853_1005301732 255
428 3300005577 Ga0068857_100045761 Ga0068857_1000457615 255
429 3300005577 Ga0068857_100233714 Ga0068857_1002337142 255
430 3300005616 Ga0068852_100068114 Ga0068852_1000681144 255
431 3300005843 Ga0068860_100152450 Ga0068860_1001524501 255
432 3300006042 Ga0075368_10066297 Ga0075368_100662972 255
433 3300006048 Ga0075363_100017797 Ga0075363_1000177972 255
434 3300006051 Ga0075364_10147209 Ga0075364_101472093 255
435 3300006177 Ga0075362_10009878 Ga0075362_100098782 255
436 3300006353 Ga0075370_10094514 Ga0075370_100945142 255
437 3300006946 Ga0079104_1000009 Ga0079104_1000009317 255
438 3300009093 Ga0105240_10093898 Ga0105240_100938982 255
439 3300009148 Ga0105243_10097400 Ga0105243_100974002 255
440 3300010375 Ga0105239_10022914 Ga0105239_100229144 255
441 3300025298 Ga0209050_1036703 Ga0209050_10367032 255
442 3300025299 Ga0209256_1000019 Ga0209256_1000019379 255
443 3300025321 Ga0207656_10085542 Ga0207656_100855423 255
444 3300025933 Ga0207706_10092080 Ga0207706_100920803 255
445 3300025935 Ga0207709_10010914 Ga0207709_100109143 255
446 3300025981 Ga0207640_10139728 Ga0207640_101397283 255
447 3300026067 Ga0207678_10044882 Ga0207678_100448822 255
448 3300026116 Ga0207674_10008673 Ga0207674_100086733 255
449 3300026116 Ga0207674_10102163 Ga0207674_101021633 255
450 3300026142 Ga0207698_10029862 Ga0207698_100298623 255
451 3300027111 Ga0209281_1000023 Ga0209281_100002370 255
452 3300028786 Ga0307517_10133568 Ga0307517_101335684 255
453 3300035091 Ga0373951_0004581 Ga0373951_0004581_232_1026 255
454 3300035114 Ga0373939_0000034 Ga0373939_0000034_45283_46077 255
455 3300035121 Ga0373960_0012498 Ga0373960_0012498_804_1598 255
456 3300035242 Ga0373962_0024087 Ga0373962_0024087_674_1468 255
457 3300035691 Ga0373931_0000318 Ga0373931_0000318_15629_16423 255
458 3300037471 Ga0395905_0019486 Ga0395905_0019486_5552_6319 255
459 3300042120 Ga0450917_000803 Ga0450917_000803_378_1148 255
460 3300042127 Ga0450890_001764 Ga0450890_001764_1198_1968 255
461 3300042130 Ga0450892_001407 Ga0450892_001407_1494_2264 255
462 3300042532 Ga0450893_0005881 Ga0450893_0005881_110_880 255
463 3300045051 Ga0451576_0060850 Ga0451576_0060850_1965_2747 255
464 3300046519 Ga0495632_0008760 Ga0495632_0008760_4145_4912 255
465 3300046694 Ga0495649_0001758 Ga0495649_0001758_8968_9735 255
466 3300047443 Ga0495687_000070 Ga0495687_000070_110748_111518 255
467 3300048091 Ga0495626_0128465 Ga0495626_0128465_236_1003 255
468 3300048917 Ga0496114_0054689 Ga0496114_0054689_2426_3196 255
469 3300049571 Ga0501034_0283495 Ga0501034_0283495_598_1473 255
470 3300050490 nmdc:mga03n38_58321_c1 nmdc:mga03n38_58321_c1_170_937 255
471 3300050493 nmdc:mga0k408_2319_c1 nmdc:mga0k408_2319_c1_618_1385 255
472 3300050495 nmdc:mga04h51_38198_c1 nmdc:mga04h51_38198_c1_54_821 255
473 3300050496 nmdc:mga07m45_58316_c1 nmdc:mga07m45_58316_c1_796_1578 255
474 3300061734 Ga0530510_0129970 Ga0530510_0129970_353_1213 255
475 iso_pu_bacteria 2842733646 2842737142 255
476 3300002704 JGI25155J39150_1000092 JGI25155J39150_100009230 256
