F475792

General Info

Members Datasets Scaffolds Average Seq Length
695 304 1390 111

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10000254|Ga0265330_1000025435
Length 127
Sequence MELTLALAIGVLTGSGVWLLLRPRTFQVIMGLSLISYAVNLFIFSMGRLGLATGKEPVLQAGVPQDLAHYTDPMPQALVLTAIVIGFAMTALFLVVLLASRGLAGTDHVDGAEPPEGDESDDEGRSP

Samples

Sample ID Description Type Environment
1 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
139 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
165 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
179 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
184 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
185 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
188 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
189 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
190 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
195 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
263 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
271 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
272 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
273 2643221570 Acidovorax sp. Root568 Isolate Unclassified
274 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
275 2643221596 Acidovorax sp. Root70 Isolate Unclassified
276 2643221611 Acidovorax sp. Root219 Isolate Unclassified
277 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
278 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
279 2643221652 Acidovorax sp. Root402 Isolate Unclassified
280 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
281 2721755523 Delftia sp. HK171 Isolate Unclassified
282 2738543012 Acidovorax sp. CF301 Isolate Unclassified
283 2738543024 Aminobacter sp. AP02 Isolate Unclassified
284 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
285 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
286 2816332133 Acidovorax radicis 2721A Isolate Unclassified
287 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
288 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
289 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
290 2849560528 Caulobacter zeae 410 Isolate Unclassified
291 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
292 2851153111 Caulobacter radicis 736 Isolate Unclassified
293 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
294 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
295 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
296 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
297 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
298 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
299 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
300 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
301 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
302 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
303 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
304 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.81
Metatranscriptomes 2.16
Isolates 5.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0.58
Rhizoplane 1.15
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265330_10000254 3300031235 Bacteria 39821
2 JGI24736J21556_1009888 3300001904 Bacteria 1566
3 JGI24741J21665_1001494 3300001915 Bacteria 6671
4 JGI24741J21665_1012384 3300001915 Bacteria 1467
5 JGI24740J21852_10000276 3300001979 Bacteria 21775
6 rootH2_10192889 3300003320 Bacteria 1684
7 Ga0006562J51391_1099889 3300003578 Bacteria 960
8 Ga0055524_1000125 3300003775 Bacteria 90042
9 Ga0065707_10692077 3300005295 Bacteria 643
10 Ga0070658_10089038 3300005327 Bacteria 2542
11 Ga0070658_10250440 3300005327 Bacteria 1503
12 Ga0070658_11053201 3300005327 Bacteria 707
13 Ga0070683_100005702 3300005329 Bacteria 10403
14 Ga0070683_100186078 3300005329 Bacteria 1971
15 Ga0070683_100714098 3300005329 Bacteria 960
16 Ga0070670_100023926 3300005331 Bacteria 5255
17 Ga0070670_100139620 3300005331 Bacteria 2095
18 Ga0070670_100975871 3300005331 Bacteria 770
19 Ga0070677_10829120 3300005333 Bacteria 530
20 Ga0070666_10500343 3300005335 Bacteria 881
21 Ga0070680_100006885 3300005336 Bacteria 8669
22 Ga0070680_100009650 3300005336 Bacteria 7424
23 Ga0070680_100081559 3300005336 Bacteria 2669
24 Ga0070680_100405442 3300005336 Bacteria 1162
25 Ga0070680_100465620 3300005336 Bacteria 1080
26 Ga0070680_101261526 3300005336 Bacteria 639
27 Ga0070682_100001386 3300005337 Bacteria 13657
28 Ga0070682_100003406 3300005337 Bacteria 8820
29 Ga0070682_100040276 3300005337 Bacteria 2874
30 Ga0070682_100798019 3300005337 Bacteria 767
31 Ga0070660_100027016 3300005339 Bacteria 4280
32 Ga0070660_100372307 3300005339 Bacteria 1178
33 Ga0070660_100386202 3300005339 Bacteria 1156
34 Ga0070691_10000277 3300005341 Bacteria 17896
35 Ga0070691_10095086 3300005341 Bacteria 1473
36 Ga0070691_10216246 3300005341 Bacteria 1013
37 Ga0070691_10491873 3300005341 Bacteria 707
38 Ga0070661_100042220 3300005344 Bacteria 3328
39 Ga0070661_100190080 3300005344 Bacteria 1566
40 Ga0070661_100226570 3300005344 Bacteria 1435
41 Ga0070661_100250152 3300005344 Bacteria 1367
42 Ga0070692_10002517 3300005345 Bacteria 7132
43 Ga0070692_10117564 3300005345 Bacteria 1478
44 Ga0070668_101084267 3300005347 Bacteria 722
45 Ga0070668_101790262 3300005347 Bacteria 565
46 Ga0070669_100932825 3300005353 Bacteria 742
47 Ga0070669_101035979 3300005353 Bacteria 705
48 Ga0070674_100835269 3300005356 Bacteria 798
49 Ga0070674_101139229 3300005356 Bacteria 690
50 Ga0070688_101632003 3300005365 Bacteria 527
51 Ga0070659_100038621 3300005366 Bacteria 3724
52 Ga0070709_10996237 3300005434 Bacteria 666
53 Ga0070705_100017726 3300005440 Bacteria 3721
54 Ga0070700_100067544 3300005441 Bacteria 2271
55 Ga0070694_100177163 3300005444 Bacteria 1575
56 Ga0070663_100002556 3300005455 Bacteria 10274
57 Ga0070663_100006672 3300005455 Bacteria 6962
58 Ga0070663_100371541 3300005455 Bacteria 1162
59 Ga0070663_100477671 3300005455 Bacteria 1031
60 Ga0070678_101147262 3300005456 Bacteria 719
61 Ga0070681_10001382 3300005458 Bacteria 21260
62 Ga0070681_10004469 3300005458 Bacteria 13326
63 Ga0070681_10015158 3300005458 Bacteria 7668
64 Ga0070681_10015785 3300005458 Bacteria 7528
65 Ga0070681_10475261 3300005458 Bacteria 1162
66 Ga0068867_100235149 3300005459 Bacteria 1483
67 Ga0070685_10024452 3300005466 Bacteria 3318
68 Ga0070699_100753356 3300005518 Bacteria 891
69 Ga0070699_101372186 3300005518 Bacteria 648
70 Ga0070679_100001222 3300005530 Bacteria 22599
71 Ga0070679_100003450 3300005530 Bacteria 14472
72 Ga0070679_100038465 3300005530 Bacteria 4756
73 Ga0070679_100075044 3300005530 Bacteria 3372
74 Ga0070679_100318600 3300005530 Bacteria 1504
75 Ga0070679_101462119 3300005530 Bacteria 630
