F475792
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 695 | 304 | 1390 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300031235|Ga0265330_10000254|Ga0265330_1000025435 |
| Length | 127 |
| Sequence | MELTLALAIGVLTGSGVWLLLRPRTFQVIMGLSLISYAVNLFIFSMGRLGLATGKEPVLQAGVPQDLAHYTDPMPQALVLTAIVIGFAMTALFLVVLLASRGLAGTDHVDGAEPPEGDESDDEGRSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 98 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 139 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 163 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 164 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 165 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 178 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 179 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 184 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 185 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 186 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 187 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 188 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 189 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 190 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 191 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 192 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 193 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 194 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 195 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 209 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 210 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 211 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 212 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 213 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 214 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 215 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 216 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 217 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 220 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 263 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 264 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 266 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 267 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 268 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 270 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 271 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 272 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 273 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 274 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 275 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 276 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 277 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 278 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 279 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 280 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 281 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 282 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 283 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 284 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 285 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 286 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 287 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 288 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 289 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 290 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 291 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 292 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 293 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 294 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 295 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 296 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 297 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 298 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 299 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 300 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 301 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 302 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 303 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 304 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.81 |
| Metatranscriptomes | 2.16 |
| Isolates | 5.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.29 |
| Nodule | 0.58 |
| Rhizoplane | 1.15 |
| Rhizosphere | 88.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265330_10000254 | 3300031235 | Bacteria | 39821 |
| 2 | JGI24736J21556_1009888 | 3300001904 | Bacteria | 1566 |
| 3 | JGI24741J21665_1001494 | 3300001915 | Bacteria | 6671 |
| 4 | JGI24741J21665_1012384 | 3300001915 | Bacteria | 1467 |
| 5 | JGI24740J21852_10000276 | 3300001979 | Bacteria | 21775 |
| 6 | rootH2_10192889 | 3300003320 | Bacteria | 1684 |
| 7 | Ga0006562J51391_1099889 | 3300003578 | Bacteria | 960 |
| 8 | Ga0055524_1000125 | 3300003775 | Bacteria | 90042 |
| 9 | Ga0065707_10692077 | 3300005295 | Bacteria | 643 |
| 10 | Ga0070658_10089038 | 3300005327 | Bacteria | 2542 |
| 11 | Ga0070658_10250440 | 3300005327 | Bacteria | 1503 |
| 12 | Ga0070658_11053201 | 3300005327 | Bacteria | 707 |
| 13 | Ga0070683_100005702 | 3300005329 | Bacteria | 10403 |
| 14 | Ga0070683_100186078 | 3300005329 | Bacteria | 1971 |
| 15 | Ga0070683_100714098 | 3300005329 | Bacteria | 960 |
| 16 | Ga0070670_100023926 | 3300005331 | Bacteria | 5255 |
| 17 | Ga0070670_100139620 | 3300005331 | Bacteria | 2095 |
| 18 | Ga0070670_100975871 | 3300005331 | Bacteria | 770 |
| 19 | Ga0070677_10829120 | 3300005333 | Bacteria | 530 |
| 20 | Ga0070666_10500343 | 3300005335 | Bacteria | 881 |
| 21 | Ga0070680_100006885 | 3300005336 | Bacteria | 8669 |
| 22 | Ga0070680_100009650 | 3300005336 | Bacteria | 7424 |
| 23 | Ga0070680_100081559 | 3300005336 | Bacteria | 2669 |
| 24 | Ga0070680_100405442 | 3300005336 | Bacteria | 1162 |
| 25 | Ga0070680_100465620 | 3300005336 | Bacteria | 1080 |
| 26 | Ga0070680_101261526 | 3300005336 | Bacteria | 639 |
| 27 | Ga0070682_100001386 | 3300005337 | Bacteria | 13657 |
| 28 | Ga0070682_100003406 | 3300005337 | Bacteria | 8820 |
| 29 | Ga0070682_100040276 | 3300005337 | Bacteria | 2874 |
| 30 | Ga0070682_100798019 | 3300005337 | Bacteria | 767 |
| 31 | Ga0070660_100027016 | 3300005339 | Bacteria | 4280 |
| 32 | Ga0070660_100372307 | 3300005339 | Bacteria | 1178 |
| 33 | Ga0070660_100386202 | 3300005339 | Bacteria | 1156 |
| 34 | Ga0070691_10000277 | 3300005341 | Bacteria | 17896 |
| 35 | Ga0070691_10095086 | 3300005341 | Bacteria | 1473 |
| 36 | Ga0070691_10216246 | 3300005341 | Bacteria | 1013 |
| 37 | Ga0070691_10491873 | 3300005341 | Bacteria | 707 |
| 38 | Ga0070661_100042220 | 3300005344 | Bacteria | 3328 |
| 39 | Ga0070661_100190080 | 3300005344 | Bacteria | 1566 |
| 40 | Ga0070661_100226570 | 3300005344 | Bacteria | 1435 |
| 41 | Ga0070661_100250152 | 3300005344 | Bacteria | 1367 |
| 42 | Ga0070692_10002517 | 3300005345 | Bacteria | 7132 |
| 43 | Ga0070692_10117564 | 3300005345 | Bacteria | 1478 |
| 44 | Ga0070668_101084267 | 3300005347 | Bacteria | 722 |
| 45 | Ga0070668_101790262 | 3300005347 | Bacteria | 565 |
| 46 | Ga0070669_100932825 | 3300005353 | Bacteria | 742 |
| 47 | Ga0070669_101035979 | 3300005353 | Bacteria | 705 |
| 48 | Ga0070674_100835269 | 3300005356 | Bacteria | 798 |
| 49 | Ga0070674_101139229 | 3300005356 | Bacteria | 690 |
| 50 | Ga0070688_101632003 | 3300005365 | Bacteria | 527 |
| 51 | Ga0070659_100038621 | 3300005366 | Bacteria | 3724 |
| 52 | Ga0070709_10996237 | 3300005434 | Bacteria | 666 |
| 53 | Ga0070705_100017726 | 3300005440 | Bacteria | 3721 |
| 54 | Ga0070700_100067544 | 3300005441 | Bacteria | 2271 |
| 55 | Ga0070694_100177163 | 3300005444 | Bacteria | 1575 |
| 56 | Ga0070663_100002556 | 3300005455 | Bacteria | 10274 |
| 57 | Ga0070663_100006672 | 3300005455 | Bacteria | 6962 |
| 58 | Ga0070663_100371541 | 3300005455 | Bacteria | 1162 |
| 59 | Ga0070663_100477671 | 3300005455 | Bacteria | 1031 |
| 60 | Ga0070678_101147262 | 3300005456 | Bacteria | 719 |
| 61 | Ga0070681_10001382 | 3300005458 | Bacteria | 21260 |
| 62 | Ga0070681_10004469 | 3300005458 | Bacteria | 13326 |
| 63 | Ga0070681_10015158 | 3300005458 | Bacteria | 7668 |
| 64 | Ga0070681_10015785 | 3300005458 | Bacteria | 7528 |
| 65 | Ga0070681_10475261 | 3300005458 | Bacteria | 1162 |
| 66 | Ga0068867_100235149 | 3300005459 | Bacteria | 1483 |
| 67 | Ga0070685_10024452 | 3300005466 | Bacteria | 3318 |
| 68 | Ga0070699_100753356 | 3300005518 | Bacteria | 891 |
| 69 | Ga0070699_101372186 | 3300005518 | Bacteria | 648 |
| 70 | Ga0070679_100001222 | 3300005530 | Bacteria | 22599 |