477 3300002705 JGI25156J39149_1000067 JGI25156J39149_100006716 256
478 3300002738 JGI25154J39366_1000089 JGI25154J39366_100008964 256
479 3300002741 JGI25157J39369_1000084 JGI25157J39369_100008416 256
480 3300002774 JGI25150J39212_1004135 JGI25150J39212_10041354 256
481 3300002987 JGI25159J45721_1000151 JGI25159J45721_100015131 256
482 3300002987 JGI25159J45721_1001940 JGI25159J45721_10019403 256
483 3300003187 JGI25151J46595_10008194 JGI25151J46595_100081943 256
484 3300003187 JGI25151J46595_10019356 JGI25151J46595_100193561 256
485 3300003187 JGI25151J46595_10053949 JGI25151J46595_100539492 256
486 3300003354 JGI25160J50197_1000076 JGI25160J50197_100007639 256
487 3300003354 JGI25160J50197_1015714 JGI25160J50197_10157143 256
488 3300003374 JGI25161J50226_1000058 JGI25161J50226_100005854 256
489 3300003771 Ga0055526_1002345 Ga0055526_100234510 256
490 3300003771 Ga0055526_1027784 Ga0055526_10277842 256
491 3300003773 Ga0055537_1000207 Ga0055537_10002079 256
492 3300003775 Ga0055524_1000303 Ga0055524_10003033 256
493 3300003781 Ga0055536_1002799 Ga0055536_10027991 256
494 3300003784 Ga0055534_1004926 Ga0055534_10049263 256
495 3300003790 Ga0055528_1000468 Ga0055528_10004688 256
496 3300003791 Ga0055530_10000449 Ga0055530_100004493 256
497 3300003791 Ga0055530_10001419 Ga0055530_1000141913 256
498 3300003792 Ga0055540_1000088 Ga0055540_100008885 256
499 3300003792 Ga0055540_1000184 Ga0055540_100018433 256
500 3300003794 Ga0055531_10001550 Ga0055531_100015509 256
501 3300003794 Ga0055531_10013435 Ga0055531_100134354 256
502 3300003794 Ga0055531_10045105 Ga0055531_100451051 256
503 3300004625 Ga0055543_1003345 Ga0055543_10033454 256
504 3300005262 Ga0065165_1024375 Ga0065165_10243752 256
505 3300005262 Ga0065165_1026081 Ga0065165_10260812 256
506 3300005331 Ga0070670_100047187 Ga0070670_1000471872 256
507 3300005338 Ga0068868_100274651 Ga0068868_1002746513 256
508 3300005539 Ga0068853_100299540 Ga0068853_1002995401 256
509 3300005578 Ga0068854_100070468 Ga0068854_1000704682 256
510 3300005616 Ga0068852_100062752 Ga0068852_1000627522 256
511 3300006048 Ga0075363_100040513 Ga0075363_1000405131 256
512 3300006051 Ga0075364_10014008 Ga0075364_100140084 256
513 3300006237 Ga0097621_100085974 Ga0097621_1000859743 256
514 3300006358 Ga0068871_100010211 Ga0068871_1000102112 256
515 3300009177 Ga0105248_10016463 Ga0105248_100164635 256
516 3300013296 Ga0157374_10093533 Ga0157374_100935335 256
517 3300014326 Ga0157380_10594228 Ga0157380_105942282 256
518 3300025206 Ga0209435_100008 Ga0209435_100008192 256
519 3300025208 Ga0209436_104260 Ga0209436_1042605 256
520 3300025245 Ga0207425_1004208 Ga0207425_10042082 256
521 3300025245 Ga0207425_1005008 Ga0207425_10050084 256
522 3300025246 Ga0209646_1000029 Ga0209646_100002987 256
523 3300025250 Ga0209026_1000016 Ga0209026_100001687 256
524 3300025256 Ga0209759_1000016 Ga0209759_100001687 256
525 3300025263 Ga0209565_1000061 Ga0209565_10000619 256
526 3300025263 Ga0209565_1001035 Ga0209565_100103513 256