76 Ga0070684_100014201 3300005535 Bacteria 6443
77 Ga0070684_100942942 3300005535 Bacteria 809
78 Ga0070697_100375615 3300005536 Bacteria 1230
79 Ga0068853_100065274 3300005539 Bacteria 3159
80 Ga0068853_101095999 3300005539 Bacteria 768
81 Ga0068853_101527266 3300005539 Bacteria 647
82 Ga0070686_100031508 3300005544 Bacteria 3243
83 Ga0070695_100388492 3300005545 Bacteria 1055
84 Ga0070695_100695441 3300005545 Bacteria 807
85 Ga0070696_100015693 3300005546 Bacteria 5090
86 Ga0070696_100031994 3300005546 Bacteria 3608
87 Ga0070696_100078838 3300005546 Bacteria 2329
88 Ga0070696_100195891 3300005546 Bacteria 1506
89 Ga0070693_100005075 3300005547 Bacteria 6293
90 Ga0070693_100224761 3300005547 Bacteria 1232
91 Ga0070693_101207556 3300005547 Bacteria 581
92 Ga0070665_100005783 3300005548 Bacteria 12687
93 Ga0070665_100109087 3300005548 Bacteria 2770
94 Ga0070665_100406779 3300005548 Bacteria 1369
95 Ga0070665_100467795 3300005548 Bacteria 1271
96 Ga0070665_100486248 3300005548 Bacteria 1245
97 Ga0070704_101005865 3300005549 Bacteria 754
98 Ga0068855_100042559 3300005563 Bacteria 5380
99 Ga0068855_100067522 3300005563 Bacteria 4165
100 Ga0068855_100253380 3300005563 Bacteria 1963
101 Ga0070664_100442014 3300005564 Bacteria 1193
102 Ga0070664_100447656 3300005564 Bacteria 1185
103 Ga0068857_100020655 3300005577 Bacteria 5796
104 Ga0068854_100078635 3300005578 Bacteria 2430
105 Ga0068854_100109213 3300005578 Bacteria 2084
106 Ga0068854_100153699 3300005578 Bacteria 1776
107 Ga0068856_100043672 3300005614 Bacteria 4410
108 Ga0068856_100604641 3300005614 Bacteria 1117
109 Ga0068856_101162343 3300005614 Bacteria 788
110 Ga0070702_100911593 3300005615 Bacteria 689
111 Ga0068852_100150965 3300005616 Bacteria 2160
112 Ga0068852_100199845 3300005616 Bacteria 1891
113 Ga0068852_101100076 3300005616 Bacteria 815
114 Ga0068861_100072648 3300005719 Bacteria 2670
115 Ga0068861_100617433 3300005719 Bacteria 997
116 Ga0068851_10009774 3300005834 Bacteria 4467
117 Ga0068851_10047048 3300005834 Bacteria 2183
118 Ga0068870_10005224 3300005840 Bacteria 5651
119 Ga0068863_100459487 3300005841 Bacteria 1250
120 Ga0068860_100636318 3300005843 Bacteria 1074
121 Ga0068860_100696859 3300005843 Bacteria 1025
122 Ga0075365_10082779 3300006038 Bacteria 2176
123 Ga0075364_10057057 3300006051 Bacteria 2557
124 Ga0075364_10815319 3300006051 Bacteria 636
125 Ga0097621_101602113 3300006237 Bacteria 619
126 Ga0068871_100231390 3300006358 Bacteria 1604
127 Ga0068871_100430846 3300006358 Bacteria 1179
128 Ga0068871_101318085 3300006358 Bacteria 679
129 Ga0068871_102122202 3300006358 Bacteria 535
130 Ga0075428_100016231 3300006844 Bacteria 8232
131 Ga0075430_100140229 3300006846 Bacteria 2013
132 Ga0075431_100164710 3300006847 Bacteria 2279
133 Ga0075431_100194592 3300006847 Bacteria 2076
134 Ga0075434_100009273 3300006871 Bacteria 9170
135 Ga0075429_100177162 3300006880 Bacteria 1868
136 Ga0068865_100744632 3300006881 Bacteria 841
137 Ga0079104_1000277 3300006946 Bacteria 66604
138 Ga0075435_100003502 3300007076 Bacteria 10654
139 Ga0105250_10006896 3300009092 Bacteria 4925
140 Ga0105240_10067764 3300009093 Bacteria 4423
141 Ga0105240_10134401 3300009093 Bacteria 2963
142 Ga0105240_10551093 3300009093 Bacteria 1276
143 Ga0105240_10687948 3300009093 Bacteria 1117
144 Ga0105240_10827812 3300009093 Bacteria 1001
145 Ga0105240_10944193 3300009093 Bacteria 925
146 Ga0114129_10617559 3300009147 Bacteria 1403
147 Ga0105243_10000420 3300009148 Bacteria 44548
148 Ga0105243_10902516 3300009148 Bacteria 879
149 Ga0105241_10062918 3300009174 Bacteria 2861
150 Ga0105241_11237478 3300009174 Bacteria 708
151 Ga0105242_10002467 3300009176 Bacteria 14516
152 Ga0105237_10142576 3300009545 Bacteria 2390
153 Ga0105237_11102122 3300009545 Bacteria 801
154 Ga0105238_10011524 3300009551 Bacteria 8907
155 Ga0105238_11085213 3300009551 Bacteria 823
156 Ga0105249_10004576 3300009553 Bacteria 11952
157 Ga0105035_126834 3300009988 Bacteria 557
158 Ga0105239_10047942 3300010375 Bacteria 4682
159 Ga0105239_10710192 3300010375 Bacteria 1150
160 Ga0157373_10025251 3300013100 Bacteria 4299
161 Ga0157373_10036879 3300013100 Bacteria 3507
162 Ga0157373_10598211 3300013100 Bacteria 803
163 Ga0157371_10007295 3300013102 Bacteria 8980
164 Ga0157371_10036254 3300013102 Bacteria 3532
165 Ga0157371_10336967 3300013102 Bacteria 1096
166 Ga0157371_11313457 3300013102 Bacteria 560
167 Ga0157370_10003655 3300013104 Bacteria 17975
168 Ga0157370_10074895 3300013104 Bacteria 3193
169 Ga0157370_10083506 3300013104 Bacteria 3003
170 Ga0157369_10059872 3300013105 Bacteria 4107
171 Ga0157369_10154529 3300013105 Bacteria 2424
172 Ga0157369_10201358 3300013105 Bacteria 2090
173 Ga0157369_10772666 3300013105 Bacteria 988
174 Ga0157369_11129945 3300013105 Bacteria 800
175 Ga0163162_13371110 3300013306 Bacteria 510
176 Ga0157372_10005091 3300013307 Bacteria 13977
177 Ga0157372_10024159 3300013307 Bacteria 6596
178 Ga0157375_10389837 3300013308 Bacteria 1560
179 Ga0163163_10005283 3300014325 Bacteria 11147
180 Ga0157380_10000878 3300014326 Bacteria 18892
181 Ga0157380_10390642 3300014326 Bacteria 1316
182 Ga0182008_10148195 3300014497 Bacteria 1176
183 Ga0163161_10341722 3300017792 Bacteria 1188
184 Ga0197907_10385332 3300020069 Bacteria 2158
185 Ga0197907_11127030 3300020069 Bacteria 2479
186 Ga0206356_10060457 3300020070 Bacteria 1351
187 Ga0206356_10109302 3300020070 Bacteria 5407
188 Ga0206356_10553656 3300020070 Bacteria 3257
189 Ga0206351_10724375 3300020077 Bacteria 531
190 Ga0206354_10504112 3300020081 Bacteria 7864
191 Ga0206354_11135313 3300020081 Bacteria 6897
192 Ga0206354_11706343 3300020081 Bacteria 645
193 Ga0206353_10383151 3300020082 Bacteria 8021
194 Ga0206353_10424224 3300020082 Bacteria 2165
195 Ga0206353_10613366 3300020082 Bacteria 2378
196 Ga0206353_11924165 3300020082 Bacteria 917
197 Ga0154015_1409539 3300020610 Bacteria 1794
198 Ga0214542_1011270 3300021321 Bacteria 12356
199 Ga0213874_10202732 3300021377 Bacteria 714
200 Ga0207656_10033523 3300025321 Bacteria 2140
201 Ga0207696_1011854 3300025711 Bacteria 3116
202 Ga0207688_10150191 3300025901 Bacteria 1376
203 Ga0207647_10001061 3300025904 Bacteria 21156
204 Ga0207647_10010748 3300025904 Bacteria 6447
205 Ga0207643_10004817 3300025908 Bacteria 7228
206 Ga0207705_10000097 3300025909 Bacteria 105579
207 Ga0207705_10000834 3300025909 Bacteria 25195
208 Ga0207705_10006124 3300025909 Bacteria 8950
209 Ga0207705_10026498 3300025909 Bacteria 4133
210 Ga0207705_10053504 3300025909 Bacteria 2908
211 Ga0207705_10144691 3300025909 Bacteria 1778
212 Ga0207705_10146818 3300025909 Bacteria 1765
213 Ga0207654_10019184 3300025911 Bacteria 3604
214 Ga0207654_11059007 3300025911 Bacteria 590