| 71 | Ga0070679_100003450 | 3300005530 | Bacteria | 14472 |
| 72 | Ga0070679_100038465 | 3300005530 | Bacteria | 4756 |
| 73 | Ga0070679_100075044 | 3300005530 | Bacteria | 3372 |
| 74 | Ga0070679_100318600 | 3300005530 | Bacteria | 1504 |
| 75 | Ga0070679_101462119 | 3300005530 | Bacteria | 630 |
| 76 | Ga0070684_100014201 | 3300005535 | Bacteria | 6443 |
| 77 | Ga0070684_100942942 | 3300005535 | Bacteria | 809 |
| 78 | Ga0070697_100375615 | 3300005536 | Bacteria | 1230 |
| 79 | Ga0068853_100065274 | 3300005539 | Bacteria | 3159 |
| 80 | Ga0068853_101095999 | 3300005539 | Bacteria | 768 |
| 81 | Ga0068853_101527266 | 3300005539 | Bacteria | 647 |
| 82 | Ga0070686_100031508 | 3300005544 | Bacteria | 3243 |
| 83 | Ga0070695_100388492 | 3300005545 | Bacteria | 1055 |
| 84 | Ga0070695_100695441 | 3300005545 | Bacteria | 807 |
| 85 | Ga0070696_100015693 | 3300005546 | Bacteria | 5090 |
| 86 | Ga0070696_100031994 | 3300005546 | Bacteria | 3608 |
| 87 | Ga0070696_100078838 | 3300005546 | Bacteria | 2329 |
| 88 | Ga0070696_100195891 | 3300005546 | Bacteria | 1506 |
| 89 | Ga0070693_100005075 | 3300005547 | Bacteria | 6293 |
| 90 | Ga0070693_100224761 | 3300005547 | Bacteria | 1232 |
| 91 | Ga0070693_101207556 | 3300005547 | Bacteria | 581 |
| 92 | Ga0070665_100005783 | 3300005548 | Bacteria | 12687 |
| 93 | Ga0070665_100109087 | 3300005548 | Bacteria | 2770 |
| 94 | Ga0070665_100406779 | 3300005548 | Bacteria | 1369 |
| 95 | Ga0070665_100467795 | 3300005548 | Bacteria | 1271 |
| 96 | Ga0070665_100486248 | 3300005548 | Bacteria | 1245 |
| 97 | Ga0070704_101005865 | 3300005549 | Bacteria | 754 |
| 98 | Ga0068855_100042559 | 3300005563 | Bacteria | 5380 |
| 99 | Ga0068855_100067522 | 3300005563 | Bacteria | 4165 |
| 100 | Ga0068855_100253380 | 3300005563 | Bacteria | 1963 |
| 101 | Ga0070664_100442014 | 3300005564 | Bacteria | 1193 |
| 102 | Ga0070664_100447656 | 3300005564 | Bacteria | 1185 |
| 103 | Ga0068857_100020655 | 3300005577 | Bacteria | 5796 |
| 104 | Ga0068854_100078635 | 3300005578 | Bacteria | 2430 |
| 105 | Ga0068854_100109213 | 3300005578 | Bacteria | 2084 |
| 106 | Ga0068854_100153699 | 3300005578 | Bacteria | 1776 |
| 107 | Ga0068856_100043672 | 3300005614 | Bacteria | 4410 |
| 108 | Ga0068856_100604641 | 3300005614 | Bacteria | 1117 |
| 109 | Ga0068856_101162343 | 3300005614 | Bacteria | 788 |
| 110 | Ga0070702_100911593 | 3300005615 | Bacteria | 689 |
| 111 | Ga0068852_100150965 | 3300005616 | Bacteria | 2160 |
| 112 | Ga0068852_100199845 | 3300005616 | Bacteria | 1891 |
| 113 | Ga0068852_101100076 | 3300005616 | Bacteria | 815 |
| 114 | Ga0068861_100072648 | 3300005719 | Bacteria | 2670 |
| 115 | Ga0068861_100617433 | 3300005719 | Bacteria | 997 |
| 116 | Ga0068851_10009774 | 3300005834 | Bacteria | 4467 |
| 117 | Ga0068851_10047048 | 3300005834 | Bacteria | 2183 |
| 118 | Ga0068870_10005224 | 3300005840 | Bacteria | 5651 |
| 119 | Ga0068863_100459487 | 3300005841 | Bacteria | 1250 |
| 120 | Ga0068860_100636318 | 3300005843 | Bacteria | 1074 |
| 121 | Ga0068860_100696859 | 3300005843 | Bacteria | 1025 |
| 122 | Ga0075365_10082779 | 3300006038 | Bacteria | 2176 |
| 123 | Ga0075364_10057057 | 3300006051 | Bacteria | 2557 |
| 124 | Ga0075364_10815319 | 3300006051 | Bacteria | 636 |
| 125 | Ga0097621_101602113 | 3300006237 | Bacteria | 619 |
| 126 | Ga0068871_100231390 | 3300006358 | Bacteria | 1604 |
| 127 | Ga0068871_100430846 | 3300006358 | Bacteria | 1179 |
| 128 | Ga0068871_101318085 | 3300006358 | Bacteria | 679 |
| 129 | Ga0068871_102122202 | 3300006358 | Bacteria | 535 |
| 130 | Ga0075428_100016231 | 3300006844 | Bacteria | 8232 |
| 131 | Ga0075430_100140229 | 3300006846 | Bacteria | 2013 |
| 132 | Ga0075431_100164710 | 3300006847 | Bacteria | 2279 |
| 133 | Ga0075431_100194592 | 3300006847 | Bacteria | 2076 |
| 134 | Ga0075434_100009273 | 3300006871 | Bacteria | 9170 |
| 135 | Ga0075429_100177162 | 3300006880 | Bacteria | 1868 |
| 136 | Ga0068865_100744632 | 3300006881 | Bacteria | 841 |
| 137 | Ga0079104_1000277 | 3300006946 | Bacteria | 66604 |
| 138 | Ga0075435_100003502 | 3300007076 | Bacteria | 10654 |
| 139 | Ga0105250_10006896 | 3300009092 | Bacteria | 4925 |
| 140 | Ga0105240_10067764 | 3300009093 | Bacteria | 4423 |
| 141 | Ga0105240_10134401 | 3300009093 | Bacteria | 2963 |
| 142 | Ga0105240_10551093 | 3300009093 | Bacteria | 1276 |
| 143 | Ga0105240_10687948 | 3300009093 | Bacteria | 1117 |
| 144 | Ga0105240_10827812 | 3300009093 | Bacteria | 1001 |
| 145 | Ga0105240_10944193 | 3300009093 | Bacteria | 925 |
| 146 | Ga0114129_10617559 | 3300009147 | Bacteria | 1403 |
| 147 | Ga0105243_10000420 | 3300009148 | Bacteria | 44548 |
| 148 | Ga0105243_10902516 | 3300009148 | Bacteria | 879 |
| 149 | Ga0105241_10062918 | 3300009174 | Bacteria | 2861 |
| 150 | Ga0105241_11237478 | 3300009174 | Bacteria | 708 |
| 151 | Ga0105242_10002467 | 3300009176 | Bacteria | 14516 |
| 152 | Ga0105237_10142576 | 3300009545 | Bacteria | 2390 |
| 153 | Ga0105237_11102122 | 3300009545 | Bacteria | 801 |
| 154 | Ga0105238_10011524 | 3300009551 | Bacteria | 8907 |
| 155 | Ga0105238_11085213 | 3300009551 | Bacteria | 823 |
| 156 | Ga0105249_10004576 | 3300009553 | Bacteria | 11952 |
| 157 | Ga0105035_126834 | 3300009988 | Bacteria | 557 |
| 158 | Ga0105239_10047942 | 3300010375 | Bacteria | 4682 |
| 159 | Ga0105239_10710192 | 3300010375 | Bacteria | 1150 |
| 160 | Ga0157373_10025251 | 3300013100 | Bacteria | 4299 |
| 161 | Ga0157373_10036879 | 3300013100 | Bacteria | 3507 |
| 162 | Ga0157373_10598211 | 3300013100 | Bacteria | 803 |
| 163 | Ga0157371_10007295 | 3300013102 | Bacteria | 8980 |
| 164 | Ga0157371_10036254 | 3300013102 | Bacteria | 3532 |
| 165 | Ga0157371_10336967 | 3300013102 | Bacteria | 1096 |
| 166 | Ga0157371_11313457 | 3300013102 | Bacteria | 560 |
| 167 | Ga0157370_10003655 | 3300013104 | Bacteria | 17975 |
| 168 | Ga0157370_10074895 | 3300013104 | Bacteria | 3193 |
| 169 | Ga0157370_10083506 | 3300013104 | Bacteria | 3003 |
| 170 | Ga0157369_10059872 | 3300013105 | Bacteria | 4107 |
| 171 | Ga0157369_10154529 | 3300013105 | Bacteria | 2424 |
| 172 | Ga0157369_10201358 | 3300013105 | Bacteria | 2090 |
| 173 | Ga0157369_10772666 | 3300013105 | Bacteria | 988 |
| 174 | Ga0157369_11129945 | 3300013105 | Bacteria | 800 |
| 175 | Ga0163162_13371110 | 3300013306 | Bacteria | 510 |
| 176 | Ga0157372_10005091 | 3300013307 | Bacteria | 13977 |
| 177 | Ga0157372_10024159 | 3300013307 | Bacteria | 6596 |
| 178 | Ga0157375_10389837 | 3300013308 | Bacteria | 1560 |
| 179 | Ga0163163_10005283 | 3300014325 | Bacteria | 11147 |
| 180 | Ga0157380_10000878 | 3300014326 | Bacteria | 18892 |
| 181 | Ga0157380_10390642 | 3300014326 | Bacteria | 1316 |
| 182 | Ga0182008_10148195 | 3300014497 | Bacteria | 1176 |
| 183 | Ga0163161_10341722 | 3300017792 | Bacteria | 1188 |
| 184 | Ga0197907_10385332 | 3300020069 | Bacteria | 2158 |
| 185 | Ga0197907_11127030 | 3300020069 | Bacteria | 2479 |
| 186 | Ga0206356_10060457 | 3300020070 | Bacteria | 1351 |
| 187 | Ga0206356_10109302 | 3300020070 | Bacteria | 5407 |
| 188 | Ga0206356_10553656 | 3300020070 | Bacteria | 3257 |
| 189 | Ga0206351_10724375 | 3300020077 | Bacteria | 531 |
| 190 | Ga0206354_10504112 | 3300020081 | Bacteria | 7864 |
| 191 | Ga0206354_11135313 | 3300020081 | Bacteria | 6897 |
| 192 | Ga0206354_11706343 | 3300020081 | Bacteria | 645 |
| 193 | Ga0206353_10383151 | 3300020082 | Bacteria | 8021 |
| 194 | Ga0206353_10424224 | 3300020082 | Bacteria | 2165 |
| 195 | Ga0206353_10613366 | 3300020082 | Bacteria | 2378 |
| 196 | Ga0206353_11924165 | 3300020082 | Bacteria | 917 |
| 197 | Ga0154015_1409539 | 3300020610 | Bacteria | 1794 |
| 198 | Ga0214542_1011270 | 3300021321 | Bacteria | 12356 |
| 199 | Ga0213874_10202732 | 3300021377 | Bacteria | 714 |
| 200 | Ga0207656_10033523 | 3300025321 | Bacteria | 2140 |
| 201 | Ga0207696_1011854 | 3300025711 | Bacteria | 3116 |
| 202 | Ga0207688_10150191 | 3300025901 | Bacteria | 1376 |
| 203 | Ga0207647_10001061 | 3300025904 | Bacteria | 21156 |
| 204 | Ga0207647_10010748 | 3300025904 | Bacteria | 6447 |
| 205 | Ga0207643_10004817 | 3300025908 | Bacteria | 7228 |
| 206 | Ga0207705_10000097 | 3300025909 | Bacteria | 105579 |
| 207 | Ga0207705_10000834 | 3300025909 | Bacteria | 25195 |
| 208 | Ga0207705_10006124 | 3300025909 | Bacteria | 8950 |
| 209 | Ga0207705_10026498 | 3300025909 | Bacteria | 4133 |
| 210 | Ga0207705_10053504 | 3300025909 | Bacteria | 2908 |
| 211 | Ga0207705_10144691 | 3300025909 | Bacteria | 1778 |
| 212 | Ga0207705_10146818 | 3300025909 | Bacteria | 1765 |
| 213 | Ga0207654_10019184 | 3300025911 | Bacteria | 3604 |
| 214 | Ga0207654_11059007 | 3300025911 | Bacteria | 590 |
| 215 | Ga0207707_10000084 | 3300025912 | Bacteria | 95228 |
| 216 | Ga0207707_10000857 | 3300025912 | Bacteria | 29704 |
| 217 | Ga0207707_10005881 | 3300025912 | Bacteria | 10725 |
