F472542
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 650 | 383 | 650 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0046852|Ga0466960_0046852_420_1115 |
| Length | 213 |
| Sequence | MSTLERNVRGLLGTKLGMTQTWDENNRVIPVTVVAAGTNVVTQVRSPETDGYNAVQIGFGEIEGRKVTKPRAGHFEKAGVTPRRHLLEIRTADAASYTVGQEIGPDLFTAGDEVDVTGTSKGKGFHRNHRKPGSIGGCATPGRVFKGMRMAGRMGGDKVTTQNVAVHAVDAEKGLILLKGAVPGPRGGVVVIRSAAKAVATAALSAGNTEASK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300003160 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 27 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 28 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 121 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 183 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 184 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 188 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 189 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 190 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 213 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 220 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 221 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 222 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 223 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 224 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 225 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 227 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 228 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 231 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 232 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 233 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 234 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 235 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 236 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 237 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 279 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 280 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 281 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 282 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 283 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 294 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 351 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.54 |
| Metatranscriptomes | 22.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.31 |
| Nodule | 0 |
| Rhizoplane | 6.92 |
| Rhizosphere | 83.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c004908 | 3300000041 | Bacteria | 1153 |
| 2 | ARcpr5oldR_c008025 | 3300000041 | Bacteria | 896 |
| 3 | JGI24739J22299_10037612 | 3300001989 | Bacteria | 1630 |
| 4 | JGI24739J22299_10073264 | 3300001989 | Bacteria | 1063 |
| 5 | JGI24745J21846_1010180 | 3300002073 | Bacteria | 1068 |
| 6 | JGI24748J21848_1001863 | 3300002074 | Bacteria | 2348 |
| 7 | JGI24738J21930_10008775 | 3300002075 | Bacteria | 2292 |
| 8 | JGI24749J21850_1001482 | 3300002076 | Bacteria | 3317 |
| 9 | JGI24744J21845_10001209 | 3300002077 | Bacteria | 5064 |
| 10 | JGI24742J22300_10008229 | 3300002244 | Bacteria | 1721 |
| 11 | Ga0006779J45831_102609 | 3300003160 | Bacteria | 1508 |
| 12 | Ga0006765J45826_109836 | 3300003161 | Bacteria | 1317 |
| 13 | Ga0006778J45830_1028228 | 3300003162 | Bacteria | 1116 |
| 14 | Ga0006759J45824_1015649 | 3300003163 | Bacteria | 1783 |
| 15 | Ga0006758J48902_1015782 | 3300003300 | Bacteria | 962 |
| 16 | Ga0006770J48903_1014088 | 3300003305 | Bacteria | 1455 |
| 17 | Ga0006777J48905_1013451 | 3300003308 | Bacteria | 1318 |
| 18 | Ga0006777J48905_1021747 | 3300003308 | Bacteria | 1232 |
| 19 | Ga0006777J48905_1034729 | 3300003308 | Bacteria | 1107 |
| 20 | Ga0006777J48905_1059879 | 3300003308 | Bacteria | 854 |
| 21 | Ga0007417J51691_1032364 | 3300003544 | Bacteria | 1330 |
| 22 | Ga0007427J51700_103349 | 3300003559 | Bacteria | 1650 |
| 23 | Ga0006781J51513_1004744 | 3300003568 | Bacteria | 2068 |
| 24 | Ga0007410J51695_1009274 | 3300003574 | Bacteria | 1407 |
| 25 | Ga0007410J51695_1039556 | 3300003574 | Bacteria | 777 |
| 26 | Ga0007409J51694_1005546 | 3300003575 | Bacteria | 1874 |
| 27 | Ga0007409J51694_1044798 | 3300003575 | Bacteria | 887 |
| 28 | Ga0007409J51694_1063908 | 3300003575 | Bacteria | 973 |
| 29 | Ga0007416J51690_1006248 | 3300003577 | Bacteria | 1390 |
| 30 | Ga0007416J51690_1006249 | 3300003577 | Bacteria | 1967 |
| 31 | Ga0007429J51699_1004465 | 3300003579 | Bacteria | 1432 |
| 32 | Ga0007429J51699_1024979 | 3300003579 | Bacteria | 1378 |
| 33 | Ga0007411J51799_103764 | 3300003611 | Bacteria | 1727 |
| 34 | Ga0007415J51800_105039 | 3300003613 | Bacteria | 1506 |
| 35 | Ga0032354_1008262 | 3300003693 | Bacteria | 1286 |
| 36 | Ga0032354_1022152 | 3300003693 | Bacteria | 1356 |
| 37 | Ga0032354_1037833 | 3300003693 | Bacteria | 926 |
| 38 | Ga0058859_10026884 | 3300004798 | Bacteria | 1377 |
| 39 | Ga0058861_10027554 | 3300004800 | Bacteria | 997 |
| 40 | Ga0058861_10146493 | 3300004800 | Bacteria | 987 |
| 41 | Ga0058860_10155767 | 3300004801 | Bacteria | 1338 |
| 42 | Ga0070658_10070042 | 3300005327 | Bacteria | 2870 |
| 43 | Ga0070658_10242846 | 3300005327 | Bacteria | 1526 |
| 44 | Ga0070676_10135919 | 3300005328 | Bacteria | 1560 |
| 45 | Ga0070683_100012063 | 3300005329 | Bacteria | 7497 |
| 46 | Ga0070683_100055375 | 3300005329 | Bacteria | 3680 |
| 47 | Ga0070683_100182428 | 3300005329 | Bacteria | 1992 |
| 48 | Ga0070666_10145092 | 3300005335 | Bacteria | 1654 |
| 49 | Ga0070682_100039916 | 3300005337 | Bacteria | 2886 |
| 50 | Ga0070682_100123028 | 3300005337 | Bacteria | 1744 |
| 51 | Ga0070682_100425257 | 3300005337 | Bacteria | 1011 |
| 52 | Ga0068868_100218028 | 3300005338 | Bacteria | 1596 |
| 53 | Ga0070660_100599957 | 3300005339 | Bacteria | 920 |
| 54 | Ga0070689_100052393 | 3300005340 | Bacteria | 3156 |
| 55 | Ga0070689_100496566 | 3300005340 | Bacteria | 1045 |
| 56 | Ga0070668_100043717 | 3300005347 | Bacteria | 3435 |
| 57 | Ga0070669_100013486 | 3300005353 | Bacteria | 5810 |
| 58 | Ga0070669_100045228 | 3300005353 | Bacteria | 3207 |
| 59 | Ga0070671_101002923 | 3300005355 | Bacteria | 732 |
| 60 | Ga0070674_100035311 | 3300005356 | Bacteria | 3347 |
| 61 | Ga0070688_100399895 | 3300005365 | Bacteria | 1016 |
| 62 | Ga0070659_100065286 | 3300005366 | Bacteria | 2883 |
| 63 | Ga0070667_100000074 | 3300005367 | Bacteria | 121299 |
| 64 | Ga0070667_100163932 | 3300005367 | Bacteria | 1959 |
| 65 | Ga0070667_100643728 | 3300005367 | Bacteria | 978 |
| 66 | Ga0070703_10018558 | 3300005406 | Bacteria | 2012 |
| 67 | Ga0070709_10046692 | 3300005434 | Bacteria | 2694 |
| 68 | Ga0070714_100028790 | 3300005435 | Bacteria | 4613 |
| 69 | Ga0070710_10000625 | 3300005437 | Bacteria | 16827 |
| 70 | Ga0070710_10280136 | 3300005437 | Bacteria | 1081 |
| 71 | Ga0070701_10015906 | 3300005438 | Bacteria | 3485 |
| 72 | Ga0070711_100000779 | 3300005439 | Bacteria | 16650 |
| 73 | Ga0070705_100262635 | 3300005440 | Bacteria | 1218 |
| 74 | Ga0070705_100272374 | 3300005440 | Bacteria | 1199 |
| 75 | Ga0070700_100561080 | 3300005441 | Bacteria | 889 |
| 76 | Ga0070663_100045912 | 3300005455 | Bacteria | 3088 |
| 77 | Ga0070663_100495390 | 3300005455 | Bacteria | 1014 |
| 78 | Ga0070678_100005866 | 3300005456 | Bacteria | 7144 |
| 79 | Ga0070662_100008435 | 3300005457 | Bacteria | 6717 |
| 80 | Ga0070662_100227868 | 3300005457 | Bacteria | 1489 |
| 81 | Ga0068867_100033947 | 3300005459 | Bacteria | 3697 |
| 82 | Ga0070684_100139275 | 3300005535 | Bacteria | 2193 |
| 83 | Ga0068853_100081495 | 3300005539 | Bacteria | 2833 |
| 84 | Ga0070686_100103556 | 3300005544 | Bacteria | 1926 |
| 85 | Ga0070695_100026313 | 3300005545 | Bacteria | 3598 |
| 86 | Ga0070696_100004591 | 3300005546 | Bacteria | 9224 |
| 87 | Ga0070665_100027663 | 3300005548 | Bacteria | 5710 |
| 88 | Ga0070665_100098563 | 3300005548 | Bacteria | 2927 |
| 89 | Ga0070665_100211452 | 3300005548 | Bacteria | 1940 |
| 90 | Ga0070665_100247063 | 3300005548 | Bacteria | 1785 |
| 91 | Ga0070704_100006863 | 3300005549 | Bacteria | 6741 |
| 92 | Ga0068855_100115656 | 3300005563 | Bacteria | 3075 |
| 93 | Ga0070664_100029753 | 3300005564 | Bacteria | 4554 |
| 94 | Ga0070664_100266001 | 3300005564 | Bacteria | 1544 |
| 95 | Ga0068854_100004108 | 3300005578 | Bacteria | 9146 |
| 96 | Ga0068856_100359438 | 3300005614 | Bacteria | 1475 |
| 97 | Ga0070702_100041727 | 3300005615 | Bacteria | 2575 |
| 98 | Ga0068852_100198688 | 3300005616 | Bacteria | 1897 |
| 99 | Ga0068859_100001947 | 3300005617 | Bacteria | 21042 |
| 100 | Ga0068859_100101969 | 3300005617 | Bacteria | 2927 |
| 101 | Ga0068864_100306228 | 3300005618 | Bacteria | 1488 |
| 102 | Ga0068864_100707269 | 3300005618 | Bacteria | 985 |
| 103 | Ga0068866_10000713 | 3300005718 | Bacteria | 15113 |
| 104 | Ga0068861_100001091 | 3300005719 | Bacteria | 16779 |
| 105 | Ga0068863_100038728 | 3300005841 | Bacteria | 4535 |
| 106 | Ga0068858_100039329 | 3300005842 | Bacteria | 4386 |
| 107 | Ga0068858_100084395 | 3300005842 | Bacteria | 2954 |
| 108 | Ga0068860_100000276 | 3300005843 | Bacteria | 74447 |
| 109 | Ga0068860_100002734 | 3300005843 | Bacteria | 18350 |
| 110 | Ga0068860_100132625 | 3300005843 | Bacteria | 2392 |
| 111 | Ga0068862_100000065 | 3300005844 | Bacteria | 124435 |
| 112 | Ga0068862_100001732 | 3300005844 | Bacteria | 19723 |
| 113 | Ga0081455_10009428 | 3300005937 | Bacteria | 10043 |
| 114 | Ga0075365_10048243 | 3300006038 | Bacteria | 2802 |
| 115 | Ga0075365_10193854 | 3300006038 | Bacteria | 1422 |
| 116 | Ga0075363_100028457 | 3300006048 | Bacteria | 2875 |
| 117 | Ga0075363_100101894 | 3300006048 | Bacteria | 1589 |
| 118 | Ga0075363_100426947 | 3300006048 | Bacteria | 781 |
| 119 | Ga0075364_10030032 | 3300006051 | Bacteria | 3487 |
| 120 | Ga0075364_10039301 | 3300006051 | Bacteria | 3067 |
| 121 | Ga0070715_10232226 | 3300006163 | Bacteria | 955 |
| 122 | Ga0070716_100030475 | 3300006173 | Bacteria | 2926 |
| 123 | Ga0070712_100000676 | 3300006175 | Bacteria | 20159 |
| 124 | Ga0075362_10138969 | 3300006177 | Bacteria | 1160 |
| 125 | Ga0075367_10041162 | 3300006178 | Bacteria | 2700 |
| 126 | Ga0075367_10293301 | 3300006178 | Bacteria | 1023 |
| 127 | Ga0075369_10000768 | 3300006186 | Bacteria | 10476 |
| 128 | Ga0075369_10050021 | 3300006186 | Bacteria | 1806 |
| 129 | Ga0075369_10051076 | 3300006186 | Bacteria | 1789 |
| 130 | Ga0075369_10084056 | 3300006186 | Bacteria | 1414 |
| 131 | Ga0075369_10250552 | 3300006186 | Bacteria | 822 |
| 132 | Ga0097621_100057941 | 3300006237 | Bacteria | 3170 |
| 133 | Ga0075370_10181367 | 3300006353 | Bacteria | 1239 |
| 134 | Ga0075370_10287801 | 3300006353 | Bacteria | 976 |
| 135 | Ga0068871_100017304 | 3300006358 | Bacteria | 5451 |
| 136 | Ga0075430_100816162 | 3300006846 | Bacteria | 769 |
| 137 | Ga0068865_100001202 | 3300006881 | Bacteria | 15069 |
| 138 | Ga0068865_100018320 | 3300006881 | Bacteria | 4516 |
| 139 | Ga0075436_100602186 | 3300006914 | Bacteria | 810 |
| 140 | Ga0097620_100001947 | 3300006931 | Bacteria | 21042 |
| 141 | Ga0097620_100101973 | 3300006931 | Bacteria | 2927 |
| 142 | Ga0105240_10203715 | 3300009093 | Bacteria | 2317 |
| 143 | Ga0111539_10754164 | 3300009094 | Bacteria | 1133 |
| 144 | Ga0105245_10001413 | 3300009098 | Bacteria | 21776 |
| 145 | Ga0105247_10000017 | 3300009101 | Bacteria | 260438 |