527 3300025273 Ga0209673_1000492 Ga0209673_100049240 256
528 3300025284 Ga0209130_1000014 Ga0209130_1000014280 256
529 3300025284 Ga0209130_1000411 Ga0209130_10004119 256
530 3300025291 Ga0209675_1003237 Ga0209675_10032372 256
531 3300025291 Ga0209675_1014235 Ga0209675_10142351 256
532 3300025291 Ga0209675_1027991 Ga0209675_10279912 256
533 3300025292 Ga0209676_1000013 Ga0209676_1000013472 256
534 3300025292 Ga0209676_1000153 Ga0209676_100015342 256
535 3300025292 Ga0209676_1003964 Ga0209676_10039642 256
536 3300025294 Ga0209025_1002161 Ga0209025_100216119 256
537 3300025294 Ga0209025_1022311 Ga0209025_10223112 256
538 3300025294 Ga0209025_1063236 Ga0209025_10632362 256
539 3300025295 Ga0209564_1001101 Ga0209564_100110130 256
540 3300025295 Ga0209564_1001248 Ga0209564_100124826 256
541 3300025298 Ga0209050_1000008 Ga0209050_1000008472 256
542 3300025298 Ga0209050_1001318 Ga0209050_100131824 256
543 3300025298 Ga0209050_1009519 Ga0209050_10095193 256
544 3300025298 Ga0209050_1014764 Ga0209050_10147644 256
545 3300025299 Ga0209256_1000039 Ga0209256_100003972 256
546 3300025299 Ga0209256_1032607 Ga0209256_10326072 256
547 3300025302 Ga0207426_1000174 Ga0207426_1000174111 256
548 3300025302 Ga0207426_1003159 Ga0207426_10031593 256
549 3300025303 Ga0209051_1000004 Ga0209051_100000422 256
550 3300025303 Ga0209051_1000005 Ga0209051_1000005472 256
551 3300025304 Ga0209257_1000031 Ga0209257_100003162 256
552 3300025304 Ga0209257_1000038 Ga0209257_1000038156 256
553 3300025304 Ga0209257_1000044 Ga0209257_1000044404 256
554 3300025304 Ga0209257_1010422 Ga0209257_10104223 256
555 3300025925 Ga0207650_10048144 Ga0207650_100481445 256
556 3300025937 Ga0207669_10017244 Ga0207669_100172442 256
557 3300025938 Ga0207704_10123775 Ga0207704_101237752 256
558 3300025941 Ga0207711_10034564 Ga0207711_100345645 256
559 3300025981 Ga0207640_10029096 Ga0207640_100290962 256
560 3300026041 Ga0207639_10477981 Ga0207639_104779812 256
561 3300026142 Ga0207698_10064761 Ga0207698_100647613 256
562 3300031456 Ga0307513_10004000 Ga0307513_100040001 256
563 3300031548 Ga0307408_100018270 Ga0307408_1000182703 256
564 3300031548 Ga0307408_100208547 Ga0307408_1002085472 256
565 3300031824 Ga0307413_10014137 Ga0307413_100141375 256
566 3300031852 Ga0307410_10107408 Ga0307410_101074084 256
567 3300031995 Ga0307409_100048505 Ga0307409_1000485055 256
568 3300031995 Ga0307409_100384763 Ga0307409_1003847632 256
569 3300032002 Ga0307416_100301441 Ga0307416_1003014413 256
570 3300037471 Ga0395905_0016646 Ga0395905_0016646_4305_5075 256
571 3300042133 Ga0450896_005609 Ga0450896_005609_718_1494 256
572 3300042435 Ga0439434_0043546 Ga0439434_0043546_379_1152 256
573 3300048905 Ga0496102_0001663 Ga0496102_0001663_2712_3566 256
574 3300050490 nmdc:mga03n38_170852_c1 nmdc:mga03n38_170852_c1_251_1021 256
575 3300050491 nmdc:mga00v17_106768_c1 nmdc:mga00v17_106768_c1_791_1561 256
576 3300050493 nmdc:mga0k408_47951_c1 nmdc:mga0k408_47951_c1_224_994 256
577 3300053088 Ga0500644_0046335 Ga0500644_0046335_295_1077 256