| 218 | Ga0207707_10008675 | 3300025912 | Bacteria | 8822 |
| 219 | Ga0207707_10009470 | 3300025912 | Bacteria | 8446 |
| 220 | Ga0207707_10100963 | 3300025912 | Bacteria | 2521 |
| 221 | Ga0207707_10122505 | 3300025912 | Bacteria | 2274 |
| 222 | Ga0207695_10011179 | 3300025913 | Bacteria | 10892 |
| 223 | Ga0207695_10018711 | 3300025913 | Bacteria | 7998 |
| 224 | Ga0207695_10019178 | 3300025913 | Bacteria | 7880 |
| 225 | Ga0207695_10178547 | 3300025913 | Bacteria | 2045 |
| 226 | Ga0207695_10642393 | 3300025913 | Bacteria | 942 |
| 227 | Ga0207695_10988400 | 3300025913 | Bacteria | 721 |
| 228 | Ga0207671_10830623 | 3300025914 | Bacteria | 732 |
| 229 | Ga0207660_10001521 | 3300025917 | Bacteria | 15584 |
| 230 | Ga0207660_10001530 | 3300025917 | Bacteria | 15484 |
| 231 | Ga0207660_10003997 | 3300025917 | Bacteria | 9610 |
| 232 | Ga0207660_10004898 | 3300025917 | Bacteria | 8721 |
| 233 | Ga0207660_10055983 | 3300025917 | Bacteria | 2820 |
| 234 | Ga0207660_10240703 | 3300025917 | Bacteria | 1425 |
| 235 | Ga0207660_10936418 | 3300025917 | Bacteria | 707 |
| 236 | Ga0207657_10014069 | 3300025919 | Bacteria | 7829 |
| 237 | Ga0207657_10042195 | 3300025919 | Bacteria | 4026 |
| 238 | Ga0207657_10049754 | 3300025919 | Bacteria | 3649 |
| 239 | Ga0207657_10131960 | 3300025919 | Bacteria | 2047 |
| 240 | Ga0207657_10360697 | 3300025919 | Bacteria | 1146 |
| 241 | Ga0207657_10470924 | 3300025919 | Bacteria | 985 |
| 242 | Ga0207649_10001768 | 3300025920 | Bacteria | 12388 |
| 243 | Ga0207649_10003720 | 3300025920 | Bacteria | 8316 |
| 244 | Ga0207649_10571225 | 3300025920 | Bacteria | 867 |
| 245 | Ga0207652_10000076 | 3300025921 | Bacteria | 107686 |
| 246 | Ga0207652_10000877 | 3300025921 | Bacteria | 28477 |
| 247 | Ga0207652_10006664 | 3300025921 | Bacteria | 9303 |
| 248 | Ga0207652_10007625 | 3300025921 | Bacteria | 8709 |
| 249 | Ga0207652_10032061 | 3300025921 | Bacteria | 4414 |
| 250 | Ga0207652_10061296 | 3300025921 | Bacteria | 3248 |
| 251 | Ga0207652_10585395 | 3300025921 | Bacteria | 1001 |
| 252 | Ga0207652_10635631 | 3300025921 | Bacteria | 955 |
| 253 | Ga0207652_11094945 | 3300025921 | Bacteria | 697 |
| 254 | Ga0207694_10029811 | 3300025924 | Bacteria | 4165 |
| 255 | Ga0207694_10865440 | 3300025924 | Bacteria | 764 |
| 256 | Ga0207694_11049824 | 3300025924 | Bacteria | 689 |
| 257 | Ga0207650_10115906 | 3300025925 | Bacteria | 2080 |
| 258 | Ga0207690_10002736 | 3300025932 | Bacteria | 10647 |
| 259 | Ga0207690_10013712 | 3300025932 | Bacteria | 4878 |
| 260 | Ga0207690_10075972 | 3300025932 | Bacteria | 2331 |
| 261 | Ga0207686_10024084 | 3300025934 | Bacteria | 3522 |
| 262 | Ga0207709_10000129 | 3300025935 | Bacteria | 111395 |
| 263 | Ga0207669_11542281 | 3300025937 | Bacteria | 567 |
| 264 | Ga0207691_10309740 | 3300025940 | Bacteria | 1355 |
| 265 | Ga0207661_10038209 | 3300025944 | Bacteria | 3760 |
| 266 | Ga0207661_10128958 | 3300025944 | Bacteria | 2163 |
| 267 | Ga0207661_10172226 | 3300025944 | Bacteria | 1885 |
| 268 | Ga0207661_10667369 | 3300025944 | Bacteria | 956 |
| 269 | Ga0207679_10038342 | 3300025945 | Bacteria | 3413 |
| 270 | Ga0207679_11409150 | 3300025945 | Bacteria | 639 |
| 271 | Ga0207667_10002959 | 3300025949 | Bacteria | 21087 |
| 272 | Ga0207667_10014722 | 3300025949 | Bacteria | 8900 |
| 273 | Ga0207667_10014795 | 3300025949 | Bacteria | 8877 |
| 274 | Ga0207667_10777409 | 3300025949 | Bacteria | 955 |
| 275 | Ga0207712_10104026 | 3300025961 | Bacteria | 2116 |
| 276 | Ga0207668_11079286 | 3300025972 | Bacteria | 719 |
| 277 | Ga0207668_11594887 | 3300025972 | Bacteria | 589 |
| 278 | Ga0207640_10000979 | 3300025981 | Bacteria | 15855 |
| 279 | Ga0207640_10004353 | 3300025981 | Bacteria | 7672 |
| 280 | Ga0207640_10254308 | 3300025981 | Bacteria | 1365 |
| 281 | Ga0207640_10639309 | 3300025981 | Bacteria | 905 |
| 282 | Ga0207658_11966327 | 3300025986 | Bacteria | 532 |
| 283 | Ga0207677_10270468 | 3300026023 | Bacteria | 1390 |
| 284 | Ga0207639_10073931 | 3300026041 | Bacteria | 2674 |
| 285 | Ga0207639_10096255 | 3300026041 | Bacteria | 2381 |
| 286 | Ga0207639_10273664 | 3300026041 | Bacteria | 1482 |
| 287 | Ga0207678_10009472 | 3300026067 | Bacteria | 8568 |
| 288 | Ga0207678_10011335 | 3300026067 | Bacteria | 7823 |
| 289 | Ga0207678_10022141 | 3300026067 | Bacteria | 5569 |
| 290 | Ga0207678_10028507 | 3300026067 | Bacteria | 4874 |
| 291 | Ga0207678_10195661 | 3300026067 | Bacteria | 1728 |
| 292 | Ga0207708_10155277 | 3300026075 | Bacteria | 1804 |
| 293 | Ga0207702_10000919 | 3300026078 | Bacteria | 30440 |
| 294 | Ga0207702_10040120 | 3300026078 | Bacteria | 3924 |
| 295 | Ga0207702_10122161 | 3300026078 | Bacteria | 2332 |
| 296 | Ga0207702_12285435 | 3300026078 | Bacteria | 529 |
| 297 | Ga0207641_10225678 | 3300026088 | Bacteria | 1739 |
| 298 | Ga0207648_11389038 | 3300026089 | Bacteria | 660 |
| 299 | Ga0207674_10002322 | 3300026116 | Bacteria | 24094 |
| 300 | Ga0207674_10017736 | 3300026116 | Bacteria | 7759 |
| 301 | Ga0207675_100015267 | 3300026118 | Bacteria | 7165 |
| 302 | Ga0207675_100119146 | 3300026118 | Bacteria | 2497 |
| 303 | Ga0207683_10059028 | 3300026121 | Bacteria | 3369 |
| 304 | Ga0207698_10004349 | 3300026142 | Bacteria | 8627 |
| 305 | Ga0207698_10007073 | 3300026142 | Bacteria | 7028 |
| 306 | Ga0207698_10007093 | 3300026142 | Bacteria | 7018 |
| 307 | Ga0209281_1000067 | 3300027111 | Bacteria | 284517 |
| 308 | Ga0209981_1037480 | 3300027378 | Bacteria | 721 |
| 309 | Ga0209983_1029995 | 3300027665 | Bacteria | 1157 |
| 310 | Ga0209971_1003630 | 3300027682 | Bacteria | 3654 |
| 311 | Ga0209971_1013919 | 3300027682 | Bacteria | 1906 |
| 312 | Ga0209966_1011869 | 3300027695 | Bacteria | 1593 |
| 313 | Ga0209998_10043893 | 3300027717 | Bacteria | 1021 |
| 314 | Ga0209974_10035098 | 3300027876 | Bacteria | 1665 |
| 315 | Ga0209974_10161955 | 3300027876 | Bacteria | 812 |
| 316 | Ga0268266_10125804 | 3300028379 | Bacteria | 2287 |
| 317 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 318 | Ga0265320_10024395 | 3300031240 | Bacteria | 3199 |
| 319 | Ga0265340_10015534 | 3300031247 | Bacteria | 3954 |
| 320 | Ga0307408_100000213 | 3300031548 | Bacteria | 61855 |
| 321 | Ga0307408_100029463 | 3300031548 | Bacteria | 3804 |
| 322 | Ga0307408_100337916 | 3300031548 | Bacteria | 1274 |
| 323 | Ga0307408_101241990 | 3300031548 | Bacteria | 696 |
| 324 | Ga0307408_101261515 | 3300031548 | Bacteria | 691 |
| 325 | Ga0265314_10000013 | 3300031711 | Bacteria | 403405 |
| 326 | Ga0316578_10464948 | 3300031728 | Bacteria | 747 |
| 327 | Ga0307405_10073207 | 3300031731 | Bacteria | 2211 |
| 328 | Ga0307405_10482551 | 3300031731 | Bacteria | 990 |
| 329 | Ga0307413_10002558 | 3300031824 | Bacteria | 7432 |
| 330 | Ga0307413_10195753 | 3300031824 | Bacteria | 1455 |
| 331 | Ga0307413_10436689 | 3300031824 | Bacteria | 1035 |
| 332 | Ga0307413_10737427 | 3300031824 | Bacteria | 822 |
| 333 | Ga0307410_10013081 | 3300031852 | Bacteria | 4828 |
| 334 | Ga0307410_10993859 | 3300031852 | Bacteria | 723 |
| 335 | Ga0307410_11909196 | 3300031852 | Bacteria | 529 |
| 336 | Ga0326468_10007278 | 3300031889 | Bacteria | 1045 |
| 337 | Ga0307406_10002389 | 3300031901 | Bacteria | 10199 |
| 338 | Ga0307406_10002478 | 3300031901 | Bacteria | 10065 |
| 339 | Ga0307407_10000676 | 3300031903 | Bacteria | 11012 |
| 340 | Ga0307407_10682153 | 3300031903 | Bacteria | 772 |
| 341 | Ga0307407_10966657 | 3300031903 | Bacteria | 656 |
| 342 | Ga0307407_11482418 | 3300031903 | Bacteria | 536 |
| 343 | Ga0307412_10000383 | 3300031911 | Bacteria | 27626 |
| 344 | Ga0307412_10150092 | 3300031911 | Bacteria | 1719 |
| 345 | Ga0307409_100004288 | 3300031995 | Bacteria | 7976 |
| 346 | Ga0307409_100276579 | 3300031995 | Bacteria | 1549 |
| 347 | Ga0307409_100815293 | 3300031995 | Bacteria | 942 |
| 348 | Ga0307409_101825768 | 3300031995 | Bacteria | 637 |
| 349 | Ga0307416_100019477 | 3300032002 | Bacteria | 4812 |
| 350 | Ga0307416_100261913 | 3300032002 | Bacteria | 1691 |
| 351 | Ga0307416_101725253 | 3300032002 | Bacteria | 731 |
| 352 | Ga0307414_10052325 | 3300032004 | Bacteria | 2841 |
| 353 | Ga0307414_10348759 | 3300032004 | Bacteria | 1270 |
| 354 | Ga0307414_10434233 | 3300032004 | Bacteria | 1148 |
| 355 | Ga0307411_10503375 | 3300032005 | Bacteria | 1024 |
| 356 | Ga0307411_11273639 | 3300032005 | Bacteria | 669 |
| 357 | Ga0307411_11830013 | 3300032005 | Bacteria | 564 |
| 358 | Ga0307415_100011367 | 3300032126 | Bacteria | 5091 |
| 359 | Ga0373948_0100321 | 3300034817 | Bacteria | 681 |
| 360 | Ga0373950_0030212 | 3300034818 | Bacteria | 1000 |
| 361 | Ga0373928_0207145 | 3300035084 | Bacteria | 568 |
| 362 | Ga0373949_0012897 | 3300035090 | Bacteria | 1852 |
| 363 | Ga0373951_0279568 | 3300035091 | Bacteria | 509 |