| 146 | Ga0105247_10001090 | 3300009101 | Bacteria | 20246 |
| 147 | Ga0114129_10637912 | 3300009147 | Bacteria | 1376 |
| 148 | Ga0105243_10011286 | 3300009148 | Bacteria | 6758 |
| 149 | Ga0105243_10620823 | 3300009148 | Bacteria | 1043 |
| 150 | Ga0105241_10072791 | 3300009174 | Bacteria | 2672 |
| 151 | Ga0105242_10033473 | 3300009176 | Bacteria | 4114 |
| 152 | Ga0105248_10000721 | 3300009177 | Bacteria | 37448 |
| 153 | Ga0105248_10123599 | 3300009177 | Bacteria | 2919 |
| 154 | Ga0105248_10638408 | 3300009177 | Bacteria | 1201 |
| 155 | Ga0105248_11646186 | 3300009177 | Bacteria | 727 |
| 156 | Ga0105237_10145052 | 3300009545 | Bacteria | 2369 |
| 157 | Ga0105237_10555823 | 3300009545 | Bacteria | 1154 |
| 158 | Ga0105249_10000096 | 3300009553 | Bacteria | 121083 |
| 159 | Ga0105249_10068716 | 3300009553 | Bacteria | 3268 |
| 160 | Ga0105249_10087548 | 3300009553 | Bacteria | 2906 |
| 161 | Ga0105249_10871059 | 3300009553 | Bacteria | 967 |
| 162 | Ga0105249_11648003 | 3300009553 | Bacteria | 714 |
| 163 | Ga0105239_10020346 | 3300010375 | Bacteria | 7321 |
| 164 | Ga0105239_10023869 | 3300010375 | Bacteria | 6734 |
| 165 | Ga0105239_10070207 | 3300010375 | Bacteria | 3847 |
| 166 | Ga0105246_10056393 | 3300011119 | Bacteria | 2716 |
| 167 | Ga0157369_10624296 | 3300013105 | Bacteria | 1112 |
| 168 | Ga0157369_10646799 | 3300013105 | Bacteria | 1090 |
| 169 | Ga0157374_10641613 | 3300013296 | Bacteria | 1073 |
| 170 | Ga0157374_10886677 | 3300013296 | Bacteria | 909 |
| 171 | Ga0157378_10034055 | 3300013297 | Bacteria | 4505 |
| 172 | Ga0163162_10015089 | 3300013306 | Bacteria | 7546 |
| 173 | Ga0163162_11513702 | 3300013306 | Bacteria | 764 |
| 174 | Ga0157372_10015409 | 3300013307 | Bacteria | 8193 |
| 175 | Ga0157372_10160715 | 3300013307 | Bacteria | 2596 |
| 176 | Ga0157375_10028052 | 3300013308 | Bacteria | 5271 |
| 177 | Ga0163163_10006752 | 3300014325 | Bacteria | 10058 |
| 178 | Ga0163163_10532098 | 3300014325 | Bacteria | 1238 |
| 179 | Ga0157380_10034116 | 3300014326 | Bacteria | 3923 |
| 180 | Ga0157379_10032279 | 3300014968 | Bacteria | 4668 |
| 181 | Ga0157379_10063626 | 3300014968 | Bacteria | 3297 |
| 182 | Ga0163161_10001600 | 3300017792 | Bacteria | 16695 |
| 183 | Ga0163161_10479832 | 3300017792 | Bacteria | 1009 |
| 184 | Ga0197907_10411015 | 3300020069 | Bacteria | 2127 |
| 185 | Ga0197907_10657930 | 3300020069 | Bacteria | 939 |
| 186 | Ga0197907_11372859 | 3300020069 | Bacteria | 1263 |
| 187 | Ga0197907_11405374 | 3300020069 | Bacteria | 1433 |
| 188 | Ga0206356_10222980 | 3300020070 | Bacteria | 1302 |
| 189 | Ga0206356_10674529 | 3300020070 | Bacteria | 1111 |
| 190 | Ga0206356_11070515 | 3300020070 | Bacteria | 1265 |
| 191 | Ga0206349_1051251 | 3300020075 | Bacteria | 1050 |
| 192 | Ga0206349_1383707 | 3300020075 | Bacteria | 1212 |
| 193 | Ga0206349_1385645 | 3300020075 | Bacteria | 1070 |
| 194 | Ga0206349_1856980 | 3300020075 | Bacteria | 1681 |
| 195 | Ga0206355_1085941 | 3300020076 | Bacteria | 1153 |
| 196 | Ga0206355_1389932 | 3300020076 | Bacteria | 2615 |
| 197 | Ga0206355_1722261 | 3300020076 | Bacteria | 1406 |
| 198 | Ga0206351_10216479 | 3300020077 | Bacteria | 2658 |
| 199 | Ga0206352_10436074 | 3300020078 | Bacteria | 1677 |
| 200 | Ga0206350_11464052 | 3300020080 | Bacteria | 827 |
| 201 | Ga0206350_11629593 | 3300020080 | Bacteria | 1688 |
| 202 | Ga0206354_10027635 | 3300020081 | Bacteria | 770 |
| 203 | Ga0206354_10163218 | 3300020081 | Bacteria | 2660 |
| 204 | Ga0206353_10868606 | 3300020082 | Bacteria | 798 |
| 205 | Ga0206353_10876636 | 3300020082 | Bacteria | 2936 |
| 206 | Ga0206353_11714178 | 3300020082 | Bacteria | 1116 |
| 207 | Ga0154015_1487752 | 3300020610 | Bacteria | 958 |
| 208 | Ga0154015_1488494 | 3300020610 | Bacteria | 3050 |
| 209 | Ga0213876_10116052 | 3300021384 | Bacteria | 1421 |
| 210 | Ga0224712_10076882 | 3300022467 | Bacteria | 1369 |
| 211 | Ga0207692_10013505 | 3300025898 | Bacteria | 3544 |
| 212 | Ga0207642_10000255 | 3300025899 | Bacteria | 15903 |
| 213 | Ga0207710_10000033 | 3300025900 | Bacteria | 260531 |
| 214 | Ga0207688_10079995 | 3300025901 | Bacteria | 1865 |
| 215 | Ga0207688_10190974 | 3300025901 | Bacteria | 1225 |
| 216 | Ga0207688_10278208 | 3300025901 | Bacteria | 1019 |
| 217 | Ga0207688_10358732 | 3300025901 | Bacteria | 899 |
| 218 | Ga0207680_10102422 | 3300025903 | Bacteria | 1842 |
| 219 | Ga0207685_10030557 | 3300025905 | Bacteria | 1919 |
| 220 | Ga0207699_10010549 | 3300025906 | Bacteria | 4642 |
| 221 | Ga0207645_10104960 | 3300025907 | Bacteria | 1825 |
| 222 | Ga0207705_10251390 | 3300025909 | Bacteria | 1348 |
| 223 | Ga0207705_10394563 | 3300025909 | Bacteria | 1070 |
| 224 | Ga0207671_10127778 | 3300025914 | Bacteria | 1949 |
| 225 | Ga0207693_10006799 | 3300025915 | Bacteria | 9444 |
| 226 | Ga0207663_10008390 | 3300025916 | Bacteria | 5399 |
| 227 | Ga0207660_10281515 | 3300025917 | Bacteria | 1320 |
| 228 | Ga0207657_10406817 | 3300025919 | Bacteria | 1070 |
| 229 | Ga0207649_10434486 | 3300025920 | Bacteria | 988 |
| 230 | Ga0207652_10118242 | 3300025921 | Bacteria | 2355 |
| 231 | Ga0207681_10000456 | 3300025923 | Bacteria | 28674 |
| 232 | Ga0207681_10081690 | 3300025923 | Bacteria | 2282 |
| 233 | Ga0207687_10002110 | 3300025927 | Bacteria | 13589 |
| 234 | Ga0207687_10052326 | 3300025927 | Bacteria | 2850 |
| 235 | Ga0207664_10104628 | 3300025929 | Bacteria | 2344 |
| 236 | Ga0207644_10011017 | 3300025931 | Bacteria | 5972 |
| 237 | Ga0207706_10208647 | 3300025933 | Bacteria | 1713 |
| 238 | Ga0207686_10020167 | 3300025934 | Bacteria | 3804 |
| 239 | Ga0207670_10010722 | 3300025936 | Bacteria | 5289 |
| 240 | Ga0207670_10530134 | 3300025936 | Bacteria | 960 |
| 241 | Ga0207669_10000192 | 3300025937 | Bacteria | 27738 |
| 242 | Ga0207704_10002317 | 3300025938 | Bacteria | 8556 |
| 243 | Ga0207665_10109923 | 3300025939 | Bacteria | 1936 |
| 244 | Ga0207711_10009740 | 3300025941 | Bacteria | 7994 |
| 245 | Ga0207711_10269492 | 3300025941 | Bacteria | 1566 |
| 246 | Ga0207711_10471905 | 3300025941 | Bacteria | 1169 |
| 247 | Ga0207689_10143187 | 3300025942 | Bacteria | 1969 |
| 248 | Ga0207661_10017317 | 3300025944 | Bacteria | 5328 |
| 249 | Ga0207661_10060501 | 3300025944 | Bacteria | 3056 |
| 250 | Ga0207661_10068581 | 3300025944 | Bacteria | 2888 |
| 251 | Ga0207661_10188638 | 3300025944 | Bacteria | 1806 |
| 252 | Ga0207679_10087528 | 3300025945 | Bacteria | 2399 |
| 253 | Ga0207667_10106388 | 3300025949 | Bacteria | 2894 |
| 254 | Ga0207651_10729922 | 3300025960 | Bacteria | 874 |
| 255 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 256 | Ga0207712_10206728 | 3300025961 | Bacteria | 1561 |
| 257 | Ga0207712_10338889 | 3300025961 | Bacteria | 1246 |
| 258 | Ga0207668_10000752 | 3300025972 | Bacteria | 19808 |
| 259 | Ga0207640_10002625 | 3300025981 | Bacteria | 9635 |
| 260 | Ga0207658_10000517 | 3300025986 | Bacteria | 35169 |
| 261 | Ga0207658_10062226 | 3300025986 | Bacteria | 2792 |
| 262 | Ga0207658_10080843 | 3300025986 | Bacteria | 2490 |
| 263 | Ga0207658_10108439 | 3300025986 | Bacteria | 2190 |
| 264 | Ga0207658_10399000 | 3300025986 | Bacteria | 1208 |
| 265 | Ga0207677_10008380 | 3300026023 | Bacteria | 5770 |
| 266 | Ga0207703_10007479 | 3300026035 | Bacteria | 8676 |
| 267 | Ga0207703_10028677 | 3300026035 | Bacteria | 4391 |
| 268 | Ga0207703_10067219 | 3300026035 | Bacteria | 2950 |
| 269 | Ga0207639_10015214 | 3300026041 | Bacteria | 5422 |
| 270 | Ga0207678_10011571 | 3300026067 | Bacteria | 7749 |
| 271 | Ga0207678_10473257 | 3300026067 | Bacteria | 1090 |
| 272 | Ga0207708_10048386 | 3300026075 | Bacteria | 3237 |
| 273 | Ga0207708_10640998 | 3300026075 | Bacteria | 903 |
| 274 | Ga0207641_10001384 | 3300026088 | Bacteria | 23892 |
| 275 | Ga0207641_10119903 | 3300026088 | Bacteria | 2345 |
| 276 | Ga0207641_10640355 | 3300026088 | Bacteria | 1043 |
| 277 | Ga0207648_10002256 | 3300026089 | Bacteria | 20849 |
| 278 | Ga0207676_10292335 | 3300026095 | Bacteria | 1484 |
| 279 | Ga0207676_10451290 | 3300026095 | Bacteria | 1212 |
| 280 | Ga0207676_10639673 | 3300026095 | Bacteria | 1025 |
| 281 | Ga0207674_10131631 | 3300026116 | Bacteria | 2464 |
| 282 | Ga0207675_100002064 | 3300026118 | Bacteria | 20030 |
| 283 | Ga0207683_10001521 | 3300026121 | Bacteria | 20891 |
| 284 | Ga0207698_10610245 | 3300026142 | Bacteria | 1077 |
| 285 | Ga0209813_10090406 | 3300027866 | Bacteria | 1027 |
| 286 | Ga0207428_10059942 | 3300027907 | Bacteria | 3015 |
| 287 | Ga0268266_10012998 | 3300028379 | Bacteria | 7178 |
| 288 | Ga0268265_10000022 | 3300028380 | Bacteria | 270788 |
| 289 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 290 | Ga0268264_10005951 | 3300028381 | Bacteria | 10323 |
| 291 | Ga0268264_10126961 | 3300028381 | Bacteria | 2255 |
| 292 | Ga0307511_10056191 | 3300030521 | Bacteria | 3081 |
| 293 | Ga0316176_1120777 | 3300030732 | Bacteria | 1942 |
| 294 | Ga0316183_1035066 | 3300030742 | Bacteria | 1156 |
| 295 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 296 | Ga0307408_100568448 | 3300031548 | Bacteria | 1003 |
| 297 | Ga0316575_10029870 | 3300031665 | Bacteria | 2129 |
| 298 | Ga0316579_10017900 | 3300031691 | Bacteria | 3113 |
| 299 | Ga0316576_10060416 | 3300031727 | Bacteria | 2776 |
| 300 | Ga0316578_10209206 | 3300031728 | Bacteria | 1173 |
| 301 | Ga0307405_10018897 | 3300031731 | Bacteria | 3814 |
| 302 | Ga0316577_10333461 | 3300031733 | Bacteria | 860 |
| 303 | Ga0307413_10085143 | 3300031824 | Bacteria | 2040 |
| 304 | Ga0307413_10143265 | 3300031824 | Bacteria | 1654 |
| 305 | Ga0307413_10183061 | 3300031824 | Bacteria | 1496 |
| 306 | Ga0307410_10125199 | 3300031852 | Bacteria | 1880 |
| 307 | Ga0307410_10249582 | 3300031852 | Bacteria | 1379 |
| 308 | Ga0307410_10599975 | 3300031852 | Bacteria | 918 |
| 309 | Ga0307407_10018303 | 3300031903 | Bacteria | 3540 |
| 310 | Ga0307407_10059858 | 3300031903 | Bacteria | 2220 |
| 311 | Ga0307407_10102065 | 3300031903 | Bacteria | 1783 |
| 312 | Ga0307412_10212864 | 3300031911 | Bacteria | 1476 |
| 313 | Ga0307412_10357771 | 3300031911 | Bacteria | 1174 |
| 314 | Ga0307409_100004499 | 3300031995 | Bacteria | 7849 |
| 315 | Ga0307409_100267210 | 3300031995 | Bacteria | 1573 |
| 316 | Ga0307409_100562406 | 3300031995 | Bacteria | 1121 |
| 317 | Ga0307409_101048399 | 3300031995 | Bacteria | 835 |
| 318 | Ga0307416_100160395 | 3300032002 | Bacteria | 2078 |
| 319 | Ga0307416_100474357 | 3300032002 | Bacteria | 1310 |
| 320 | Ga0307414_10088660 | 3300032004 | Bacteria | 2290 |
| 321 | Ga0307414_10172679 | 3300032004 | Bacteria | 1730 |
| 322 | Ga0307414_10675625 | 3300032004 | Bacteria | 933 |
| 323 | Ga0307411_10305562 | 3300032005 | Bacteria | 1278 |
| 324 | Ga0307415_100051963 | 3300032126 | Bacteria | 2784 |
| 325 | Ga0307415_100138218 | 3300032126 | Bacteria | 1856 |
| 326 | Ga0307415_100400896 | 3300032126 | Bacteria | 1171 |
| 327 | Ga0316592_1018804 | 3300033524 | Bacteria | 1458 |
| 328 | Ga0316588_1099128 | 3300033528 | Bacteria | 729 |
| 329 | Ga0316596_1011082 | 3300033541 | Bacteria | 2195 |
| 330 | Ga0373958_0021254 | 3300034819 | Bacteria | 1203 |
| 331 | Ga0373949_0034009 | 3300035090 | Bacteria | 1227 |
| 332 | Ga0373952_0013839 | 3300035092 | Bacteria | 1607 |
| 333 | Ga0373961_0096863 | 3300035241 | Bacteria | 950 |
| 334 | Ga0373962_0099598 | 3300035242 | Bacteria | 905 |