215 Ga0207707_10000084 3300025912 Bacteria 95228
216 Ga0207707_10000857 3300025912 Bacteria 29704
217 Ga0207707_10005881 3300025912 Bacteria 10725
218 Ga0207707_10008675 3300025912 Bacteria 8822
219 Ga0207707_10009470 3300025912 Bacteria 8446
220 Ga0207707_10100963 3300025912 Bacteria 2521
221 Ga0207707_10122505 3300025912 Bacteria 2274
222 Ga0207695_10011179 3300025913 Bacteria 10892
223 Ga0207695_10018711 3300025913 Bacteria 7998
224 Ga0207695_10019178 3300025913 Bacteria 7880
225 Ga0207695_10178547 3300025913 Bacteria 2045
226 Ga0207695_10642393 3300025913 Bacteria 942
227 Ga0207695_10988400 3300025913 Bacteria 721
228 Ga0207671_10830623 3300025914 Bacteria 732
229 Ga0207660_10001521 3300025917 Bacteria 15584
230 Ga0207660_10001530 3300025917 Bacteria 15484
231 Ga0207660_10003997 3300025917 Bacteria 9610
232 Ga0207660_10004898 3300025917 Bacteria 8721
233 Ga0207660_10055983 3300025917 Bacteria 2820
234 Ga0207660_10240703 3300025917 Bacteria 1425
235 Ga0207660_10936418 3300025917 Bacteria 707
236 Ga0207657_10014069 3300025919 Bacteria 7829
237 Ga0207657_10042195 3300025919 Bacteria 4026
238 Ga0207657_10049754 3300025919 Bacteria 3649
239 Ga0207657_10131960 3300025919 Bacteria 2047
240 Ga0207657_10360697 3300025919 Bacteria 1146
241 Ga0207657_10470924 3300025919 Bacteria 985
242 Ga0207649_10001768 3300025920 Bacteria 12388
243 Ga0207649_10003720 3300025920 Bacteria 8316
244 Ga0207649_10571225 3300025920 Bacteria 867
245 Ga0207652_10000076 3300025921 Bacteria 107686
246 Ga0207652_10000877 3300025921 Bacteria 28477
247 Ga0207652_10006664 3300025921 Bacteria 9303
248 Ga0207652_10007625 3300025921 Bacteria 8709
249 Ga0207652_10032061 3300025921 Bacteria 4414
250 Ga0207652_10061296 3300025921 Bacteria 3248
251 Ga0207652_10585395 3300025921 Bacteria 1001
252 Ga0207652_10635631 3300025921 Bacteria 955
253 Ga0207652_11094945 3300025921 Bacteria 697
254 Ga0207694_10029811 3300025924 Bacteria 4165
255 Ga0207694_10865440 3300025924 Bacteria 764
256 Ga0207694_11049824 3300025924 Bacteria 689
257 Ga0207650_10115906 3300025925 Bacteria 2080
258 Ga0207690_10002736 3300025932 Bacteria 10647
259 Ga0207690_10013712 3300025932 Bacteria 4878
260 Ga0207690_10075972 3300025932 Bacteria 2331
261 Ga0207686_10024084 3300025934 Bacteria 3522
262 Ga0207709_10000129 3300025935 Bacteria 111395
263 Ga0207669_11542281 3300025937 Bacteria 567
264 Ga0207691_10309740 3300025940 Bacteria 1355
265 Ga0207661_10038209 3300025944 Bacteria 3760
266 Ga0207661_10128958 3300025944 Bacteria 2163
267 Ga0207661_10172226 3300025944 Bacteria 1885
268 Ga0207661_10667369 3300025944 Bacteria 956
269 Ga0207679_10038342 3300025945 Bacteria 3413
270 Ga0207679_11409150 3300025945 Bacteria 639
271 Ga0207667_10002959 3300025949 Bacteria 21087
272 Ga0207667_10014722 3300025949 Bacteria 8900
273 Ga0207667_10014795 3300025949 Bacteria 8877
274 Ga0207667_10777409 3300025949 Bacteria 955
275 Ga0207712_10104026 3300025961 Bacteria 2116
276 Ga0207668_11079286 3300025972 Bacteria 719
277 Ga0207668_11594887 3300025972 Bacteria 589
278 Ga0207640_10000979 3300025981 Bacteria 15855
279 Ga0207640_10004353 3300025981 Bacteria 7672
280 Ga0207640_10254308 3300025981 Bacteria 1365
281 Ga0207640_10639309 3300025981 Bacteria 905
282 Ga0207658_11966327 3300025986 Bacteria 532
283 Ga0207677_10270468 3300026023 Bacteria 1390
284 Ga0207639_10073931 3300026041 Bacteria 2674
285 Ga0207639_10096255 3300026041 Bacteria 2381
286 Ga0207639_10273664 3300026041 Bacteria 1482
287 Ga0207678_10009472 3300026067 Bacteria 8568
288 Ga0207678_10011335 3300026067 Bacteria 7823
289 Ga0207678_10022141 3300026067 Bacteria 5569
290 Ga0207678_10028507 3300026067 Bacteria 4874
291 Ga0207678_10195661 3300026067 Bacteria 1728
292 Ga0207708_10155277 3300026075 Bacteria 1804
293 Ga0207702_10000919 3300026078 Bacteria 30440
294 Ga0207702_10040120 3300026078 Bacteria 3924
295 Ga0207702_10122161 3300026078 Bacteria 2332
296 Ga0207702_12285435 3300026078 Bacteria 529
297 Ga0207641_10225678 3300026088 Bacteria 1739
298 Ga0207648_11389038 3300026089 Bacteria 660
299 Ga0207674_10002322 3300026116 Bacteria 24094
300 Ga0207674_10017736 3300026116 Bacteria 7759
301 Ga0207675_100015267 3300026118 Bacteria 7165
302 Ga0207675_100119146 3300026118 Bacteria 2497
303 Ga0207683_10059028 3300026121 Bacteria 3369
304 Ga0207698_10004349 3300026142 Bacteria 8627
305 Ga0207698_10007073 3300026142 Bacteria 7028
306 Ga0207698_10007093 3300026142 Bacteria 7018
307 Ga0209281_1000067 3300027111 Bacteria 284517
308 Ga0209981_1037480 3300027378 Bacteria 721
309 Ga0209983_1029995 3300027665 Bacteria 1157
310 Ga0209971_1003630 3300027682 Bacteria 3654
311 Ga0209971_1013919 3300027682 Bacteria 1906
312 Ga0209966_1011869 3300027695 Bacteria 1593
313 Ga0209998_10043893 3300027717 Bacteria 1021
314 Ga0209974_10035098 3300027876 Bacteria 1665
315 Ga0209974_10161955 3300027876 Bacteria 812
316 Ga0268266_10125804 3300028379 Bacteria 2287
317 Ga0265332_10000001 3300031238 Bacteria 863783
318 Ga0265320_10024395 3300031240 Bacteria 3199
319 Ga0265340_10015534 3300031247 Bacteria 3954
320 Ga0307408_100000213 3300031548 Bacteria 61855
321 Ga0307408_100029463 3300031548 Bacteria 3804
322 Ga0307408_100337916 3300031548 Bacteria 1274
323 Ga0307408_101241990 3300031548 Bacteria 696
324 Ga0307408_101261515 3300031548 Bacteria 691
325 Ga0265314_10000013 3300031711 Bacteria 403405
326 Ga0316578_10464948 3300031728 Bacteria 747
327 Ga0307405_10073207 3300031731 Bacteria 2211
328 Ga0307405_10482551 3300031731 Bacteria 990
329 Ga0307413_10002558 3300031824 Bacteria 7432
330 Ga0307413_10195753 3300031824 Bacteria 1455
331 Ga0307413_10436689 3300031824 Bacteria 1035
332 Ga0307413_10737427 3300031824 Bacteria 822
333 Ga0307410_10013081 3300031852 Bacteria 4828
334 Ga0307410_10993859 3300031852 Bacteria 723
335 Ga0307410_11909196 3300031852 Bacteria 529
336 Ga0326468_10007278 3300031889 Bacteria 1045
337 Ga0307406_10002389 3300031901 Bacteria 10199
338 Ga0307406_10002478 3300031901 Bacteria 10065
339 Ga0307407_10000676 3300031903 Bacteria 11012
340 Ga0307407_10682153 3300031903 Bacteria 772
341 Ga0307407_10966657 3300031903 Bacteria 656
342 Ga0307407_11482418 3300031903 Bacteria 536
343 Ga0307412_10000383 3300031911 Bacteria 27626
344 Ga0307412_10150092 3300031911 Bacteria 1719
345 Ga0307409_100004288 3300031995 Bacteria 7976
346 Ga0307409_100276579 3300031995 Bacteria 1549
347 Ga0307409_100815293 3300031995 Bacteria 942
348 Ga0307409_101825768 3300031995 Bacteria 637
349 Ga0307416_100019477 3300032002 Bacteria 4812
350 Ga0307416_100261913 3300032002 Bacteria 1691
351 Ga0307416_101725253 3300032002 Bacteria 731
352 Ga0307414_10052325 3300032004 Bacteria 2841
353 Ga0307414_10348759 3300032004 Bacteria 1270