578 3300002773 JGI25152J39213_1002247 JGI25152J39213_10022476 257
579 3300002774 JGI25150J39212_1013536 JGI25150J39212_10135362 257
580 3300003215 JGI25153J46596_10001482 JGI25153J46596_1000148211 257
581 3300003771 Ga0055526_1015985 Ga0055526_10159852 257
582 3300005328 Ga0070676_10007740 Ga0070676_100077405 257
583 3300005331 Ga0070670_100600763 Ga0070670_1006007631 257
584 3300005333 Ga0070677_10015480 Ga0070677_100154803 257
585 3300005344 Ga0070661_100002070 Ga0070661_1000020705 257
586 3300005354 Ga0070675_100001642 Ga0070675_10000164220 257
587 3300005355 Ga0070671_100001451 Ga0070671_1000014514 257
588 3300005355 Ga0070671_100043544 Ga0070671_1000435442 257
589 3300005356 Ga0070674_100073993 Ga0070674_1000739934 257
590 3300005364 Ga0070673_100039125 Ga0070673_1000391253 257
591 3300005366 Ga0070659_100004522 Ga0070659_1000045226 257
592 3300005367 Ga0070667_100011551 Ga0070667_1000115515 257
593 3300005456 Ga0070678_100204351 Ga0070678_1002043513 257
594 3300005459 Ga0068867_100011407 Ga0068867_1000114075 257
595 3300005548 Ga0070665_100243266 Ga0070665_1002432662 257
596 3300005564 Ga0070664_100004129 Ga0070664_1000041293 257
597 3300005578 Ga0068854_100024279 Ga0068854_1000242793 257
598 3300005844 Ga0068862_100157457 Ga0068862_1001574572 257
599 3300006177 Ga0075362_10052784 Ga0075362_100527844 257
600 3300006237 Ga0097621_100162159 Ga0097621_1001621592 257
601 3300013308 Ga0157375_10330179 Ga0157375_103301793 257
602 3300014325 Ga0163163_10651398 Ga0163163_106513982 257
603 3300014969 Ga0157376_10518467 Ga0157376_105184672 257
604 3300017792 Ga0163161_10005830 Ga0163161_1000583010 257
605 3300021361 Ga0213872_10011812 Ga0213872_100118121 257
606 3300025304 Ga0209257_1018761 Ga0209257_10187612 257
607 3300025315 Ga0207697_10010847 Ga0207697_100108473 257
608 3300025893 Ga0207682_10002340 Ga0207682_100023402 257
609 3300025907 Ga0207645_10008271 Ga0207645_100082714 257
610 3300025919 Ga0207657_10085031 Ga0207657_100850314 257
611 3300025920 Ga0207649_10002913 Ga0207649_100029132 257
612 3300025923 Ga0207681_10233874 Ga0207681_102338742 257
613 3300025926 Ga0207659_10000693 Ga0207659_1000069312 257
614 3300025927 Ga0207687_10098913 Ga0207687_100989132 257
615 3300025931 Ga0207644_10066152 Ga0207644_100661522 257
616 3300025932 Ga0207690_10052076 Ga0207690_100520763 257
617 3300025940 Ga0207691_10001450 Ga0207691_100014504 257
618 3300025945 Ga0207679_10001298 Ga0207679_100012987 257
619 3300025960 Ga0207651_10014050 Ga0207651_100140504 257
620 3300025972 Ga0207668_10121606 Ga0207668_101216062 257
621 3300025986 Ga0207658_10059759 Ga0207658_100597592 257
622 3300026023 Ga0207677_10052419 Ga0207677_100524193 257
623 3300026023 Ga0207677_10405544 Ga0207677_104055442 257
624 3300026089 Ga0207648_10014273 Ga0207648_100142733 257
625 3300026089 Ga0207648_10014457 Ga0207648_100144575 257
626 3300026118 Ga0207675_100572309 Ga0207675_1005723091 257
627 3300026121 Ga0207683_10035305 Ga0207683_100353055 257
628 3300026121 Ga0207683_10355119 Ga0207683_103551192 257