| 335 | Ga0316574_0001480 | 3300035398 | Bacteria | 11186 |
| 336 | Ga0373931_0166372 | 3300035691 | Bacteria | 1296 |
| 337 | Ga0316582_0098538 | 3300036647 | Bacteria | 1933 |
| 338 | Ga0316584_0065499 | 3300036712 | Bacteria | 2721 |
| 339 | Ga0395900_0166917 | 3300037418 | Bacteria | 2243 |
| 340 | Ga0395898_0181056 | 3300037466 | Bacteria | 2014 |
| 341 | Ga0395898_0468312 | 3300037466 | Bacteria | 1199 |
| 342 | Ga0395901_0338158 | 3300038443 | Bacteria | 1555 |
| 343 | Ga0242420_017563 | 3300038996 | Bacteria | 1253 |
| 344 | Ga0436365_1912815 | 3300039437 | Bacteria | 1047 |
| 345 | Ga0439436_0017852 | 3300041404 | Bacteria | 2123 |
| 346 | Ga0439438_052351 | 3300041405 | Bacteria | 1035 |
| 347 | Ga0439439_0001664 | 3300041406 | Bacteria | 4503 |
| 348 | Ga0439461_0014172 | 3300041410 | Bacteria | 1512 |
| 349 | Ga0439461_0028633 | 3300041410 | Bacteria | 1148 |
| 350 | Ga0439466_0039544 | 3300041411 | Bacteria | 1580 |
| 351 | Ga0439466_0052307 | 3300041411 | Bacteria | 1335 |
| 352 | Ga0439465_0004465 | 3300041413 | Bacteria | 4526 |
| 353 | Ga0451800_1651231 | 3300041459 | Bacteria | 860 |
| 354 | Ga0451833_0930245 | 3300041491 | Bacteria | 992 |
| 355 | Ga0451833_1420425 | 3300041491 | Bacteria | 962 |
| 356 | Ga0451837_1540429 | 3300041494 | Bacteria | 1575 |
| 357 | Ga0451839_0151690 | 3300041496 | Bacteria | 834 |
| 358 | Ga0451853_1178819 | 3300041512 | Bacteria | 2324 |
| 359 | Ga0439442_013782 | 3300042002 | Bacteria | 1660 |
| 360 | Ga0439442_041753 | 3300042002 | Bacteria | 964 |
| 361 | Ga0439445_0006922 | 3300042004 | Bacteria | 2619 |
| 362 | Ga0439448_0090578 | 3300042005 | Bacteria | 1033 |
| 363 | Ga0439449_0063432 | 3300042007 | Bacteria | 1363 |
| 364 | Ga0439457_002215 | 3300042014 | Bacteria | 5624 |
| 365 | Ga0450908_020399 | 3300042184 | Bacteria | 1165 |
| 366 | Ga0466969_0262021 | 3300044656 | Bacteria | 783 |
| 367 | Ga0466972_0007943 | 3300044658 | Bacteria | 5318 |
| 368 | Ga0466965_0010425 | 3300044683 | Bacteria | 4335 |
| 369 | Ga0466965_0126491 | 3300044683 | Bacteria | 1322 |
| 370 | Ga0466965_0135157 | 3300044683 | Bacteria | 1281 |
| 371 | Ga0466965_0139494 | 3300044683 | Bacteria | 1261 |
| 372 | Ga0466965_0230273 | 3300044683 | Bacteria | 990 |
| 373 | Ga0466966_0080967 | 3300044684 | Bacteria | 2022 |
| 374 | Ga0466966_0279288 | 3300044684 | Bacteria | 1005 |
| 375 | Ga0466961_0014059 | 3300044693 | Bacteria | 5133 |
| 376 | Ga0466961_0154795 | 3300044693 | Bacteria | 1430 |
| 377 | Ga0466963_0049053 | 3300044694 | Bacteria | 2791 |
| 378 | Ga0466964_0125217 | 3300044706 | Bacteria | 1163 |
| 379 | Ga0466971_0030753 | 3300044719 | Bacteria | 2403 |
| 380 | Ga0466970_0015597 | 3300044765 | Bacteria | 3911 |
| 381 | Ga0466970_0041257 | 3300044765 | Bacteria | 2451 |
| 382 | Ga0466970_0157007 | 3300044765 | Bacteria | 1257 |
| 383 | Ga0466957_0040100 | 3300044842 | Bacteria | 2827 |
| 384 | Ga0466957_0129558 | 3300044842 | Bacteria | 1615 |
| 385 | Ga0466957_0258112 | 3300044842 | Bacteria | 1161 |
| 386 | Ga0466960_0008863 | 3300044901 | Bacteria | 4132 |
| 387 | Ga0466960_0046852 | 3300044901 | Bacteria | 2071 |
| 388 | Ga0466960_0060274 | 3300044901 | Bacteria | 1859 |
| 389 | Ga0466960_0095993 | 3300044901 | Bacteria | 1519 |
| 390 | Ga0466960_0098191 | 3300044901 | Bacteria | 1504 |
| 391 | Ga0466960_0115977 | 3300044901 | Bacteria | 1397 |
| 392 | Ga0466960_0175939 | 3300044901 | Bacteria | 1157 |
| 393 | Ga0466960_0213028 | 3300044901 | Bacteria | 1060 |
| 394 | Ga0466960_0292990 | 3300044901 | Bacteria | 915 |
| 395 | Ga0466960_0380090 | 3300044901 | Bacteria | 810 |
| 396 | Ga0451576_1722735 | 3300045051 | Bacteria | 649 |
| 397 | Ga0466958_0035085 | 3300045836 | Bacteria | 2995 |
| 398 | Ga0466958_0325999 | 3300045836 | Bacteria | 987 |
| 399 | Ga0466967_0005418 | 3300045976 | Bacteria | 8840 |
| 400 | Ga0466967_0013542 | 3300045976 | Bacteria | 6308 |
| 401 | Ga0466967_0031836 | 3300045976 | Bacteria | 4446 |
| 402 | Ga0466967_0082261 | 3300045976 | Bacteria | 2909 |
| 403 | Ga0466967_0111971 | 3300045976 | Bacteria | 2509 |
| 404 | Ga0466967_0149309 | 3300045976 | Bacteria | 2183 |
| 405 | Ga0466967_0180952 | 3300045976 | Bacteria | 1988 |
| 406 | Ga0466967_0194515 | 3300045976 | Bacteria | 1918 |
| 407 | Ga0466967_0531400 | 3300045976 | Bacteria | 1156 |
| 408 | Ga0466967_0543790 | 3300045976 | Bacteria | 1143 |
| 409 | Ga0466967_1135897 | 3300045976 | Bacteria | 778 |
| 410 | Ga0495590_0106347 | 3300046457 | Bacteria | 999 |
| 411 | Ga0495582_0137551 | 3300046473 | Bacteria | 1383 |
| 412 | Ga0495585_0101767 | 3300046492 | Bacteria | 1536 |
| 413 | Ga0495648_0012039 | 3300046524 | Bacteria | 6480 |
| 414 | Ga0495654_0035358 | 3300046530 | Bacteria | 2516 |
| 415 | Ga0495611_0045012 | 3300046648 | Bacteria | 1975 |
| 416 | Ga0495658_0349217 | 3300046683 | Bacteria | 940 |
| 417 | Ga0495671_0125209 | 3300046692 | Bacteria | 1253 |
| 418 | Ga0495672_0002334 | 3300047320 | Bacteria | 17587 |
| 419 | Ga0495672_0054180 | 3300047320 | Bacteria | 2346 |
| 420 | Ga0495672_0057053 | 3300047320 | Bacteria | 2269 |
| 421 | Ga0495676_0097315 | 3300047321 | Bacteria | 2186 |
| 422 | Ga0495673_0000805 | 3300047469 | Bacteria | 29466 |
| 423 | Ga0495593_0112535 | 3300047673 | Bacteria | 1389 |
| 424 | Ga0496100_0003761 | 3300048903 | Bacteria | 7949 |
| 425 | Ga0496100_0535105 | 3300048903 | Bacteria | 905 |
| 426 | Ga0496101_0000691 | 3300048904 | Bacteria | 20348 |
| 427 | Ga0496102_0000415 | 3300048905 | Bacteria | 49294 |
| 428 | Ga0496102_0000473 | 3300048905 | Bacteria | 44556 |
| 429 | Ga0496102_0004268 | 3300048905 | Bacteria | 12085 |
| 430 | Ga0496102_0087146 | 3300048905 | Bacteria | 2884 |
| 431 | Ga0496102_0103244 | 3300048905 | Bacteria | 2651 |
| 432 | Ga0496102_0745233 | 3300048905 | Bacteria | 902 |
| 433 | Ga0496103_0000906 | 3300048906 | Bacteria | 21290 |
| 434 | Ga0496103_0002413 | 3300048906 | Bacteria | 11762 |
| 435 | Ga0496103_0013273 | 3300048906 | Bacteria | 4882 |
| 436 | Ga0496103_0116562 | 3300048906 | Bacteria | 1699 |
| 437 | Ga0496104_0042002 | 3300048907 | Bacteria | 4289 |
| 438 | Ga0496104_0253820 | 3300048907 | Bacteria | 1671 |
| 439 | Ga0496104_0755116 | 3300048907 | Bacteria | 879 |
| 440 | Ga0496105_0125958 | 3300048908 | Bacteria | 2111 |
| 441 | Ga0496105_0267499 | 3300048908 | Bacteria | 1381 |
| 442 | Ga0496105_0520908 | 3300048908 | Bacteria | 931 |
| 443 | Ga0496106_0001016 | 3300048909 | Bacteria | 20579 |
| 444 | Ga0496106_0005923 | 3300048909 | Bacteria | 9038 |
| 445 | Ga0496107_0016176 | 3300048910 | Bacteria | 5234 |
| 446 | Ga0496107_0114720 | 3300048910 | Bacteria | 1982 |
| 447 | Ga0496108_0028097 | 3300048911 | Bacteria | 4653 |
| 448 | Ga0496108_0263958 | 3300048911 | Bacteria | 1498 |
| 449 | Ga0496109_0058601 | 3300048912 | Bacteria | 3518 |
| 450 | Ga0496109_0287633 | 3300048912 | Bacteria | 1549 |
| 451 | Ga0496109_0311753 | 3300048912 | Bacteria | 1484 |
| 452 | Ga0496109_0502992 | 3300048912 | Bacteria | 1144 |
| 453 | Ga0496109_0530361 | 3300048912 | Bacteria | 1111 |
| 454 | Ga0496110_0002566 | 3300048913 | Bacteria | 13655 |
| 455 | Ga0496110_0003020 | 3300048913 | Bacteria | 12767 |
| 456 | Ga0496110_0768126 | 3300048913 | Bacteria | 867 |
| 457 | Ga0496111_0021913 | 3300048914 | Bacteria | 4466 |
| 458 | Ga0496111_0176614 | 3300048914 | Bacteria | 1587 |
| 459 | Ga0496112_0028280 | 3300048915 | Bacteria | 5410 |
| 460 | Ga0496112_0186348 | 3300048915 | Bacteria | 2038 |
| 461 | Ga0496112_0468162 | 3300048915 | Bacteria | 1197 |
| 462 | Ga0496112_1269469 | 3300048915 | Bacteria | 652 |
| 463 | Ga0496113_0021372 | 3300048916 | Bacteria | 4565 |
| 464 | Ga0496114_0000153 | 3300048917 | Bacteria | 50028 |
| 465 | Ga0496114_0107141 | 3300048917 | Bacteria | 2391 |
| 466 | Ga0496115_0004346 | 3300048918 | Bacteria | 10254 |
| 467 | Ga0496115_0140640 | 3300048918 | Bacteria | 1991 |
| 468 | Ga0496116_0026069 | 3300048919 | Bacteria | 4283 |
| 469 | Ga0496116_0209961 | 3300048919 | Bacteria | 1010 |
| 470 | Ga0496117_0174642 | 3300048920 | Bacteria | 1243 |
| 471 | Ga0496118_0001365 | 3300048921 | Bacteria | 36792 |
| 472 | Ga0496119_0018915 | 3300048922 | Bacteria | 5101 |
| 473 | Ga0496120_0067128 | 3300048923 | Bacteria | 1982 |
| 474 | Ga0496121_0082139 | 3300048924 | Bacteria | 2548 |
| 475 | Ga0496124_0024263 | 3300048927 | Bacteria | 5519 |
| 476 | Ga0496126_0005099 | 3300048929 | Bacteria | 15224 |
| 477 | Ga0501306_001693 | 3300049127 | Bacteria | 2137 |
| 478 | Ga0501306_007769 | 3300049127 | Bacteria | 1292 |
| 479 | Ga0501306_013397 | 3300049127 | Bacteria | 1069 |
| 480 | Ga0501308_001262 | 3300049128 | Bacteria | 1973 |
| 481 | Ga0501308_001922 | 3300049128 | Bacteria | 1750 |
| 482 | Ga0501308_009318 | 3300049128 | Bacteria | 1070 |
| 483 | Ga0501309_000178 | 3300049129 | Bacteria | 4209 |
| 484 | Ga0501309_001465 | 3300049129 | Bacteria | 2328 |
| 485 | Ga0501309_004756 | 3300049129 | Bacteria | 1594 |
| 486 | Ga0501310_002424 | 3300049130 | Bacteria | 1771 |
| 487 | Ga0501310_021008 | 3300049130 | Bacteria | 814 |
| 488 | Ga0501304_002286 | 3300049160 | Bacteria | 1320 |
| 489 | Ga0501305_001701 | 3300049161 | Bacteria | 2222 |
| 490 | Ga0501305_003255 | 3300049161 | Bacteria | 1827 |
| 491 | Ga0501307_005562 | 3300049162 | Bacteria | 1332 |
| 492 | Ga0501307_010162 | 3300049162 | Bacteria | 1085 |
| 493 | Ga0501307_017212 | 3300049162 | Bacteria | 909 |
| 494 | Ga0501291_022464 | 3300049514 | Bacteria | 1012 |
| 495 | Ga0501311_004092 | 3300049527 | Bacteria | 1535 |
| 496 | Ga0501311_004901 | 3300049527 | Bacteria | 1443 |
| 497 | Ga0501311_014200 | 3300049527 | Bacteria | 1014 |
| 498 | Ga0501312_000825 | 3300049528 | Bacteria | 2752 |
| 499 | Ga0501312_002931 | 3300049528 | Bacteria | 1886 |
| 500 | Ga0501313_001487 | 3300049529 | Bacteria | 2053 |
| 501 | Ga0501313_019064 | 3300049529 | Bacteria | 837 |
| 502 | Ga0501313_025343 | 3300049529 | Bacteria | 750 |
| 503 | Ga0501314_000768 | 3300049530 | Bacteria | 2121 |
| 504 | Ga0501315_002341 | 3300049531 | Bacteria | 1767 |
| 505 | Ga0501316_000783 | 3300049532 | Bacteria | 2419 |
| 506 | Ga0501316_001281 | 3300049532 | Bacteria | 2096 |
| 507 | Ga0501316_004979 | 3300049532 | Bacteria | 1358 |
| 508 | Ga0501317_000435 | 3300049533 | Bacteria | 2897 |
| 509 | Ga0501317_000756 | 3300049533 | Bacteria | 2473 |
| 510 | Ga0501317_015612 | 3300049533 | Bacteria | 976 |
| 511 | Ga0501318_000293 | 3300049534 | Bacteria | 2911 |
| 512 | Ga0501318_000622 | 3300049534 | Bacteria | 2357 |
| 513 | Ga0501318_004378 | 3300049534 | Bacteria | 1351 |
| 514 | Ga0501318_006608 | 3300049534 | Bacteria | 1189 |
| 515 | Ga0501318_013676 | 3300049534 | Bacteria | 947 |
| 516 | Ga0501318_014478 | 3300049534 | Bacteria | 931 |
| 517 | Ga0501319_001043 | 3300049535 | Bacteria | 1516 |
| 518 | Ga0501320_004420 | 3300049536 | Bacteria | 1240 |
| 519 | Ga0501321_000223 | 3300049537 | Bacteria | 3255 |
| 520 | Ga0501321_000446 | 3300049537 | Bacteria | 2648 |
| 521 | Ga0501321_014497 | 3300049537 | Bacteria | 918 |
| 522 | Ga0501323_000695 | 3300049539 | Bacteria | 2628 |
| 523 | Ga0501324_000317 | 3300049540 | Bacteria | 2469 |
| 524 | Ga0501333_004354 | 3300049549 | Bacteria | 892 |
| 525 | Ga0501340_000700 | 3300049556 | Bacteria | 1593 |
| 526 | Ga0501034_0365623 | 3300049571 | Bacteria | 1369 |
| 527 | Ga0501036_0089550 | 3300049572 | Bacteria | 2600 |
| 528 | Ga0501039_0193911 | 3300049575 | Bacteria | 1597 |