354 Ga0307414_10434233 3300032004 Bacteria 1148
355 Ga0307411_10503375 3300032005 Bacteria 1024
356 Ga0307411_11273639 3300032005 Bacteria 669
357 Ga0307411_11830013 3300032005 Bacteria 564
358 Ga0307415_100011367 3300032126 Bacteria 5091
359 Ga0373948_0100321 3300034817 Bacteria 681
360 Ga0373950_0030212 3300034818 Bacteria 1000
361 Ga0373928_0207145 3300035084 Bacteria 568
362 Ga0373949_0012897 3300035090 Bacteria 1852
363 Ga0373951_0279568 3300035091 Bacteria 509
364 Ga0373932_0082750 3300035112 Bacteria 1017
365 Ga0373941_0388408 3300035115 Bacteria 575
366 Ga0373931_0045032 3300035691 Bacteria 2328
367 Ga0395899_0000114 3300037312 Bacteria 134621
368 Ga0395899_0005394 3300037312 Bacteria 9936
369 Ga0395899_0053086 3300037312 Bacteria 3002
370 Ga0395899_0084725 3300037312 Bacteria 2304
371 Ga0395899_0283854 3300037312 Bacteria 1125
372 Ga0395899_0891239 3300037312 Bacteria 543
373 Ga0395900_0000246 3300037418 Bacteria 85104
374 Ga0395900_0012176 3300037418 Bacteria 8793
375 Ga0395900_0020317 3300037418 Bacteria 6778
376 Ga0395900_0115620 3300037418 Bacteria 2753
377 Ga0395900_0131562 3300037418 Bacteria 2564
378 Ga0395900_0910451 3300037418 Bacteria 802
379 Ga0395900_1089344 3300037418 Bacteria 716
380 Ga0395898_0000447 3300037466 Bacteria 85103
381 Ga0395898_0004315 3300037466 Bacteria 15582
382 Ga0395898_0079560 3300037466 Bacteria 3162
383 Ga0395898_0138364 3300037466 Bacteria 2331
384 Ga0395898_0334533 3300037466 Bacteria 1444
385 Ga0395905_0000228 3300037471 Bacteria 85103
386 Ga0395905_0010260 3300037471 Bacteria 9122
387 Ga0395905_1048508 3300037471 Bacteria 718
388 Ga0395905_1477430 3300037471 Bacteria 584
389 Ga0395905_1625742 3300037471 Bacteria 551
390 Ga0395901_0000167 3300038443 Bacteria 85844
391 Ga0395901_0004402 3300038443 Bacteria 14197
392 Ga0395901_0014729 3300038443 Bacteria 7948
393 Ga0395901_0056523 3300038443 Bacteria 4082
394 Ga0395901_0235919 3300038443 Bacteria 1909
395 Ga0395901_0249509 3300038443 Bacteria 1849
396 Ga0395901_0256798 3300038443 Bacteria 1820
397 Ga0395901_0817691 3300038443 Bacteria 919
398 Ga0395901_0930216 3300038443 Bacteria 849
399 Ga0395901_1003943 3300038443 Bacteria 810
400 Ga0436363_0040042 3300039450 Bacteria 1464
401 Ga0439453_0021497 3300041408 Bacteria 1164
402 Ga0451787_037661 3300041441 Bacteria 645
403 Ga0451791_0625845 3300041451 Bacteria 634
404 Ga0451791_1300758 3300041451 Bacteria 646
405 Ga0451802_0902181 3300041460 Bacteria 863
406 Ga0451807_0414696 3300041486 Bacteria 638
407 Ga0451807_2702882 3300041486 Bacteria 2862
408 Ga0451837_0933495 3300041494 Bacteria 586
409 Ga0451837_1701748 3300041494 Bacteria 713
410 Ga0451851_0432079 3300041507 Bacteria 686
411 Ga0451843_0396548 3300041509 Bacteria 925
412 Ga0451853_0787453 3300041512 Bacteria 520
413 Ga0439441_005271 3300042001 Bacteria 2000
414 Ga0439443_023192 3300042003 Bacteria 989
415 Ga0450919_001439 3300042121 Bacteria 3108
416 Ga0450888_038723 3300042126 Bacteria 658
417 Ga0439434_0183044 3300042435 Bacteria 702
418 Ga0439435_0159084 3300042436 Bacteria 728
419 Ga0439444_0022108 3300042437 Bacteria 1131
420 Ga0439460_0074181 3300042461 Bacteria 1059
421 Ga0450893_0085393 3300042532 Bacteria 628
422 Ga0451577_0020696 3300042876 Bacteria 6033
423 Ga0451577_0083016 3300042876 Bacteria 2859
424 Ga0466961_0320523 3300044693 Bacteria 945
425 Ga0466964_0059902 3300044706 Bacteria 1582
426 Ga0453684_0297951 3300044712 Bacteria 1834
427 Ga0451576_0035370 3300045051 Bacteria 5300
428 Ga0466967_0021359 3300045976 Bacteria 5256
429 Ga0466967_1101378 3300045976 Bacteria 791
430 Ga0495638_0263957 3300046460 Bacteria 943
431 Ga0495607_0000073 3300046501 Bacteria 100053
432 Ga0495643_0289793 3300046522 Bacteria 750
433 Ga0495633_0001245 3300046558 Bacteria 20322
434 Ga0495633_0002109 3300046558 Bacteria 14284
435 Ga0496105_0616116 3300048908 Bacteria 841
436 Ga0496113_1138752 3300048916 Bacteria 611
437 Ga0496116_0003563 3300048919 Bacteria 15304
438 Ga0496116_0035018 3300048919 Bacteria 3531
439 Ga0496116_0208160 3300048919 Bacteria 1016
440 Ga0496117_0011712 3300048920 Bacteria 7823
441 Ga0496117_0119548 3300048920 Bacteria 1622
442 Ga0496118_0032058 3300048921 Bacteria 4340
443 Ga0496119_0057087 3300048922 Bacteria 2361
444 Ga0496119_0156753 3300048922 Bacteria 1215
445 Ga0496120_0009451 3300048923 Bacteria 6912
446 Ga0496121_0001225 3300048924 Bacteria 44636
447 Ga0496121_0260034 3300048924 Bacteria 1199
448 Ga0496122_0000021 3300048925 Bacteria 391363
449 Ga0496122_0029036 3300048925 Bacteria 4676
450 Ga0496122_0185929 3300048925 Bacteria 1232
451 Ga0496123_0001255 3300048926 Bacteria 36486
452 Ga0496123_0001826 3300048926 Bacteria 27983
453 Ga0496123_0017505 3300048926 Bacteria 5761
454 Ga0496123_0034717 3300048926 Bacteria 3607
455 Ga0496124_0347440 3300048927 Bacteria 1050
456 Ga0496125_0000005 3300048928 Bacteria 827598
457 Ga0496125_0001215 3300048928 Bacteria 38708
458 Ga0496125_0007745 3300048928 Bacteria 11368
459 Ga0496125_0101668 3300048928 Bacteria 2114
460 Ga0496125_0305502 3300048928 Bacteria 972
461 Ga0496125_0339971 3300048928 Bacteria 901
462 Ga0496126_0033384 3300048929 Bacteria 4842
463 Ga0496126_0064339 3300048929 Bacteria 3286
464 Ga0496126_0114087 3300048929 Bacteria 2351
465 Ga0501299_180642 3300049522 Bacteria 551
466 Ga0501031_0004079 3300049568 Bacteria 9429
467 Ga0501031_0029220 3300049568 Bacteria 3596
468 Ga0501032_0006844 3300049569 Bacteria 8364
469 Ga0501032_0044295 3300049569 Bacteria 3013
470 Ga0501032_0182628 3300049569 Bacteria 1373
471 Ga0501032_0378282 3300049569 Bacteria 911
472 Ga0501032_0563430 3300049569 Bacteria 726
473 Ga0501032_0697025 3300049569 Bacteria 644
474 Ga0501032_0769360 3300049569 Bacteria 609
475 Ga0501033_0009861 3300049570 Bacteria 7328
476 Ga0501033_0236996 3300049570 Bacteria 1295
477 Ga0501033_0279276 3300049570 Bacteria 1179
478 Ga0501033_0503782 3300049570 Bacteria 837
479 Ga0501034_0000444 3300049571 Bacteria 68426
480 Ga0501034_0051457 3300049571 Bacteria 4152
481 Ga0501034_0193966 3300049571 Bacteria 1992
482 Ga0501034_0288417 3300049571 Bacteria 1580
483 Ga0501034_0342558 3300049571 Bacteria 1424
484 Ga0501034_0448471 3300049571 Bacteria 1208
485 Ga0501036_0013804 3300049572 Bacteria 6717
486 Ga0501036_0050276 3300049572 Bacteria 3530
487 Ga0501036_0131581 3300049572 Bacteria 2112
488 Ga0501036_0206347 3300049572 Bacteria 1652
489 Ga0501036_0770998 3300049572 Bacteria 793
490 Ga0501036_1653713 3300049572 Bacteria 516
491 Ga0501037_0002738 3300049573 Bacteria 12744
492 Ga0501037_0063864 3300049573 Bacteria 2684
493 Ga0501037_0100434 3300049573 Bacteria 2089
494 Ga0501037_0124314 3300049573 Bacteria 1853
495 Ga0501038_0026982 3300049574 Bacteria 5112
496 Ga0501038_0028372 3300049574 Bacteria 4973