629 3300028794 Ga0307515_10099441 Ga0307515_100994415 257
630 3300030522 Ga0307512_10014330 Ga0307512_100143305 257
631 3300030522 Ga0307512_10174447 Ga0307512_101744472 257
632 3300031507 Ga0307509_10000139 Ga0307509_1000013972 257
633 3300031649 Ga0307514_10011572 Ga0307514_100115726 257
634 3300033180 Ga0307510_10098490 Ga0307510_100984903 257
635 3300035691 Ga0373931_0139762 Ga0373931_0139762_419_1195 257
636 3300041999 Ga0439433_0009231 Ga0439433_0009231_1225_2004 257
637 3300042134 Ga0450898_004229 Ga0450898_004229_1156_1944 257
638 3300042134 Ga0450898_015669 Ga0450898_015669_311_1096 257
639 3300042156 Ga0439446_0012231 Ga0439446_0012231_873_1661 257
640 3300042876 Ga0451577_0000093 Ga0451577_0000093_39437_40237 257
641 3300042876 Ga0451577_0006366 Ga0451577_0006366_9927_10706 257
642 3300042876 Ga0451577_0025368 Ga0451577_0025368_347_1120 257
643 3300042876 Ga0451577_0260846 Ga0451577_0260846_13_819 257
644 3300044673 Ga0453683_0009689 Ga0453683_0009689_4965_5744 257
645 3300044712 Ga0453684_0026331 Ga0453684_0026331_6546_7325 257
646 3300045051 Ga0451576_0004656 Ga0451576_0004656_6774_7559 257
647 3300045051 Ga0451576_0052444 Ga0451576_0052444_870_1649 257
648 3300045051 Ga0451576_0059748 Ga0451576_0059748_2685_3464 257
649 3300046454 Ga0495592_0000578 Ga0495592_0000578_23968_24741 257
650 3300046516 Ga0495628_0055764 Ga0495628_0055764_131_949 257
651 3300047472 Ga0495686_0000014 Ga0495686_0000014_405692_406510 257
652 3300048905 Ga0496102_0001807 Ga0496102_0001807_2642_3415 257
653 3300053093 Ga0500651_0013545 Ga0500651_0013545_1101_1880 257
654 3300053118 Ga0500594_0010790 Ga0500594_0010790_899_1672 257
655 3300053123 Ga0500614_015044 Ga0500614_015044_159_932 257
656 3300053136 Ga0500559_0000252 Ga0500559_0000252_30778_31551 257
657 3300053148 Ga0500590_002538 Ga0500590_002538_7042_7830 257
658 3300053156 Ga0500622_0009907 Ga0500622_0009907_1265_2044 257
659 3300053177 Ga0500636_0017380 Ga0500636_0017380_2661_3434 257
660 3300053739 Ga0500587_006109 Ga0500587_006109_299_1078 257
661 3300005355 Ga0070671_100378509 Ga0070671_1003785092 258
662 3300005841 Ga0068863_100371966 Ga0068863_1003719662 258
663 3300006237 Ga0097621_100191014 Ga0097621_1001910144 258
664 3300009177 Ga0105248_10386550 Ga0105248_103865503 258
665 3300025931 Ga0207644_10334264 Ga0207644_103342642 258
666 3300026088 Ga0207641_10236833 Ga0207641_102368332 258
667 3300037471 Ga0395905_0000047 Ga0395905_0000047_79993_80775 258
668 3300037471 Ga0395905_0004019 Ga0395905_0004019_9713_10495 259
669 3300046457 Ga0495590_0000944 Ga0495590_0000944_6538_7320 259
670 3300046810 Ga0495660_0011436 Ga0495660_0011436_1914_2696 259
671 3300005354 Ga0070675_100108089 Ga0070675_1001080892 261
672 3300025926 Ga0207659_10115990 Ga0207659_101159902 261
673 3300025933 Ga0207706_10498954 Ga0207706_104989541 261
674 3300046539 Ga0495621_0013815 Ga0495621_0013815_1668_2480 261
675 3300050511 nmdc:mga08y16_216578_c1 nmdc:mga08y16_216578_c1_1157_1969 261
676 3300027876 Ga0209974_10004900 Ga0209974_100049003 262