| 529 | Ga0501039_0349800 | 3300049575 | Bacteria | 1161 |
| 530 | Ga0501039_0450267 | 3300049575 | Bacteria | 1011 |
| 531 | Ga0501039_0623996 | 3300049575 | Bacteria | 844 |
| 532 | Ga0501039_0685713 | 3300049575 | Bacteria | 801 |
| 533 | Ga0501039_0793613 | 3300049575 | Bacteria | 739 |
| 534 | Ga0501040_0047321 | 3300049576 | Bacteria | 2938 |
| 535 | Ga0501040_0106687 | 3300049576 | Bacteria | 1957 |
| 536 | Ga0501040_0274266 | 3300049576 | Bacteria | 1204 |
| 537 | Ga0501041_0188567 | 3300049577 | Bacteria | 1291 |
| 538 | Ga0501041_0239630 | 3300049577 | Bacteria | 1140 |
| 539 | Ga0501042_0094733 | 3300049578 | Bacteria | 2144 |
| 540 | Ga0501042_0166457 | 3300049578 | Bacteria | 1591 |
| 541 | Ga0501042_0347868 | 3300049578 | Bacteria | 1072 |
| 542 | Ga0501043_0668646 | 3300049579 | Bacteria | 761 |
| 543 | Ga0501046_0282482 | 3300049580 | Bacteria | 1216 |
| 544 | Ga0501047_0674618 | 3300049581 | Bacteria | 852 |
| 545 | Ga0501048_0357014 | 3300049582 | Bacteria | 1042 |
| 546 | Ga0501067_0018448 | 3300049583 | Bacteria | 3865 |
| 547 | Ga0501067_0047395 | 3300049583 | Bacteria | 2383 |
| 548 | Ga0501067_0056320 | 3300049583 | Bacteria | 2178 |
| 549 | Ga0501068_0005522 | 3300049584 | Bacteria | 6928 |
| 550 | Ga0501069_0143732 | 3300049585 | Bacteria | 1369 |
| 551 | Ga0501070_0012735 | 3300049586 | Bacteria | 7091 |
| 552 | Ga0501070_0051285 | 3300049586 | Bacteria | 3425 |
| 553 | Ga0501071_0473734 | 3300049587 | Bacteria | 959 |
| 554 | Ga0501071_0641317 | 3300049587 | Bacteria | 817 |
| 555 | Ga0501072_0020572 | 3300049588 | Bacteria | 5115 |
| 556 | Ga0501072_0402708 | 3300049588 | Bacteria | 1085 |
| 557 | Ga0501073_0009585 | 3300049589 | Bacteria | 7141 |
| 558 | Ga0501074_0012602 | 3300049590 | Bacteria | 6147 |
| 559 | Ga0501074_0289478 | 3300049590 | Bacteria | 1164 |
| 560 | Ga0501074_0368651 | 3300049590 | Bacteria | 1019 |
| 561 | Ga0501076_0338603 | 3300049592 | Bacteria | 1234 |
| 562 | Ga0501077_0052062 | 3300049593 | Bacteria | 2600 |
| 563 | Ga0501077_0518364 | 3300049593 | Bacteria | 765 |
| 564 | Ga0501079_0182081 | 3300049741 | Bacteria | 1640 |
| 565 | Ga0501079_0247014 | 3300049741 | Bacteria | 1394 |
| 566 | Ga0501079_0458501 | 3300049741 | Bacteria | 1001 |
| 567 | Ga0501080_0161166 | 3300049742 | Bacteria | 2071 |
| 568 | Ga0501081_0314113 | 3300049743 | Bacteria | 1151 |
| 569 | Ga0501083_0060051 | 3300049744 | Bacteria | 2541 |
| 570 | Ga0501271_002630 | 3300049768 | Bacteria | 1615 |
| 571 | Ga0501044_0254784 | 3300049823 | Bacteria | 1695 |
| 572 | Ga0501045_0059228 | 3300049824 | Bacteria | 2805 |
| 573 | Ga0501045_0161508 | 3300049824 | Bacteria | 1668 |
| 574 | Ga0501045_0646918 | 3300049824 | Bacteria | 781 |
| 575 | nmdc:mga03683_45975_c1 | 3300050489 | Bacteria | 1808 |
| 576 | nmdc:mga03n38_162103_c1 | 3300050490 | Bacteria | 805 |
| 577 | nmdc:mga03n38_1711_c1 | 3300050490 | Bacteria | 6465 |
| 578 | nmdc:mga03n38_90510_c1 | 3300050490 | Bacteria | 1456 |
| 579 | nmdc:mga00v17_20801_c1 | 3300050491 | Bacteria | 3764 |
| 580 | nmdc:mga00v17_21448_c1 | 3300050491 | Bacteria | 3714 |
| 581 | nmdc:mga00v17_306446_c1 | 3300050491 | Bacteria | 1032 |
| 582 | nmdc:mga00v17_333923_c1 | 3300050491 | Bacteria | 985 |
| 583 | nmdc:mga00v17_46427_c1 | 3300050491 | Bacteria | 2628 |
| 584 | nmdc:mga00v17_53384_c1 | 3300050491 | Bacteria | 2463 |
| 585 | nmdc:mga0yw44_366089_c1 | 3300050492 | Bacteria | 972 |
| 586 | nmdc:mga0yw44_38654_c1 | 3300050492 | Bacteria | 2825 |
| 587 | nmdc:mga0yw44_57995_c1 | 3300050492 | Bacteria | 2364 |
| 588 | nmdc:mga0yw44_62695_c1 | 3300050492 | Bacteria | 2284 |
| 589 | nmdc:mga06z11_88551_c1 | 3300050494 | Bacteria | 1676 |
| 590 | nmdc:mga07m45_179374_c1 | 3300050496 | Bacteria | 1232 |
| 591 | nmdc:mga07m45_36992_c1 | 3300050496 | Bacteria | 2722 |
| 592 | nmdc:mga07m45_68362_c1 | 3300050496 | Bacteria | 2019 |
| 593 | nmdc:mga05p37_10660_c1 | 3300050507 | Bacteria | 10905 |
| 594 | nmdc:mga09592_2299_c1 | 3300050508 | Bacteria | 15408 |
| 595 | nmdc:mga0qj67_73060_c1 | 3300050509 | Bacteria | 2121 |
| 596 | nmdc:mga06r32_130_c1 | 3300050510 | Bacteria | 55123 |
| 597 | nmdc:mga08y16_3501_c1 | 3300050511 | Bacteria | 16300 |
| 598 | nmdc:mga08y16_525368_c1 | 3300050511 | Bacteria | 1200 |
| 599 | nmdc:mga0a205_62541_c1 | 3300050515 | Bacteria | 3596 |
| 600 | nmdc:mga0sz30_3448_c1 | 3300050516 | Bacteria | 5697 |
| 601 | nmdc:mga0sz30_50890_c1 | 3300050516 | Bacteria | 1757 |
| 602 | nmdc:mga0sz30_6746_c2 | 3300050516 | Bacteria | 1712 |
| 603 | nmdc:mga0sz30_9944_c1 | 3300050516 | Bacteria | 3633 |
| 604 | Ga0495619_0239729 | 3300053085 | Bacteria | 1257 |
| 605 | Ga0500646_0040691 | 3300053090 | Bacteria | 1308 |
| 606 | Ga0501084_0081326 | 3300054114 | Bacteria | 2717 |
| 607 | Ga0501084_0390289 | 3300054114 | Bacteria | 1176 |
| 608 | Ga0501084_0480212 | 3300054114 | Bacteria | 1050 |
| 609 | Ga0587084_009923 | 3300059477 | Bacteria | 1239 |
| 610 | Ga0587093_004188 | 3300059478 | Bacteria | 1458 |
| 611 | Ga0587070_035544 | 3300059491 | Bacteria | 927 |
| 612 | Ga0587073_0026157 | 3300059492 | Bacteria | 1166 |
| 613 | Ga0587073_0035387 | 3300059492 | Bacteria | 1058 |
| 614 | Ga0587088_029575 | 3300059508 | Bacteria | 970 |
| 615 | Ga0587090_051558 | 3300059510 | Bacteria | 755 |
| 616 | Ga0587092_011416 | 3300059512 | Bacteria | 1235 |
| 617 | Ga0587106_024093 | 3300059605 | Bacteria | 928 |
| 618 | Ga0587106_024612 | 3300059605 | Bacteria | 922 |
| 619 | Ga0587106_036262 | 3300059605 | Bacteria | 817 |
| 620 | Ga0587125_018228 | 3300059607 | Bacteria | 805 |
| 621 | Ga0587129_001917 | 3300059608 | Bacteria | 1180 |
| 622 | Ga0587099_008267 | 3300059622 | Bacteria | 1001 |
| 623 | Ga0587101_008779 | 3300059623 | Bacteria | 1231 |
| 624 | Ga0587109_041569 | 3300059624 | Bacteria | 913 |
| 625 | Ga0587117_013196 | 3300059627 | Bacteria | 1054 |
| 626 | Ga0587122_009649 | 3300059628 | Bacteria | 897 |
| 627 | Ga0587128_012632 | 3300059630 | Bacteria | 1177 |
| 628 | Ga0587062_006343 | 3300059639 | Bacteria | 1341 |
| 629 | Ga0587069_031284 | 3300059642 | Bacteria | 862 |
| 630 | Ga0587072_018139 | 3300059643 | Bacteria | 1220 |
| 631 | Ga0587075_003565 | 3300059644 | Bacteria | 1746 |
| 632 | Ga0587078_005748 | 3300059646 | Bacteria | 1332 |
| 633 | Ga0587079_009278 | 3300059647 | Bacteria | 1527 |
| 634 | Ga0587079_030308 | 3300059647 | Bacteria | 1035 |
| 635 | Ga0587100_001887 | 3300059648 | Bacteria | 1283 |
| 636 | Ga0587102_011562 | 3300059649 | Bacteria | 889 |
| 637 | Ga0587105_004755 | 3300059651 | Bacteria | 880 |
| 638 | Ga0587105_007091 | 3300059651 | Bacteria | 785 |
| 639 | Ga0587107_005072 | 3300059652 | Bacteria | 1374 |
| 640 | Ga0587107_013837 | 3300059652 | Bacteria | 1029 |
| 641 | Ga0587107_014561 | 3300059652 | Bacteria | 1013 |
| 642 | Ga0587119_020478 | 3300059658 | Bacteria | 840 |
| 643 | Ga0587071_027839 | 3300060344 | Bacteria | 1073 |
| 644 | Ga0587071_061619 | 3300060344 | Bacteria | 799 |
| 645 | Ga0587111_0002748 | 3300060346 | Bacteria | 2401 |
| 646 | Ga0587111_0050936 | 3300060346 | Bacteria | 914 |
| 647 | Ga0501082_0003723 | 3300060353 | Bacteria | 13323 |
| 648 | Ga0466962_0047571 | 3300061719 | Bacteria | 2049 |
| 649 | Ga0530510_0228964 | 3300061734 | Bacteria | 1382 |
| 650 | Ga0530510_0415616 | 3300061734 | Bacteria | 1015 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005457 | Ga0070662_100227868 | Ga0070662_1002278682 | 153 |
| 2 | 3300044683 | Ga0466965_0135157 | Ga0466965_0135157_177_821 | 160 |
| 3 | 3300048915 | Ga0496112_1269469 | Ga0496112_1269469_18_593 | 161 |
| 4 | 3300003308 | Ga0006777J48905_1021747 | Ga0006777J48905_10217472 | 164 |
| 5 | 3300003544 | Ga0007417J51691_1032364 | Ga0007417J51691_10323642 | 164 |
| 6 | 3300003693 | Ga0032354_1008262 | Ga0032354_10082622 | 164 |
| 7 | 3300049129 | Ga0501309_000178 | Ga0501309_000178_848_1513 | 164 |
| 8 | 3300049528 | Ga0501312_000825 | Ga0501312_000825_1490_2155 | 164 |
| 9 | 3300003162 | Ga0006778J45830_1028228 | Ga0006778J45830_10282282 | 165 |
| 10 | 3300003308 | Ga0006777J48905_1059879 | Ga0006777J48905_10598792 | 165 |
| 11 | 3300003575 | Ga0007409J51694_1063908 | Ga0007409J51694_10639082 | 165 |
| 12 | 3300003579 | Ga0007429J51699_1024979 | Ga0007429J51699_10249792 | 165 |
| 13 | 3300003693 | Ga0032354_1037833 | Ga0032354_10378332 | 165 |
| 14 | 3300050516 | nmdc:mga0sz30_6746_c2 | nmdc:mga0sz30_6746_c2_23_637 | 171 |
| 15 | 3300049540 | Ga0501324_000317 | Ga0501324_000317_360_1034 | 172 |
| 16 | 3300003574 | Ga0007410J51695_1039556 | Ga0007410J51695_10395561 | 173 |
| 17 | 3300004798 | Ga0058859_10026884 | Ga0058859_100268841 | 173 |
| 18 | 3300004801 | Ga0058860_10155767 | Ga0058860_101557673 | 173 |
| 19 | 3300020075 | Ga0206349_1051251 | Ga0206349_10512512 | 173 |
| 20 | 3300025901 | Ga0207688_10358732 | Ga0207688_103587322 | 173 |
| 21 | 3300031731 | Ga0307405_10018897 | Ga0307405_100188974 | 173 |
| 22 | 3300031824 | Ga0307413_10143265 | Ga0307413_101432652 | 173 |
| 23 | 3300031852 | Ga0307410_10125199 | Ga0307410_101251992 | 173 |
| 24 | 3300031903 | Ga0307407_10018303 | Ga0307407_100183034 | 173 |
| 25 | 3300031911 | Ga0307412_10212864 | Ga0307412_102128642 | 173 |
| 26 | 3300031995 | Ga0307409_100004499 | Ga0307409_1000044993 | 173 |
| 27 | 3300032004 | Ga0307414_10088660 | Ga0307414_100886603 | 173 |
| 28 | 3300032126 | Ga0307415_100051963 | Ga0307415_1000519634 | 173 |
| 29 | 3300049127 | Ga0501306_001693 | Ga0501306_001693_704_1381 | 173 |
| 30 | 3300049128 | Ga0501308_001922 | Ga0501308_001922_448_1125 | 173 |
| 31 | 3300049129 | Ga0501309_001465 | Ga0501309_001465_846_1523 | 173 |
| 32 | 3300049130 | Ga0501310_002424 | Ga0501310_002424_715_1392 | 173 |
| 33 | 3300049161 | Ga0501305_001701 | Ga0501305_001701_1180_1857 | 173 |
| 34 | 3300049162 | Ga0501307_010162 | Ga0501307_010162_83_760 | 173 |
| 35 | 3300049514 | Ga0501291_022464 | Ga0501291_022464_136_813 | 173 |
| 36 | 3300049527 | Ga0501311_004901 | Ga0501311_004901_379_1056 | 173 |
| 37 | 3300049528 | Ga0501312_002931 | Ga0501312_002931_321_998 | 173 |
| 38 | 3300049529 | Ga0501313_001487 | Ga0501313_001487_662_1339 | 173 |
| 39 | 3300049530 | Ga0501314_000768 | Ga0501314_000768_139_816 | 173 |
| 40 | 3300049531 | Ga0501315_002341 | Ga0501315_002341_462_1139 | 173 |
| 41 | 3300049532 | Ga0501316_004979 | Ga0501316_004979_388_1065 | 173 |
| 42 | 3300049533 | Ga0501317_000756 | Ga0501317_000756_1123_1800 | 173 |
| 43 | 3300049534 | Ga0501318_000293 | Ga0501318_000293_900_1577 | 173 |
| 44 | 3300049535 | Ga0501319_001043 | Ga0501319_001043_461_1138 | 173 |
| 45 | 3300049536 | Ga0501320_004420 | Ga0501320_004420_174_851 | 173 |
| 46 | 3300049537 | Ga0501321_000223 | Ga0501321_000223_2003_2680 | 173 |
| 47 | 3300049539 | Ga0501323_000695 | Ga0501323_000695_1711_2388 | 173 |
| 48 | 3300049549 | Ga0501333_004354 | Ga0501333_004354_45_719 | 173 |
| 49 | 3300049556 | Ga0501340_000700 | Ga0501340_000700_151_828 | 173 |
| 50 | 3300049768 | Ga0501271_002630 | Ga0501271_002630_306_983 | 173 |
| 51 | 3300003160 | Ga0006779J45831_102609 | Ga0006779J45831_1026093 | 174 |
| 52 | 3300003161 | Ga0006765J45826_109836 | Ga0006765J45826_1098363 | 174 |
| 53 | 3300003163 | Ga0006759J45824_1015649 | Ga0006759J45824_10156492 | 174 |
| 54 | 3300003300 | Ga0006758J48902_1015782 | Ga0006758J48902_10157822 | 174 |
| 55 | 3300003305 | Ga0006770J48903_1014088 | Ga0006770J48903_10140883 | 174 |