| 364 | Ga0373932_0082750 | 3300035112 | Bacteria | 1017 |
| 365 | Ga0373941_0388408 | 3300035115 | Bacteria | 575 |
| 366 | Ga0373931_0045032 | 3300035691 | Bacteria | 2328 |
| 367 | Ga0395899_0000114 | 3300037312 | Bacteria | 134621 |
| 368 | Ga0395899_0005394 | 3300037312 | Bacteria | 9936 |
| 369 | Ga0395899_0053086 | 3300037312 | Bacteria | 3002 |
| 370 | Ga0395899_0084725 | 3300037312 | Bacteria | 2304 |
| 371 | Ga0395899_0283854 | 3300037312 | Bacteria | 1125 |
| 372 | Ga0395899_0891239 | 3300037312 | Bacteria | 543 |
| 373 | Ga0395900_0000246 | 3300037418 | Bacteria | 85104 |
| 374 | Ga0395900_0012176 | 3300037418 | Bacteria | 8793 |
| 375 | Ga0395900_0020317 | 3300037418 | Bacteria | 6778 |
| 376 | Ga0395900_0115620 | 3300037418 | Bacteria | 2753 |
| 377 | Ga0395900_0131562 | 3300037418 | Bacteria | 2564 |
| 378 | Ga0395900_0910451 | 3300037418 | Bacteria | 802 |
| 379 | Ga0395900_1089344 | 3300037418 | Bacteria | 716 |
| 380 | Ga0395898_0000447 | 3300037466 | Bacteria | 85103 |
| 381 | Ga0395898_0004315 | 3300037466 | Bacteria | 15582 |
| 382 | Ga0395898_0079560 | 3300037466 | Bacteria | 3162 |
| 383 | Ga0395898_0138364 | 3300037466 | Bacteria | 2331 |
| 384 | Ga0395898_0334533 | 3300037466 | Bacteria | 1444 |
| 385 | Ga0395905_0000228 | 3300037471 | Bacteria | 85103 |
| 386 | Ga0395905_0010260 | 3300037471 | Bacteria | 9122 |
| 387 | Ga0395905_1048508 | 3300037471 | Bacteria | 718 |
| 388 | Ga0395905_1477430 | 3300037471 | Bacteria | 584 |
| 389 | Ga0395905_1625742 | 3300037471 | Bacteria | 551 |
| 390 | Ga0395901_0000167 | 3300038443 | Bacteria | 85844 |
| 391 | Ga0395901_0004402 | 3300038443 | Bacteria | 14197 |
| 392 | Ga0395901_0014729 | 3300038443 | Bacteria | 7948 |
| 393 | Ga0395901_0056523 | 3300038443 | Bacteria | 4082 |
| 394 | Ga0395901_0235919 | 3300038443 | Bacteria | 1909 |
| 395 | Ga0395901_0249509 | 3300038443 | Bacteria | 1849 |
| 396 | Ga0395901_0256798 | 3300038443 | Bacteria | 1820 |
| 397 | Ga0395901_0817691 | 3300038443 | Bacteria | 919 |
| 398 | Ga0395901_0930216 | 3300038443 | Bacteria | 849 |
| 399 | Ga0395901_1003943 | 3300038443 | Bacteria | 810 |
| 400 | Ga0436363_0040042 | 3300039450 | Bacteria | 1464 |
| 401 | Ga0439453_0021497 | 3300041408 | Bacteria | 1164 |
| 402 | Ga0451787_037661 | 3300041441 | Bacteria | 645 |
| 403 | Ga0451791_0625845 | 3300041451 | Bacteria | 634 |
| 404 | Ga0451791_1300758 | 3300041451 | Bacteria | 646 |
| 405 | Ga0451802_0902181 | 3300041460 | Bacteria | 863 |
| 406 | Ga0451807_0414696 | 3300041486 | Bacteria | 638 |
| 407 | Ga0451807_2702882 | 3300041486 | Bacteria | 2862 |
| 408 | Ga0451837_0933495 | 3300041494 | Bacteria | 586 |
| 409 | Ga0451837_1701748 | 3300041494 | Bacteria | 713 |
| 410 | Ga0451851_0432079 | 3300041507 | Bacteria | 686 |
| 411 | Ga0451843_0396548 | 3300041509 | Bacteria | 925 |
| 412 | Ga0451853_0787453 | 3300041512 | Bacteria | 520 |
| 413 | Ga0439441_005271 | 3300042001 | Bacteria | 2000 |
| 414 | Ga0439443_023192 | 3300042003 | Bacteria | 989 |
| 415 | Ga0450919_001439 | 3300042121 | Bacteria | 3108 |
| 416 | Ga0450888_038723 | 3300042126 | Bacteria | 658 |
| 417 | Ga0439434_0183044 | 3300042435 | Bacteria | 702 |
| 418 | Ga0439435_0159084 | 3300042436 | Bacteria | 728 |
| 419 | Ga0439444_0022108 | 3300042437 | Bacteria | 1131 |
| 420 | Ga0439460_0074181 | 3300042461 | Bacteria | 1059 |
| 421 | Ga0450893_0085393 | 3300042532 | Bacteria | 628 |
| 422 | Ga0451577_0020696 | 3300042876 | Bacteria | 6033 |
| 423 | Ga0451577_0083016 | 3300042876 | Bacteria | 2859 |
| 424 | Ga0466961_0320523 | 3300044693 | Bacteria | 945 |
| 425 | Ga0466964_0059902 | 3300044706 | Bacteria | 1582 |
| 426 | Ga0453684_0297951 | 3300044712 | Bacteria | 1834 |
| 427 | Ga0451576_0035370 | 3300045051 | Bacteria | 5300 |
| 428 | Ga0466967_0021359 | 3300045976 | Bacteria | 5256 |
| 429 | Ga0466967_1101378 | 3300045976 | Bacteria | 791 |
| 430 | Ga0495638_0263957 | 3300046460 | Bacteria | 943 |
| 431 | Ga0495607_0000073 | 3300046501 | Bacteria | 100053 |
| 432 | Ga0495643_0289793 | 3300046522 | Bacteria | 750 |
| 433 | Ga0495633_0001245 | 3300046558 | Bacteria | 20322 |
| 434 | Ga0495633_0002109 | 3300046558 | Bacteria | 14284 |
| 435 | Ga0496105_0616116 | 3300048908 | Bacteria | 841 |
| 436 | Ga0496113_1138752 | 3300048916 | Bacteria | 611 |
| 437 | Ga0496116_0003563 | 3300048919 | Bacteria | 15304 |
| 438 | Ga0496116_0035018 | 3300048919 | Bacteria | 3531 |
| 439 | Ga0496116_0208160 | 3300048919 | Bacteria | 1016 |
| 440 | Ga0496117_0011712 | 3300048920 | Bacteria | 7823 |
| 441 | Ga0496117_0119548 | 3300048920 | Bacteria | 1622 |
| 442 | Ga0496118_0032058 | 3300048921 | Bacteria | 4340 |
| 443 | Ga0496119_0057087 | 3300048922 | Bacteria | 2361 |
| 444 | Ga0496119_0156753 | 3300048922 | Bacteria | 1215 |
| 445 | Ga0496120_0009451 | 3300048923 | Bacteria | 6912 |
| 446 | Ga0496121_0001225 | 3300048924 | Bacteria | 44636 |
| 447 | Ga0496121_0260034 | 3300048924 | Bacteria | 1199 |
| 448 | Ga0496122_0000021 | 3300048925 | Bacteria | 391363 |
| 449 | Ga0496122_0029036 | 3300048925 | Bacteria | 4676 |
| 450 | Ga0496122_0185929 | 3300048925 | Bacteria | 1232 |
| 451 | Ga0496123_0001255 | 3300048926 | Bacteria | 36486 |
| 452 | Ga0496123_0001826 | 3300048926 | Bacteria | 27983 |
| 453 | Ga0496123_0017505 | 3300048926 | Bacteria | 5761 |
| 454 | Ga0496123_0034717 | 3300048926 | Bacteria | 3607 |
| 455 | Ga0496124_0347440 | 3300048927 | Bacteria | 1050 |
| 456 | Ga0496125_0000005 | 3300048928 | Bacteria | 827598 |
| 457 | Ga0496125_0001215 | 3300048928 | Bacteria | 38708 |
| 458 | Ga0496125_0007745 | 3300048928 | Bacteria | 11368 |
| 459 | Ga0496125_0101668 | 3300048928 | Bacteria | 2114 |
| 460 | Ga0496125_0305502 | 3300048928 | Bacteria | 972 |
| 461 | Ga0496125_0339971 | 3300048928 | Bacteria | 901 |
| 462 | Ga0496126_0033384 | 3300048929 | Bacteria | 4842 |
| 463 | Ga0496126_0064339 | 3300048929 | Bacteria | 3286 |
| 464 | Ga0496126_0114087 | 3300048929 | Bacteria | 2351 |
| 465 | Ga0501299_180642 | 3300049522 | Bacteria | 551 |
| 466 | Ga0501031_0004079 | 3300049568 | Bacteria | 9429 |
| 467 | Ga0501031_0029220 | 3300049568 | Bacteria | 3596 |
| 468 | Ga0501032_0006844 | 3300049569 | Bacteria | 8364 |
| 469 | Ga0501032_0044295 | 3300049569 | Bacteria | 3013 |
| 470 | Ga0501032_0182628 | 3300049569 | Bacteria | 1373 |
| 471 | Ga0501032_0378282 | 3300049569 | Bacteria | 911 |
| 472 | Ga0501032_0563430 | 3300049569 | Bacteria | 726 |
| 473 | Ga0501032_0697025 | 3300049569 | Bacteria | 644 |
| 474 | Ga0501032_0769360 | 3300049569 | Bacteria | 609 |
| 475 | Ga0501033_0009861 | 3300049570 | Bacteria | 7328 |
| 476 | Ga0501033_0236996 | 3300049570 | Bacteria | 1295 |
| 477 | Ga0501033_0279276 | 3300049570 | Bacteria | 1179 |
| 478 | Ga0501033_0503782 | 3300049570 | Bacteria | 837 |
| 479 | Ga0501034_0000444 | 3300049571 | Bacteria | 68426 |
| 480 | Ga0501034_0051457 | 3300049571 | Bacteria | 4152 |
| 481 | Ga0501034_0193966 | 3300049571 | Bacteria | 1992 |
| 482 | Ga0501034_0288417 | 3300049571 | Bacteria | 1580 |
| 483 | Ga0501034_0342558 | 3300049571 | Bacteria | 1424 |
| 484 | Ga0501034_0448471 | 3300049571 | Bacteria | 1208 |
| 485 | Ga0501036_0013804 | 3300049572 | Bacteria | 6717 |
| 486 | Ga0501036_0050276 | 3300049572 | Bacteria | 3530 |
| 487 | Ga0501036_0131581 | 3300049572 | Bacteria | 2112 |
| 488 | Ga0501036_0206347 | 3300049572 | Bacteria | 1652 |
| 489 | Ga0501036_0770998 | 3300049572 | Bacteria | 793 |
| 490 | Ga0501036_1653713 | 3300049572 | Bacteria | 516 |
| 491 | Ga0501037_0002738 | 3300049573 | Bacteria | 12744 |
| 492 | Ga0501037_0063864 | 3300049573 | Bacteria | 2684 |
| 493 | Ga0501037_0100434 | 3300049573 | Bacteria | 2089 |
| 494 | Ga0501037_0124314 | 3300049573 | Bacteria | 1853 |
| 495 | Ga0501038_0026982 | 3300049574 | Bacteria | 5112 |
| 496 | Ga0501038_0028372 | 3300049574 | Bacteria | 4973 |
| 497 | Ga0501038_0036294 | 3300049574 | Bacteria | 4327 |
| 498 | Ga0501038_0086054 | 3300049574 | Bacteria | 2642 |
| 499 | Ga0501038_0179034 | 3300049574 | Bacteria | 1712 |
| 500 | Ga0501038_0200552 | 3300049574 | Bacteria | 1601 |
| 501 | Ga0501038_0775574 | 3300049574 | Bacteria | 714 |
| 502 | Ga0501038_0931762 | 3300049574 | Bacteria | 640 |
| 503 | Ga0501039_0007212 | 3300049575 | Bacteria | 8471 |
| 504 | Ga0501039_0012056 | 3300049575 | Bacteria | 6589 |
| 505 | Ga0501039_0089266 | 3300049575 | Bacteria | 2402 |
| 506 | Ga0501039_0302594 | 3300049575 | Bacteria | 1257 |
| 507 | Ga0501039_0515008 | 3300049575 | Bacteria | 939 |
| 508 | Ga0501039_0591229 | 3300049575 | Bacteria | 870 |
| 509 | Ga0501039_0994684 | 3300049575 | Bacteria | 652 |
| 510 | Ga0501040_0009228 | 3300049576 | Bacteria | 6423 |
| 511 | Ga0501040_0053048 | 3300049576 | Bacteria | 2776 |
| 512 | Ga0501040_0070058 | 3300049576 | Bacteria | 2419 |
| 513 | Ga0501040_0283296 | 3300049576 | Bacteria | 1184 |