497 Ga0501038_0036294 3300049574 Bacteria 4327
498 Ga0501038_0086054 3300049574 Bacteria 2642
499 Ga0501038_0179034 3300049574 Bacteria 1712
500 Ga0501038_0200552 3300049574 Bacteria 1601
501 Ga0501038_0775574 3300049574 Bacteria 714
502 Ga0501038_0931762 3300049574 Bacteria 640
503 Ga0501039_0007212 3300049575 Bacteria 8471
504 Ga0501039_0012056 3300049575 Bacteria 6589
505 Ga0501039_0089266 3300049575 Bacteria 2402
506 Ga0501039_0302594 3300049575 Bacteria 1257
507 Ga0501039_0515008 3300049575 Bacteria 939
508 Ga0501039_0591229 3300049575 Bacteria 870
509 Ga0501039_0994684 3300049575 Bacteria 652
510 Ga0501040_0009228 3300049576 Bacteria 6423
511 Ga0501040_0053048 3300049576 Bacteria 2776
512 Ga0501040_0070058 3300049576 Bacteria 2419
513 Ga0501040_0283296 3300049576 Bacteria 1184
514 Ga0501040_0539230 3300049576 Bacteria 842
515 Ga0501040_0999722 3300049576 Bacteria 606
516 Ga0501040_1412810 3300049576 Bacteria 505
517 Ga0501041_0009961 3300049577 Bacteria 5600
518 Ga0501041_0035735 3300049577 Bacteria 3011
519 Ga0501041_0273549 3300049577 Bacteria 1062
520 Ga0501041_0647171 3300049577 Bacteria 676
521 Ga0501041_1027214 3300049577 Bacteria 531
522 Ga0501042_0016734 3300049578 Bacteria 5041
523 Ga0501042_0031258 3300049578 Bacteria 3767
524 Ga0501042_0077445 3300049578 Bacteria 2381
525 Ga0501042_0107835 3300049578 Bacteria 2005
526 Ga0501042_0358160 3300049578 Bacteria 1056
527 Ga0501042_0442849 3300049578 Bacteria 942
528 Ga0501042_0608569 3300049578 Bacteria 794
529 Ga0501043_0031198 3300049579 Bacteria 4190
530 Ga0501043_0075634 3300049579 Bacteria 2645
531 Ga0501043_0164242 3300049579 Bacteria 1734
532 Ga0501043_0255725 3300049579 Bacteria 1348
533 Ga0501043_0296390 3300049579 Bacteria 1237
534 Ga0501043_0332207 3300049579 Bacteria 1157
535 Ga0501043_0880657 3300049579 Bacteria 643
536 Ga0501043_1229887 3300049579 Bacteria 525
537 Ga0501046_0006239 3300049580 Bacteria 10582
538 Ga0501046_0087917 3300049580 Bacteria 2394
539 Ga0501046_0106125 3300049580 Bacteria 2150
540 Ga0501046_0461565 3300049580 Bacteria 912
541 Ga0501046_0853947 3300049580 Bacteria 636
542 Ga0501047_0021867 3300049581 Bacteria 6142
543 Ga0501047_0173535 3300049581 Bacteria 2024
544 Ga0501047_0182100 3300049581 Bacteria 1967
545 Ga0501047_0262758 3300049581 Bacteria 1573
546 Ga0501047_1222531 3300049581 Bacteria 565
547 Ga0501048_0022535 3300049582 Bacteria 4605
548 Ga0501048_0139174 3300049582 Bacteria 1716
549 Ga0501048_0152278 3300049582 Bacteria 1636
550 Ga0501048_0284265 3300049582 Bacteria 1176
551 Ga0501048_0737046 3300049582 Bacteria 708
552 Ga0501048_1258195 3300049582 Bacteria 532
553 Ga0501068_0035148 3300049584 Bacteria 2990
554 Ga0501069_0234696 3300049585 Bacteria 1068
555 Ga0501069_0254713 3300049585 Bacteria 1024
556 Ga0501069_0366137 3300049585 Bacteria 851
557 Ga0501069_0372491 3300049585 Bacteria 843
558 Ga0501070_0001023 3300049586 Bacteria 25130
559 Ga0501070_0006781 3300049586 Bacteria 9745
560 Ga0501070_0007437 3300049586 Bacteria 9302
561 Ga0501070_0046515 3300049586 Bacteria 3608
562 Ga0501070_0093558 3300049586 Bacteria 2487
563 Ga0501070_0150655 3300049586 Bacteria 1919
564 Ga0501070_0186508 3300049586 Bacteria 1706
565 Ga0501070_0315796 3300049586 Bacteria 1271
566 Ga0501070_0408179 3300049586 Bacteria 1098
567 Ga0501070_0504172 3300049586 Bacteria 972
568 Ga0501070_0920570 3300049586 Bacteria 681
569 Ga0501071_0042283 3300049587 Bacteria 3264
570 Ga0501071_0231158 3300049587 Bacteria 1393
571 Ga0501071_1512137 3300049587 Bacteria 518
572 Ga0501072_0016038 3300049588 Bacteria 5745
573 Ga0501072_0019498 3300049588 Bacteria 5244
574 Ga0501072_0056368 3300049588 Bacteria 3096
575 Ga0501072_0280757 3300049588 Bacteria 1325
576 Ga0501072_0513749 3300049588 Bacteria 947
577 Ga0501073_0102813 3300049589 Bacteria 1984
578 Ga0501073_0620591 3300049589 Bacteria 746
579 Ga0501074_0004171 3300049590 Bacteria 10322
580 Ga0501074_0075025 3300049590 Bacteria 2428
581 Ga0501074_0455415 3300049590 Bacteria 907
582 Ga0501074_0689664 3300049590 Bacteria 721
583 Ga0501075_0016047 3300049591 Bacteria 5388
584 Ga0501075_0020581 3300049591 Bacteria 4802
585 Ga0501075_0036056 3300049591 Bacteria 3690
586 Ga0501075_0652299 3300049591 Bacteria 802
587 Ga0501075_0799818 3300049591 Bacteria 717
588 Ga0501076_0003440 3300049592 Bacteria 11105
589 Ga0501076_0013015 3300049592 Bacteria 6229
590 Ga0501076_0105535 3300049592 Bacteria 2274
591 Ga0501076_0333182 3300049592 Bacteria 1245
592 Ga0501076_0726088 3300049592 Bacteria 820
593 Ga0501076_1168396 3300049592 Bacteria 633
594 Ga0501076_1367763 3300049592 Bacteria 582
595 Ga0501077_0029031 3300049593 Bacteria 3516
596 Ga0501077_0042541 3300049593 Bacteria 2888
597 Ga0501077_0063099 3300049593 Bacteria 2351
598 Ga0501077_0164588 3300049593 Bacteria 1408
599 Ga0501249_063576 3300049679 Bacteria 857
600 Ga0501079_0098650 3300049741 Bacteria 2264
601 Ga0501079_0116141 3300049741 Bacteria 2080
602 Ga0501079_0236125 3300049741 Bacteria 1428
603 Ga0501079_0964461 3300049741 Bacteria 672
604 Ga0501080_0070656 3300049742 Bacteria 3247
605 Ga0501080_0158788 3300049742 Bacteria 2089
606 Ga0501080_0222210 3300049742 Bacteria 1728
607 Ga0501080_0573699 3300049742 Bacteria 1003
608 Ga0501080_1368685 3300049742 Bacteria 604
609 Ga0501081_0073062 3300049743 Bacteria 2392
610 Ga0501081_0093098 3300049743 Bacteria 2122
611 Ga0501081_0114647 3300049743 Bacteria 1915
612 Ga0501081_0978720 3300049743 Bacteria 639
613 Ga0501081_1263654 3300049743 Bacteria 560
614 Ga0501083_0081449 3300049744 Bacteria 2146
615 Ga0501083_0129862 3300049744 Bacteria 1652
616 Ga0501083_0196534 3300049744 Bacteria 1316
617 Ga0501035_0002723 3300049822 Bacteria 17155
618 Ga0501035_0007737 3300049822 Bacteria 10036
619 Ga0501035_0039585 3300049822 Bacteria 4265
620 Ga0501035_0310836 3300049822 Bacteria 1326
621 Ga0501035_0342653 3300049822 Bacteria 1252
622 Ga0501035_1103775 3300049822 Bacteria 619
623 Ga0501044_0001822 3300049823 Bacteria 24824
624 Ga0501044_0036766 3300049823 Bacteria 5121
625 Ga0501044_0037701 3300049823 Bacteria 5051
626 Ga0501044_0078495 3300049823 Bacteria 3345
627 Ga0501044_0309770 3300049823 Bacteria 1506
628 Ga0501044_0369638 3300049823 Bacteria 1351
629 Ga0501044_0459696 3300049823 Bacteria 1178
630 Ga0501044_1361259 3300049823 Bacteria 576
631 Ga0501045_0010575 3300049824 Bacteria 6464
632 Ga0501045_0065497 3300049824 Bacteria 2667
633 Ga0501045_0082666 3300049824 Bacteria 2368
634 Ga0501045_0321677 3300049824 Bacteria 1151
635 Ga0501045_0412189 3300049824 Bacteria 1005
636 Ga0501045_0879550 3300049824 Bacteria 658
637 nmdc:mga00v17_126226_c1 3300050491 Bacteria 1633
638 nmdc:mga0yw44_198151_c1 3300050492 Bacteria 1326