| 56 | 3300003308 | Ga0006777J48905_1013451 | Ga0006777J48905_10134512 | 174 |
| 57 | 3300003559 | Ga0007427J51700_103349 | Ga0007427J51700_1033493 | 174 |
| 58 | 3300003568 | Ga0006781J51513_1004744 | Ga0006781J51513_10047443 | 174 |
| 59 | 3300003574 | Ga0007410J51695_1009274 | Ga0007410J51695_10092741 | 174 |
| 60 | 3300003575 | Ga0007409J51694_1005546 | Ga0007409J51694_10055463 | 174 |
| 61 | 3300003577 | Ga0007416J51690_1006248 | Ga0007416J51690_10062483 | 174 |
| 62 | 3300003577 | Ga0007416J51690_1006249 | Ga0007416J51690_10062492 | 174 |
| 63 | 3300003579 | Ga0007429J51699_1004465 | Ga0007429J51699_10044652 | 174 |
| 64 | 3300003611 | Ga0007411J51799_103764 | Ga0007411J51799_1037643 | 174 |
| 65 | 3300003613 | Ga0007415J51800_105039 | Ga0007415J51800_1050393 | 174 |
| 66 | 3300013105 | Ga0157369_10624296 | Ga0157369_106242962 | 174 |
| 67 | 3300044901 | Ga0466960_0008863 | Ga0466960_0008863_1779_2474 | 174 |
| 68 | 3300044901 | Ga0466960_0098191 | Ga0466960_0098191_555_1241 | 174 |
| 69 | 3300045051 | Ga0451576_1722735 | Ga0451576_1722735_24_638 | 174 |
| 70 | 3300045976 | Ga0466967_0111971 | Ga0466967_0111971_1420_2037 | 174 |
| 71 | 3300048912 | Ga0496109_0530361 | Ga0496109_0530361_282_902 | 174 |
| 72 | 3300049162 | Ga0501307_017212 | Ga0501307_017212_13_624 | 174 |
| 73 | 3300049529 | Ga0501313_025343 | Ga0501313_025343_18_632 | 174 |
| 74 | 3300049575 | Ga0501039_0623996 | Ga0501039_0623996_214_831 | 174 |
| 75 | 3300003308 | Ga0006777J48905_1034729 | Ga0006777J48905_10347292 | 175 |
| 76 | 3300003575 | Ga0007409J51694_1044798 | Ga0007409J51694_10447982 | 175 |
| 77 | 3300003693 | Ga0032354_1022152 | Ga0032354_10221522 | 175 |
| 78 | 3300001989 | JGI24739J22299_10037612 | JGI24739J22299_100376123 | 178 |
| 79 | 3300020069 | Ga0197907_11405374 | Ga0197907_114053742 | 178 |
| 80 | 3300020080 | Ga0206350_11464052 | Ga0206350_114640522 | 178 |
| 81 | 3300020610 | Ga0154015_1487752 | Ga0154015_14877522 | 178 |
| 82 | 3300032002 | Ga0307416_100474357 | Ga0307416_1004743572 | 178 |
| 83 | 3300027907 | Ga0207428_10059942 | Ga0207428_100599422 | 180 |
| 84 | 3300037418 | Ga0395900_0166917 | Ga0395900_0166917_826_1476 | 180 |
| 85 | 3300050507 | nmdc:mga05p37_10660_c1 | nmdc:mga05p37_10660_c1_9392_10057 | 180 |
| 86 | 3300050508 | nmdc:mga09592_2299_c1 | nmdc:mga09592_2299_c1_5815_6480 | 180 |
| 87 | 3300050510 | nmdc:mga06r32_130_c1 | nmdc:mga06r32_130_c1_51534_52199 | 180 |
| 88 | 3300050511 | nmdc:mga08y16_3501_c1 | nmdc:mga08y16_3501_c1_15594_16259 | 180 |
| 89 | 3300050515 | nmdc:mga0a205_62541_c1 | nmdc:mga0a205_62541_c1_1564_2229 | 180 |
| 90 | 3300059510 | Ga0587090_051558 | Ga0587090_051558_71_721 | 180 |
| 91 | 3300059605 | Ga0587106_036262 | Ga0587106_036262_73_723 | 180 |
| 92 | 3300059608 | Ga0587129_001917 | Ga0587129_001917_415_1065 | 180 |
| 93 | 3300059642 | Ga0587069_031284 | Ga0587069_031284_39_695 | 180 |
| 94 | 3300059646 | Ga0587078_005748 | Ga0587078_005748_612_1262 | 180 |
| 95 | 3300059647 | Ga0587079_030308 | Ga0587079_030308_171_821 | 180 |
| 96 | 3300059651 | Ga0587105_007091 | Ga0587105_007091_73_723 | 180 |
| 97 | 3300060344 | Ga0587071_061619 | Ga0587071_061619_111_761 | 180 |
| 98 | 3300041410 | Ga0439461_0028633 | Ga0439461_0028633_150_800 | 181 |
| 99 | 3300041411 | Ga0439466_0039544 | Ga0439466_0039544_123_773 | 181 |
| 100 | 3300041413 | Ga0439465_0004465 | Ga0439465_0004465_597_1247 | 181 |
| 101 | 3300042004 | Ga0439445_0006922 | Ga0439445_0006922_458_1108 | 181 |
| 102 | 3300001989 | JGI24739J22299_10073264 | JGI24739J22299_100732641 | 182 |
| 103 | 3300002073 | JGI24745J21846_1010180 | JGI24745J21846_10101801 | 182 |
| 104 | 3300002074 | JGI24748J21848_1001863 | JGI24748J21848_10018634 | 182 |
| 105 | 3300002075 | JGI24738J21930_10008775 | JGI24738J21930_100087753 | 182 |
| 106 | 3300002076 | JGI24749J21850_1001482 | JGI24749J21850_10014824 | 182 |
| 107 | 3300002077 | JGI24744J21845_10001209 | JGI24744J21845_100012098 | 182 |
| 108 | 3300002244 | JGI24742J22300_10008229 | JGI24742J22300_100082292 | 182 |
| 109 | 3300005328 | Ga0070676_10135919 | Ga0070676_101359191 | 182 |
| 110 | 3300005335 | Ga0070666_10145092 | Ga0070666_101450922 | 182 |
| 111 | 3300005337 | Ga0070682_100039916 | Ga0070682_1000399162 | 182 |
| 112 | 3300005338 | Ga0068868_100218028 | Ga0068868_1002180282 | 182 |
| 113 | 3300005340 | Ga0070689_100052393 | Ga0070689_1000523934 | 182 |
| 114 | 3300005347 | Ga0070668_100043717 | Ga0070668_1000437173 | 182 |
| 115 | 3300005353 | Ga0070669_100013486 | Ga0070669_1000134865 | 182 |
| 116 | 3300005353 | Ga0070669_100045228 | Ga0070669_1000452281 | 182 |
| 117 | 3300005355 | Ga0070671_101002923 | Ga0070671_1010029231 | 182 |
| 118 | 3300005356 | Ga0070674_100035311 | Ga0070674_1000353113 | 182 |
| 119 | 3300005365 | Ga0070688_100399895 | Ga0070688_1003998952 | 182 |
| 120 | 3300005367 | Ga0070667_100000074 | Ga0070667_100000074116 | 182 |
| 121 | 3300005367 | Ga0070667_100163932 | Ga0070667_1001639322 | 182 |
| 122 | 3300005406 | Ga0070703_10018558 | Ga0070703_100185583 | 182 |
| 123 | 3300005434 | Ga0070709_10046692 | Ga0070709_100466924 | 182 |
| 124 | 3300005437 | Ga0070710_10000625 | Ga0070710_1000062516 | 182 |
| 125 | 3300005437 | Ga0070710_10280136 | Ga0070710_102801361 | 182 |
| 126 | 3300005438 | Ga0070701_10015906 | Ga0070701_100159064 | 182 |
| 127 | 3300005439 | Ga0070711_100000779 | Ga0070711_1000007795 | 182 |
| 128 | 3300005440 | Ga0070705_100272374 | Ga0070705_1002723742 | 182 |
| 129 | 3300005441 | Ga0070700_100561080 | Ga0070700_1005610801 | 182 |
| 130 | 3300005455 | Ga0070663_100045912 | Ga0070663_1000459125 | 182 |
| 131 | 3300005456 | Ga0070678_100005866 | Ga0070678_1000058668 | 182 |
| 132 | 3300005457 | Ga0070662_100008435 | Ga0070662_1000084353 | 182 |
| 133 | 3300005459 | Ga0068867_100033947 | Ga0068867_1000339473 | 182 |
| 134 | 3300005539 | Ga0068853_100081495 | Ga0068853_1000814954 | 182 |
| 135 | 3300005544 | Ga0070686_100103556 | Ga0070686_1001035562 | 182 |
| 136 | 3300005545 | Ga0070695_100026313 | Ga0070695_1000263131 | 182 |
| 137 | 3300005546 | Ga0070696_100004591 | Ga0070696_10000459110 | 182 |
| 138 | 3300005548 | Ga0070665_100027663 | Ga0070665_1000276636 | 182 |
| 139 | 3300005548 | Ga0070665_100098563 | Ga0070665_1000985635 | 182 |
| 140 | 3300005548 | Ga0070665_100211452 | Ga0070665_1002114522 | 182 |
| 141 | 3300005549 | Ga0070704_100006863 | Ga0070704_1000068637 | 182 |
| 142 | 3300005578 | Ga0068854_100004108 | Ga0068854_1000041084 | 182 |
| 143 | 3300005615 | Ga0070702_100041727 | Ga0070702_1000417274 | 182 |
| 144 | 3300005616 | Ga0068852_100198688 | Ga0068852_1001986884 | 182 |
| 145 | 3300005617 | Ga0068859_100001947 | Ga0068859_10000194717 | 182 |
| 146 | 3300005617 | Ga0068859_100101969 | Ga0068859_1001019692 | 182 |
| 147 | 3300005618 | Ga0068864_100306228 | Ga0068864_1003062282 | 182 |
| 148 | 3300005618 | Ga0068864_100707269 | Ga0068864_1007072692 | 182 |
| 149 | 3300005718 | Ga0068866_10000713 | Ga0068866_1000071316 | 182 |
| 150 | 3300005719 | Ga0068861_100001091 | Ga0068861_1000010915 | 182 |
| 151 | 3300005841 | Ga0068863_100038728 | Ga0068863_1000387282 | 182 |
| 152 | 3300005842 | Ga0068858_100039329 | Ga0068858_1000393298 | 182 |
| 153 | 3300005842 | Ga0068858_100084395 | Ga0068858_1000843952 | 182 |
| 154 | 3300005843 | Ga0068860_100000276 | Ga0068860_10000027675 | 182 |
| 155 | 3300005843 | Ga0068860_100002734 | Ga0068860_10000273420 | 182 |
| 156 | 3300005844 | Ga0068862_100000065 | Ga0068862_100000065119 | 182 |
| 157 | 3300005844 | Ga0068862_100001732 | Ga0068862_1000017325 | 182 |
| 158 | 3300006038 | Ga0075365_10048243 | Ga0075365_100482431 | 182 |
| 159 | 3300006038 | Ga0075365_10193854 | Ga0075365_101938542 | 182 |
| 160 | 3300006048 | Ga0075363_100028457 | Ga0075363_1000284575 | 182 |
| 161 | 3300006048 | Ga0075363_100101894 | Ga0075363_1001018943 | 182 |
| 162 | 3300006051 | Ga0075364_10039301 | Ga0075364_100393012 | 182 |
| 163 | 3300006163 | Ga0070715_10232226 | Ga0070715_102322262 | 182 |
| 164 | 3300006173 | Ga0070716_100030475 | Ga0070716_1000304754 | 182 |
| 165 | 3300006175 | Ga0070712_100000676 | Ga0070712_1000006766 | 182 |
| 166 | 3300006178 | Ga0075367_10041162 | Ga0075367_100411625 | 182 |
| 167 | 3300006178 | Ga0075367_10293301 | Ga0075367_102933012 | 182 |
| 168 | 3300006186 | Ga0075369_10000768 | Ga0075369_1000076813 | 182 |
| 169 | 3300006186 | Ga0075369_10050021 | Ga0075369_100500212 | 182 |
| 170 | 3300006186 | Ga0075369_10051076 | Ga0075369_100510762 | 182 |
| 171 | 3300006186 | Ga0075369_10084056 | Ga0075369_100840562 | 182 |
| 172 | 3300006186 | Ga0075369_10250552 | Ga0075369_102505521 | 182 |
| 173 | 3300006237 | Ga0097621_100057941 | Ga0097621_1000579412 | 182 |
| 174 | 3300006353 | Ga0075370_10181367 | Ga0075370_101813671 | 182 |
| 175 | 3300006353 | Ga0075370_10287801 | Ga0075370_102878012 | 182 |
| 176 | 3300006358 | Ga0068871_100017304 | Ga0068871_1000173042 | 182 |
| 177 | 3300006846 | Ga0075430_100816162 | Ga0075430_1008161622 | 182 |
| 178 | 3300006881 | Ga0068865_100001202 | Ga0068865_1000012025 | 182 |
| 179 | 3300006931 | Ga0097620_100001947 | Ga0097620_10000194717 | 182 |
| 180 | 3300006931 | Ga0097620_100101973 | Ga0097620_1001019732 | 182 |
| 181 | 3300009093 | Ga0105240_10203715 | Ga0105240_102037151 | 182 |
| 182 | 3300009098 | Ga0105245_10001413 | Ga0105245_100014135 | 182 |
| 183 | 3300009101 | Ga0105247_10000017 | Ga0105247_100000176 | 182 |
| 184 | 3300009101 | Ga0105247_10001090 | Ga0105247_1000109021 | 182 |
| 185 | 3300009147 | Ga0114129_10637912 | Ga0114129_106379121 | 182 |
| 186 | 3300009148 | Ga0105243_10011286 | Ga0105243_100112868 | 182 |
| 187 | 3300009174 | Ga0105241_10072791 | Ga0105241_100727913 | 182 |
| 188 | 3300009176 | Ga0105242_10033473 | Ga0105242_100334732 | 182 |
| 189 | 3300009177 | Ga0105248_10000721 | Ga0105248_1000072134 | 182 |
| 190 | 3300009177 | Ga0105248_10123599 | Ga0105248_101235995 | 182 |
| 191 | 3300009177 | Ga0105248_11646186 | Ga0105248_116461861 | 182 |
| 192 | 3300009545 | Ga0105237_10145052 | Ga0105237_101450522 | 182 |
| 193 | 3300009553 | Ga0105249_10000096 | Ga0105249_100000967 | 182 |
| 194 | 3300009553 | Ga0105249_10068716 | Ga0105249_100687166 | 182 |
| 195 | 3300009553 | Ga0105249_10087548 | Ga0105249_100875485 | 182 |
| 196 | 3300009553 | Ga0105249_10871059 | Ga0105249_108710592 | 182 |
| 197 | 3300010375 | Ga0105239_10023869 | Ga0105239_100238697 | 182 |
| 198 | 3300013296 | Ga0157374_10641613 | Ga0157374_106416132 | 182 |
| 199 | 3300013296 | Ga0157374_10886677 | Ga0157374_108866771 | 182 |
| 200 | 3300013297 | Ga0157378_10034055 | Ga0157378_100340552 | 182 |
| 201 | 3300013306 | Ga0163162_10015089 | Ga0163162_100150895 | 182 |
| 202 | 3300013306 | Ga0163162_11513702 | Ga0163162_115137021 | 182 |
| 203 | 3300013307 | Ga0157372_10015409 | Ga0157372_100154094 | 182 |
| 204 | 3300013307 | Ga0157372_10160715 | Ga0157372_101607153 | 182 |
| 205 | 3300013308 | Ga0157375_10028052 | Ga0157375_100280524 | 182 |
| 206 | 3300014325 | Ga0163163_10006752 | Ga0163163_100067521 | 182 |
| 207 | 3300014326 | Ga0157380_10034116 | Ga0157380_100341162 | 182 |
| 208 | 3300014968 | Ga0157379_10032279 | Ga0157379_100322795 | 182 |
| 209 | 3300014968 | Ga0157379_10063626 | Ga0157379_100636266 | 182 |
| 210 | 3300017792 | Ga0163161_10001600 | Ga0163161_100016005 | 182 |