| 514 | Ga0501040_0539230 | 3300049576 | Bacteria | 842 |
| 515 | Ga0501040_0999722 | 3300049576 | Bacteria | 606 |
| 516 | Ga0501040_1412810 | 3300049576 | Bacteria | 505 |
| 517 | Ga0501041_0009961 | 3300049577 | Bacteria | 5600 |
| 518 | Ga0501041_0035735 | 3300049577 | Bacteria | 3011 |
| 519 | Ga0501041_0273549 | 3300049577 | Bacteria | 1062 |
| 520 | Ga0501041_0647171 | 3300049577 | Bacteria | 676 |
| 521 | Ga0501041_1027214 | 3300049577 | Bacteria | 531 |
| 522 | Ga0501042_0016734 | 3300049578 | Bacteria | 5041 |
| 523 | Ga0501042_0031258 | 3300049578 | Bacteria | 3767 |
| 524 | Ga0501042_0077445 | 3300049578 | Bacteria | 2381 |
| 525 | Ga0501042_0107835 | 3300049578 | Bacteria | 2005 |
| 526 | Ga0501042_0358160 | 3300049578 | Bacteria | 1056 |
| 527 | Ga0501042_0442849 | 3300049578 | Bacteria | 942 |
| 528 | Ga0501042_0608569 | 3300049578 | Bacteria | 794 |
| 529 | Ga0501043_0031198 | 3300049579 | Bacteria | 4190 |
| 530 | Ga0501043_0075634 | 3300049579 | Bacteria | 2645 |
| 531 | Ga0501043_0164242 | 3300049579 | Bacteria | 1734 |
| 532 | Ga0501043_0255725 | 3300049579 | Bacteria | 1348 |
| 533 | Ga0501043_0296390 | 3300049579 | Bacteria | 1237 |
| 534 | Ga0501043_0332207 | 3300049579 | Bacteria | 1157 |
| 535 | Ga0501043_0880657 | 3300049579 | Bacteria | 643 |
| 536 | Ga0501043_1229887 | 3300049579 | Bacteria | 525 |
| 537 | Ga0501046_0006239 | 3300049580 | Bacteria | 10582 |
| 538 | Ga0501046_0087917 | 3300049580 | Bacteria | 2394 |
| 539 | Ga0501046_0106125 | 3300049580 | Bacteria | 2150 |
| 540 | Ga0501046_0461565 | 3300049580 | Bacteria | 912 |
| 541 | Ga0501046_0853947 | 3300049580 | Bacteria | 636 |
| 542 | Ga0501047_0021867 | 3300049581 | Bacteria | 6142 |
| 543 | Ga0501047_0173535 | 3300049581 | Bacteria | 2024 |
| 544 | Ga0501047_0182100 | 3300049581 | Bacteria | 1967 |
| 545 | Ga0501047_0262758 | 3300049581 | Bacteria | 1573 |
| 546 | Ga0501047_1222531 | 3300049581 | Bacteria | 565 |
| 547 | Ga0501048_0022535 | 3300049582 | Bacteria | 4605 |
| 548 | Ga0501048_0139174 | 3300049582 | Bacteria | 1716 |
| 549 | Ga0501048_0152278 | 3300049582 | Bacteria | 1636 |
| 550 | Ga0501048_0284265 | 3300049582 | Bacteria | 1176 |
| 551 | Ga0501048_0737046 | 3300049582 | Bacteria | 708 |
| 552 | Ga0501048_1258195 | 3300049582 | Bacteria | 532 |
| 553 | Ga0501068_0035148 | 3300049584 | Bacteria | 2990 |
| 554 | Ga0501069_0234696 | 3300049585 | Bacteria | 1068 |
| 555 | Ga0501069_0254713 | 3300049585 | Bacteria | 1024 |
| 556 | Ga0501069_0366137 | 3300049585 | Bacteria | 851 |
| 557 | Ga0501069_0372491 | 3300049585 | Bacteria | 843 |
| 558 | Ga0501070_0001023 | 3300049586 | Bacteria | 25130 |
| 559 | Ga0501070_0006781 | 3300049586 | Bacteria | 9745 |
| 560 | Ga0501070_0007437 | 3300049586 | Bacteria | 9302 |
| 561 | Ga0501070_0046515 | 3300049586 | Bacteria | 3608 |
| 562 | Ga0501070_0093558 | 3300049586 | Bacteria | 2487 |
| 563 | Ga0501070_0150655 | 3300049586 | Bacteria | 1919 |
| 564 | Ga0501070_0186508 | 3300049586 | Bacteria | 1706 |
| 565 | Ga0501070_0315796 | 3300049586 | Bacteria | 1271 |
| 566 | Ga0501070_0408179 | 3300049586 | Bacteria | 1098 |
| 567 | Ga0501070_0504172 | 3300049586 | Bacteria | 972 |
| 568 | Ga0501070_0920570 | 3300049586 | Bacteria | 681 |
| 569 | Ga0501071_0042283 | 3300049587 | Bacteria | 3264 |
| 570 | Ga0501071_0231158 | 3300049587 | Bacteria | 1393 |
| 571 | Ga0501071_1512137 | 3300049587 | Bacteria | 518 |
| 572 | Ga0501072_0016038 | 3300049588 | Bacteria | 5745 |
| 573 | Ga0501072_0019498 | 3300049588 | Bacteria | 5244 |
| 574 | Ga0501072_0056368 | 3300049588 | Bacteria | 3096 |
| 575 | Ga0501072_0280757 | 3300049588 | Bacteria | 1325 |
| 576 | Ga0501072_0513749 | 3300049588 | Bacteria | 947 |
| 577 | Ga0501073_0102813 | 3300049589 | Bacteria | 1984 |
| 578 | Ga0501073_0620591 | 3300049589 | Bacteria | 746 |
| 579 | Ga0501074_0004171 | 3300049590 | Bacteria | 10322 |
| 580 | Ga0501074_0075025 | 3300049590 | Bacteria | 2428 |
| 581 | Ga0501074_0455415 | 3300049590 | Bacteria | 907 |
| 582 | Ga0501074_0689664 | 3300049590 | Bacteria | 721 |
| 583 | Ga0501075_0016047 | 3300049591 | Bacteria | 5388 |
| 584 | Ga0501075_0020581 | 3300049591 | Bacteria | 4802 |
| 585 | Ga0501075_0036056 | 3300049591 | Bacteria | 3690 |
| 586 | Ga0501075_0652299 | 3300049591 | Bacteria | 802 |
| 587 | Ga0501075_0799818 | 3300049591 | Bacteria | 717 |
| 588 | Ga0501076_0003440 | 3300049592 | Bacteria | 11105 |
| 589 | Ga0501076_0013015 | 3300049592 | Bacteria | 6229 |
| 590 | Ga0501076_0105535 | 3300049592 | Bacteria | 2274 |
| 591 | Ga0501076_0333182 | 3300049592 | Bacteria | 1245 |
| 592 | Ga0501076_0726088 | 3300049592 | Bacteria | 820 |
| 593 | Ga0501076_1168396 | 3300049592 | Bacteria | 633 |
| 594 | Ga0501076_1367763 | 3300049592 | Bacteria | 582 |
| 595 | Ga0501077_0029031 | 3300049593 | Bacteria | 3516 |
| 596 | Ga0501077_0042541 | 3300049593 | Bacteria | 2888 |
| 597 | Ga0501077_0063099 | 3300049593 | Bacteria | 2351 |
| 598 | Ga0501077_0164588 | 3300049593 | Bacteria | 1408 |
| 599 | Ga0501249_063576 | 3300049679 | Bacteria | 857 |
| 600 | Ga0501079_0098650 | 3300049741 | Bacteria | 2264 |
| 601 | Ga0501079_0116141 | 3300049741 | Bacteria | 2080 |
| 602 | Ga0501079_0236125 | 3300049741 | Bacteria | 1428 |
| 603 | Ga0501079_0964461 | 3300049741 | Bacteria | 672 |
| 604 | Ga0501080_0070656 | 3300049742 | Bacteria | 3247 |
| 605 | Ga0501080_0158788 | 3300049742 | Bacteria | 2089 |
| 606 | Ga0501080_0222210 | 3300049742 | Bacteria | 1728 |
| 607 | Ga0501080_0573699 | 3300049742 | Bacteria | 1003 |
| 608 | Ga0501080_1368685 | 3300049742 | Bacteria | 604 |
| 609 | Ga0501081_0073062 | 3300049743 | Bacteria | 2392 |
| 610 | Ga0501081_0093098 | 3300049743 | Bacteria | 2122 |
| 611 | Ga0501081_0114647 | 3300049743 | Bacteria | 1915 |
| 612 | Ga0501081_0978720 | 3300049743 | Bacteria | 639 |
| 613 | Ga0501081_1263654 | 3300049743 | Bacteria | 560 |
| 614 | Ga0501083_0081449 | 3300049744 | Bacteria | 2146 |
| 615 | Ga0501083_0129862 | 3300049744 | Bacteria | 1652 |
| 616 | Ga0501083_0196534 | 3300049744 | Bacteria | 1316 |
| 617 | Ga0501035_0002723 | 3300049822 | Bacteria | 17155 |
| 618 | Ga0501035_0007737 | 3300049822 | Bacteria | 10036 |
| 619 | Ga0501035_0039585 | 3300049822 | Bacteria | 4265 |
| 620 | Ga0501035_0310836 | 3300049822 | Bacteria | 1326 |
| 621 | Ga0501035_0342653 | 3300049822 | Bacteria | 1252 |
| 622 | Ga0501035_1103775 | 3300049822 | Bacteria | 619 |
| 623 | Ga0501044_0001822 | 3300049823 | Bacteria | 24824 |
| 624 | Ga0501044_0036766 | 3300049823 | Bacteria | 5121 |
| 625 | Ga0501044_0037701 | 3300049823 | Bacteria | 5051 |
| 626 | Ga0501044_0078495 | 3300049823 | Bacteria | 3345 |
| 627 | Ga0501044_0309770 | 3300049823 | Bacteria | 1506 |
| 628 | Ga0501044_0369638 | 3300049823 | Bacteria | 1351 |
| 629 | Ga0501044_0459696 | 3300049823 | Bacteria | 1178 |
| 630 | Ga0501044_1361259 | 3300049823 | Bacteria | 576 |
| 631 | Ga0501045_0010575 | 3300049824 | Bacteria | 6464 |
| 632 | Ga0501045_0065497 | 3300049824 | Bacteria | 2667 |
| 633 | Ga0501045_0082666 | 3300049824 | Bacteria | 2368 |
| 634 | Ga0501045_0321677 | 3300049824 | Bacteria | 1151 |
| 635 | Ga0501045_0412189 | 3300049824 | Bacteria | 1005 |
| 636 | Ga0501045_0879550 | 3300049824 | Bacteria | 658 |
| 637 | nmdc:mga00v17_126226_c1 | 3300050491 | Bacteria | 1633 |
| 638 | nmdc:mga0yw44_198151_c1 | 3300050492 | Bacteria | 1326 |
| 639 | nmdc:mga05p37_228293_c1 | 3300050507 | Bacteria | 2244 |
| 640 | nmdc:mga09592_91302_c1 | 3300050508 | Bacteria | 2603 |
| 641 | nmdc:mga0qj67_115199_c1 | 3300050509 | Bacteria | 2172 |
| 642 | nmdc:mga0qj67_202487_c1 | 3300050509 | Bacteria | 1613 |
| 643 | nmdc:mga06r32_455575_c1 | 3300050510 | Bacteria | 1259 |
| 644 | nmdc:mga0n895_1257339_c1 | 3300050512 | Bacteria | 712 |
| 645 | nmdc:mga0n895_147278_c1 | 3300050512 | Bacteria | 2384 |
| 646 | nmdc:mga0rr50_13981_c1 | 3300050513 | Bacteria | 5247 |
| 647 | nmdc:mga08x19_1044_c1 | 3300050514 | Bacteria | 17303 |
| 648 | Ga0500579_279069 | 3300053143 | Bacteria | 513 |
| 649 | Ga0500634_0006492 | 3300053161 | Bacteria | 5667 |
| 650 | Ga0500634_0082144 | 3300053161 | Bacteria | 1657 |
| 651 | Ga0501084_0012973 | 3300054114 | Bacteria | 6898 |
| 652 | Ga0501084_0103821 | 3300054114 | Bacteria | 2387 |
| 653 | Ga0501084_0127356 | 3300054114 | Bacteria | 2143 |
| 654 | Ga0590071_040255 | 3300059421 | Bacteria | 1124 |
| 655 | Ga0590074_023864 | 3300059423 | Bacteria | 1062 |
| 656 | Ga0590077_026885 | 3300059426 | Bacteria | 1245 |
| 657 | Ga0501082_0173156 | 3300060353 | Bacteria | 1877 |
| 658 | Ga0501082_0388231 | 3300060353 | Bacteria | 1218 |
| 659 | Ga0530510_0791275 | 3300061734 | Bacteria | 723 |
| 660 | Ga0530510_0966563 | 3300061734 | Bacteria | 651 |
| 661 | 2538834337 | 2537561836 | Bacteria | 3910579 |
| 662 | 2643772933 | 2643221550 | Bacteria | 4619371 |
| 663 | 2643828725 | 2643221562 | Bacteria | 4048635 |
| 664 | 2643866781 | 2643221570 | Bacteria | 5103772 |
| 665 | 2643894650 | 2643221577 | Bacteria | 3710843 |
| 666 | 2643993500 | 2643221596 | Bacteria | 5006805 |
| 667 | 2644076329 | 2643221611 | Bacteria | 6820941 |
| 668 | 2644133098 | 2643221623 | Bacteria | 5239945 |
| 669 | 2644248802 | 2643221644 | Bacteria | 6865017 |
| 670 | 2644294637 | 2643221652 | Bacteria | 5140275 |
| 671 | 2644476799 | 2643221685 | Bacteria | 3673288 |
| 672 | 2722882795 | 2721755523 | Bacteria | 6430384 |
| 673 | 2739244660 | 2738543012 | Bacteria | 7115078 |
| 674 | 2739305876 | 2738543024 | Bacteria | 5603683 |
| 675 | 2739613519 | 2739367655 | Bacteria | 4051151 |
| 676 | 2792461935 | 2791355048 | Bacteria | 5832535 |
| 677 | 2816475136 | 2816332133 | Bacteria | 7249298 |
| 678 | 2839138506 | 2839138175 | Bacteria | 6549354 |
| 679 | 2842719654 | 2842718218 | Bacteria | 4560148 |
| 680 | 2843748797 | 2843744320 | Bacteria | 5659202 |
| 681 | 2849562162 | 2849560528 | Bacteria | 5393480 |
| 682 | 2849578836 | 2849573788 | Bacteria | 5421256 |
| 683 | 2851156600 | 2851153111 | Bacteria | 5542585 |
| 684 | 2857579405 | 2857576091 | Bacteria | 5465855 |
| 685 | 2881927982 | 2881927736 | Bacteria | 3993927 |
| 686 | 2887379132 | 2887375801 | Bacteria | 5334027 |
| 687 | 2894026015 | 2894023352 | Bacteria | 5167372 |
| 688 | 2898330269 | 2898329390 | Bacteria | 5168154 |
| 689 | 2928972609 | 2928972540 | Bacteria | 3058286 |
| 690 | 2932426263 | 2932422444 | Bacteria | 4678430 |
| 691 | 2941488177 | 2941485952 | Bacteria | 3591484 |
| 692 | 2974323722 | 2974320154 | Bacteria | 4571377 |
| 693 | 2977242389 | 2977240413 | Bacteria | 3191065 |
| 694 | 2996314961 | 2996310559 | Bacteria | 6357320 |
| 695 | 8002394624 | 8002392321 | Bacteria | 4159911 |
| 696 | Ga0265330_10000254 | |||
| 697 | JGI24736J21556_1009888 | |||
| 698 | JGI24741J21665_1001494 | |||
| 699 | JGI24741J21665_1012384 | |||
| 700 | JGI24740J21852_10000276 | |||
| 701 | rootH2_10192889 | |||
| 702 | Ga0006562J51391_1099889 | |||
| 703 | Ga0055524_1000125 | |||
| 704 | Ga0065707_10692077 | |||
| 705 | Ga0070658_10089038 | |||
| 706 | Ga0070658_10250440 | |||
| 707 | Ga0070658_11053201 | |||
| 708 | Ga0070683_100005702 | |||
| 709 | Ga0070683_100186078 | |||
| 710 | Ga0070683_100714098 | |||
| 711 | Ga0070670_100023926 | |||
| 712 | Ga0070670_100139620 | |||
| 713 | Ga0070670_100975871 | |||
| 714 | Ga0070677_10829120 | |||
| 715 | Ga0070666_10500343 | |||
| 716 | Ga0070680_100006885 | |||
| 717 | Ga0070680_100009650 | |||
| 718 | Ga0070680_100081559 | |||
| 719 | Ga0070680_100405442 | |||
| 720 | Ga0070680_100465620 | |||
| 721 | Ga0070680_101261526 | |||
| 722 | Ga0070682_100001386 | |||
| 723 | Ga0070682_100003406 | |||
| 724 | Ga0070682_100040276 | |||
| 725 | Ga0070682_100798019 | |||
| 726 | Ga0070660_100027016 | |||
| 727 | Ga0070660_100372307 | |||
| 728 | Ga0070660_100386202 | |||
| 729 | Ga0070691_10000277 | |||
| 730 | Ga0070691_10095086 | |||
| 731 | Ga0070691_10216246 | |||
| 732 | Ga0070691_10491873 | |||
| 733 | Ga0070661_100042220 | |||
| 734 | Ga0070661_100190080 | |||
| 735 | Ga0070661_100226570 | |||
| 736 | Ga0070661_100250152 | |||
| 737 | Ga0070692_10002517 | |||
| 738 | Ga0070692_10117564 | |||
| 739 | Ga0070668_101084267 | |||
| 740 | Ga0070668_101790262 | |||
| 741 | Ga0070669_100932825 | |||
| 742 | Ga0070669_101035979 | |||
| 743 | Ga0070674_100835269 | |||
| 744 | Ga0070674_101139229 | |||
| 745 | Ga0070688_101632003 | |||
| 746 | Ga0070659_100038621 | |||
| 747 | Ga0070709_10996237 | |||
| 748 | Ga0070705_100017726 | |||
| 749 | Ga0070700_100067544 | |||
| 750 | Ga0070694_100177163 | |||
| 751 | Ga0070663_100002556 | |||
| 752 | Ga0070663_100006672 | |||
| 753 | Ga0070663_100371541 | |||
| 754 | Ga0070663_100477671 | |||
| 755 | Ga0070678_101147262 | |||
| 756 | Ga0070681_10001382 | |||
| 757 | Ga0070681_10004469 | |||
| 758 | Ga0070681_10015158 | |||
| 759 | Ga0070681_10015785 | |||
| 760 | Ga0070681_10475261 | |||
| 761 | Ga0068867_100235149 | |||
| 762 | Ga0070685_10024452 | |||
| 763 | Ga0070699_100753356 | |||
| 764 | Ga0070699_101372186 | |||
| 765 | Ga0070679_100001222 | |||
| 766 | Ga0070679_100003450 | |||
| 767 | Ga0070679_100038465 | |||
| 768 | Ga0070679_100075044 | |||
| 769 | Ga0070679_100318600 | |||
| 770 | Ga0070679_101462119 | |||
| 771 | Ga0070684_100014201 | |||
| 772 | Ga0070684_100942942 | |||
| 773 | Ga0070697_100375615 | |||
| 774 | Ga0068853_100065274 | |||
| 775 | Ga0068853_101095999 | |||
| 776 | Ga0068853_101527266 | |||
| 777 | Ga0070686_100031508 | |||
| 778 | Ga0070695_100388492 | |||
| 779 | Ga0070695_100695441 | |||
| 780 | Ga0070696_100015693 | |||
| 781 | Ga0070696_100031994 | |||
| 782 | Ga0070696_100078838 | |||
| 783 | Ga0070696_100195891 | |||
| 784 | Ga0070693_100005075 | |||
| 785 | Ga0070693_100224761 | |||
| 786 | Ga0070693_101207556 | |||
| 787 | Ga0070665_100005783 | |||
| 788 | Ga0070665_100109087 | |||
| 789 | Ga0070665_100406779 | |||
| 790 | Ga0070665_100467795 | |||
| 791 | Ga0070665_100486248 | |||
| 792 | Ga0070704_101005865 | |||
| 793 | Ga0068855_100042559 | |||
| 794 | Ga0068855_100067522 | |||
| 795 | Ga0068855_100253380 | |||
| 796 | Ga0070664_100442014 | |||
| 797 | Ga0070664_100447656 | |||
| 798 | Ga0068857_100020655 | |||
| 799 | Ga0068854_100078635 | |||
| 800 | Ga0068854_100109213 | |||
| 801 | Ga0068854_100153699 | |||
| 802 | Ga0068856_100043672 | |||
| 803 | Ga0068856_100604641 | |||
| 804 | Ga0068856_101162343 | |||
| 805 | Ga0070702_100911593 | |||
| 806 | Ga0068852_100150965 | |||
| 807 | Ga0068852_100199845 | |||
| 808 | Ga0068852_101100076 | |||
| 809 | Ga0068861_100072648 | |||
| 810 | Ga0068861_100617433 | |||
| 811 | Ga0068851_10009774 | |||
| 812 | Ga0068851_10047048 | |||
| 813 | Ga0068870_10005224 | |||
| 814 | Ga0068863_100459487 | |||
| 815 | Ga0068860_100636318 | |||
| 816 | Ga0068860_100696859 | |||
| 817 | Ga0075365_10082779 | |||
| 818 | Ga0075364_10057057 | |||
| 819 | Ga0075364_10815319 | |||
| 820 | Ga0097621_101602113 | |||
| 821 | Ga0068871_100231390 | |||
| 822 | Ga0068871_100430846 | |||
| 823 | Ga0068871_101318085 | |||
| 824 | Ga0068871_102122202 | |||
| 825 | Ga0075428_100016231 | |||
| 826 | Ga0075430_100140229 | |||
| 827 | Ga0075431_100164710 | |||
| 828 | Ga0075431_100194592 | |||
| 829 | Ga0075434_100009273 | |||
| 830 | Ga0075429_100177162 | |||
| 831 | Ga0068865_100744632 | |||
| 832 | Ga0079104_1000277 | |||
| 833 | Ga0075435_100003502 | |||
| 834 | Ga0105250_10006896 | |||
| 835 | Ga0105240_10067764 | |||
| 836 | Ga0105240_10134401 | |||
| 837 | Ga0105240_10551093 | |||
| 838 | Ga0105240_10687948 | |||
| 839 | Ga0105240_10827812 | |||
| 840 | Ga0105240_10944193 | |||
| 841 | Ga0114129_10617559 | |||
| 842 | Ga0105243_10000420 | |||
| 843 | Ga0105243_10902516 | |||
| 844 | Ga0105241_10062918 | |||
| 845 | Ga0105241_11237478 | |||
| 846 | Ga0105242_10002467 | |||
| 847 | Ga0105237_10142576 | |||
| 848 | Ga0105237_11102122 | |||
| 849 | Ga0105238_10011524 | |||
| 850 | Ga0105238_11085213 | |||
| 851 | Ga0105249_10004576 | |||
| 852 | Ga0105035_126834 | |||
| 853 | Ga0105239_10047942 | |||
| 854 | Ga0105239_10710192 | |||
| 855 | Ga0157373_10025251 | |||
| 856 | Ga0157373_10036879 | |||
| 857 | Ga0157373_10598211 | |||
| 858 | Ga0157371_10007295 | |||
| 859 | Ga0157371_10036254 | |||
| 860 | Ga0157371_10336967 | |||
| 861 | Ga0157371_11313457 | |||
| 862 | Ga0157370_10003655 | |||
| 863 | Ga0157370_10074895 | |||
| 864 | Ga0157370_10083506 | |||
| 865 | Ga0157369_10059872 | |||
| 866 | Ga0157369_10154529 | |||
| 867 | Ga0157369_10201358 | |||
| 868 | Ga0157369_10772666 | |||
| 869 | Ga0157369_11129945 | |||
| 870 | Ga0163162_13371110 | |||
| 871 | Ga0157372_10005091 | |||
| 872 | Ga0157372_10024159 | |||
| 873 | Ga0157375_10389837 | |||
| 874 | Ga0163163_10005283 | |||
| 875 | Ga0157380_10000878 | |||
| 876 | Ga0157380_10390642 | |||
| 877 | Ga0182008_10148195 | |||
| 878 | Ga0163161_10341722 | |||
| 879 | Ga0197907_10385332 | |||
| 880 | Ga0197907_11127030 | |||
| 881 | Ga0206356_10060457 | |||
| 882 | Ga0206356_10109302 | |||
| 883 | Ga0206356_10553656 | |||
| 884 | Ga0206351_10724375 | |||
| 885 | Ga0206354_10504112 | |||
| 886 | Ga0206354_11135313 | |||
| 887 | Ga0206354_11706343 | |||
| 888 | Ga0206353_10383151 | |||
| 889 | Ga0206353_10424224 | |||
| 890 | Ga0206353_10613366 | |||
| 891 | Ga0206353_11924165 | |||
| 892 | Ga0154015_1409539 | |||
| 893 | Ga0214542_1011270 | |||
| 894 | Ga0213874_10202732 | |||
| 895 | Ga0207656_10033523 | |||
| 896 | Ga0207696_1011854 | |||
| 897 | Ga0207688_10150191 | |||
| 898 | Ga0207647_10001061 | |||
| 899 | Ga0207647_10010748 | |||
| 900 | Ga0207643_10004817 | |||
| 901 | Ga0207705_10000097 | |||
| 902 | Ga0207705_10000834 | |||
| 903 | Ga0207705_10006124 | |||
| 904 | Ga0207705_10026498 | |||
| 905 | Ga0207705_10053504 | |||
| 906 | Ga0207705_10144691 | |||
| 907 | Ga0207705_10146818 | |||
| 908 | Ga0207654_10019184 | |||
| 909 | Ga0207654_11059007 | |||
| 910 | Ga0207707_10000084 | |||
| 911 | Ga0207707_10000857 | |||
| 912 | Ga0207707_10005881 | |||
| 913 | Ga0207707_10008675 | |||
| 914 | Ga0207707_10009470 | |||
| 915 | Ga0207707_10100963 | |||
| 916 | Ga0207707_10122505 | |||
| 917 | Ga0207695_10011179 | |||
| 918 | Ga0207695_10018711 | |||
| 919 | Ga0207695_10019178 | |||
| 920 | Ga0207695_10178547 | |||
| 921 | Ga0207695_10642393 | |||
| 922 | Ga0207695_10988400 | |||
| 923 | Ga0207671_10830623 | |||
| 924 | Ga0207660_10001521 | |||
| 925 | Ga0207660_10001530 | |||
| 926 | Ga0207660_10003997 | |||
| 927 | Ga0207660_10004898 | |||
| 928 | Ga0207660_10055983 | |||
| 929 | Ga0207660_10240703 | |||
| 930 | Ga0207660_10936418 | |||
| 931 | Ga0207657_10014069 | |||
| 932 | Ga0207657_10042195 | |||
| 933 | Ga0207657_10049754 | |||
| 934 | Ga0207657_10131960 | |||
| 935 | Ga0207657_10360697 | |||
| 936 | Ga0207657_10470924 | |||
| 937 | Ga0207649_10001768 | |||
| 938 | Ga0207649_10003720 | |||
| 939 | Ga0207649_10571225 | |||
| 940 | Ga0207652_10000076 | |||
| 941 | Ga0207652_10000877 | |||
| 942 | Ga0207652_10006664 | |||
| 943 | Ga0207652_10007625 | |||
| 944 | Ga0207652_10032061 | |||
| 945 | Ga0207652_10061296 | |||
| 946 | Ga0207652_10585395 | |||
| 947 | Ga0207652_10635631 | |||
| 948 | Ga0207652_11094945 | |||
| 949 | Ga0207694_10029811 | |||
| 950 | Ga0207694_10865440 | |||
| 951 | Ga0207694_11049824 | |||
| 952 | Ga0207650_10115906 | |||
| 953 | Ga0207690_10002736 | |||
| 954 | Ga0207690_10013712 | |||
| 955 | Ga0207690_10075972 | |||
| 956 | Ga0207686_10024084 | |||
| 957 | Ga0207709_10000129 | |||
| 958 | Ga0207669_11542281 | |||
| 959 | Ga0207691_10309740 | |||
| 960 | Ga0207661_10038209 | |||
| 961 | Ga0207661_10128958 | |||
| 962 | Ga0207661_10172226 | |||
| 963 | Ga0207661_10667369 | |||
| 964 | Ga0207679_10038342 | |||
| 965 | Ga0207679_11409150 | |||
| 966 | Ga0207667_10002959 | |||
| 967 | Ga0207667_10014722 | |||
| 968 | Ga0207667_10014795 | |||
| 969 | Ga0207667_10777409 | |||
| 970 | Ga0207712_10104026 | |||
| 971 | Ga0207668_11079286 | |||
| 972 | Ga0207668_11594887 | |||
| 973 | Ga0207640_10000979 | |||
| 974 | Ga0207640_10004353 | |||
| 975 | Ga0207640_10254308 | |||
| 976 | Ga0207640_10639309 | |||
| 977 | Ga0207658_11966327 | |||
| 978 | Ga0207677_10270468 | |||
| 979 | Ga0207639_10073931 | |||
| 980 | Ga0207639_10096255 | |||
| 981 | Ga0207639_10273664 | |||
| 982 | Ga0207678_10009472 | |||
| 983 | Ga0207678_10011335 | |||
| 984 | Ga0207678_10022141 | |||
| 985 | Ga0207678_10028507 | |||
| 986 | Ga0207678_10195661 | |||
| 987 | Ga0207708_10155277 | |||
| 988 | Ga0207702_10000919 | |||
| 989 | Ga0207702_10040120 | |||
| 990 | Ga0207702_10122161 | |||
| 991 | Ga0207702_12285435 | |||
| 992 | Ga0207641_10225678 | |||
| 993 | Ga0207648_11389038 | |||
| 994 | Ga0207674_10002322 | |||
| 995 | Ga0207674_10017736 | |||
| 996 | Ga0207675_100015267 | |||
| 997 | Ga0207675_100119146 | |||
| 998 | Ga0207683_10059028 | |||
| 999 | Ga0207698_10004349 | |||
| 1000 | Ga0207698_10007073 | |||
| 1001 | Ga0207698_10007093 | |||
| 1002 | Ga0209281_1000067 | |||
| 1003 | Ga0209981_1037480 | |||
| 1004 | Ga0209983_1029995 | |||
| 1005 | Ga0209971_1003630 | |||
| 1006 | Ga0209971_1013919 | |||
| 1007 | Ga0209966_1011869 | |||
| 1008 | Ga0209998_10043893 | |||
| 1009 | Ga0209974_10035098 | |||
| 1010 | Ga0209974_10161955 | |||
| 1011 | Ga0268266_10125804 | |||
| 1012 | Ga0265332_10000001 | |||
| 1013 | Ga0265320_10024395 | |||
| 1014 | Ga0265340_10015534 | |||
| 1015 | Ga0307408_100000213 | |||
| 1016 | Ga0307408_100029463 | |||
| 1017 | Ga0307408_100337916 | |||
| 1018 | Ga0307408_101241990 | |||
| 1019 | Ga0307408_101261515 | |||
| 1020 | Ga0265314_10000013 | |||
| 1021 | Ga0316578_10464948 | |||
| 1022 | Ga0307405_10073207 | |||
| 1023 | Ga0307405_10482551 | |||
| 1024 | Ga0307413_10002558 | |||
| 1025 | Ga0307413_10195753 | |||
| 1026 | Ga0307413_10436689 | |||
| 1027 | Ga0307413_10737427 | |||
| 1028 | Ga0307410_10013081 | |||
| 1029 | Ga0307410_10993859 | |||
| 1030 | Ga0307410_11909196 | |||
| 1031 | Ga0326468_10007278 | |||
| 1032 | Ga0307406_10002389 | |||
| 1033 | Ga0307406_10002478 | |||
| 1034 | Ga0307407_10000676 | |||
| 1035 | Ga0307407_10682153 | |||
| 1036 | Ga0307407_10966657 | |||
| 1037 | Ga0307407_11482418 | |||
| 1038 | Ga0307412_10000383 | |||
| 1039 | Ga0307412_10150092 | |||
| 1040 | Ga0307409_100004288 | |||
| 1041 | Ga0307409_100276579 | |||
| 1042 | Ga0307409_100815293 | |||
| 1043 | Ga0307409_101825768 | |||
| 1044 | Ga0307416_100019477 | |||
| 1045 | Ga0307416_100261913 | |||
| 1046 | Ga0307416_101725253 | |||
| 1047 | Ga0307414_10052325 | |||
| 1048 | Ga0307414_10348759 | |||
| 1049 | Ga0307414_10434233 | |||
| 1050 | Ga0307411_10503375 | |||
| 1051 | Ga0307411_11273639 | |||
| 1052 | Ga0307411_11830013 | |||
| 1053 | Ga0307415_100011367 | |||
| 1054 | Ga0373948_0100321 | |||
| 1055 | Ga0373950_0030212 | |||
| 1056 | Ga0373928_0207145 | |||
| 1057 | Ga0373949_0012897 | |||
| 1058 | Ga0373951_0279568 | |||
| 1059 | Ga0373932_0082750 | |||
| 1060 | Ga0373941_0388408 | |||
| 1061 | Ga0373931_0045032 | |||
| 1062 | Ga0395899_0000114 | |||
| 1063 | Ga0395899_0005394 | |||
| 1064 | Ga0395899_0053086 | |||
| 1065 | Ga0395899_0084725 | |||
| 1066 | Ga0395899_0283854 | |||
| 1067 | Ga0395899_0891239 | |||
| 1068 | Ga0395900_0000246 | |||
| 1069 | Ga0395900_0012176 | |||
| 1070 | Ga0395900_0020317 | |||
| 1071 | Ga0395900_0115620 | |||
| 1072 | Ga0395900_0131562 | |||
| 1073 | Ga0395900_0910451 | |||
| 1074 | Ga0395900_1089344 | |||
| 1075 | Ga0395898_0000447 | |||
| 1076 | Ga0395898_0004315 | |||
| 1077 | Ga0395898_0079560 | |||
| 1078 | Ga0395898_0138364 | |||
| 1079 | Ga0395898_0334533 | |||
| 1080 | Ga0395905_0000228 | |||
| 1081 | Ga0395905_0010260 | |||
| 1082 | Ga0395905_1048508 | |||
| 1083 | Ga0395905_1477430 | |||
| 1084 | Ga0395905_1625742 | |||
| 1085 | Ga0395901_0000167 | |||
| 1086 | Ga0395901_0004402 | |||
| 1087 | Ga0395901_0014729 | |||
| 1088 | Ga0395901_0056523 | |||
| 1089 | Ga0395901_0235919 | |||
| 1090 | Ga0395901_0249509 | |||
| 1091 | Ga0395901_0256798 | |||
| 1092 | Ga0395901_0817691 | |||
| 1093 | Ga0395901_0930216 | |||
| 1094 | Ga0395901_1003943 | |||
| 1095 | Ga0436363_0040042 | |||
| 1096 | Ga0439453_0021497 | |||
| 1097 | Ga0451787_037661 | |||
| 1098 | Ga0451791_0625845 | |||
| 1099 | Ga0451791_1300758 | |||
| 1100 | Ga0451802_0902181 | |||
| 1101 | Ga0451807_0414696 | |||
| 1102 | Ga0451807_2702882 | |||
| 1103 | Ga0451837_0933495 | |||
| 1104 | Ga0451837_1701748 | |||
| 1105 | Ga0451851_0432079 | |||
| 1106 | Ga0451843_0396548 | |||
| 1107 | Ga0451853_0787453 | |||
| 1108 | Ga0439441_005271 | |||
| 1109 | Ga0439443_023192 | |||
| 1110 | Ga0450919_001439 | |||
| 1111 | Ga0450888_038723 | |||
| 1112 | Ga0439434_0183044 | |||
| 1113 | Ga0439435_0159084 | |||
| 1114 | Ga0439444_0022108 | |||
| 1115 | Ga0439460_0074181 | |||
| 1116 | Ga0450893_0085393 | |||
| 1117 | Ga0451577_0020696 | |||
| 1118 | Ga0451577_0083016 | |||
| 1119 | Ga0466961_0320523 | |||
| 1120 | Ga0466964_0059902 | |||
| 1121 | Ga0453684_0297951 | |||
| 1122 | Ga0451576_0035370 | |||
| 1123 | Ga0466967_0021359 | |||
| 1124 | Ga0466967_1101378 | |||
| 1125 | Ga0495638_0263957 | |||
| 1126 | Ga0495607_0000073 | |||
| 1127 | Ga0495643_0289793 | |||
| 1128 | Ga0495633_0001245 | |||
| 1129 | Ga0495633_0002109 | |||
| 1130 | Ga0496105_0616116 | |||
| 1131 | Ga0496113_1138752 | |||
| 1132 | Ga0496116_0003563 | |||
| 1133 | Ga0496116_0035018 | |||
| 1134 | Ga0496116_0208160 | |||
| 1135 | Ga0496117_0011712 | |||
| 1136 | Ga0496117_0119548 | |||
| 1137 | Ga0496118_0032058 | |||
| 1138 | Ga0496119_0057087 | |||
| 1139 | Ga0496119_0156753 | |||
| 1140 | Ga0496120_0009451 | |||
| 1141 | Ga0496121_0001225 | |||
| 1142 | Ga0496121_0260034 | |||
| 1143 | Ga0496122_0000021 | |||
| 1144 | Ga0496122_0029036 | |||
| 1145 | Ga0496122_0185929 | |||
| 1146 | Ga0496123_0001255 | |||
| 1147 | Ga0496123_0001826 | |||
| 1148 | Ga0496123_0017505 | |||
| 1149 | Ga0496123_0034717 | |||
| 1150 | Ga0496124_0347440 | |||
| 1151 | Ga0496125_0000005 | |||
| 1152 | Ga0496125_0001215 | |||
| 1153 | Ga0496125_0007745 | |||
| 1154 | Ga0496125_0101668 | |||
| 1155 | Ga0496125_0305502 | |||
| 1156 | Ga0496125_0339971 | |||
| 1157 | Ga0496126_0033384 | |||
| 1158 | Ga0496126_0064339 | |||
| 1159 | Ga0496126_0114087 | |||
| 1160 | Ga0501299_180642 | |||
| 1161 | Ga0501031_0004079 | |||
| 1162 | Ga0501031_0029220 | |||
| 1163 | Ga0501032_0006844 | |||
| 1164 | Ga0501032_0044295 | |||
| 1165 | Ga0501032_0182628 | |||
| 1166 | Ga0501032_0378282 | |||
| 1167 | Ga0501032_0563430 | |||
| 1168 | Ga0501032_0697025 | |||
| 1169 | Ga0501032_0769360 | |||
| 1170 | Ga0501033_0009861 | |||
| 1171 | Ga0501033_0236996 | |||
| 1172 | Ga0501033_0279276 | |||
| 1173 | Ga0501033_0503782 | |||
| 1174 | Ga0501034_0000444 | |||
| 1175 | Ga0501034_0051457 | |||
| 1176 | Ga0501034_0193966 | |||
| 1177 | Ga0501034_0288417 | |||
| 1178 | Ga0501034_0342558 | |||
| 1179 | Ga0501034_0448471 | |||
| 1180 | Ga0501036_0013804 | |||
| 1181 | Ga0501036_0050276 | |||
| 1182 | Ga0501036_0131581 | |||
| 1183 | Ga0501036_0206347 | |||
| 1184 | Ga0501036_0770998 | |||
| 1185 | Ga0501036_1653713 | |||
| 1186 | Ga0501037_0002738 | |||
| 1187 | Ga0501037_0063864 | |||
| 1188 | Ga0501037_0100434 | |||
| 1189 | Ga0501037_0124314 | |||
| 1190 | Ga0501038_0026982 | |||
| 1191 | Ga0501038_0028372 | |||
| 1192 | Ga0501038_0036294 | |||
| 1193 | Ga0501038_0086054 | |||
| 1194 | Ga0501038_0179034 | |||
| 1195 | Ga0501038_0200552 | |||
| 1196 | Ga0501038_0775574 | |||
| 1197 | Ga0501038_0931762 | |||
| 1198 | Ga0501039_0007212 | |||
| 1199 | Ga0501039_0012056 | |||
| 1200 | Ga0501039_0089266 | |||
| 1201 | Ga0501039_0302594 | |||
| 1202 | Ga0501039_0515008 | |||
| 1203 | Ga0501039_0591229 | |||
| 1204 | Ga0501039_0994684 | |||
| 1205 | Ga0501040_0009228 | |||
| 1206 | Ga0501040_0053048 | |||
| 1207 | Ga0501040_0070058 | |||
| 1208 | Ga0501040_0283296 | |||
| 1209 | Ga0501040_0539230 | |||
| 1210 | Ga0501040_0999722 | |||
| 1211 | Ga0501040_1412810 | |||
| 1212 | Ga0501041_0009961 | |||
| 1213 | Ga0501041_0035735 | |||
| 1214 | Ga0501041_0273549 | |||
| 1215 | Ga0501041_0647171 | |||
| 1216 | Ga0501041_1027214 | |||
| 1217 | Ga0501042_0016734 | |||
| 1218 | Ga0501042_0031258 | |||
| 1219 | Ga0501042_0077445 | |||
| 1220 | Ga0501042_0107835 | |||
| 1221 | Ga0501042_0358160 | |||
| 1222 | Ga0501042_0442849 | |||
| 1223 | Ga0501042_0608569 | |||
| 1224 | Ga0501043_0031198 | |||
| 1225 | Ga0501043_0075634 | |||
| 1226 | Ga0501043_0164242 | |||
| 1227 | Ga0501043_0255725 | |||
| 1228 | Ga0501043_0296390 | |||
| 1229 | Ga0501043_0332207 | |||
| 1230 | Ga0501043_0880657 | |||
| 1231 | Ga0501043_1229887 | |||
| 1232 | Ga0501046_0006239 | |||
| 1233 | Ga0501046_0087917 | |||
| 1234 | Ga0501046_0106125 | |||
| 1235 | Ga0501046_0461565 | |||
| 1236 | Ga0501046_0853947 | |||
| 1237 | Ga0501047_0021867 | |||
| 1238 | Ga0501047_0173535 | |||
| 1239 | Ga0501047_0182100 | |||
| 1240 | Ga0501047_0262758 | |||
| 1241 | Ga0501047_1222531 | |||
| 1242 | Ga0501048_0022535 | |||
| 1243 | Ga0501048_0139174 | |||
| 1244 | Ga0501048_0152278 | |||
| 1245 | Ga0501048_0284265 | |||
| 1246 | Ga0501048_0737046 | |||
| 1247 | Ga0501048_1258195 | |||
| 1248 | Ga0501068_0035148 | |||
| 1249 | Ga0501069_0234696 | |||
| 1250 | Ga0501069_0254713 | |||
| 1251 | Ga0501069_0366137 | |||
| 1252 | Ga0501069_0372491 | |||
| 1253 | Ga0501070_0001023 | |||
| 1254 | Ga0501070_0006781 | |||
| 1255 | Ga0501070_0007437 | |||
| 1256 | Ga0501070_0046515 | |||
| 1257 | Ga0501070_0093558 | |||
| 1258 | Ga0501070_0150655 | |||
| 1259 | Ga0501070_0186508 | |||
| 1260 | Ga0501070_0315796 | |||
| 1261 | Ga0501070_0408179 | |||
| 1262 | Ga0501070_0504172 | |||
| 1263 | Ga0501070_0920570 | |||
| 1264 | Ga0501071_0042283 | |||
| 1265 | Ga0501071_0231158 | |||
| 1266 | Ga0501071_1512137 | |||
| 1267 | Ga0501072_0016038 | |||
| 1268 | Ga0501072_0019498 | |||
| 1269 | Ga0501072_0056368 | |||
| 1270 | Ga0501072_0280757 | |||
| 1271 | Ga0501072_0513749 | |||
| 1272 | Ga0501073_0102813 | |||
| 1273 | Ga0501073_0620591 | |||
| 1274 | Ga0501074_0004171 | |||
| 1275 | Ga0501074_0075025 | |||
| 1276 | Ga0501074_0455415 | |||
| 1277 | Ga0501074_0689664 | |||
| 1278 | Ga0501075_0016047 | |||
| 1279 | Ga0501075_0020581 | |||
| 1280 | Ga0501075_0036056 | |||
| 1281 | Ga0501075_0652299 | |||
| 1282 | Ga0501075_0799818 | |||
| 1283 | Ga0501076_0003440 | |||
| 1284 | Ga0501076_0013015 | |||
| 1285 | Ga0501076_0105535 | |||
| 1286 | Ga0501076_0333182 | |||
| 1287 | Ga0501076_0726088 | |||
| 1288 | Ga0501076_1168396 | |||
| 1289 | Ga0501076_1367763 | |||
| 1290 | Ga0501077_0029031 | |||
| 1291 | Ga0501077_0042541 | |||
| 1292 | Ga0501077_0063099 | |||
| 1293 | Ga0501077_0164588 | |||
| 1294 | Ga0501249_063576 | |||
| 1295 | Ga0501079_0098650 | |||
| 1296 | Ga0501079_0116141 | |||
| 1297 | Ga0501079_0236125 | |||
| 1298 | Ga0501079_0964461 | |||
| 1299 | Ga0501080_0070656 | |||
| 1300 | Ga0501080_0158788 | |||
| 1301 | Ga0501080_0222210 | |||
| 1302 | Ga0501080_0573699 | |||
| 1303 | Ga0501080_1368685 | |||
| 1304 | Ga0501081_0073062 | |||
| 1305 | Ga0501081_0093098 | |||
| 1306 | Ga0501081_0114647 | |||
| 1307 | Ga0501081_0978720 | |||
| 1308 | Ga0501081_1263654 | |||
| 1309 | Ga0501083_0081449 | |||
| 1310 | Ga0501083_0129862 | |||
| 1311 | Ga0501083_0196534 | |||
| 1312 | Ga0501035_0002723 | |||
| 1313 | Ga0501035_0007737 | |||
| 1314 | Ga0501035_0039585 | |||
| 1315 | Ga0501035_0310836 | |||
| 1316 | Ga0501035_0342653 | |||
| 1317 | Ga0501035_1103775 | |||
| 1318 | Ga0501044_0001822 | |||
| 1319 | Ga0501044_0036766 | |||
| 1320 | Ga0501044_0037701 | |||
| 1321 | Ga0501044_0078495 | |||
| 1322 | Ga0501044_0309770 | |||
| 1323 | Ga0501044_0369638 | |||
| 1324 | Ga0501044_0459696 | |||
| 1325 | Ga0501044_1361259 | |||
| 1326 | Ga0501045_0010575 | |||
| 1327 | Ga0501045_0065497 | |||
| 1328 | Ga0501045_0082666 | |||
| 1329 | Ga0501045_0321677 | |||
| 1330 | Ga0501045_0412189 | |||
| 1331 | Ga0501045_0879550 | |||
| 1332 | nmdc:mga00v17_126226_c1 | |||
| 1333 | nmdc:mga0yw44_198151_c1 | |||
| 1334 | nmdc:mga05p37_228293_c1 | |||
| 1335 | nmdc:mga09592_91302_c1 | |||
| 1336 | nmdc:mga0qj67_115199_c1 | |||
| 1337 | nmdc:mga0qj67_202487_c1 | |||
| 1338 | nmdc:mga06r32_455575_c1 | |||
| 1339 | nmdc:mga0n895_1257339_c1 | |||
| 1340 | nmdc:mga0n895_147278_c1 | |||
| 1341 | nmdc:mga0rr50_13981_c1 | |||
| 1342 | nmdc:mga08x19_1044_c1 | |||
| 1343 | Ga0500579_279069 | |||
| 1344 | Ga0500634_0006492 | |||
| 1345 | Ga0500634_0082144 | |||
| 1346 | Ga0501084_0012973 | |||
| 1347 | Ga0501084_0103821 | |||
| 1348 | Ga0501084_0127356 | |||
| 1349 | Ga0590071_040255 | |||
| 1350 | Ga0590074_023864 | |||
| 1351 | Ga0590077_026885 | |||
| 1352 | Ga0501082_0173156 | |||
| 1353 | Ga0501082_0388231 | |||
| 1354 | Ga0530510_0791275 | |||
| 1355 | Ga0530510_0966563 | |||
| 1356 | 2538834337 | |||
| 1357 | 2643772933 | |||
| 1358 | 2643828725 | |||
| 1359 | 2643866781 | |||
| 1360 | 2643894650 | |||
| 1361 | 2643993500 | |||
| 1362 | 2644076329 | |||
| 1363 | 2644133098 | |||
| 1364 | 2644248802 | |||
| 1365 | 2644294637 | |||
| 1366 | 2644476799 | |||
| 1367 | 2722882795 | |||
| 1368 | 2739244660 | |||
| 1369 | 2739305876 | |||
| 1370 | 2739613519 | |||
| 1371 | 2792461935 | |||
| 1372 | 2816475136 | |||
| 1373 | 2839138506 | |||
| 1374 | 2842719654 | |||
| 1375 | 2843748797 | |||
| 1376 | 2849562162 | |||
| 1377 | 2849578836 | |||
| 1378 | 2851156600 | |||
| 1379 | 2857579405 | |||
| 1380 | 2881927982 | |||
| 1381 | 2887379132 | |||
| 1382 | 2894026015 | |||
| 1383 | 2898330269 | |||
| 1384 | 2928972609 | |||
| 1385 | 2932426263 | |||
| 1386 | 2941488177 | |||
| 1387 | 2974323722 | |||
| 1388 | 2977242389 | |||
| 1389 | 2996314961 | |||
| 1390 | 8002394624 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4o93-assembly1.cif.gz_B | crystal structure of thermus thermophilis transhydrogeanse domain ii dimer | 0.5581 | 1 | 92 |
| 6ys8-assembly1.cif.gz_F | structure of gldlm, the proton-powered motor that drives protein transport and gliding motility | 0.5207 | 1 | 53 |
| 7qru-assembly1.cif.gz_C | structure of bacillus pseudofirmus mrp antiporter complex, monomer | 0.4984 | 1 | 112 |
| 6z16-assembly1.cif.gz_c | structure of the mrp antiporter complex | 0.4958 | 1 | 109 |
| 7d3u-assembly1.cif.gz_C | structure of mrp complex from dietzia sp. dq12-45-1b | 0.4958 | 4 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0X9L3_107_499_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9527 | 4 | 46 | 1.10.3860.10 |
| af_E7FBL8_30_139_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.9431 | 5 | 46 | 1.20.140.150 |
| af_I1MB11_126_214_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9093 | 8 | 43 | 1.25.40.10 |
| af_Q9VNJ5_922_1117_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.8879 | 1 | 45 | 1.20.1640.10 |
| af_H0WEV0_822_1008_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8661 | 1 | 51 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B1TCR1-F1-model_v4 | Uncharacterized protein | 0.8654 | 1 | 48 |
|
| AF-A0A090T0P6-F1-model_v4 | Na(+) H(+) antiporter subunit C | 0.8466 | 1 | 55 |
GO:0016020
|
| AF-A0A090T0P6-F1-model_v4 | Na(+) H(+) antiporter subunit C | 0.8322 | 1 | 55 |
GO:0016020
|
| AF-A0A7C1SY28-F1-model_v4 | Cation:proton antiporter | 0.8273 | 1 | 57 |
GO:0016020
|
| AF-A0A4Y8ZH83-F1-model_v4 | deleted | 0.8244 | 4 | 56 |
|