677 3300042005 Ga0439448_0096513 Ga0439448_0096513_97_936 262
678 3300026089 Ga0207648_10626723 Ga0207648_106267231 263
679 3300031903 Ga0307407_10049587 Ga0307407_100495872 263
680 3300031911 Ga0307412_10009949 Ga0307412_100099496 263
681 3300031911 Ga0307412_10307843 Ga0307412_103078432 263
682 3300032002 Ga0307416_100086283 Ga0307416_1000862834 263
683 3300032004 Ga0307414_10049634 Ga0307414_100496345 263
684 3300049580 Ga0501046_0144958 Ga0501046_0144958_906_1703 263
685 3300025245 Ga0207425_1001448 Ga0207425_10014488 264
686 3300025258 Ga0209129_1000309 Ga0209129_100030921 264
687 3300025263 Ga0209565_1008463 Ga0209565_10084632 264
688 3300025273 Ga0209673_1017905 Ga0209673_10179052 264
689 3300025295 Ga0209564_1000162 Ga0209564_100016221 264
690 3300025297 Ga0209758_1000152 Ga0209758_1000152133 264
691 3300032002 Ga0307416_100133700 Ga0307416_1001337002 264
692 3300031730 Ga0307516_10281994 Ga0307516_102819942 265
693 3300028794 Ga0307515_10059341 Ga0307515_100593413 266
694 3300028794 Ga0307515_10085898 Ga0307515_100858982 268
695 3300025949 Ga0207667_10133601 Ga0207667_101336014 275
696 3300026142 Ga0207698_10079133 Ga0207698_100791331 275
697 3300001979 JGI24740J21852_10005939 JGI24740J21852_100059394 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

46

296

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fte-assembly1.cif.gz_A crystal structure of a. aeolicus ksga in complex with rna 0.8931 30 268
3tqs-assembly2.cif.gz_B structure of the dimethyladenosine transferase (ksga) from coxiella burnetii 0.8868 24 270
6ifv-assembly2.cif.gz_B c-terminal truncated ksga from bacillus subtilis 168 0.8835 24 206
3tpz-assembly1.cif.gz_A 2.1 angstrom crystal structure of the l114p mutant of e. coli ksga 0.8787 21 273
3uzu-assembly1.cif.gz_A the structure of the ribosomal rna small subunit methyltransferase a from burkholderia pseudomallei 0.8766 19 270
ID Description Score Start End Superfamily
1qyrB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9174 24 209 3.40.50.150
3fteA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9151 30 207 3.40.50.150
af_A0A144A0V8_364_547_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9083 46 205 3.40.50.150
1qyrB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9078 24 209 3.40.50.150
3fteA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8947 30 207 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3D5Q6L7-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase 0.9891 122 206 GO:0000179
GO:0003723
GO:0005829
AF-A0A645FEW7-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) 0.9709 142 270 GO:0003723
GO:0005829
GO:0052908
AF-A0A4R4GC92-F1-model_v4 deleted 0.964 142 206
AF-A0A3P8M4N2-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) 0.9601 115 213 GO:0003723
GO:0005829
GO:0052908
AF-A0A855K800-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase 0.9568 143 213 GO:0000179
GO:0003723
GO:0005829

Feature Viewer

pLDDT pTM Quality
87.71 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map