639 nmdc:mga05p37_228293_c1 3300050507 Bacteria 2244
640 nmdc:mga09592_91302_c1 3300050508 Bacteria 2603
641 nmdc:mga0qj67_115199_c1 3300050509 Bacteria 2172
642 nmdc:mga0qj67_202487_c1 3300050509 Bacteria 1613
643 nmdc:mga06r32_455575_c1 3300050510 Bacteria 1259
644 nmdc:mga0n895_1257339_c1 3300050512 Bacteria 712
645 nmdc:mga0n895_147278_c1 3300050512 Bacteria 2384
646 nmdc:mga0rr50_13981_c1 3300050513 Bacteria 5247
647 nmdc:mga08x19_1044_c1 3300050514 Bacteria 17303
648 Ga0500579_279069 3300053143 Bacteria 513
649 Ga0500634_0006492 3300053161 Bacteria 5667
650 Ga0500634_0082144 3300053161 Bacteria 1657
651 Ga0501084_0012973 3300054114 Bacteria 6898
652 Ga0501084_0103821 3300054114 Bacteria 2387
653 Ga0501084_0127356 3300054114 Bacteria 2143
654 Ga0590071_040255 3300059421 Bacteria 1124
655 Ga0590074_023864 3300059423 Bacteria 1062
656 Ga0590077_026885 3300059426 Bacteria 1245
657 Ga0501082_0173156 3300060353 Bacteria 1877
658 Ga0501082_0388231 3300060353 Bacteria 1218
659 Ga0530510_0791275 3300061734 Bacteria 723
660 Ga0530510_0966563 3300061734 Bacteria 651
661 2538834337 2537561836 Bacteria 3910579
662 2643772933 2643221550 Bacteria 4619371
663 2643828725 2643221562 Bacteria 4048635
664 2643866781 2643221570 Bacteria 5103772
665 2643894650 2643221577 Bacteria 3710843
666 2643993500 2643221596 Bacteria 5006805
667 2644076329 2643221611 Bacteria 6820941
668 2644133098 2643221623 Bacteria 5239945
669 2644248802 2643221644 Bacteria 6865017
670 2644294637 2643221652 Bacteria 5140275
671 2644476799 2643221685 Bacteria 3673288
672 2722882795 2721755523 Bacteria 6430384
673 2739244660 2738543012 Bacteria 7115078
674 2739305876 2738543024 Bacteria 5603683
675 2739613519 2739367655 Bacteria 4051151
676 2792461935 2791355048 Bacteria 5832535
677 2816475136 2816332133 Bacteria 7249298
678 2839138506 2839138175 Bacteria 6549354
679 2842719654 2842718218 Bacteria 4560148
680 2843748797 2843744320 Bacteria 5659202
681 2849562162 2849560528 Bacteria 5393480
682 2849578836 2849573788 Bacteria 5421256
683 2851156600 2851153111 Bacteria 5542585
684 2857579405 2857576091 Bacteria 5465855
685 2881927982 2881927736 Bacteria 3993927
686 2887379132 2887375801 Bacteria 5334027
687 2894026015 2894023352 Bacteria 5167372
688 2898330269 2898329390 Bacteria 5168154
689 2928972609 2928972540 Bacteria 3058286
690 2932426263 2932422444 Bacteria 4678430
691 2941488177 2941485952 Bacteria 3591484
692 2974323722 2974320154 Bacteria 4571377
693 2977242389 2977240413 Bacteria 3191065
694 2996314961 2996310559 Bacteria 6357320
695 8002394624 8002392321 Bacteria 4159911
696 Ga0265330_10000254
697 JGI24736J21556_1009888
698 JGI24741J21665_1001494
699 JGI24741J21665_1012384
700 JGI24740J21852_10000276
701 rootH2_10192889
702 Ga0006562J51391_1099889
703 Ga0055524_1000125
704 Ga0065707_10692077
705 Ga0070658_10089038
706 Ga0070658_10250440
707 Ga0070658_11053201
708 Ga0070683_100005702
709 Ga0070683_100186078
710 Ga0070683_100714098
711 Ga0070670_100023926
712 Ga0070670_100139620
713 Ga0070670_100975871
714 Ga0070677_10829120
715 Ga0070666_10500343
716 Ga0070680_100006885
717 Ga0070680_100009650
718 Ga0070680_100081559
719 Ga0070680_100405442
720 Ga0070680_100465620
721 Ga0070680_101261526
722 Ga0070682_100001386
723 Ga0070682_100003406
724 Ga0070682_100040276
725 Ga0070682_100798019
726 Ga0070660_100027016
727 Ga0070660_100372307
728 Ga0070660_100386202
729 Ga0070691_10000277
730 Ga0070691_10095086
731 Ga0070691_10216246
732 Ga0070691_10491873
733 Ga0070661_100042220
734 Ga0070661_100190080
735 Ga0070661_100226570
736 Ga0070661_100250152
737 Ga0070692_10002517
738 Ga0070692_10117564
739 Ga0070668_101084267
740 Ga0070668_101790262
741 Ga0070669_100932825
742 Ga0070669_101035979
743 Ga0070674_100835269
744 Ga0070674_101139229
745 Ga0070688_101632003
746 Ga0070659_100038621
747 Ga0070709_10996237
748 Ga0070705_100017726
749 Ga0070700_100067544
750 Ga0070694_100177163
751 Ga0070663_100002556
752 Ga0070663_100006672
753 Ga0070663_100371541
754 Ga0070663_100477671
755 Ga0070678_101147262
756 Ga0070681_10001382
757 Ga0070681_10004469
758 Ga0070681_10015158
759 Ga0070681_10015785
760 Ga0070681_10475261
761 Ga0068867_100235149
762 Ga0070685_10024452
763 Ga0070699_100753356
764 Ga0070699_101372186
765 Ga0070679_100001222
766 Ga0070679_100003450
767 Ga0070679_100038465
768 Ga0070679_100075044
769 Ga0070679_100318600
770 Ga0070679_101462119
771 Ga0070684_100014201
772 Ga0070684_100942942
773 Ga0070697_100375615
774 Ga0068853_100065274
775 Ga0068853_101095999
776 Ga0068853_101527266
777 Ga0070686_100031508
778 Ga0070695_100388492
779 Ga0070695_100695441
780 Ga0070696_100015693
781 Ga0070696_100031994
782 Ga0070696_100078838
783 Ga0070696_100195891
784 Ga0070693_100005075
785 Ga0070693_100224761
786 Ga0070693_101207556
787 Ga0070665_100005783
788 Ga0070665_100109087
789 Ga0070665_100406779
790 Ga0070665_100467795
791 Ga0070665_100486248
792 Ga0070704_101005865
793 Ga0068855_100042559
794 Ga0068855_100067522
795 Ga0068855_100253380
796 Ga0070664_100442014
797 Ga0070664_100447656
798 Ga0068857_100020655
799 Ga0068854_100078635
800 Ga0068854_100109213
801 Ga0068854_100153699
802 Ga0068856_100043672
803 Ga0068856_100604641
804 Ga0068856_101162343
805 Ga0070702_100911593
806 Ga0068852_100150965
807 Ga0068852_100199845
808 Ga0068852_101100076
809 Ga0068861_100072648
810 Ga0068861_100617433
811 Ga0068851_10009774
812 Ga0068851_10047048
813 Ga0068870_10005224
814 Ga0068863_100459487
815 Ga0068860_100636318
816 Ga0068860_100696859
817 Ga0075365_10082779
818 Ga0075364_10057057
819 Ga0075364_10815319
820 Ga0097621_101602113
821 Ga0068871_100231390
822 Ga0068871_100430846
823 Ga0068871_101318085
824 Ga0068871_102122202
825 Ga0075428_100016231
826 Ga0075430_100140229
827 Ga0075431_100164710
828 Ga0075431_100194592
829 Ga0075434_100009273
830 Ga0075429_100177162
831 Ga0068865_100744632
832 Ga0079104_1000277
833 Ga0075435_100003502
834 Ga0105250_10006896
835 Ga0105240_10067764
836 Ga0105240_10134401
837 Ga0105240_10551093
838 Ga0105240_10687948
839 Ga0105240_10827812
840 Ga0105240_10944193
841 Ga0114129_10617559
842 Ga0105243_10000420
843 Ga0105243_10902516
844 Ga0105241_10062918
845 Ga0105241_11237478
846 Ga0105242_10002467
847 Ga0105237_10142576
848 Ga0105237_11102122
849 Ga0105238_10011524
850 Ga0105238_11085213
851 Ga0105249_10004576
852 Ga0105035_126834
853 Ga0105239_10047942
854 Ga0105239_10710192
855 Ga0157373_10025251
856 Ga0157373_10036879
857 Ga0157373_10598211
858 Ga0157371_10007295
859 Ga0157371_10036254
860 Ga0157371_10336967
861 Ga0157371_11313457
862 Ga0157370_10003655
863 Ga0157370_10074895
864 Ga0157370_10083506
865 Ga0157369_10059872
866 Ga0157369_10154529
867 Ga0157369_10201358
868 Ga0157369_10772666
869 Ga0157369_11129945