| 211 | 3300025898 | Ga0207692_10013505 | Ga0207692_100135051 | 182 |
| 212 | 3300025899 | Ga0207642_10000255 | Ga0207642_100002558 | 182 |
| 213 | 3300025900 | Ga0207710_10000033 | Ga0207710_10000033259 | 182 |
| 214 | 3300025901 | Ga0207688_10079995 | Ga0207688_100799952 | 182 |
| 215 | 3300025903 | Ga0207680_10102422 | Ga0207680_101024222 | 182 |
| 216 | 3300025905 | Ga0207685_10030557 | Ga0207685_100305572 | 182 |
| 217 | 3300025906 | Ga0207699_10010549 | Ga0207699_100105493 | 182 |
| 218 | 3300025907 | Ga0207645_10104960 | Ga0207645_101049602 | 182 |
| 219 | 3300025914 | Ga0207671_10127778 | Ga0207671_101277783 | 182 |
| 220 | 3300025915 | Ga0207693_10006799 | Ga0207693_1000679910 | 182 |
| 221 | 3300025916 | Ga0207663_10008390 | Ga0207663_100083907 | 182 |
| 222 | 3300025917 | Ga0207660_10281515 | Ga0207660_102815152 | 182 |
| 223 | 3300025923 | Ga0207681_10000456 | Ga0207681_1000045630 | 182 |
| 224 | 3300025923 | Ga0207681_10081690 | Ga0207681_100816904 | 182 |
| 225 | 3300025927 | Ga0207687_10002110 | Ga0207687_1000211015 | 182 |
| 226 | 3300025931 | Ga0207644_10011017 | Ga0207644_1001101712 | 182 |
| 227 | 3300025933 | Ga0207706_10208647 | Ga0207706_102086472 | 182 |
| 228 | 3300025934 | Ga0207686_10020167 | Ga0207686_100201677 | 182 |
| 229 | 3300025936 | Ga0207670_10010722 | Ga0207670_100107225 | 182 |
| 230 | 3300025937 | Ga0207669_10000192 | Ga0207669_1000019213 | 182 |
| 231 | 3300025938 | Ga0207704_10002317 | Ga0207704_100023178 | 182 |
| 232 | 3300025939 | Ga0207665_10109923 | Ga0207665_101099232 | 182 |
| 233 | 3300025941 | Ga0207711_10009740 | Ga0207711_1000974010 | 182 |
| 234 | 3300025941 | Ga0207711_10269492 | Ga0207711_102694922 | 182 |
| 235 | 3300025942 | Ga0207689_10143187 | Ga0207689_101431872 | 182 |
| 236 | 3300025960 | Ga0207651_10729922 | Ga0207651_107299222 | 182 |
| 237 | 3300025961 | Ga0207712_10000005 | Ga0207712_10000005264 | 182 |
| 238 | 3300025961 | Ga0207712_10206728 | Ga0207712_102067282 | 182 |
| 239 | 3300025961 | Ga0207712_10338889 | Ga0207712_103388892 | 182 |
| 240 | 3300025972 | Ga0207668_10000752 | Ga0207668_1000075212 | 182 |
| 241 | 3300025981 | Ga0207640_10002625 | Ga0207640_100026256 | 182 |
| 242 | 3300025986 | Ga0207658_10000517 | Ga0207658_100005177 | 182 |
| 243 | 3300025986 | Ga0207658_10062226 | Ga0207658_100622265 | 182 |
| 244 | 3300025986 | Ga0207658_10080843 | Ga0207658_100808432 | 182 |
| 245 | 3300025986 | Ga0207658_10399000 | Ga0207658_103990002 | 182 |
| 246 | 3300026023 | Ga0207677_10008380 | Ga0207677_100083805 | 182 |
| 247 | 3300026035 | Ga0207703_10007479 | Ga0207703_100074795 | 182 |
| 248 | 3300026035 | Ga0207703_10028677 | Ga0207703_100286775 | 182 |
| 249 | 3300026041 | Ga0207639_10015214 | Ga0207639_100152148 | 182 |
| 250 | 3300026067 | Ga0207678_10011571 | Ga0207678_100115719 | 182 |
| 251 | 3300026075 | Ga0207708_10048386 | Ga0207708_100483862 | 182 |
| 252 | 3300026088 | Ga0207641_10001384 | Ga0207641_1000138412 | 182 |
| 253 | 3300026088 | Ga0207641_10119903 | Ga0207641_101199033 | 182 |
| 254 | 3300026088 | Ga0207641_10640355 | Ga0207641_106403552 | 182 |
| 255 | 3300026089 | Ga0207648_10002256 | Ga0207648_100022563 | 182 |
| 256 | 3300026095 | Ga0207676_10292335 | Ga0207676_102923352 | 182 |
| 257 | 3300026095 | Ga0207676_10639673 | Ga0207676_106396732 | 182 |
| 258 | 3300026118 | Ga0207675_100002064 | Ga0207675_1000020643 | 182 |
| 259 | 3300026121 | Ga0207683_10001521 | Ga0207683_1000152123 | 182 |
| 260 | 3300026142 | Ga0207698_10610245 | Ga0207698_106102452 | 182 |
| 261 | 3300027866 | Ga0209813_10090406 | Ga0209813_100904061 | 182 |
| 262 | 3300028379 | Ga0268266_10012998 | Ga0268266_100129988 | 182 |
| 263 | 3300028380 | Ga0268265_10000022 | Ga0268265_1000002210 | 182 |
| 264 | 3300028381 | Ga0268264_10000005 | Ga0268264_10000005260 | 182 |
| 265 | 3300028381 | Ga0268264_10005951 | Ga0268264_100059519 | 182 |
| 266 | 3300031824 | Ga0307413_10183061 | Ga0307413_101830612 | 182 |
| 267 | 3300031852 | Ga0307410_10249582 | Ga0307410_102495822 | 182 |
| 268 | 3300031995 | Ga0307409_100562406 | Ga0307409_1005624062 | 182 |
| 269 | 3300031995 | Ga0307409_101048399 | Ga0307409_1010483992 | 182 |
| 270 | 3300032005 | Ga0307411_10305562 | Ga0307411_103055622 | 182 |
| 271 | 3300035090 | Ga0373949_0034009 | Ga0373949_0034009_278_931 | 182 |
| 272 | 3300035092 | Ga0373952_0013839 | Ga0373952_0013839_130_783 | 182 |
| 273 | 3300035242 | Ga0373962_0099598 | Ga0373962_0099598_123_776 | 182 |
| 274 | 3300041410 | Ga0439461_0014172 | Ga0439461_0014172_268_921 | 182 |
| 275 | 3300041496 | Ga0451839_0151690 | Ga0451839_0151690_19_672 | 182 |
| 276 | 3300042002 | Ga0439442_013782 | Ga0439442_013782_204_857 | 182 |
| 277 | 3300044683 | Ga0466965_0230273 | Ga0466965_0230273_104_754 | 182 |
| 278 | 3300045976 | Ga0466967_1135897 | Ga0466967_1135897_10_663 | 182 |
| 279 | 3300046457 | Ga0495590_0106347 | Ga0495590_0106347_192_845 | 182 |
| 280 | 3300046492 | Ga0495585_0101767 | Ga0495585_0101767_867_1520 | 182 |
| 281 | 3300046524 | Ga0495648_0012039 | Ga0495648_0012039_5038_5694 | 182 |
| 282 | 3300046530 | Ga0495654_0035358 | Ga0495654_0035358_918_1574 | 182 |
| 283 | 3300046648 | Ga0495611_0045012 | Ga0495611_0045012_624_1280 | 182 |
| 284 | 3300046692 | Ga0495671_0125209 | Ga0495671_0125209_171_827 | 182 |
| 285 | 3300047320 | Ga0495672_0002334 | Ga0495672_0002334_7349_8005 | 182 |
| 286 | 3300047320 | Ga0495672_0054180 | Ga0495672_0054180_529_1182 | 182 |
| 287 | 3300047320 | Ga0495672_0057053 | Ga0495672_0057053_1282_1935 | 182 |
| 288 | 3300047469 | Ga0495673_0000805 | Ga0495673_0000805_15216_15872 | 182 |
| 289 | 3300048903 | Ga0496100_0003761 | Ga0496100_0003761_2771_3424 | 182 |
| 290 | 3300048903 | Ga0496100_0535105 | Ga0496100_0535105_109_762 | 182 |
| 291 | 3300048904 | Ga0496101_0000691 | Ga0496101_0000691_3118_3771 | 182 |
| 292 | 3300048905 | Ga0496102_0000415 | Ga0496102_0000415_3104_3751 | 182 |
| 293 | 3300048905 | Ga0496102_0000473 | Ga0496102_0000473_16031_16684 | 182 |
| 294 | 3300048905 | Ga0496102_0087146 | Ga0496102_0087146_199_852 | 182 |
| 295 | 3300048905 | Ga0496102_0103244 | Ga0496102_0103244_1917_2570 | 182 |
| 296 | 3300048905 | Ga0496102_0745233 | Ga0496102_0745233_83_736 | 182 |
| 297 | 3300048906 | Ga0496103_0000906 | Ga0496103_0000906_18396_19043 | 182 |
| 298 | 3300048906 | Ga0496103_0013273 | Ga0496103_0013273_2965_3618 | 182 |
| 299 | 3300048907 | Ga0496104_0253820 | Ga0496104_0253820_843_1496 | 182 |
| 300 | 3300048907 | Ga0496104_0755116 | Ga0496104_0755116_145_798 | 182 |
| 301 | 3300048908 | Ga0496105_0125958 | Ga0496105_0125958_20_673 | 182 |
| 302 | 3300048908 | Ga0496105_0520908 | Ga0496105_0520908_187_840 | 182 |
| 303 | 3300048909 | Ga0496106_0001016 | Ga0496106_0001016_4307_4960 | 182 |
| 304 | 3300048910 | Ga0496107_0016176 | Ga0496107_0016176_3537_4190 | 182 |
| 305 | 3300048910 | Ga0496107_0114720 | Ga0496107_0114720_654_1301 | 182 |
| 306 | 3300048911 | Ga0496108_0028097 | Ga0496108_0028097_1491_2144 | 182 |
| 307 | 3300048912 | Ga0496109_0311753 | Ga0496109_0311753_343_996 | 182 |
| 308 | 3300048913 | Ga0496110_0768126 | Ga0496110_0768126_29_682 | 182 |
| 309 | 3300048915 | Ga0496112_0028280 | Ga0496112_0028280_4414_5067 | 182 |
| 310 | 3300048915 | Ga0496112_0468162 | Ga0496112_0468162_390_1043 | 182 |
| 311 | 3300048916 | Ga0496113_0021372 | Ga0496113_0021372_32_685 | 182 |
| 312 | 3300048917 | Ga0496114_0000153 | Ga0496114_0000153_35453_36106 | 182 |
| 313 | 3300048918 | Ga0496115_0004346 | Ga0496115_0004346_9445_10092 | 182 |
| 314 | 3300048918 | Ga0496115_0140640 | Ga0496115_0140640_1265_1918 | 182 |
| 315 | 3300048919 | Ga0496116_0026069 | Ga0496116_0026069_1113_1760 | 182 |
| 316 | 3300048919 | Ga0496116_0209961 | Ga0496116_0209961_276_884 | 182 |
| 317 | 3300048920 | Ga0496117_0174642 | Ga0496117_0174642_146_799 | 182 |
| 318 | 3300048921 | Ga0496118_0001365 | Ga0496118_0001365_19803_20450 | 182 |
| 319 | 3300048922 | Ga0496119_0018915 | Ga0496119_0018915_2056_2703 | 182 |
| 320 | 3300048923 | Ga0496120_0067128 | Ga0496120_0067128_1091_1738 | 182 |
| 321 | 3300048924 | Ga0496121_0082139 | Ga0496121_0082139_629_1276 | 182 |
| 322 | 3300048927 | Ga0496124_0024263 | Ga0496124_0024263_1125_1772 | 182 |
| 323 | 3300048929 | Ga0496126_0005099 | Ga0496126_0005099_1567_2214 | 182 |
| 324 | 3300050490 | nmdc:mga03n38_162103_c1 | nmdc:mga03n38_162103_c1_120_773 | 182 |
| 325 | 3300050490 | nmdc:mga03n38_1711_c1 | nmdc:mga03n38_1711_c1_703_1356 | 182 |
| 326 | 3300050490 | nmdc:mga03n38_90510_c1 | nmdc:mga03n38_90510_c1_63_716 | 182 |
| 327 | 3300050491 | nmdc:mga00v17_20801_c1 | nmdc:mga00v17_20801_c1_2555_3208 | 182 |
| 328 | 3300050491 | nmdc:mga00v17_306446_c1 | nmdc:mga00v17_306446_c1_360_1013 | 182 |
| 329 | 3300050491 | nmdc:mga00v17_333923_c1 | nmdc:mga00v17_333923_c1_187_840 | 182 |
| 330 | 3300050491 | nmdc:mga00v17_46427_c1 | nmdc:mga00v17_46427_c1_1950_2603 | 182 |
| 331 | 3300050491 | nmdc:mga00v17_53384_c1 | nmdc:mga00v17_53384_c1_1376_2029 | 182 |
| 332 | 3300050492 | nmdc:mga0yw44_366089_c1 | nmdc:mga0yw44_366089_c1_111_761 | 182 |
| 333 | 3300050492 | nmdc:mga0yw44_38654_c1 | nmdc:mga0yw44_38654_c1_117_770 | 182 |
| 334 | 3300050492 | nmdc:mga0yw44_57995_c1 | nmdc:mga0yw44_57995_c1_1665_2318 | 182 |
| 335 | 3300050492 | nmdc:mga0yw44_62695_c1 | nmdc:mga0yw44_62695_c1_1550_2203 | 182 |
| 336 | 3300050494 | nmdc:mga06z11_88551_c1 | nmdc:mga06z11_88551_c1_282_935 | 182 |
| 337 | 3300050496 | nmdc:mga07m45_179374_c1 | nmdc:mga07m45_179374_c1_551_1204 | 182 |
| 338 | 3300050496 | nmdc:mga07m45_36992_c1 | nmdc:mga07m45_36992_c1_1001_1654 | 182 |
| 339 | 3300050509 | nmdc:mga0qj67_73060_c1 | nmdc:mga0qj67_73060_c1_1053_1706 | 182 |
| 340 | 3300050516 | nmdc:mga0sz30_3448_c1 | nmdc:mga0sz30_3448_c1_136_789 | 182 |
| 341 | 3300050516 | nmdc:mga0sz30_50890_c1 | nmdc:mga0sz30_50890_c1_969_1622 | 182 |
| 342 | 3300050516 | nmdc:mga0sz30_9944_c1 | nmdc:mga0sz30_9944_c1_1168_1818 | 182 |
| 343 | 3300053090 | Ga0500646_0040691 | Ga0500646_0040691_503_1150 | 182 |
| 344 | 3300005435 | Ga0070714_100028790 | Ga0070714_1000287905 | 183 |
| 345 | 3300025929 | Ga0207664_10104628 | Ga0207664_101046284 | 183 |
| 346 | 3300041491 | Ga0451833_1420425 | Ga0451833_1420425_116_772 | 183 |
| 347 | 3300059605 | Ga0587106_024612 | Ga0587106_024612_218_889 | 183 |
| 348 | 3300041491 | Ga0451833_0930245 | Ga0451833_0930245_125_805 | 184 |
| 349 | 3300044706 | Ga0466964_0125217 | Ga0466964_0125217_11_655 | 184 |
| 350 | 3300049129 | Ga0501309_004756 | Ga0501309_004756_251_922 | 184 |
| 351 | 3300005937 | Ga0081455_10009428 | Ga0081455_100094283 | 185 |
| 352 | 3300031456 | Ga0307513_10000001 | Ga0307513_10000001754 | 185 |
| 353 | 3300031548 | Ga0307408_100568448 | Ga0307408_1005684482 | 185 |
| 354 | 3300031665 | Ga0316575_10029870 | Ga0316575_100298702 | 185 |
| 355 | 3300031691 | Ga0316579_10017900 | Ga0316579_100179001 | 185 |
| 356 | 3300031727 | Ga0316576_10060416 | Ga0316576_100604163 | 185 |
| 357 | 3300031728 | Ga0316578_10209206 | Ga0316578_102092062 | 185 |
| 358 | 3300031733 | Ga0316577_10333461 | Ga0316577_103334612 | 185 |
| 359 | 3300032004 | Ga0307414_10675625 | Ga0307414_106756252 | 185 |
| 360 | 3300033524 | Ga0316592_1018804 | Ga0316592_10188043 | 185 |
| 361 | 3300033528 | Ga0316588_1099128 | Ga0316588_10991281 | 185 |
| 362 | 3300033541 | Ga0316596_1011082 | Ga0316596_10110824 | 185 |