870 Ga0163162_13371110
871 Ga0157372_10005091
872 Ga0157372_10024159
873 Ga0157375_10389837
874 Ga0163163_10005283
875 Ga0157380_10000878
876 Ga0157380_10390642
877 Ga0182008_10148195
878 Ga0163161_10341722
879 Ga0197907_10385332
880 Ga0197907_11127030
881 Ga0206356_10060457
882 Ga0206356_10109302
883 Ga0206356_10553656
884 Ga0206351_10724375
885 Ga0206354_10504112
886 Ga0206354_11135313
887 Ga0206354_11706343
888 Ga0206353_10383151
889 Ga0206353_10424224
890 Ga0206353_10613366
891 Ga0206353_11924165
892 Ga0154015_1409539
893 Ga0214542_1011270
894 Ga0213874_10202732
895 Ga0207656_10033523
896 Ga0207696_1011854
897 Ga0207688_10150191
898 Ga0207647_10001061
899 Ga0207647_10010748
900 Ga0207643_10004817
901 Ga0207705_10000097
902 Ga0207705_10000834
903 Ga0207705_10006124
904 Ga0207705_10026498
905 Ga0207705_10053504
906 Ga0207705_10144691
907 Ga0207705_10146818
908 Ga0207654_10019184
909 Ga0207654_11059007
910 Ga0207707_10000084
911 Ga0207707_10000857
912 Ga0207707_10005881
913 Ga0207707_10008675
914 Ga0207707_10009470
915 Ga0207707_10100963
916 Ga0207707_10122505
917 Ga0207695_10011179
918 Ga0207695_10018711
919 Ga0207695_10019178
920 Ga0207695_10178547
921 Ga0207695_10642393
922 Ga0207695_10988400
923 Ga0207671_10830623
924 Ga0207660_10001521
925 Ga0207660_10001530
926 Ga0207660_10003997
927 Ga0207660_10004898
928 Ga0207660_10055983
929 Ga0207660_10240703
930 Ga0207660_10936418
931 Ga0207657_10014069
932 Ga0207657_10042195
933 Ga0207657_10049754
934 Ga0207657_10131960
935 Ga0207657_10360697
936 Ga0207657_10470924
937 Ga0207649_10001768
938 Ga0207649_10003720
939 Ga0207649_10571225
940 Ga0207652_10000076
941 Ga0207652_10000877
942 Ga0207652_10006664
943 Ga0207652_10007625
944 Ga0207652_10032061
945 Ga0207652_10061296
946 Ga0207652_10585395
947 Ga0207652_10635631
948 Ga0207652_11094945
949 Ga0207694_10029811
950 Ga0207694_10865440
951 Ga0207694_11049824
952 Ga0207650_10115906
953 Ga0207690_10002736
954 Ga0207690_10013712
955 Ga0207690_10075972
956 Ga0207686_10024084
957 Ga0207709_10000129
958 Ga0207669_11542281
959 Ga0207691_10309740
960 Ga0207661_10038209
961 Ga0207661_10128958
962 Ga0207661_10172226
963 Ga0207661_10667369
964 Ga0207679_10038342
965 Ga0207679_11409150
966 Ga0207667_10002959
967 Ga0207667_10014722
968 Ga0207667_10014795
969 Ga0207667_10777409
970 Ga0207712_10104026
971 Ga0207668_11079286
972 Ga0207668_11594887
973 Ga0207640_10000979
974 Ga0207640_10004353
975 Ga0207640_10254308
976 Ga0207640_10639309
977 Ga0207658_11966327
978 Ga0207677_10270468
979 Ga0207639_10073931
980 Ga0207639_10096255
981 Ga0207639_10273664
982 Ga0207678_10009472
983 Ga0207678_10011335
984 Ga0207678_10022141
985 Ga0207678_10028507
986 Ga0207678_10195661
987 Ga0207708_10155277
988 Ga0207702_10000919
989 Ga0207702_10040120
990 Ga0207702_10122161
991 Ga0207702_12285435
992 Ga0207641_10225678
993 Ga0207648_11389038
994 Ga0207674_10002322
995 Ga0207674_10017736
996 Ga0207675_100015267
997 Ga0207675_100119146
998 Ga0207683_10059028
999 Ga0207698_10004349
1000 Ga0207698_10007073
1001 Ga0207698_10007093
1002 Ga0209281_1000067
1003 Ga0209981_1037480
1004 Ga0209983_1029995
1005 Ga0209971_1003630
1006 Ga0209971_1013919
1007 Ga0209966_1011869
1008 Ga0209998_10043893
1009 Ga0209974_10035098
1010 Ga0209974_10161955
1011 Ga0268266_10125804
1012 Ga0265332_10000001
1013 Ga0265320_10024395
1014 Ga0265340_10015534
1015 Ga0307408_100000213
1016 Ga0307408_100029463
1017 Ga0307408_100337916
1018 Ga0307408_101241990
1019 Ga0307408_101261515
1020 Ga0265314_10000013
1021 Ga0316578_10464948
1022 Ga0307405_10073207
1023 Ga0307405_10482551
1024 Ga0307413_10002558
1025 Ga0307413_10195753
1026 Ga0307413_10436689
1027 Ga0307413_10737427
1028 Ga0307410_10013081
1029 Ga0307410_10993859
1030 Ga0307410_11909196
1031 Ga0326468_10007278
1032 Ga0307406_10002389
1033 Ga0307406_10002478
1034 Ga0307407_10000676
1035 Ga0307407_10682153
1036 Ga0307407_10966657
1037 Ga0307407_11482418
1038 Ga0307412_10000383
1039 Ga0307412_10150092
1040 Ga0307409_100004288
1041 Ga0307409_100276579
1042 Ga0307409_100815293
1043 Ga0307409_101825768
1044 Ga0307416_100019477
1045 Ga0307416_100261913
1046 Ga0307416_101725253
1047 Ga0307414_10052325
1048 Ga0307414_10348759
1049 Ga0307414_10434233
1050 Ga0307411_10503375
1051 Ga0307411_11273639
1052 Ga0307411_11830013
1053 Ga0307415_100011367
1054 Ga0373948_0100321
1055 Ga0373950_0030212
1056 Ga0373928_0207145
1057 Ga0373949_0012897
1058 Ga0373951_0279568
1059 Ga0373932_0082750
1060 Ga0373941_0388408
1061 Ga0373931_0045032
1062 Ga0395899_0000114
1063 Ga0395899_0005394
1064 Ga0395899_0053086
1065 Ga0395899_0084725
1066 Ga0395899_0283854
1067 Ga0395899_0891239
1068 Ga0395900_0000246
1069 Ga0395900_0012176
1070 Ga0395900_0020317
1071 Ga0395900_0115620
1072 Ga0395900_0131562
1073 Ga0395900_0910451
1074 Ga0395900_1089344
1075 Ga0395898_0000447
1076 Ga0395898_0004315
1077 Ga0395898_0079560
1078 Ga0395898_0138364
1079 Ga0395898_0334533
1080 Ga0395905_0000228
1081 Ga0395905_0010260
1082 Ga0395905_1048508
1083 Ga0395905_1477430
1084 Ga0395905_1625742
1085 Ga0395901_0000167
1086 Ga0395901_0004402
1087 Ga0395901_0014729
1088 Ga0395901_0056523
1089 Ga0395901_0235919
1090 Ga0395901_0249509
1091 Ga0395901_0256798
1092 Ga0395901_0817691
1093 Ga0395901_0930216
1094 Ga0395901_1003943
1095 Ga0436363_0040042
1096 Ga0439453_0021497
1097 Ga0451787_037661
1098 Ga0451791_0625845
1099 Ga0451791_1300758
1100 Ga0451802_0902181
1101 Ga0451807_0414696
1102 Ga0451807_2702882
1103 Ga0451837_0933495
1104 Ga0451837_1701748
1105 Ga0451851_0432079
1106 Ga0451843_0396548
1107 Ga0451853_0787453
1108 Ga0439441_005271
1109 Ga0439443_023192
1110 Ga0450919_001439
1111 Ga0450888_038723
1112 Ga0439434_0183044
1113 Ga0439435_0159084
1114 Ga0439444_0022108
1115 Ga0439460_0074181
1116 Ga0450893_0085393
1117 Ga0451577_0020696
1118 Ga0451577_0083016
1119 Ga0466961_0320523
1120 Ga0466964_0059902
1121 Ga0453684_0297951
1122 Ga0451576_0035370
1123 Ga0466967_0021359
1124 Ga0466967_1101378
1125 Ga0495638_0263957
1126 Ga0495607_0000073
1127 Ga0495643_0289793
1128 Ga0495633_0001245
1129 Ga0495633_0002109
1130 Ga0496105_0616116
1131 Ga0496113_1138752
1132 Ga0496116_0003563
1133 Ga0496116_0035018
1134 Ga0496116_0208160
1135 Ga0496117_0011712
1136 Ga0496117_0119548
1137 Ga0496118_0032058
1138 Ga0496119_0057087
1139 Ga0496119_0156753
1140 Ga0496120_0009451
1141 Ga0496121_0001225
1142 Ga0496121_0260034
1143 Ga0496122_0000021
1144 Ga0496122_0029036
1145 Ga0496122_0185929
1146 Ga0496123_0001255
1147 Ga0496123_0001826
1148 Ga0496123_0017505
1149 Ga0496123_0034717
1150 Ga0496124_0347440
1151 Ga0496125_0000005
1152 Ga0496125_0001215
1153 Ga0496125_0007745
1154 Ga0496125_0101668
1155 Ga0496125_0305502
1156 Ga0496125_0339971
1157 Ga0496126_0033384
1158 Ga0496126_0064339
1159 Ga0496126_0114087
1160 Ga0501299_180642
1161 Ga0501031_0004079
1162 Ga0501031_0029220
1163 Ga0501032_0006844
1164 Ga0501032_0044295
1165 Ga0501032_0182628
1166 Ga0501032_0378282
1167 Ga0501032_0563430
1168 Ga0501032_0697025
1169 Ga0501032_0769360
1170 Ga0501033_0009861
1171 Ga0501033_0236996
1172 Ga0501033_0279276
1173 Ga0501033_0503782
1174 Ga0501034_0000444
1175 Ga0501034_0051457
1176 Ga0501034_0193966
1177 Ga0501034_0288417
1178 Ga0501034_0342558
1179 Ga0501034_0448471
1180 Ga0501036_0013804
1181 Ga0501036_0050276
1182 Ga0501036_0131581
1183 Ga0501036_0206347
1184 Ga0501036_0770998
1185 Ga0501036_1653713
1186 Ga0501037_0002738
1187 Ga0501037_0063864
1188 Ga0501037_0100434
1189 Ga0501037_0124314
1190 Ga0501038_0026982
1191 Ga0501038_0028372
1192 Ga0501038_0036294
1193 Ga0501038_0086054
1194 Ga0501038_0179034
1195 Ga0501038_0200552
1196 Ga0501038_0775574
1197 Ga0501038_0931762
1198 Ga0501039_0007212
1199 Ga0501039_0012056
1200 Ga0501039_0089266
1201 Ga0501039_0302594
1202 Ga0501039_0515008
1203 Ga0501039_0591229
1204 Ga0501039_0994684
1205 Ga0501040_0009228
1206 Ga0501040_0053048
1207 Ga0501040_0070058
1208 Ga0501040_0283296
1209 Ga0501040_0539230
1210 Ga0501040_0999722
1211 Ga0501040_1412810
1212 Ga0501041_0009961
1213 Ga0501041_0035735
1214 Ga0501041_0273549
1215 Ga0501041_0647171
1216 Ga0501041_1027214
1217 Ga0501042_0016734
1218 Ga0501042_0031258
1219 Ga0501042_0077445
1220 Ga0501042_0107835
1221 Ga0501042_0358160
1222 Ga0501042_0442849
1223 Ga0501042_0608569
1224 Ga0501043_0031198
1225 Ga0501043_0075634
1226 Ga0501043_0164242
1227 Ga0501043_0255725
1228 Ga0501043_0296390
1229 Ga0501043_0332207
1230 Ga0501043_0880657
1231 Ga0501043_1229887
1232 Ga0501046_0006239
1233 Ga0501046_0087917
1234 Ga0501046_0106125
1235 Ga0501046_0461565
1236 Ga0501046_0853947
1237 Ga0501047_0021867
1238 Ga0501047_0173535
1239 Ga0501047_0182100
1240 Ga0501047_0262758
1241 Ga0501047_1222531
1242 Ga0501048_0022535
1243 Ga0501048_0139174
1244 Ga0501048_0152278
1245 Ga0501048_0284265
1246 Ga0501048_0737046
1247 Ga0501048_1258195
1248 Ga0501068_0035148
1249 Ga0501069_0234696
1250 Ga0501069_0254713
1251 Ga0501069_0366137
1252 Ga0501069_0372491
1253 Ga0501070_0001023
1254 Ga0501070_0006781
1255 Ga0501070_0007437
1256 Ga0501070_0046515
1257 Ga0501070_0093558
1258 Ga0501070_0150655
1259 Ga0501070_0186508
1260 Ga0501070_0315796
1261 Ga0501070_0408179
1262 Ga0501070_0504172
1263 Ga0501070_0920570
1264 Ga0501071_0042283
1265 Ga0501071_0231158
1266 Ga0501071_1512137
1267 Ga0501072_0016038
1268 Ga0501072_0019498
1269 Ga0501072_0056368
1270 Ga0501072_0280757
1271 Ga0501072_0513749
1272 Ga0501073_0102813
1273 Ga0501073_0620591
1274 Ga0501074_0004171
1275 Ga0501074_0075025
1276 Ga0501074_0455415
1277 Ga0501074_0689664
1278 Ga0501075_0016047
1279 Ga0501075_0020581
1280 Ga0501075_0036056
1281 Ga0501075_0652299
1282 Ga0501075_0799818
1283 Ga0501076_0003440
1284 Ga0501076_0013015
1285 Ga0501076_0105535
1286 Ga0501076_0333182
1287 Ga0501076_0726088
1288 Ga0501076_1168396
1289 Ga0501076_1367763
1290 Ga0501077_0029031
1291 Ga0501077_0042541
1292 Ga0501077_0063099
1293 Ga0501077_0164588
1294 Ga0501249_063576
1295 Ga0501079_0098650
1296 Ga0501079_0116141
1297 Ga0501079_0236125
1298 Ga0501079_0964461
1299 Ga0501080_0070656
1300 Ga0501080_0158788
1301 Ga0501080_0222210
1302 Ga0501080_0573699
1303 Ga0501080_1368685
1304 Ga0501081_0073062
1305 Ga0501081_0093098
1306 Ga0501081_0114647
1307 Ga0501081_0978720
1308 Ga0501081_1263654
1309 Ga0501083_0081449
1310 Ga0501083_0129862
1311 Ga0501083_0196534
1312 Ga0501035_0002723
1313 Ga0501035_0007737
1314 Ga0501035_0039585
1315 Ga0501035_0310836
1316 Ga0501035_0342653
1317 Ga0501035_1103775
1318 Ga0501044_0001822
1319 Ga0501044_0036766
1320 Ga0501044_0037701
1321 Ga0501044_0078495
1322 Ga0501044_0309770
1323 Ga0501044_0369638
1324 Ga0501044_0459696
1325 Ga0501044_1361259
1326 Ga0501045_0010575
1327 Ga0501045_0065497
1328 Ga0501045_0082666
1329 Ga0501045_0321677
1330 Ga0501045_0412189
1331 Ga0501045_0879550
1332 nmdc:mga00v17_126226_c1
1333 nmdc:mga0yw44_198151_c1
1334 nmdc:mga05p37_228293_c1
1335 nmdc:mga09592_91302_c1
1336 nmdc:mga0qj67_115199_c1
1337 nmdc:mga0qj67_202487_c1
1338 nmdc:mga06r32_455575_c1
1339 nmdc:mga0n895_1257339_c1
1340 nmdc:mga0n895_147278_c1
1341 nmdc:mga0rr50_13981_c1
1342 nmdc:mga08x19_1044_c1
1343 Ga0500579_279069
1344 Ga0500634_0006492
1345 Ga0500634_0082144
1346 Ga0501084_0012973
1347 Ga0501084_0103821
1348 Ga0501084_0127356
1349 Ga0590071_040255
1350 Ga0590074_023864
1351 Ga0590077_026885
1352 Ga0501082_0173156
1353 Ga0501082_0388231
1354 Ga0530510_0791275
1355 Ga0530510_0966563
1356 2538834337
1357 2643772933
1358 2643828725
1359 2643866781
1360 2643894650
1361 2643993500
1362 2644076329
1363 2644133098
1364 2644248802
1365 2644294637
1366 2644476799
1367 2722882795
1368 2739244660
1369 2739305876
1370 2739613519
1371 2792461935
1372 2816475136
1373 2839138506
1374 2842719654
1375 2843748797
1376 2849562162
1377 2849578836
1378 2851156600
1379 2857579405
1380 2881927982
1381 2887379132
1382 2894026015
1383 2898330269
1384 2928972609
1385 2932426263
1386 2941488177
1387 2974323722
1388 2977242389
1389 2996314961
1390 8002394624

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

4

114

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o93-assembly1.cif.gz_B crystal structure of thermus thermophilis transhydrogeanse domain ii dimer 0.5581 1 92
6ys8-assembly1.cif.gz_F structure of gldlm, the proton-powered motor that drives protein transport and gliding motility 0.5207 1 53
7qru-assembly1.cif.gz_C structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.4984 1 112
6z16-assembly1.cif.gz_c structure of the mrp antiporter complex 0.4958 1 109
7d3u-assembly1.cif.gz_C structure of mrp complex from dietzia sp. dq12-45-1b 0.4958 4 92
ID Description Score Start End Superfamily
af_A0A0P0X9L3_107_499_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9527 4 46 1.10.3860.10
af_E7FBL8_30_139_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.9431 5 46 1.20.140.150
af_I1MB11_126_214_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9093 8 43 1.25.40.10
af_Q9VNJ5_922_1117_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.8879 1 45 1.20.1640.10
af_H0WEV0_822_1008_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8661 1 51 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A1B1TCR1-F1-model_v4 Uncharacterized protein 0.8654 1 48
AF-A0A090T0P6-F1-model_v4 Na(+) H(+) antiporter subunit C 0.8466 1 55 GO:0016020
AF-A0A090T0P6-F1-model_v4 Na(+) H(+) antiporter subunit C 0.8322 1 55 GO:0016020
AF-A0A7C1SY28-F1-model_v4 Cation:proton antiporter 0.8273 1 57 GO:0016020
AF-A0A4Y8ZH83-F1-model_v4 deleted 0.8244 4 56

Map