| 363 | 3300035398 | Ga0316574_0001480 | Ga0316574_0001480_4007_4663 | 185 |
| 364 | 3300036647 | Ga0316582_0098538 | Ga0316582_0098538_1233_1889 | 185 |
| 365 | 3300036712 | Ga0316584_0065499 | Ga0316584_0065499_162_818 | 185 |
| 366 | 3300037466 | Ga0395898_0468312 | Ga0395898_0468312_220_870 | 185 |
| 367 | 3300038443 | Ga0395901_0338158 | Ga0395901_0338158_24_674 | 185 |
| 368 | 3300044683 | Ga0466965_0126491 | Ga0466965_0126491_551_1201 | 185 |
| 369 | 3300044684 | Ga0466966_0080967 | Ga0466966_0080967_1142_1792 | 185 |
| 370 | 3300044693 | Ga0466961_0154795 | Ga0466961_0154795_156_806 | 185 |
| 371 | 3300044765 | Ga0466970_0157007 | Ga0466970_0157007_339_989 | 185 |
| 372 | 3300044842 | Ga0466957_0129558 | Ga0466957_0129558_497_1147 | 185 |
| 373 | 3300044901 | Ga0466960_0175939 | Ga0466960_0175939_181_831 | 185 |
| 374 | 3300044901 | Ga0466960_0292990 | Ga0466960_0292990_233_889 | 185 |
| 375 | 3300045836 | Ga0466958_0325999 | Ga0466958_0325999_144_800 | 185 |
| 376 | 3300049127 | Ga0501306_007769 | Ga0501306_007769_361_1011 | 185 |
| 377 | 3300049128 | Ga0501308_001262 | Ga0501308_001262_201_851 | 185 |
| 378 | 3300049161 | Ga0501305_003255 | Ga0501305_003255_654_1304 | 185 |
| 379 | 3300049527 | Ga0501311_014200 | Ga0501311_014200_328_978 | 185 |
| 380 | 3300049532 | Ga0501316_001281 | Ga0501316_001281_1108_1758 | 185 |
| 381 | 3300049534 | Ga0501318_000622 | Ga0501318_000622_1072_1722 | 185 |
| 382 | 3300049537 | Ga0501321_014497 | Ga0501321_014497_26_682 | 185 |
| 383 | 3300059477 | Ga0587084_009923 | Ga0587084_009923_281_931 | 185 |
| 384 | 3300059478 | Ga0587093_004188 | Ga0587093_004188_171_821 | 185 |
| 385 | 3300059491 | Ga0587070_035544 | Ga0587070_035544_110_760 | 185 |
| 386 | 3300059508 | Ga0587088_029575 | Ga0587088_029575_50_700 | 185 |
| 387 | 3300059512 | Ga0587092_011416 | Ga0587092_011416_204_854 | 185 |
| 388 | 3300059605 | Ga0587106_024093 | Ga0587106_024093_184_834 | 185 |
| 389 | 3300059607 | Ga0587125_018228 | Ga0587125_018228_80_736 | 185 |
| 390 | 3300059622 | Ga0587099_008267 | Ga0587099_008267_195_845 | 185 |
| 391 | 3300059623 | Ga0587101_008779 | Ga0587101_008779_273_923 | 185 |
| 392 | 3300059624 | Ga0587109_041569 | Ga0587109_041569_118_768 | 185 |
| 393 | 3300059627 | Ga0587117_013196 | Ga0587117_013196_96_746 | 185 |
| 394 | 3300059628 | Ga0587122_009649 | Ga0587122_009649_62_712 | 185 |
| 395 | 3300059639 | Ga0587062_006343 | Ga0587062_006343_344_994 | 185 |
| 396 | 3300059643 | Ga0587072_018139 | Ga0587072_018139_262_912 | 185 |
| 397 | 3300059644 | Ga0587075_003565 | Ga0587075_003565_788_1438 | 185 |
| 398 | 3300059647 | Ga0587079_009278 | Ga0587079_009278_631_1281 | 185 |
| 399 | 3300059648 | Ga0587100_001887 | Ga0587100_001887_171_821 | 185 |
| 400 | 3300059649 | Ga0587102_011562 | Ga0587102_011562_75_725 | 185 |
| 401 | 3300059652 | Ga0587107_013837 | Ga0587107_013837_71_721 | 185 |
| 402 | 3300060346 | Ga0587111_0050936 | Ga0587111_0050936_195_845 | 185 |
| 403 | 3300031824 | Ga0307413_10085143 | Ga0307413_100851434 | 186 |
| 404 | 3300031903 | Ga0307407_10059858 | Ga0307407_100598584 | 186 |
| 405 | 3300031911 | Ga0307412_10357771 | Ga0307412_103577712 | 186 |
| 406 | 3300031995 | Ga0307409_100267210 | Ga0307409_1002672102 | 186 |
| 407 | 3300032002 | Ga0307416_100160395 | Ga0307416_1001603952 | 186 |
| 408 | 3300032004 | Ga0307414_10172679 | Ga0307414_101726792 | 186 |
| 409 | 3300032126 | Ga0307415_100138218 | Ga0307415_1001382182 | 186 |
| 410 | 3300044656 | Ga0466969_0262021 | Ga0466969_0262021_59_718 | 186 |
| 411 | 3300044658 | Ga0466972_0007943 | Ga0466972_0007943_1321_1980 | 186 |
| 412 | 3300044683 | Ga0466965_0010425 | Ga0466965_0010425_2964_3623 | 186 |
| 413 | 3300044684 | Ga0466966_0279288 | Ga0466966_0279288_161_817 | 186 |
| 414 | 3300044693 | Ga0466961_0014059 | Ga0466961_0014059_3143_3802 | 186 |
| 415 | 3300044719 | Ga0466971_0030753 | Ga0466971_0030753_1619_2278 | 186 |
| 416 | 3300044765 | Ga0466970_0015597 | Ga0466970_0015597_2925_3584 | 186 |
| 417 | 3300044842 | Ga0466957_0040100 | Ga0466957_0040100_1727_2386 | 186 |
| 418 | 3300044901 | Ga0466960_0213028 | Ga0466960_0213028_305_961 | 186 |
| 419 | 3300044901 | Ga0466960_0380090 | Ga0466960_0380090_84_743 | 186 |
| 420 | 3300045836 | Ga0466958_0035085 | Ga0466958_0035085_1038_1697 | 186 |
| 421 | 3300045976 | Ga0466967_0013542 | Ga0466967_0013542_1429_2088 | 186 |
| 422 | 3300061719 | Ga0466962_0047571 | Ga0466962_0047571_1284_1943 | 186 |
| 423 | 3300006048 | Ga0075363_100426947 | Ga0075363_1004269472 | 187 |
| 424 | 3300006051 | Ga0075364_10030032 | Ga0075364_100300324 | 187 |
| 425 | 3300006177 | Ga0075362_10138969 | Ga0075362_101389692 | 187 |
| 426 | 3300009094 | Ga0111539_10754164 | Ga0111539_107541642 | 187 |
| 427 | 3300017792 | Ga0163161_10479832 | Ga0163161_104798322 | 187 |
| 428 | 3300020069 | Ga0197907_11372859 | Ga0197907_113728592 | 187 |
| 429 | 3300020081 | Ga0206354_10027635 | Ga0206354_100276351 | 187 |
| 430 | 3300020082 | Ga0206353_10868606 | Ga0206353_108686062 | 187 |
| 431 | 3300031903 | Ga0307407_10102065 | Ga0307407_101020652 | 187 |
| 432 | 3300041459 | Ga0451800_1651231 | Ga0451800_1651231_113_772 | 187 |
| 433 | 3300041494 | Ga0451837_1540429 | Ga0451837_1540429_826_1485 | 187 |
| 434 | 3300041512 | Ga0451853_1178819 | Ga0451853_1178819_1379_2038 | 187 |
| 435 | 3300044765 | Ga0466970_0041257 | Ga0466970_0041257_245_901 | 187 |
| 436 | 3300049162 | Ga0501307_005562 | Ga0501307_005562_37_699 | 187 |
| 437 | 3300049575 | Ga0501039_0193911 | Ga0501039_0193911_228_890 | 187 |
| 438 | 3300049576 | Ga0501040_0106687 | Ga0501040_0106687_929_1591 | 187 |
| 439 | 3300049577 | Ga0501041_0188567 | Ga0501041_0188567_86_748 | 187 |
| 440 | 3300049578 | Ga0501042_0094733 | Ga0501042_0094733_179_841 | 187 |
| 441 | 3300049582 | Ga0501048_0357014 | Ga0501048_0357014_150_812 | 187 |
| 442 | 3300049583 | Ga0501067_0018448 | Ga0501067_0018448_963_1622 | 187 |
| 443 | 3300049588 | Ga0501072_0402708 | Ga0501072_0402708_216_878 | 187 |
| 444 | 3300049592 | Ga0501076_0338603 | Ga0501076_0338603_106_768 | 187 |
| 445 | 3300050489 | nmdc:mga03683_45975_c1 | nmdc:mga03683_45975_c1_331_996 | 187 |
| 446 | 3300050491 | nmdc:mga00v17_21448_c1 | nmdc:mga00v17_21448_c1_1194_1859 | 187 |
| 447 | 3300050496 | nmdc:mga07m45_68362_c1 | nmdc:mga07m45_68362_c1_632_1297 | 187 |
| 448 | 3300050511 | nmdc:mga08y16_525368_c1 | nmdc:mga08y16_525368_c1_376_1038 | 187 |
| 449 | 3300000041 | ARcpr5oldR_c004908 | ARcpr5oldR_0049082 | 188 |
| 450 | 3300000041 | ARcpr5oldR_c008025 | ARcpr5oldR_0080252 | 188 |
| 451 | 3300004800 | Ga0058861_10027554 | Ga0058861_100275542 | 188 |
| 452 | 3300004800 | Ga0058861_10146493 | Ga0058861_101464932 | 188 |
| 453 | 3300005327 | Ga0070658_10070042 | Ga0070658_100700424 | 188 |
| 454 | 3300005327 | Ga0070658_10242846 | Ga0070658_102428462 | 188 |
| 455 | 3300005329 | Ga0070683_100012063 | Ga0070683_1000120632 | 188 |
| 456 | 3300005329 | Ga0070683_100055375 | Ga0070683_1000553753 | 188 |
| 457 | 3300005329 | Ga0070683_100182428 | Ga0070683_1001824282 | 188 |
| 458 | 3300005337 | Ga0070682_100123028 | Ga0070682_1001230282 | 188 |
| 459 | 3300005337 | Ga0070682_100425257 | Ga0070682_1004252572 | 188 |
| 460 | 3300005339 | Ga0070660_100599957 | Ga0070660_1005999571 | 188 |
| 461 | 3300005340 | Ga0070689_100496566 | Ga0070689_1004965662 | 188 |
| 462 | 3300005366 | Ga0070659_100065286 | Ga0070659_1000652864 | 188 |
| 463 | 3300005367 | Ga0070667_100643728 | Ga0070667_1006437281 | 188 |
| 464 | 3300005440 | Ga0070705_100262635 | Ga0070705_1002626352 | 188 |
| 465 | 3300005455 | Ga0070663_100495390 | Ga0070663_1004953902 | 188 |
| 466 | 3300005535 | Ga0070684_100139275 | Ga0070684_1001392753 | 188 |
| 467 | 3300005548 | Ga0070665_100247063 | Ga0070665_1002470632 | 188 |
| 468 | 3300005563 | Ga0068855_100115656 | Ga0068855_1001156562 | 188 |
| 469 | 3300005564 | Ga0070664_100029753 | Ga0070664_1000297531 | 188 |
| 470 | 3300005564 | Ga0070664_100266001 | Ga0070664_1002660012 | 188 |
| 471 | 3300005614 | Ga0068856_100359438 | Ga0068856_1003594382 | 188 |
| 472 | 3300005843 | Ga0068860_100132625 | Ga0068860_1001326252 | 188 |
| 473 | 3300006881 | Ga0068865_100018320 | Ga0068865_1000183202 | 188 |
| 474 | 3300006914 | Ga0075436_100602186 | Ga0075436_1006021862 | 188 |
| 475 | 3300009148 | Ga0105243_10620823 | Ga0105243_106208232 | 188 |
| 476 | 3300009177 | Ga0105248_10638408 | Ga0105248_106384082 | 188 |
| 477 | 3300009545 | Ga0105237_10555823 | Ga0105237_105558232 | 188 |
| 478 | 3300009553 | Ga0105249_11648003 | Ga0105249_116480031 | 188 |
| 479 | 3300010375 | Ga0105239_10020346 | Ga0105239_100203467 | 188 |
| 480 | 3300010375 | Ga0105239_10070207 | Ga0105239_100702076 | 188 |
| 481 | 3300011119 | Ga0105246_10056393 | Ga0105246_100563934 | 188 |
| 482 | 3300013105 | Ga0157369_10646799 | Ga0157369_106467992 | 188 |
| 483 | 3300014325 | Ga0163163_10532098 | Ga0163163_105320981 | 188 |
| 484 | 3300020069 | Ga0197907_10411015 | Ga0197907_104110152 | 188 |
| 485 | 3300020069 | Ga0197907_10657930 | Ga0197907_106579301 | 188 |
| 486 | 3300020070 | Ga0206356_10222980 | Ga0206356_102229802 | 188 |
| 487 | 3300020070 | Ga0206356_10674529 | Ga0206356_106745292 | 188 |
| 488 | 3300020070 | Ga0206356_11070515 | Ga0206356_110705151 | 188 |
| 489 | 3300020075 | Ga0206349_1383707 | Ga0206349_13837072 | 188 |
| 490 | 3300020075 | Ga0206349_1385645 | Ga0206349_13856451 | 188 |
| 491 | 3300020075 | Ga0206349_1856980 | Ga0206349_18569802 | 188 |
| 492 | 3300020076 | Ga0206355_1085941 | Ga0206355_10859412 | 188 |
| 493 | 3300020076 | Ga0206355_1389932 | Ga0206355_13899324 | 188 |
| 494 | 3300020076 | Ga0206355_1722261 | Ga0206355_17222612 | 188 |
| 495 | 3300020077 | Ga0206351_10216479 | Ga0206351_102164792 | 188 |
| 496 | 3300020078 | Ga0206352_10436074 | Ga0206352_104360742 | 188 |
| 497 | 3300020080 | Ga0206350_11629593 | Ga0206350_116295932 | 188 |
| 498 | 3300020081 | Ga0206354_10163218 | Ga0206354_101632182 | 188 |
| 499 | 3300020082 | Ga0206353_10876636 | Ga0206353_108766362 | 188 |
| 500 | 3300020082 | Ga0206353_11714178 | Ga0206353_117141782 | 188 |
| 501 | 3300020610 | Ga0154015_1488494 | Ga0154015_14884943 | 188 |
| 502 | 3300021384 | Ga0213876_10116052 | Ga0213876_101160522 | 188 |
| 503 | 3300022467 | Ga0224712_10076882 | Ga0224712_100768822 | 188 |
| 504 | 3300025901 | Ga0207688_10190974 | Ga0207688_101909742 | 188 |
| 505 | 3300025901 | Ga0207688_10278208 | Ga0207688_102782082 | 188 |
| 506 | 3300025909 | Ga0207705_10251390 | Ga0207705_102513902 | 188 |
| 507 | 3300025909 | Ga0207705_10394563 | Ga0207705_103945632 | 188 |
| 508 | 3300025919 | Ga0207657_10406817 | Ga0207657_104068172 | 188 |
| 509 | 3300025920 | Ga0207649_10434486 | Ga0207649_104344861 | 188 |
| 510 | 3300025921 | Ga0207652_10118242 | Ga0207652_101182423 | 188 |
| 511 | 3300025927 | Ga0207687_10052326 | Ga0207687_100523262 | 188 |
| 512 | 3300025936 | Ga0207670_10530134 | Ga0207670_105301342 | 188 |
| 513 | 3300025941 | Ga0207711_10471905 | Ga0207711_104719052 | 188 |
| 514 | 3300025944 | Ga0207661_10017317 | Ga0207661_100173173 | 188 |
| 515 | 3300025944 | Ga0207661_10060501 | Ga0207661_100605012 | 188 |
| 516 | 3300025944 | Ga0207661_10068581 | Ga0207661_100685814 | 188 |
| 517 | 3300025944 | Ga0207661_10188638 | Ga0207661_101886382 | 188 |
| 518 | 3300025945 | Ga0207679_10087528 | Ga0207679_100875284 | 188 |
| 519 | 3300025949 | Ga0207667_10106388 | Ga0207667_101063883 | 188 |
| 520 | 3300025986 | Ga0207658_10108439 | Ga0207658_101084392 | 188 |
| 521 | 3300026035 | Ga0207703_10067219 | Ga0207703_100672192 | 188 |
| 522 | 3300026067 | Ga0207678_10473257 | Ga0207678_104732572 | 188 |
| 523 | 3300026075 | Ga0207708_10640998 | Ga0207708_106409982 | 188 |
| 524 | 3300026095 | Ga0207676_10451290 | Ga0207676_104512902 | 188 |
| 525 | 3300026116 | Ga0207674_10131631 | Ga0207674_101316312 | 188 |
| 526 | 3300028381 | Ga0268264_10126961 | Ga0268264_101269614 | 188 |
| 527 | 3300030521 | Ga0307511_10056191 | Ga0307511_100561912 | 188 |
| 528 | 3300030732 | Ga0316176_1120777 | Ga0316176_11207773 | 188 |
| 529 | 3300030742 | Ga0316183_1035066 | Ga0316183_10350661 | 188 |
| 530 | 3300031852 | Ga0307410_10599975 | Ga0307410_105999751 | 188 |
| 531 | 3300032126 | Ga0307415_100400896 | Ga0307415_1004008962 | 188 |
| 532 | 3300034819 | Ga0373958_0021254 | Ga0373958_0021254_77_745 | 188 |
| 533 | 3300035241 | Ga0373961_0096863 | Ga0373961_0096863_180_848 | 188 |
| 534 | 3300035691 | Ga0373931_0166372 | Ga0373931_0166372_329_997 | 188 |
| 535 | 3300037466 | Ga0395898_0181056 | Ga0395898_0181056_900_1568 | 188 |
| 536 | 3300038996 | Ga0242420_017563 | Ga0242420_017563_59_727 | 188 |
| 537 | 3300039437 | Ga0436365_1912815 | Ga0436365_1912815_341_1003 | 188 |
| 538 | 3300041404 | Ga0439436_0017852 | Ga0439436_0017852_465_1112 | 188 |
| 539 | 3300041405 | Ga0439438_052351 | Ga0439438_052351_41_688 | 188 |
| 540 | 3300041406 | Ga0439439_0001664 | Ga0439439_0001664_3328_3975 | 188 |
| 541 | 3300041411 | Ga0439466_0052307 | Ga0439466_0052307_377_1024 | 188 |
| 542 | 3300042002 | Ga0439442_041753 | Ga0439442_041753_62_709 | 188 |
| 543 | 3300042005 | Ga0439448_0090578 | Ga0439448_0090578_175_834 | 188 |
| 544 | 3300042007 | Ga0439449_0063432 | Ga0439449_0063432_649_1296 | 188 |
| 545 | 3300042014 | Ga0439457_002215 | Ga0439457_002215_832_1479 | 188 |
| 546 | 3300042184 | Ga0450908_020399 | Ga0450908_020399_415_1062 | 188 |
| 547 | 3300044683 | Ga0466965_0139494 | Ga0466965_0139494_200_862 | 188 |
| 548 | 3300044694 | Ga0466963_0049053 | Ga0466963_0049053_1920_2582 | 188 |
| 549 | 3300044842 | Ga0466957_0258112 | Ga0466957_0258112_209_874 | 188 |
| 550 | 3300044901 | Ga0466960_0046852 | Ga0466960_0046852_420_1115 | 188 |
| 551 | 3300044901 | Ga0466960_0060274 | Ga0466960_0060274_1012_1674 | 188 |
| 552 | 3300044901 | Ga0466960_0095993 | Ga0466960_0095993_131_802 | 188 |
| 553 | 3300044901 | Ga0466960_0115977 | Ga0466960_0115977_163_822 | 188 |
| 554 | 3300045976 | Ga0466967_0005418 | Ga0466967_0005418_1518_2180 | 188 |
| 555 | 3300045976 | Ga0466967_0031836 | Ga0466967_0031836_659_1321 | 188 |
| 556 | 3300045976 | Ga0466967_0082261 | Ga0466967_0082261_1826_2488 | 188 |
| 557 | 3300045976 | Ga0466967_0149309 | Ga0466967_0149309_1184_1846 | 188 |
| 558 | 3300045976 | Ga0466967_0180952 | Ga0466967_0180952_1179_1841 | 188 |
| 559 | 3300045976 | Ga0466967_0194515 | Ga0466967_0194515_835_1509 | 188 |
| 560 | 3300045976 | Ga0466967_0531400 | Ga0466967_0531400_222_881 | 188 |
| 561 | 3300045976 | Ga0466967_0543790 | Ga0466967_0543790_240_935 | 188 |
| 562 | 3300046473 | Ga0495582_0137551 | Ga0495582_0137551_224_886 | 188 |
| 563 | 3300046683 | Ga0495658_0349217 | Ga0495658_0349217_148_810 | 188 |
| 564 | 3300047321 | Ga0495676_0097315 | Ga0495676_0097315_964_1626 | 188 |
| 565 | 3300047673 | Ga0495593_0112535 | Ga0495593_0112535_601_1263 | 188 |
| 566 | 3300048905 | Ga0496102_0004268 | Ga0496102_0004268_3699_4367 | 188 |
| 567 | 3300048906 | Ga0496103_0002413 | Ga0496103_0002413_2498_3166 | 188 |
| 568 | 3300048906 | Ga0496103_0116562 | Ga0496103_0116562_201_863 | 188 |
| 569 | 3300048907 | Ga0496104_0042002 | Ga0496104_0042002_839_1507 | 188 |
| 570 | 3300048908 | Ga0496105_0267499 | Ga0496105_0267499_211_879 | 188 |
| 571 | 3300048909 | Ga0496106_0005923 | Ga0496106_0005923_4724_5392 | 188 |
| 572 | 3300048911 | Ga0496108_0263958 | Ga0496108_0263958_434_1102 | 188 |
| 573 | 3300048912 | Ga0496109_0058601 | Ga0496109_0058601_1142_1810 | 188 |
| 574 | 3300048912 | Ga0496109_0287633 | Ga0496109_0287633_252_914 | 188 |
| 575 | 3300048912 | Ga0496109_0502992 | Ga0496109_0502992_330_989 | 188 |
| 576 | 3300048913 | Ga0496110_0002566 | Ga0496110_0002566_12762_13424 | 188 |
| 577 | 3300048913 | Ga0496110_0003020 | Ga0496110_0003020_3511_4179 | 188 |
| 578 | 3300048914 | Ga0496111_0021913 | Ga0496111_0021913_691_1359 | 188 |
| 579 | 3300048914 | Ga0496111_0176614 | Ga0496111_0176614_741_1403 | 188 |
| 580 | 3300048915 | Ga0496112_0186348 | Ga0496112_0186348_860_1528 | 188 |
| 581 | 3300048917 | Ga0496114_0107141 | Ga0496114_0107141_1574_2242 | 188 |
| 582 | 3300049127 | Ga0501306_013397 | Ga0501306_013397_259_936 | 188 |
| 583 | 3300049128 | Ga0501308_009318 | Ga0501308_009318_328_1002 | 188 |
| 584 | 3300049130 | Ga0501310_021008 | Ga0501310_021008_65_748 | 188 |
| 585 | 3300049160 | Ga0501304_002286 | Ga0501304_002286_530_1195 | 188 |
| 586 | 3300049527 | Ga0501311_004092 | Ga0501311_004092_60_725 | 188 |
| 587 | 3300049529 | Ga0501313_019064 | Ga0501313_019064_132_809 | 188 |
| 588 | 3300049532 | Ga0501316_000783 | Ga0501316_000783_403_1068 | 188 |
| 589 | 3300049533 | Ga0501317_000435 | Ga0501317_000435_636_1301 | 188 |
| 590 | 3300049533 | Ga0501317_015612 | Ga0501317_015612_175_840 | 188 |
| 591 | 3300049534 | Ga0501318_004378 | Ga0501318_004378_339_1004 | 188 |
| 592 | 3300049534 | Ga0501318_006608 | Ga0501318_006608_376_1041 | 188 |
| 593 | 3300049534 | Ga0501318_013676 | Ga0501318_013676_197_862 | 188 |
| 594 | 3300049534 | Ga0501318_014478 | Ga0501318_014478_74_739 | 188 |
| 595 | 3300049537 | Ga0501321_000446 | Ga0501321_000446_630_1295 | 188 |
| 596 | 3300049571 | Ga0501034_0365623 | Ga0501034_0365623_362_1021 | 188 |
| 597 | 3300049572 | Ga0501036_0089550 | Ga0501036_0089550_1857_2522 | 188 |
| 598 | 3300049575 | Ga0501039_0349800 | Ga0501039_0349800_275_940 | 188 |
| 599 | 3300049575 | Ga0501039_0450267 | Ga0501039_0450267_155_820 | 188 |
| 600 | 3300049575 | Ga0501039_0685713 | Ga0501039_0685713_75_740 | 188 |
| 601 | 3300049575 | Ga0501039_0793613 | Ga0501039_0793613_56_727 | 188 |
| 602 | 3300049576 | Ga0501040_0047321 | Ga0501040_0047321_708_1370 | 188 |
| 603 | 3300049576 | Ga0501040_0274266 | Ga0501040_0274266_378_1043 | 188 |
| 604 | 3300049577 | Ga0501041_0239630 | Ga0501041_0239630_345_1010 | 188 |
| 605 | 3300049578 | Ga0501042_0166457 | Ga0501042_0166457_136_801 | 188 |
| 606 | 3300049578 | Ga0501042_0347868 | Ga0501042_0347868_117_782 | 188 |
| 607 | 3300049579 | Ga0501043_0668646 | Ga0501043_0668646_19_684 | 188 |
| 608 | 3300049580 | Ga0501046_0282482 | Ga0501046_0282482_431_1093 | 188 |
| 609 | 3300049581 | Ga0501047_0674618 | Ga0501047_0674618_90_764 | 188 |
| 610 | 3300049583 | Ga0501067_0047395 | Ga0501067_0047395_1553_2215 | 188 |
| 611 | 3300049583 | Ga0501067_0056320 | Ga0501067_0056320_537_1205 | 188 |
| 612 | 3300049584 | Ga0501068_0005522 | Ga0501068_0005522_5164_5826 | 188 |
| 613 | 3300049585 | Ga0501069_0143732 | Ga0501069_0143732_321_995 | 188 |
| 614 | 3300049586 | Ga0501070_0012735 | Ga0501070_0012735_5322_5996 | 188 |
| 615 | 3300049586 | Ga0501070_0051285 | Ga0501070_0051285_2567_3229 | 188 |
| 616 | 3300049587 | Ga0501071_0473734 | Ga0501071_0473734_147_809 | 188 |
| 617 | 3300049587 | Ga0501071_0641317 | Ga0501071_0641317_55_729 | 188 |
| 618 | 3300049588 | Ga0501072_0020572 | Ga0501072_0020572_499_1161 | 188 |
| 619 | 3300049589 | Ga0501073_0009585 | Ga0501073_0009585_1553_2215 | 188 |
| 620 | 3300049590 | Ga0501074_0012602 | Ga0501074_0012602_408_1070 | 188 |
| 621 | 3300049590 | Ga0501074_0289478 | Ga0501074_0289478_149_829 | 188 |
| 622 | 3300049590 | Ga0501074_0368651 | Ga0501074_0368651_138_803 | 188 |
| 623 | 3300049593 | Ga0501077_0052062 | Ga0501077_0052062_1383_2045 | 188 |
| 624 | 3300049593 | Ga0501077_0518364 | Ga0501077_0518364_91_750 | 188 |
| 625 | 3300049741 | Ga0501079_0182081 | Ga0501079_0182081_638_1312 | 188 |
| 626 | 3300049741 | Ga0501079_0247014 | Ga0501079_0247014_242_904 | 188 |
| 627 | 3300049741 | Ga0501079_0458501 | Ga0501079_0458501_311_973 | 188 |
| 628 | 3300049742 | Ga0501080_0161166 | Ga0501080_0161166_174_836 | 188 |
| 629 | 3300049743 | Ga0501081_0314113 | Ga0501081_0314113_266_931 | 188 |
| 630 | 3300049744 | Ga0501083_0060051 | Ga0501083_0060051_278_940 | 188 |
| 631 | 3300049823 | Ga0501044_0254784 | Ga0501044_0254784_322_987 | 188 |
| 632 | 3300049824 | Ga0501045_0059228 | Ga0501045_0059228_1064_1729 | 188 |
| 633 | 3300049824 | Ga0501045_0161508 | Ga0501045_0161508_485_1147 | 188 |
| 634 | 3300049824 | Ga0501045_0646918 | Ga0501045_0646918_42_707 | 188 |
| 635 | 3300053085 | Ga0495619_0239729 | Ga0495619_0239729_325_984 | 188 |
| 636 | 3300054114 | Ga0501084_0081326 | Ga0501084_0081326_45_707 | 188 |
| 637 | 3300054114 | Ga0501084_0390289 | Ga0501084_0390289_299_964 | 188 |
| 638 | 3300054114 | Ga0501084_0480212 | Ga0501084_0480212_163_828 | 188 |
| 639 | 3300059492 | Ga0587073_0026157 | Ga0587073_0026157_39_698 | 188 |
| 640 | 3300059492 | Ga0587073_0035387 | Ga0587073_0035387_330_989 | 188 |
| 641 | 3300059630 | Ga0587128_012632 | Ga0587128_012632_291_953 | 188 |
| 642 | 3300059651 | Ga0587105_004755 | Ga0587105_004755_90_752 | 188 |
| 643 | 3300059652 | Ga0587107_005072 | Ga0587107_005072_80_739 | 188 |
| 644 | 3300059652 | Ga0587107_014561 | Ga0587107_014561_309_971 | 188 |
| 645 | 3300059658 | Ga0587119_020478 | Ga0587119_020478_89_748 | 188 |
| 646 | 3300060344 | Ga0587071_027839 | Ga0587071_027839_318_980 | 188 |
| 647 | 3300060346 | Ga0587111_0002748 | Ga0587111_0002748_1140_1799 | 188 |
| 648 | 3300060353 | Ga0501082_0003723 | Ga0501082_0003723_196_858 | 188 |
| 649 | 3300061734 | Ga0530510_0228964 | Ga0530510_0228964_308_976 | 188 |
| 650 | 3300061734 | Ga0530510_0415616 | Ga0530510_0415616_40_705 | 188 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.8278 | 7 | 187 |
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.8252 | 6 | 182 |
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.8134 | 7 | 187 |
| 6ppf-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class b | 0.8076 | 6 | 185 |
| 6ppf-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class b | 0.803 | 6 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WH87_35_101_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9103 | 37 | 100 | 3.30.160.810 |
| af_Q9SKX4_88_148_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8943 | 37 | 97 | 3.30.160.810 |
| af_Q9SKX4_88_148_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8811 | 37 | 97 | 3.30.160.810 |
| af_Q9LIT4_106_169_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.863 | 37 | 100 | 3.30.160.810 |
| af_P9WH87_35_101_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8603 | 37 | 100 | 3.30.160.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A087B7P6-F1-model_v4 | deleted | 0.9302 | 1 | 106 |
|
| AF-A0A845Y1H4-F1-model_v4 | 50S ribosomal protein L3 | 0.9179 | 6 | 107 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A6P0ZZ13-F1-model_v4 | 50S ribosomal protein L3 | 0.892 | 6 | 101 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2D7RYG7-F1-model_v4 | 50S ribosomal protein L3 | 0.8914 | 6 | 98 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A485AH68-F1-model_v4 | 50S ribosomal protein L3 | 0.8871 | 4 | 104 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar