F472542

General Info

Members Datasets Scaffolds Average Seq Length
650 383 650 197

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0046852|Ga0466960_0046852_420_1115
Length 213
Sequence MSTLERNVRGLLGTKLGMTQTWDENNRVIPVTVVAAGTNVVTQVRSPETDGYNAVQIGFGEIEGRKVTKPRAGHFEKAGVTPRRHLLEIRTADAASYTVGQEIGPDLFTAGDEVDVTGTSKGKGFHRNHRKPGSIGGCATPGRVFKGMRMAGRMGGDKVTTQNVAVHAVDAEKGLILLKGAVPGPRGGVVVIRSAAKAVATAALSAGNTEASK

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
27 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
121 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
184 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
188 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
189 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
190 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
213 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
220 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
226 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
227 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
228 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
231 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
232 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
233 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
234 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
235 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
294 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
325 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
326 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.54
Metatranscriptomes 22.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.31
Nodule 0
Rhizoplane 6.92
Rhizosphere 83.69
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c004908 3300000041 Bacteria 1153
2 ARcpr5oldR_c008025 3300000041 Bacteria 896
3 JGI24739J22299_10037612 3300001989 Bacteria 1630
4 JGI24739J22299_10073264 3300001989 Bacteria 1063
5 JGI24745J21846_1010180 3300002073 Bacteria 1068
6 JGI24748J21848_1001863 3300002074 Bacteria 2348
7 JGI24738J21930_10008775 3300002075 Bacteria 2292
8 JGI24749J21850_1001482 3300002076 Bacteria 3317
9 JGI24744J21845_10001209 3300002077 Bacteria 5064
10 JGI24742J22300_10008229 3300002244 Bacteria 1721
11 Ga0006779J45831_102609 3300003160 Bacteria 1508
12 Ga0006765J45826_109836 3300003161 Bacteria 1317
13 Ga0006778J45830_1028228 3300003162 Bacteria 1116
14 Ga0006759J45824_1015649 3300003163 Bacteria 1783
15 Ga0006758J48902_1015782 3300003300 Bacteria 962
16 Ga0006770J48903_1014088 3300003305 Bacteria 1455
17 Ga0006777J48905_1013451 3300003308 Bacteria 1318
18 Ga0006777J48905_1021747 3300003308 Bacteria 1232
19 Ga0006777J48905_1034729 3300003308 Bacteria 1107
20 Ga0006777J48905_1059879 3300003308 Bacteria 854
21 Ga0007417J51691_1032364 3300003544 Bacteria 1330
22 Ga0007427J51700_103349 3300003559 Bacteria 1650
23 Ga0006781J51513_1004744 3300003568 Bacteria 2068
24 Ga0007410J51695_1009274 3300003574 Bacteria 1407
25 Ga0007410J51695_1039556 3300003574 Bacteria 777
26 Ga0007409J51694_1005546 3300003575 Bacteria 1874
27 Ga0007409J51694_1044798 3300003575 Bacteria 887
28 Ga0007409J51694_1063908 3300003575 Bacteria 973
29 Ga0007416J51690_1006248 3300003577 Bacteria 1390
30 Ga0007416J51690_1006249 3300003577 Bacteria 1967
31 Ga0007429J51699_1004465 3300003579 Bacteria 1432
32 Ga0007429J51699_1024979 3300003579 Bacteria 1378
33 Ga0007411J51799_103764 3300003611 Bacteria 1727
34 Ga0007415J51800_105039 3300003613 Bacteria 1506
35 Ga0032354_1008262 3300003693 Bacteria 1286
36 Ga0032354_1022152 3300003693 Bacteria 1356
37 Ga0032354_1037833 3300003693 Bacteria 926
38 Ga0058859_10026884 3300004798 Bacteria 1377
39 Ga0058861_10027554 3300004800 Bacteria 997
40 Ga0058861_10146493 3300004800 Bacteria 987
41 Ga0058860_10155767 3300004801 Bacteria 1338
42 Ga0070658_10070042 3300005327 Bacteria 2870
43 Ga0070658_10242846 3300005327 Bacteria 1526
44 Ga0070676_10135919 3300005328 Bacteria 1560
45 Ga0070683_100012063 3300005329 Bacteria 7497
46 Ga0070683_100055375 3300005329 Bacteria 3680
47 Ga0070683_100182428 3300005329 Bacteria 1992
48 Ga0070666_10145092 3300005335 Bacteria 1654
49 Ga0070682_100039916 3300005337 Bacteria 2886
50 Ga0070682_100123028 3300005337 Bacteria 1744
51 Ga0070682_100425257 3300005337 Bacteria 1011
52 Ga0068868_100218028 3300005338 Bacteria 1596
53 Ga0070660_100599957 3300005339 Bacteria 920
54 Ga0070689_100052393 3300005340 Bacteria 3156
55 Ga0070689_100496566 3300005340 Bacteria 1045
56 Ga0070668_100043717 3300005347 Bacteria 3435
57 Ga0070669_100013486 3300005353 Bacteria 5810
58 Ga0070669_100045228 3300005353 Bacteria 3207
59 Ga0070671_101002923 3300005355 Bacteria 732
60 Ga0070674_100035311 3300005356 Bacteria 3347
61 Ga0070688_100399895 3300005365 Bacteria 1016
62 Ga0070659_100065286 3300005366 Bacteria 2883
63 Ga0070667_100000074 3300005367 Bacteria 121299
64 Ga0070667_100163932 3300005367 Bacteria 1959
65 Ga0070667_100643728 3300005367 Bacteria 978
66 Ga0070703_10018558 3300005406 Bacteria 2012
67 Ga0070709_10046692 3300005434 Bacteria 2694
68 Ga0070714_100028790 3300005435 Bacteria 4613
69 Ga0070710_10000625 3300005437 Bacteria 16827
70 Ga0070710_10280136 3300005437 Bacteria 1081
71 Ga0070701_10015906 3300005438 Bacteria 3485
72 Ga0070711_100000779 3300005439 Bacteria 16650
73 Ga0070705_100262635 3300005440 Bacteria 1218
74 Ga0070705_100272374 3300005440 Bacteria 1199
75 Ga0070700_100561080 3300005441 Bacteria 889
76 Ga0070663_100045912 3300005455 Bacteria 3088
77 Ga0070663_100495390 3300005455 Bacteria 1014
78 Ga0070678_100005866 3300005456 Bacteria 7144
79 Ga0070662_100008435 3300005457 Bacteria 6717
80 Ga0070662_100227868 3300005457 Bacteria 1489
81 Ga0068867_100033947 3300005459 Bacteria 3697
82 Ga0070684_100139275 3300005535 Bacteria 2193
83 Ga0068853_100081495 3300005539 Bacteria 2833
84 Ga0070686_100103556 3300005544 Bacteria 1926
85 Ga0070695_100026313 3300005545 Bacteria 3598
86 Ga0070696_100004591 3300005546 Bacteria 9224
87 Ga0070665_100027663 3300005548 Bacteria 5710
88 Ga0070665_100098563 3300005548 Bacteria 2927
89 Ga0070665_100211452 3300005548 Bacteria 1940
90 Ga0070665_100247063 3300005548 Bacteria 1785
91 Ga0070704_100006863 3300005549 Bacteria 6741
92 Ga0068855_100115656 3300005563 Bacteria 3075
93 Ga0070664_100029753 3300005564 Bacteria 4554
94 Ga0070664_100266001 3300005564 Bacteria 1544
95 Ga0068854_100004108 3300005578 Bacteria 9146
96 Ga0068856_100359438 3300005614 Bacteria 1475
97 Ga0070702_100041727 3300005615 Bacteria 2575
98 Ga0068852_100198688 3300005616 Bacteria 1897
99 Ga0068859_100001947 3300005617 Bacteria 21042
100 Ga0068859_100101969 3300005617 Bacteria 2927
101 Ga0068864_100306228 3300005618 Bacteria 1488
102 Ga0068864_100707269 3300005618 Bacteria 985
103 Ga0068866_10000713 3300005718 Bacteria 15113
104 Ga0068861_100001091 3300005719 Bacteria 16779
105 Ga0068863_100038728 3300005841 Bacteria 4535
106 Ga0068858_100039329 3300005842 Bacteria 4386
107 Ga0068858_100084395 3300005842 Bacteria 2954
108 Ga0068860_100000276 3300005843 Bacteria 74447
109 Ga0068860_100002734 3300005843 Bacteria 18350
110 Ga0068860_100132625 3300005843 Bacteria 2392
111 Ga0068862_100000065 3300005844 Bacteria 124435
112 Ga0068862_100001732 3300005844 Bacteria 19723
113 Ga0081455_10009428 3300005937 Bacteria 10043
114 Ga0075365_10048243 3300006038 Bacteria 2802
115 Ga0075365_10193854 3300006038 Bacteria 1422
116 Ga0075363_100028457 3300006048 Bacteria 2875
117 Ga0075363_100101894 3300006048 Bacteria 1589
118 Ga0075363_100426947 3300006048 Bacteria 781
119 Ga0075364_10030032 3300006051 Bacteria 3487
120 Ga0075364_10039301 3300006051 Bacteria 3067
121 Ga0070715_10232226 3300006163 Bacteria 955
122 Ga0070716_100030475 3300006173 Bacteria 2926
123 Ga0070712_100000676 3300006175 Bacteria 20159
124 Ga0075362_10138969 3300006177 Bacteria 1160
125 Ga0075367_10041162 3300006178 Bacteria 2700
126 Ga0075367_10293301 3300006178 Bacteria 1023
127 Ga0075369_10000768 3300006186 Bacteria 10476
128 Ga0075369_10050021 3300006186 Bacteria 1806
129 Ga0075369_10051076 3300006186 Bacteria 1789
130 Ga0075369_10084056 3300006186 Bacteria 1414
131 Ga0075369_10250552 3300006186 Bacteria 822
132 Ga0097621_100057941 3300006237 Bacteria 3170
133 Ga0075370_10181367 3300006353 Bacteria 1239
134 Ga0075370_10287801 3300006353 Bacteria 976
135 Ga0068871_100017304 3300006358 Bacteria 5451
136 Ga0075430_100816162 3300006846 Bacteria 769
137 Ga0068865_100001202 3300006881 Bacteria 15069
138 Ga0068865_100018320 3300006881 Bacteria 4516
139 Ga0075436_100602186 3300006914 Bacteria 810
140 Ga0097620_100001947 3300006931 Bacteria 21042
141 Ga0097620_100101973 3300006931 Bacteria 2927
142 Ga0105240_10203715 3300009093 Bacteria 2317
143 Ga0111539_10754164 3300009094 Bacteria 1133
144 Ga0105245_10001413 3300009098 Bacteria 21776
145 Ga0105247_10000017 3300009101 Bacteria 260438
146 Ga0105247_10001090 3300009101 Bacteria 20246
147 Ga0114129_10637912 3300009147 Bacteria 1376
148 Ga0105243_10011286 3300009148 Bacteria 6758
149 Ga0105243_10620823 3300009148 Bacteria 1043
150 Ga0105241_10072791 3300009174 Bacteria 2672
151 Ga0105242_10033473 3300009176 Bacteria 4114
152 Ga0105248_10000721 3300009177 Bacteria 37448
153 Ga0105248_10123599 3300009177 Bacteria 2919
154 Ga0105248_10638408 3300009177 Bacteria 1201
155 Ga0105248_11646186 3300009177 Bacteria 727
156 Ga0105237_10145052 3300009545 Bacteria 2369
157 Ga0105237_10555823 3300009545 Bacteria 1154
158 Ga0105249_10000096 3300009553 Bacteria 121083
159 Ga0105249_10068716 3300009553 Bacteria 3268
160 Ga0105249_10087548 3300009553 Bacteria 2906
161 Ga0105249_10871059 3300009553 Bacteria 967
162 Ga0105249_11648003 3300009553 Bacteria 714
163 Ga0105239_10020346 3300010375 Bacteria 7321
164 Ga0105239_10023869 3300010375 Bacteria 6734
165 Ga0105239_10070207 3300010375 Bacteria 3847
166 Ga0105246_10056393 3300011119 Bacteria 2716
167 Ga0157369_10624296 3300013105 Bacteria 1112
168 Ga0157369_10646799 3300013105 Bacteria 1090
169 Ga0157374_10641613 3300013296 Bacteria 1073
170 Ga0157374_10886677 3300013296 Bacteria 909
171 Ga0157378_10034055 3300013297 Bacteria 4505
172 Ga0163162_10015089 3300013306 Bacteria 7546
173 Ga0163162_11513702 3300013306 Bacteria 764
174 Ga0157372_10015409 3300013307 Bacteria 8193
175 Ga0157372_10160715 3300013307 Bacteria 2596
176 Ga0157375_10028052 3300013308 Bacteria 5271
177 Ga0163163_10006752 3300014325 Bacteria 10058
178 Ga0163163_10532098 3300014325 Bacteria 1238
179 Ga0157380_10034116 3300014326 Bacteria 3923
180 Ga0157379_10032279 3300014968 Bacteria 4668
181 Ga0157379_10063626 3300014968 Bacteria 3297
182 Ga0163161_10001600 3300017792 Bacteria 16695
183 Ga0163161_10479832 3300017792 Bacteria 1009
184 Ga0197907_10411015 3300020069 Bacteria 2127
185 Ga0197907_10657930 3300020069 Bacteria 939
186 Ga0197907_11372859 3300020069 Bacteria 1263
187 Ga0197907_11405374 3300020069 Bacteria 1433
188 Ga0206356_10222980 3300020070 Bacteria 1302
189 Ga0206356_10674529 3300020070 Bacteria 1111
190 Ga0206356_11070515 3300020070 Bacteria 1265
191 Ga0206349_1051251 3300020075 Bacteria 1050
192 Ga0206349_1383707 3300020075 Bacteria 1212
193 Ga0206349_1385645 3300020075 Bacteria 1070
194 Ga0206349_1856980 3300020075 Bacteria 1681
195 Ga0206355_1085941 3300020076 Bacteria 1153
196 Ga0206355_1389932 3300020076 Bacteria 2615
197 Ga0206355_1722261 3300020076 Bacteria 1406
198 Ga0206351_10216479 3300020077 Bacteria 2658
199 Ga0206352_10436074 3300020078 Bacteria 1677
200 Ga0206350_11464052 3300020080 Bacteria 827
201 Ga0206350_11629593 3300020080 Bacteria 1688
202 Ga0206354_10027635 3300020081 Bacteria 770
203 Ga0206354_10163218 3300020081 Bacteria 2660
204 Ga0206353_10868606 3300020082 Bacteria 798
205 Ga0206353_10876636 3300020082 Bacteria 2936
206 Ga0206353_11714178 3300020082 Bacteria 1116
207 Ga0154015_1487752 3300020610 Bacteria 958
208 Ga0154015_1488494 3300020610 Bacteria 3050
209 Ga0213876_10116052 3300021384 Bacteria 1421
210 Ga0224712_10076882 3300022467 Bacteria 1369
211 Ga0207692_10013505 3300025898 Bacteria 3544
212 Ga0207642_10000255 3300025899 Bacteria 15903
213 Ga0207710_10000033 3300025900 Bacteria 260531
214 Ga0207688_10079995 3300025901 Bacteria 1865
215 Ga0207688_10190974 3300025901 Bacteria 1225
216 Ga0207688_10278208 3300025901 Bacteria 1019
217 Ga0207688_10358732 3300025901 Bacteria 899
218 Ga0207680_10102422 3300025903 Bacteria 1842
219 Ga0207685_10030557 3300025905 Bacteria 1919
220 Ga0207699_10010549 3300025906 Bacteria 4642
221 Ga0207645_10104960 3300025907 Bacteria 1825
222 Ga0207705_10251390 3300025909 Bacteria 1348
223 Ga0207705_10394563 3300025909 Bacteria 1070
224 Ga0207671_10127778 3300025914 Bacteria 1949
225 Ga0207693_10006799 3300025915 Bacteria 9444
226 Ga0207663_10008390 3300025916 Bacteria 5399
227 Ga0207660_10281515 3300025917 Bacteria 1320
228 Ga0207657_10406817 3300025919 Bacteria 1070
229 Ga0207649_10434486 3300025920 Bacteria 988
230 Ga0207652_10118242 3300025921 Bacteria 2355
231 Ga0207681_10000456 3300025923 Bacteria 28674
232 Ga0207681_10081690 3300025923 Bacteria 2282
233 Ga0207687_10002110 3300025927 Bacteria 13589
234 Ga0207687_10052326 3300025927 Bacteria 2850
235 Ga0207664_10104628 3300025929 Bacteria 2344
236 Ga0207644_10011017 3300025931 Bacteria 5972
237 Ga0207706_10208647 3300025933 Bacteria 1713
238 Ga0207686_10020167 3300025934 Bacteria 3804
239 Ga0207670_10010722 3300025936 Bacteria 5289
240 Ga0207670_10530134 3300025936 Bacteria 960
241 Ga0207669_10000192 3300025937 Bacteria 27738
242 Ga0207704_10002317 3300025938 Bacteria 8556
243 Ga0207665_10109923 3300025939 Bacteria 1936
244 Ga0207711_10009740 3300025941 Bacteria 7994
245 Ga0207711_10269492 3300025941 Bacteria 1566
246 Ga0207711_10471905 3300025941 Bacteria 1169
247 Ga0207689_10143187 3300025942 Bacteria 1969
248 Ga0207661_10017317 3300025944 Bacteria 5328
249 Ga0207661_10060501 3300025944 Bacteria 3056
250 Ga0207661_10068581 3300025944 Bacteria 2888
251 Ga0207661_10188638 3300025944 Bacteria 1806
252 Ga0207679_10087528 3300025945 Bacteria 2399
253 Ga0207667_10106388 3300025949 Bacteria 2894
254 Ga0207651_10729922 3300025960 Bacteria 874
255 Ga0207712_10000005 3300025961 Bacteria 608697
256 Ga0207712_10206728 3300025961 Bacteria 1561
257 Ga0207712_10338889 3300025961 Bacteria 1246
258 Ga0207668_10000752 3300025972 Bacteria 19808
259 Ga0207640_10002625 3300025981 Bacteria 9635
260 Ga0207658_10000517 3300025986 Bacteria 35169
261 Ga0207658_10062226 3300025986 Bacteria 2792
262 Ga0207658_10080843 3300025986 Bacteria 2490
263 Ga0207658_10108439 3300025986 Bacteria 2190
264 Ga0207658_10399000 3300025986 Bacteria 1208
265 Ga0207677_10008380 3300026023 Bacteria 5770
266 Ga0207703_10007479 3300026035 Bacteria 8676
267 Ga0207703_10028677 3300026035 Bacteria 4391
268 Ga0207703_10067219 3300026035 Bacteria 2950
269 Ga0207639_10015214 3300026041 Bacteria 5422
270 Ga0207678_10011571 3300026067 Bacteria 7749
271 Ga0207678_10473257 3300026067 Bacteria 1090
272 Ga0207708_10048386 3300026075 Bacteria 3237
273 Ga0207708_10640998 3300026075 Bacteria 903
274 Ga0207641_10001384 3300026088 Bacteria 23892
275 Ga0207641_10119903 3300026088 Bacteria 2345
276 Ga0207641_10640355 3300026088 Bacteria 1043
277 Ga0207648_10002256 3300026089 Bacteria 20849
278 Ga0207676_10292335 3300026095 Bacteria 1484
279 Ga0207676_10451290 3300026095 Bacteria 1212
280 Ga0207676_10639673 3300026095 Bacteria 1025
281 Ga0207674_10131631 3300026116 Bacteria 2464
282 Ga0207675_100002064 3300026118 Bacteria 20030
283 Ga0207683_10001521 3300026121 Bacteria 20891
284 Ga0207698_10610245 3300026142 Bacteria 1077
285 Ga0209813_10090406 3300027866 Bacteria 1027
286 Ga0207428_10059942 3300027907 Bacteria 3015
287 Ga0268266_10012998 3300028379 Bacteria 7178
288 Ga0268265_10000022 3300028380 Bacteria 270788
289 Ga0268264_10000005 3300028381 Bacteria 934972
290 Ga0268264_10005951 3300028381 Bacteria 10323
291 Ga0268264_10126961 3300028381 Bacteria 2255
292 Ga0307511_10056191 3300030521 Bacteria 3081
293 Ga0316176_1120777 3300030732 Bacteria 1942
294 Ga0316183_1035066 3300030742 Bacteria 1156
295 Ga0307513_10000001 3300031456 Bacteria 1660464
296 Ga0307408_100568448 3300031548 Bacteria 1003
297 Ga0316575_10029870 3300031665 Bacteria 2129
298 Ga0316579_10017900 3300031691 Bacteria 3113
299 Ga0316576_10060416 3300031727 Bacteria 2776
300 Ga0316578_10209206 3300031728 Bacteria 1173
301 Ga0307405_10018897 3300031731 Bacteria 3814
302 Ga0316577_10333461 3300031733 Bacteria 860
303 Ga0307413_10085143 3300031824 Bacteria 2040
304 Ga0307413_10143265 3300031824 Bacteria 1654
305 Ga0307413_10183061 3300031824 Bacteria 1496
306 Ga0307410_10125199 3300031852 Bacteria 1880
307 Ga0307410_10249582 3300031852 Bacteria 1379
308 Ga0307410_10599975 3300031852 Bacteria 918
309 Ga0307407_10018303 3300031903 Bacteria 3540
310 Ga0307407_10059858 3300031903 Bacteria 2220
311 Ga0307407_10102065 3300031903 Bacteria 1783
312 Ga0307412_10212864 3300031911 Bacteria 1476
313 Ga0307412_10357771 3300031911 Bacteria 1174
314 Ga0307409_100004499 3300031995 Bacteria 7849
315 Ga0307409_100267210 3300031995 Bacteria 1573
316 Ga0307409_100562406 3300031995 Bacteria 1121
317 Ga0307409_101048399 3300031995 Bacteria 835
318 Ga0307416_100160395 3300032002 Bacteria 2078
319 Ga0307416_100474357 3300032002 Bacteria 1310
320 Ga0307414_10088660 3300032004 Bacteria 2290
321 Ga0307414_10172679 3300032004 Bacteria 1730
322 Ga0307414_10675625 3300032004 Bacteria 933
323 Ga0307411_10305562 3300032005 Bacteria 1278
324 Ga0307415_100051963 3300032126 Bacteria 2784
325 Ga0307415_100138218 3300032126 Bacteria 1856
326 Ga0307415_100400896 3300032126 Bacteria 1171
327 Ga0316592_1018804 3300033524 Bacteria 1458
328 Ga0316588_1099128 3300033528 Bacteria 729
329 Ga0316596_1011082 3300033541 Bacteria 2195
330 Ga0373958_0021254 3300034819 Bacteria 1203
331 Ga0373949_0034009 3300035090 Bacteria 1227
332 Ga0373952_0013839 3300035092 Bacteria 1607
333 Ga0373961_0096863 3300035241 Bacteria 950
334 Ga0373962_0099598 3300035242 Bacteria 905
335 Ga0316574_0001480 3300035398 Bacteria 11186
336 Ga0373931_0166372 3300035691 Bacteria 1296
337 Ga0316582_0098538 3300036647 Bacteria 1933
338 Ga0316584_0065499 3300036712 Bacteria 2721
339 Ga0395900_0166917 3300037418 Bacteria 2243
340 Ga0395898_0181056 3300037466 Bacteria 2014
341 Ga0395898_0468312 3300037466 Bacteria 1199
342 Ga0395901_0338158 3300038443 Bacteria 1555
343 Ga0242420_017563 3300038996 Bacteria 1253
344 Ga0436365_1912815 3300039437 Bacteria 1047
345 Ga0439436_0017852 3300041404 Bacteria 2123
346 Ga0439438_052351 3300041405 Bacteria 1035
347 Ga0439439_0001664 3300041406 Bacteria 4503
348 Ga0439461_0014172 3300041410 Bacteria 1512
349 Ga0439461_0028633 3300041410 Bacteria 1148
350 Ga0439466_0039544 3300041411 Bacteria 1580
351 Ga0439466_0052307 3300041411 Bacteria 1335
352 Ga0439465_0004465 3300041413 Bacteria 4526
353 Ga0451800_1651231 3300041459 Bacteria 860
354 Ga0451833_0930245 3300041491 Bacteria 992
355 Ga0451833_1420425 3300041491 Bacteria 962
356 Ga0451837_1540429 3300041494 Bacteria 1575
357 Ga0451839_0151690 3300041496 Bacteria 834
358 Ga0451853_1178819 3300041512 Bacteria 2324
359 Ga0439442_013782 3300042002 Bacteria 1660
360 Ga0439442_041753 3300042002 Bacteria 964
361 Ga0439445_0006922 3300042004 Bacteria 2619
362 Ga0439448_0090578 3300042005 Bacteria 1033
363 Ga0439449_0063432 3300042007 Bacteria 1363
364 Ga0439457_002215 3300042014 Bacteria 5624
365 Ga0450908_020399 3300042184 Bacteria 1165
366 Ga0466969_0262021 3300044656 Bacteria 783
367 Ga0466972_0007943 3300044658 Bacteria 5318
368 Ga0466965_0010425 3300044683 Bacteria 4335
369 Ga0466965_0126491 3300044683 Bacteria 1322
370 Ga0466965_0135157 3300044683 Bacteria 1281
371 Ga0466965_0139494 3300044683 Bacteria 1261
372 Ga0466965_0230273 3300044683 Bacteria 990
373 Ga0466966_0080967 3300044684 Bacteria 2022
374 Ga0466966_0279288 3300044684 Bacteria 1005
375 Ga0466961_0014059 3300044693 Bacteria 5133
376 Ga0466961_0154795 3300044693 Bacteria 1430
377 Ga0466963_0049053 3300044694 Bacteria 2791
378 Ga0466964_0125217 3300044706 Bacteria 1163
379 Ga0466971_0030753 3300044719 Bacteria 2403
380 Ga0466970_0015597 3300044765 Bacteria 3911
381 Ga0466970_0041257 3300044765 Bacteria 2451
382 Ga0466970_0157007 3300044765 Bacteria 1257
383 Ga0466957_0040100 3300044842 Bacteria 2827
384 Ga0466957_0129558 3300044842 Bacteria 1615
385 Ga0466957_0258112 3300044842 Bacteria 1161
386 Ga0466960_0008863 3300044901 Bacteria 4132
387 Ga0466960_0046852 3300044901 Bacteria 2071
388 Ga0466960_0060274 3300044901 Bacteria 1859
389 Ga0466960_0095993 3300044901 Bacteria 1519
390 Ga0466960_0098191 3300044901 Bacteria 1504
391 Ga0466960_0115977 3300044901 Bacteria 1397
392 Ga0466960_0175939 3300044901 Bacteria 1157
393 Ga0466960_0213028 3300044901 Bacteria 1060
394 Ga0466960_0292990 3300044901 Bacteria 915
395 Ga0466960_0380090 3300044901 Bacteria 810
396 Ga0451576_1722735 3300045051 Bacteria 649
397 Ga0466958_0035085 3300045836 Bacteria 2995
398 Ga0466958_0325999 3300045836 Bacteria 987
399 Ga0466967_0005418 3300045976 Bacteria 8840
400 Ga0466967_0013542 3300045976 Bacteria 6308
401 Ga0466967_0031836 3300045976 Bacteria 4446
402 Ga0466967_0082261 3300045976 Bacteria 2909
403 Ga0466967_0111971 3300045976 Bacteria 2509
404 Ga0466967_0149309 3300045976 Bacteria 2183
405 Ga0466967_0180952 3300045976 Bacteria 1988
406 Ga0466967_0194515 3300045976 Bacteria 1918
407 Ga0466967_0531400 3300045976 Bacteria 1156
408 Ga0466967_0543790 3300045976 Bacteria 1143
409 Ga0466967_1135897 3300045976 Bacteria 778
410 Ga0495590_0106347 3300046457 Bacteria 999
411 Ga0495582_0137551 3300046473 Bacteria 1383
412 Ga0495585_0101767 3300046492 Bacteria 1536
413 Ga0495648_0012039 3300046524 Bacteria 6480
414 Ga0495654_0035358 3300046530 Bacteria 2516
415 Ga0495611_0045012 3300046648 Bacteria 1975
416 Ga0495658_0349217 3300046683 Bacteria 940
417 Ga0495671_0125209 3300046692 Bacteria 1253
418 Ga0495672_0002334 3300047320 Bacteria 17587
419 Ga0495672_0054180 3300047320 Bacteria 2346
420 Ga0495672_0057053 3300047320 Bacteria 2269
421 Ga0495676_0097315 3300047321 Bacteria 2186
422 Ga0495673_0000805 3300047469 Bacteria 29466
423 Ga0495593_0112535 3300047673 Bacteria 1389
424 Ga0496100_0003761 3300048903 Bacteria 7949
425 Ga0496100_0535105 3300048903 Bacteria 905
426 Ga0496101_0000691 3300048904 Bacteria 20348
427 Ga0496102_0000415 3300048905 Bacteria 49294
428 Ga0496102_0000473 3300048905 Bacteria 44556
429 Ga0496102_0004268 3300048905 Bacteria 12085
430 Ga0496102_0087146 3300048905 Bacteria 2884
431 Ga0496102_0103244 3300048905 Bacteria 2651
432 Ga0496102_0745233 3300048905 Bacteria 902
433 Ga0496103_0000906 3300048906 Bacteria 21290
434 Ga0496103_0002413 3300048906 Bacteria 11762
435 Ga0496103_0013273 3300048906 Bacteria 4882
436 Ga0496103_0116562 3300048906 Bacteria 1699
437 Ga0496104_0042002 3300048907 Bacteria 4289
438 Ga0496104_0253820 3300048907 Bacteria 1671
439 Ga0496104_0755116 3300048907 Bacteria 879
440 Ga0496105_0125958 3300048908 Bacteria 2111
441 Ga0496105_0267499 3300048908 Bacteria 1381
442 Ga0496105_0520908 3300048908 Bacteria 931
443 Ga0496106_0001016 3300048909 Bacteria 20579
444 Ga0496106_0005923 3300048909 Bacteria 9038
445 Ga0496107_0016176 3300048910 Bacteria 5234
446 Ga0496107_0114720 3300048910 Bacteria 1982
447 Ga0496108_0028097 3300048911 Bacteria 4653
448 Ga0496108_0263958 3300048911 Bacteria 1498
449 Ga0496109_0058601 3300048912 Bacteria 3518
450 Ga0496109_0287633 3300048912 Bacteria 1549
451 Ga0496109_0311753 3300048912 Bacteria 1484
452 Ga0496109_0502992 3300048912 Bacteria 1144
453 Ga0496109_0530361 3300048912 Bacteria 1111
454 Ga0496110_0002566 3300048913 Bacteria 13655
455 Ga0496110_0003020 3300048913 Bacteria 12767
456 Ga0496110_0768126 3300048913 Bacteria 867
457 Ga0496111_0021913 3300048914 Bacteria 4466
458 Ga0496111_0176614 3300048914 Bacteria 1587
459 Ga0496112_0028280 3300048915 Bacteria 5410
460 Ga0496112_0186348 3300048915 Bacteria 2038
461 Ga0496112_0468162 3300048915 Bacteria 1197
462 Ga0496112_1269469 3300048915 Bacteria 652
463 Ga0496113_0021372 3300048916 Bacteria 4565
464 Ga0496114_0000153 3300048917 Bacteria 50028
465 Ga0496114_0107141 3300048917 Bacteria 2391
466 Ga0496115_0004346 3300048918 Bacteria 10254
467 Ga0496115_0140640 3300048918 Bacteria 1991
468 Ga0496116_0026069 3300048919 Bacteria 4283
469 Ga0496116_0209961 3300048919 Bacteria 1010
470 Ga0496117_0174642 3300048920 Bacteria 1243
471 Ga0496118_0001365 3300048921 Bacteria 36792
472 Ga0496119_0018915 3300048922 Bacteria 5101
473 Ga0496120_0067128 3300048923 Bacteria 1982
474 Ga0496121_0082139 3300048924 Bacteria 2548
475 Ga0496124_0024263 3300048927 Bacteria 5519
476 Ga0496126_0005099 3300048929 Bacteria 15224
477 Ga0501306_001693 3300049127 Bacteria 2137
478 Ga0501306_007769 3300049127 Bacteria 1292
479 Ga0501306_013397 3300049127 Bacteria 1069
480 Ga0501308_001262 3300049128 Bacteria 1973
481 Ga0501308_001922 3300049128 Bacteria 1750
482 Ga0501308_009318 3300049128 Bacteria 1070
483 Ga0501309_000178 3300049129 Bacteria 4209
484 Ga0501309_001465 3300049129 Bacteria 2328
485 Ga0501309_004756 3300049129 Bacteria 1594
486 Ga0501310_002424 3300049130 Bacteria 1771
487 Ga0501310_021008 3300049130 Bacteria 814
488 Ga0501304_002286 3300049160 Bacteria 1320
489 Ga0501305_001701 3300049161 Bacteria 2222
490 Ga0501305_003255 3300049161 Bacteria 1827
491 Ga0501307_005562 3300049162 Bacteria 1332
492 Ga0501307_010162 3300049162 Bacteria 1085
493 Ga0501307_017212 3300049162 Bacteria 909
494 Ga0501291_022464 3300049514 Bacteria 1012
495 Ga0501311_004092 3300049527 Bacteria 1535
496 Ga0501311_004901 3300049527 Bacteria 1443
497 Ga0501311_014200 3300049527 Bacteria 1014
498 Ga0501312_000825 3300049528 Bacteria 2752
499 Ga0501312_002931 3300049528 Bacteria 1886
500 Ga0501313_001487 3300049529 Bacteria 2053
501 Ga0501313_019064 3300049529 Bacteria 837
502 Ga0501313_025343 3300049529 Bacteria 750
503 Ga0501314_000768 3300049530 Bacteria 2121
504 Ga0501315_002341 3300049531 Bacteria 1767
505 Ga0501316_000783 3300049532 Bacteria 2419
506 Ga0501316_001281 3300049532 Bacteria 2096
507 Ga0501316_004979 3300049532 Bacteria 1358
508 Ga0501317_000435 3300049533 Bacteria 2897
509 Ga0501317_000756 3300049533 Bacteria 2473
510 Ga0501317_015612 3300049533 Bacteria 976
511 Ga0501318_000293 3300049534 Bacteria 2911
512 Ga0501318_000622 3300049534 Bacteria 2357
513 Ga0501318_004378 3300049534 Bacteria 1351
514 Ga0501318_006608 3300049534 Bacteria 1189
515 Ga0501318_013676 3300049534 Bacteria 947
516 Ga0501318_014478 3300049534 Bacteria 931
517 Ga0501319_001043 3300049535 Bacteria 1516
518 Ga0501320_004420 3300049536 Bacteria 1240
519 Ga0501321_000223 3300049537 Bacteria 3255
520 Ga0501321_000446 3300049537 Bacteria 2648
521 Ga0501321_014497 3300049537 Bacteria 918
522 Ga0501323_000695 3300049539 Bacteria 2628
523 Ga0501324_000317 3300049540 Bacteria 2469
524 Ga0501333_004354 3300049549 Bacteria 892
525 Ga0501340_000700 3300049556 Bacteria 1593
526 Ga0501034_0365623 3300049571 Bacteria 1369
527 Ga0501036_0089550 3300049572 Bacteria 2600
528 Ga0501039_0193911 3300049575 Bacteria 1597
529 Ga0501039_0349800 3300049575 Bacteria 1161
530 Ga0501039_0450267 3300049575 Bacteria 1011
531 Ga0501039_0623996 3300049575 Bacteria 844
532 Ga0501039_0685713 3300049575 Bacteria 801
533 Ga0501039_0793613 3300049575 Bacteria 739
534 Ga0501040_0047321 3300049576 Bacteria 2938
535 Ga0501040_0106687 3300049576 Bacteria 1957
536 Ga0501040_0274266 3300049576 Bacteria 1204
537 Ga0501041_0188567 3300049577 Bacteria 1291
538 Ga0501041_0239630 3300049577 Bacteria 1140
539 Ga0501042_0094733 3300049578 Bacteria 2144
540 Ga0501042_0166457 3300049578 Bacteria 1591
541 Ga0501042_0347868 3300049578 Bacteria 1072
542 Ga0501043_0668646 3300049579 Bacteria 761
543 Ga0501046_0282482 3300049580 Bacteria 1216
544 Ga0501047_0674618 3300049581 Bacteria 852
545 Ga0501048_0357014 3300049582 Bacteria 1042
546 Ga0501067_0018448 3300049583 Bacteria 3865
547 Ga0501067_0047395 3300049583 Bacteria 2383
548 Ga0501067_0056320 3300049583 Bacteria 2178
549 Ga0501068_0005522 3300049584 Bacteria 6928
550 Ga0501069_0143732 3300049585 Bacteria 1369
551 Ga0501070_0012735 3300049586 Bacteria 7091
552 Ga0501070_0051285 3300049586 Bacteria 3425
553 Ga0501071_0473734 3300049587 Bacteria 959
554 Ga0501071_0641317 3300049587 Bacteria 817
555 Ga0501072_0020572 3300049588 Bacteria 5115
556 Ga0501072_0402708 3300049588 Bacteria 1085
557 Ga0501073_0009585 3300049589 Bacteria 7141
558 Ga0501074_0012602 3300049590 Bacteria 6147
559 Ga0501074_0289478 3300049590 Bacteria 1164
560 Ga0501074_0368651 3300049590 Bacteria 1019
561 Ga0501076_0338603 3300049592 Bacteria 1234
562 Ga0501077_0052062 3300049593 Bacteria 2600
563 Ga0501077_0518364 3300049593 Bacteria 765
564 Ga0501079_0182081 3300049741 Bacteria 1640
565 Ga0501079_0247014 3300049741 Bacteria 1394
566 Ga0501079_0458501 3300049741 Bacteria 1001
567 Ga0501080_0161166 3300049742 Bacteria 2071
568 Ga0501081_0314113 3300049743 Bacteria 1151
569 Ga0501083_0060051 3300049744 Bacteria 2541
570 Ga0501271_002630 3300049768 Bacteria 1615
571 Ga0501044_0254784 3300049823 Bacteria 1695
572 Ga0501045_0059228 3300049824 Bacteria 2805
573 Ga0501045_0161508 3300049824 Bacteria 1668
574 Ga0501045_0646918 3300049824 Bacteria 781
575 nmdc:mga03683_45975_c1 3300050489 Bacteria 1808
576 nmdc:mga03n38_162103_c1 3300050490 Bacteria 805
577 nmdc:mga03n38_1711_c1 3300050490 Bacteria 6465
578 nmdc:mga03n38_90510_c1 3300050490 Bacteria 1456
579 nmdc:mga00v17_20801_c1 3300050491 Bacteria 3764
580 nmdc:mga00v17_21448_c1 3300050491 Bacteria 3714
581 nmdc:mga00v17_306446_c1 3300050491 Bacteria 1032
582 nmdc:mga00v17_333923_c1 3300050491 Bacteria 985
583 nmdc:mga00v17_46427_c1 3300050491 Bacteria 2628
584 nmdc:mga00v17_53384_c1 3300050491 Bacteria 2463
585 nmdc:mga0yw44_366089_c1 3300050492 Bacteria 972
586 nmdc:mga0yw44_38654_c1 3300050492 Bacteria 2825
587 nmdc:mga0yw44_57995_c1 3300050492 Bacteria 2364
588 nmdc:mga0yw44_62695_c1 3300050492 Bacteria 2284
589 nmdc:mga06z11_88551_c1 3300050494 Bacteria 1676
590 nmdc:mga07m45_179374_c1 3300050496 Bacteria 1232
591 nmdc:mga07m45_36992_c1 3300050496 Bacteria 2722
592 nmdc:mga07m45_68362_c1 3300050496 Bacteria 2019
593 nmdc:mga05p37_10660_c1 3300050507 Bacteria 10905
594 nmdc:mga09592_2299_c1 3300050508 Bacteria 15408
595 nmdc:mga0qj67_73060_c1 3300050509 Bacteria 2121
596 nmdc:mga06r32_130_c1 3300050510 Bacteria 55123
597 nmdc:mga08y16_3501_c1 3300050511 Bacteria 16300
598 nmdc:mga08y16_525368_c1 3300050511 Bacteria 1200
599 nmdc:mga0a205_62541_c1 3300050515 Bacteria 3596
600 nmdc:mga0sz30_3448_c1 3300050516 Bacteria 5697
601 nmdc:mga0sz30_50890_c1 3300050516 Bacteria 1757
602 nmdc:mga0sz30_6746_c2 3300050516 Bacteria 1712
603 nmdc:mga0sz30_9944_c1 3300050516 Bacteria 3633
604 Ga0495619_0239729 3300053085 Bacteria 1257
605 Ga0500646_0040691 3300053090 Bacteria 1308
606 Ga0501084_0081326 3300054114 Bacteria 2717
607 Ga0501084_0390289 3300054114 Bacteria 1176
608 Ga0501084_0480212 3300054114 Bacteria 1050
609 Ga0587084_009923 3300059477 Bacteria 1239
610 Ga0587093_004188 3300059478 Bacteria 1458
611 Ga0587070_035544 3300059491 Bacteria 927
612 Ga0587073_0026157 3300059492 Bacteria 1166
613 Ga0587073_0035387 3300059492 Bacteria 1058
614 Ga0587088_029575 3300059508 Bacteria 970
615 Ga0587090_051558 3300059510 Bacteria 755
616 Ga0587092_011416 3300059512 Bacteria 1235
617 Ga0587106_024093 3300059605 Bacteria 928
618 Ga0587106_024612 3300059605 Bacteria 922
619 Ga0587106_036262 3300059605 Bacteria 817
620 Ga0587125_018228 3300059607 Bacteria 805
621 Ga0587129_001917 3300059608 Bacteria 1180
622 Ga0587099_008267 3300059622 Bacteria 1001
623 Ga0587101_008779 3300059623 Bacteria 1231
624 Ga0587109_041569 3300059624 Bacteria 913
625 Ga0587117_013196 3300059627 Bacteria 1054
626 Ga0587122_009649 3300059628 Bacteria 897
627 Ga0587128_012632 3300059630 Bacteria 1177
628 Ga0587062_006343 3300059639 Bacteria 1341
629 Ga0587069_031284 3300059642 Bacteria 862
630 Ga0587072_018139 3300059643 Bacteria 1220
631 Ga0587075_003565 3300059644 Bacteria 1746
632 Ga0587078_005748 3300059646 Bacteria 1332
633 Ga0587079_009278 3300059647 Bacteria 1527
634 Ga0587079_030308 3300059647 Bacteria 1035
635 Ga0587100_001887 3300059648 Bacteria 1283
636 Ga0587102_011562 3300059649 Bacteria 889
637 Ga0587105_004755 3300059651 Bacteria 880
638 Ga0587105_007091 3300059651 Bacteria 785
639 Ga0587107_005072 3300059652 Bacteria 1374
640 Ga0587107_013837 3300059652 Bacteria 1029
641 Ga0587107_014561 3300059652 Bacteria 1013
642 Ga0587119_020478 3300059658 Bacteria 840
643 Ga0587071_027839 3300060344 Bacteria 1073
644 Ga0587071_061619 3300060344 Bacteria 799
645 Ga0587111_0002748 3300060346 Bacteria 2401
646 Ga0587111_0050936 3300060346 Bacteria 914
647 Ga0501082_0003723 3300060353 Bacteria 13323
648 Ga0466962_0047571 3300061719 Bacteria 2049
649 Ga0530510_0228964 3300061734 Bacteria 1382
650 Ga0530510_0415616 3300061734 Bacteria 1015

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100227868 Ga0070662_1002278682 153
2 3300044683 Ga0466965_0135157 Ga0466965_0135157_177_821 160
3 3300048915 Ga0496112_1269469 Ga0496112_1269469_18_593 161
4 3300003308 Ga0006777J48905_1021747 Ga0006777J48905_10217472 164
5 3300003544 Ga0007417J51691_1032364 Ga0007417J51691_10323642 164
6 3300003693 Ga0032354_1008262 Ga0032354_10082622 164
7 3300049129 Ga0501309_000178 Ga0501309_000178_848_1513 164
8 3300049528 Ga0501312_000825 Ga0501312_000825_1490_2155 164
9 3300003162 Ga0006778J45830_1028228 Ga0006778J45830_10282282 165
10 3300003308 Ga0006777J48905_1059879 Ga0006777J48905_10598792 165
11 3300003575 Ga0007409J51694_1063908 Ga0007409J51694_10639082 165
12 3300003579 Ga0007429J51699_1024979 Ga0007429J51699_10249792 165
13 3300003693 Ga0032354_1037833 Ga0032354_10378332 165
14 3300050516 nmdc:mga0sz30_6746_c2 nmdc:mga0sz30_6746_c2_23_637 171
15 3300049540 Ga0501324_000317 Ga0501324_000317_360_1034 172
16 3300003574 Ga0007410J51695_1039556 Ga0007410J51695_10395561 173
17 3300004798 Ga0058859_10026884 Ga0058859_100268841 173
18 3300004801 Ga0058860_10155767 Ga0058860_101557673 173
19 3300020075 Ga0206349_1051251 Ga0206349_10512512 173
20 3300025901 Ga0207688_10358732 Ga0207688_103587322 173
21 3300031731 Ga0307405_10018897 Ga0307405_100188974 173
22 3300031824 Ga0307413_10143265 Ga0307413_101432652 173
23 3300031852 Ga0307410_10125199 Ga0307410_101251992 173
24 3300031903 Ga0307407_10018303 Ga0307407_100183034 173
25 3300031911 Ga0307412_10212864 Ga0307412_102128642 173
26 3300031995 Ga0307409_100004499 Ga0307409_1000044993 173
27 3300032004 Ga0307414_10088660 Ga0307414_100886603 173
28 3300032126 Ga0307415_100051963 Ga0307415_1000519634 173
29 3300049127 Ga0501306_001693 Ga0501306_001693_704_1381 173
30 3300049128 Ga0501308_001922 Ga0501308_001922_448_1125 173
31 3300049129 Ga0501309_001465 Ga0501309_001465_846_1523 173
32 3300049130 Ga0501310_002424 Ga0501310_002424_715_1392 173
33 3300049161 Ga0501305_001701 Ga0501305_001701_1180_1857 173
34 3300049162 Ga0501307_010162 Ga0501307_010162_83_760 173
35 3300049514 Ga0501291_022464 Ga0501291_022464_136_813 173
36 3300049527 Ga0501311_004901 Ga0501311_004901_379_1056 173
37 3300049528 Ga0501312_002931 Ga0501312_002931_321_998 173
38 3300049529 Ga0501313_001487 Ga0501313_001487_662_1339 173
39 3300049530 Ga0501314_000768 Ga0501314_000768_139_816 173
40 3300049531 Ga0501315_002341 Ga0501315_002341_462_1139 173
41 3300049532 Ga0501316_004979 Ga0501316_004979_388_1065 173
42 3300049533 Ga0501317_000756 Ga0501317_000756_1123_1800 173
43 3300049534 Ga0501318_000293 Ga0501318_000293_900_1577 173
44 3300049535 Ga0501319_001043 Ga0501319_001043_461_1138 173
45 3300049536 Ga0501320_004420 Ga0501320_004420_174_851 173
46 3300049537 Ga0501321_000223 Ga0501321_000223_2003_2680 173
47 3300049539 Ga0501323_000695 Ga0501323_000695_1711_2388 173
48 3300049549 Ga0501333_004354 Ga0501333_004354_45_719 173
49 3300049556 Ga0501340_000700 Ga0501340_000700_151_828 173
50 3300049768 Ga0501271_002630 Ga0501271_002630_306_983 173
51 3300003160 Ga0006779J45831_102609 Ga0006779J45831_1026093 174
52 3300003161 Ga0006765J45826_109836 Ga0006765J45826_1098363 174
53 3300003163 Ga0006759J45824_1015649 Ga0006759J45824_10156492 174
54 3300003300 Ga0006758J48902_1015782 Ga0006758J48902_10157822 174
55 3300003305 Ga0006770J48903_1014088 Ga0006770J48903_10140883 174
56 3300003308 Ga0006777J48905_1013451 Ga0006777J48905_10134512 174
57 3300003559 Ga0007427J51700_103349 Ga0007427J51700_1033493 174
58 3300003568 Ga0006781J51513_1004744 Ga0006781J51513_10047443 174
59 3300003574 Ga0007410J51695_1009274 Ga0007410J51695_10092741 174
60 3300003575 Ga0007409J51694_1005546 Ga0007409J51694_10055463 174
61 3300003577 Ga0007416J51690_1006248 Ga0007416J51690_10062483 174
62 3300003577 Ga0007416J51690_1006249 Ga0007416J51690_10062492 174
63 3300003579 Ga0007429J51699_1004465 Ga0007429J51699_10044652 174
64 3300003611 Ga0007411J51799_103764 Ga0007411J51799_1037643 174
65 3300003613 Ga0007415J51800_105039 Ga0007415J51800_1050393 174
66 3300013105 Ga0157369_10624296 Ga0157369_106242962 174
67 3300044901 Ga0466960_0008863 Ga0466960_0008863_1779_2474 174
68 3300044901 Ga0466960_0098191 Ga0466960_0098191_555_1241 174
69 3300045051 Ga0451576_1722735 Ga0451576_1722735_24_638 174
70 3300045976 Ga0466967_0111971 Ga0466967_0111971_1420_2037 174
71 3300048912 Ga0496109_0530361 Ga0496109_0530361_282_902 174
72 3300049162 Ga0501307_017212 Ga0501307_017212_13_624 174
73 3300049529 Ga0501313_025343 Ga0501313_025343_18_632 174
74 3300049575 Ga0501039_0623996 Ga0501039_0623996_214_831 174
75 3300003308 Ga0006777J48905_1034729 Ga0006777J48905_10347292 175
76 3300003575 Ga0007409J51694_1044798 Ga0007409J51694_10447982 175
77 3300003693 Ga0032354_1022152 Ga0032354_10221522 175
78 3300001989 JGI24739J22299_10037612 JGI24739J22299_100376123 178
79 3300020069 Ga0197907_11405374 Ga0197907_114053742 178
80 3300020080 Ga0206350_11464052 Ga0206350_114640522 178
81 3300020610 Ga0154015_1487752 Ga0154015_14877522 178
82 3300032002 Ga0307416_100474357 Ga0307416_1004743572 178
83 3300027907 Ga0207428_10059942 Ga0207428_100599422 180
84 3300037418 Ga0395900_0166917 Ga0395900_0166917_826_1476 180
85 3300050507 nmdc:mga05p37_10660_c1 nmdc:mga05p37_10660_c1_9392_10057 180
86 3300050508 nmdc:mga09592_2299_c1 nmdc:mga09592_2299_c1_5815_6480 180
87 3300050510 nmdc:mga06r32_130_c1 nmdc:mga06r32_130_c1_51534_52199 180
88 3300050511 nmdc:mga08y16_3501_c1 nmdc:mga08y16_3501_c1_15594_16259 180
89 3300050515 nmdc:mga0a205_62541_c1 nmdc:mga0a205_62541_c1_1564_2229 180
90 3300059510 Ga0587090_051558 Ga0587090_051558_71_721 180
91 3300059605 Ga0587106_036262 Ga0587106_036262_73_723 180
92 3300059608 Ga0587129_001917 Ga0587129_001917_415_1065 180
93 3300059642 Ga0587069_031284 Ga0587069_031284_39_695 180
94 3300059646 Ga0587078_005748 Ga0587078_005748_612_1262 180
95 3300059647 Ga0587079_030308 Ga0587079_030308_171_821 180
96 3300059651 Ga0587105_007091 Ga0587105_007091_73_723 180
97 3300060344 Ga0587071_061619 Ga0587071_061619_111_761 180
98 3300041410 Ga0439461_0028633 Ga0439461_0028633_150_800 181
99 3300041411 Ga0439466_0039544 Ga0439466_0039544_123_773 181
100 3300041413 Ga0439465_0004465 Ga0439465_0004465_597_1247 181
101 3300042004 Ga0439445_0006922 Ga0439445_0006922_458_1108 181
102 3300001989 JGI24739J22299_10073264 JGI24739J22299_100732641 182
103 3300002073 JGI24745J21846_1010180 JGI24745J21846_10101801 182
104 3300002074 JGI24748J21848_1001863 JGI24748J21848_10018634 182
105 3300002075 JGI24738J21930_10008775 JGI24738J21930_100087753 182
106 3300002076 JGI24749J21850_1001482 JGI24749J21850_10014824 182
107 3300002077 JGI24744J21845_10001209 JGI24744J21845_100012098 182
108 3300002244 JGI24742J22300_10008229 JGI24742J22300_100082292 182
109 3300005328 Ga0070676_10135919 Ga0070676_101359191 182
110 3300005335 Ga0070666_10145092 Ga0070666_101450922 182
111 3300005337 Ga0070682_100039916 Ga0070682_1000399162 182
112 3300005338 Ga0068868_100218028 Ga0068868_1002180282 182
113 3300005340 Ga0070689_100052393 Ga0070689_1000523934 182
114 3300005347 Ga0070668_100043717 Ga0070668_1000437173 182
115 3300005353 Ga0070669_100013486 Ga0070669_1000134865 182
116 3300005353 Ga0070669_100045228 Ga0070669_1000452281 182
117 3300005355 Ga0070671_101002923 Ga0070671_1010029231 182
118 3300005356 Ga0070674_100035311 Ga0070674_1000353113 182
119 3300005365 Ga0070688_100399895 Ga0070688_1003998952 182
120 3300005367 Ga0070667_100000074 Ga0070667_100000074116 182
121 3300005367 Ga0070667_100163932 Ga0070667_1001639322 182
122 3300005406 Ga0070703_10018558 Ga0070703_100185583 182
123 3300005434 Ga0070709_10046692 Ga0070709_100466924 182
124 3300005437 Ga0070710_10000625 Ga0070710_1000062516 182
125 3300005437 Ga0070710_10280136 Ga0070710_102801361 182
126 3300005438 Ga0070701_10015906 Ga0070701_100159064 182
127 3300005439 Ga0070711_100000779 Ga0070711_1000007795 182
128 3300005440 Ga0070705_100272374 Ga0070705_1002723742 182
129 3300005441 Ga0070700_100561080 Ga0070700_1005610801 182
130 3300005455 Ga0070663_100045912 Ga0070663_1000459125 182
131 3300005456 Ga0070678_100005866 Ga0070678_1000058668 182
132 3300005457 Ga0070662_100008435 Ga0070662_1000084353 182
133 3300005459 Ga0068867_100033947 Ga0068867_1000339473 182
134 3300005539 Ga0068853_100081495 Ga0068853_1000814954 182
135 3300005544 Ga0070686_100103556 Ga0070686_1001035562 182
136 3300005545 Ga0070695_100026313 Ga0070695_1000263131 182
137 3300005546 Ga0070696_100004591 Ga0070696_10000459110 182
138 3300005548 Ga0070665_100027663 Ga0070665_1000276636 182
139 3300005548 Ga0070665_100098563 Ga0070665_1000985635 182
140 3300005548 Ga0070665_100211452 Ga0070665_1002114522 182
141 3300005549 Ga0070704_100006863 Ga0070704_1000068637 182
142 3300005578 Ga0068854_100004108 Ga0068854_1000041084 182
143 3300005615 Ga0070702_100041727 Ga0070702_1000417274 182
144 3300005616 Ga0068852_100198688 Ga0068852_1001986884 182
145 3300005617 Ga0068859_100001947 Ga0068859_10000194717 182
146 3300005617 Ga0068859_100101969 Ga0068859_1001019692 182
147 3300005618 Ga0068864_100306228 Ga0068864_1003062282 182
148 3300005618 Ga0068864_100707269 Ga0068864_1007072692 182
149 3300005718 Ga0068866_10000713 Ga0068866_1000071316 182
150 3300005719 Ga0068861_100001091 Ga0068861_1000010915 182
151 3300005841 Ga0068863_100038728 Ga0068863_1000387282 182
152 3300005842 Ga0068858_100039329 Ga0068858_1000393298 182
153 3300005842 Ga0068858_100084395 Ga0068858_1000843952 182
154 3300005843 Ga0068860_100000276 Ga0068860_10000027675 182
155 3300005843 Ga0068860_100002734 Ga0068860_10000273420 182
156 3300005844 Ga0068862_100000065 Ga0068862_100000065119 182
157 3300005844 Ga0068862_100001732 Ga0068862_1000017325 182
158 3300006038 Ga0075365_10048243 Ga0075365_100482431 182
159 3300006038 Ga0075365_10193854 Ga0075365_101938542 182
160 3300006048 Ga0075363_100028457 Ga0075363_1000284575 182
161 3300006048 Ga0075363_100101894 Ga0075363_1001018943 182
162 3300006051 Ga0075364_10039301 Ga0075364_100393012 182
163 3300006163 Ga0070715_10232226 Ga0070715_102322262 182
164 3300006173 Ga0070716_100030475 Ga0070716_1000304754 182
165 3300006175 Ga0070712_100000676 Ga0070712_1000006766 182
166 3300006178 Ga0075367_10041162 Ga0075367_100411625 182
167 3300006178 Ga0075367_10293301 Ga0075367_102933012 182
168 3300006186 Ga0075369_10000768 Ga0075369_1000076813 182
169 3300006186 Ga0075369_10050021 Ga0075369_100500212 182
170 3300006186 Ga0075369_10051076 Ga0075369_100510762 182
171 3300006186 Ga0075369_10084056 Ga0075369_100840562 182
172 3300006186 Ga0075369_10250552 Ga0075369_102505521 182
173 3300006237 Ga0097621_100057941 Ga0097621_1000579412 182
174 3300006353 Ga0075370_10181367 Ga0075370_101813671 182
175 3300006353 Ga0075370_10287801 Ga0075370_102878012 182
176 3300006358 Ga0068871_100017304 Ga0068871_1000173042 182
177 3300006846 Ga0075430_100816162 Ga0075430_1008161622 182
178 3300006881 Ga0068865_100001202 Ga0068865_1000012025 182
179 3300006931 Ga0097620_100001947 Ga0097620_10000194717 182
180 3300006931 Ga0097620_100101973 Ga0097620_1001019732 182
181 3300009093 Ga0105240_10203715 Ga0105240_102037151 182
182 3300009098 Ga0105245_10001413 Ga0105245_100014135 182
183 3300009101 Ga0105247_10000017 Ga0105247_100000176 182
184 3300009101 Ga0105247_10001090 Ga0105247_1000109021 182
185 3300009147 Ga0114129_10637912 Ga0114129_106379121 182
186 3300009148 Ga0105243_10011286 Ga0105243_100112868 182
187 3300009174 Ga0105241_10072791 Ga0105241_100727913 182
188 3300009176 Ga0105242_10033473 Ga0105242_100334732 182
189 3300009177 Ga0105248_10000721 Ga0105248_1000072134 182
190 3300009177 Ga0105248_10123599 Ga0105248_101235995 182
191 3300009177 Ga0105248_11646186 Ga0105248_116461861 182
192 3300009545 Ga0105237_10145052 Ga0105237_101450522 182
193 3300009553 Ga0105249_10000096 Ga0105249_100000967 182
194 3300009553 Ga0105249_10068716 Ga0105249_100687166 182
195 3300009553 Ga0105249_10087548 Ga0105249_100875485 182
196 3300009553 Ga0105249_10871059 Ga0105249_108710592 182
197 3300010375 Ga0105239_10023869 Ga0105239_100238697 182
198 3300013296 Ga0157374_10641613 Ga0157374_106416132 182
199 3300013296 Ga0157374_10886677 Ga0157374_108866771 182
200 3300013297 Ga0157378_10034055 Ga0157378_100340552 182
201 3300013306 Ga0163162_10015089 Ga0163162_100150895 182
202 3300013306 Ga0163162_11513702 Ga0163162_115137021 182
203 3300013307 Ga0157372_10015409 Ga0157372_100154094 182
204 3300013307 Ga0157372_10160715 Ga0157372_101607153 182
205 3300013308 Ga0157375_10028052 Ga0157375_100280524 182
206 3300014325 Ga0163163_10006752 Ga0163163_100067521 182
207 3300014326 Ga0157380_10034116 Ga0157380_100341162 182
208 3300014968 Ga0157379_10032279 Ga0157379_100322795 182
209 3300014968 Ga0157379_10063626 Ga0157379_100636266 182
210 3300017792 Ga0163161_10001600 Ga0163161_100016005 182
211 3300025898 Ga0207692_10013505 Ga0207692_100135051 182
212 3300025899 Ga0207642_10000255 Ga0207642_100002558 182
213 3300025900 Ga0207710_10000033 Ga0207710_10000033259 182
214 3300025901 Ga0207688_10079995 Ga0207688_100799952 182
215 3300025903 Ga0207680_10102422 Ga0207680_101024222 182
216 3300025905 Ga0207685_10030557 Ga0207685_100305572 182
217 3300025906 Ga0207699_10010549 Ga0207699_100105493 182
218 3300025907 Ga0207645_10104960 Ga0207645_101049602 182
219 3300025914 Ga0207671_10127778 Ga0207671_101277783 182
220 3300025915 Ga0207693_10006799 Ga0207693_1000679910 182
221 3300025916 Ga0207663_10008390 Ga0207663_100083907 182
222 3300025917 Ga0207660_10281515 Ga0207660_102815152 182
223 3300025923 Ga0207681_10000456 Ga0207681_1000045630 182
224 3300025923 Ga0207681_10081690 Ga0207681_100816904 182
225 3300025927 Ga0207687_10002110 Ga0207687_1000211015 182
226 3300025931 Ga0207644_10011017 Ga0207644_1001101712 182
227 3300025933 Ga0207706_10208647 Ga0207706_102086472 182
228 3300025934 Ga0207686_10020167 Ga0207686_100201677 182
229 3300025936 Ga0207670_10010722 Ga0207670_100107225 182
230 3300025937 Ga0207669_10000192 Ga0207669_1000019213 182
231 3300025938 Ga0207704_10002317 Ga0207704_100023178 182
232 3300025939 Ga0207665_10109923 Ga0207665_101099232 182
233 3300025941 Ga0207711_10009740 Ga0207711_1000974010 182
234 3300025941 Ga0207711_10269492 Ga0207711_102694922 182
235 3300025942 Ga0207689_10143187 Ga0207689_101431872 182
236 3300025960 Ga0207651_10729922 Ga0207651_107299222 182
237 3300025961 Ga0207712_10000005 Ga0207712_10000005264 182
238 3300025961 Ga0207712_10206728 Ga0207712_102067282 182
239 3300025961 Ga0207712_10338889 Ga0207712_103388892 182
240 3300025972 Ga0207668_10000752 Ga0207668_1000075212 182
241 3300025981 Ga0207640_10002625 Ga0207640_100026256 182
242 3300025986 Ga0207658_10000517 Ga0207658_100005177 182
243 3300025986 Ga0207658_10062226 Ga0207658_100622265 182
244 3300025986 Ga0207658_10080843 Ga0207658_100808432 182
245 3300025986 Ga0207658_10399000 Ga0207658_103990002 182
246 3300026023 Ga0207677_10008380 Ga0207677_100083805 182
247 3300026035 Ga0207703_10007479 Ga0207703_100074795 182
248 3300026035 Ga0207703_10028677 Ga0207703_100286775 182
249 3300026041 Ga0207639_10015214 Ga0207639_100152148 182
250 3300026067 Ga0207678_10011571 Ga0207678_100115719 182
251 3300026075 Ga0207708_10048386 Ga0207708_100483862 182
252 3300026088 Ga0207641_10001384 Ga0207641_1000138412 182
253 3300026088 Ga0207641_10119903 Ga0207641_101199033 182
254 3300026088 Ga0207641_10640355 Ga0207641_106403552 182
255 3300026089 Ga0207648_10002256 Ga0207648_100022563 182
256 3300026095 Ga0207676_10292335 Ga0207676_102923352 182
257 3300026095 Ga0207676_10639673 Ga0207676_106396732 182
258 3300026118 Ga0207675_100002064 Ga0207675_1000020643 182
259 3300026121 Ga0207683_10001521 Ga0207683_1000152123 182
260 3300026142 Ga0207698_10610245 Ga0207698_106102452 182
261 3300027866 Ga0209813_10090406 Ga0209813_100904061 182
262 3300028379 Ga0268266_10012998 Ga0268266_100129988 182
263 3300028380 Ga0268265_10000022 Ga0268265_1000002210 182
264 3300028381 Ga0268264_10000005 Ga0268264_10000005260 182
265 3300028381 Ga0268264_10005951 Ga0268264_100059519 182
266 3300031824 Ga0307413_10183061 Ga0307413_101830612 182
267 3300031852 Ga0307410_10249582 Ga0307410_102495822 182
268 3300031995 Ga0307409_100562406 Ga0307409_1005624062 182
269 3300031995 Ga0307409_101048399 Ga0307409_1010483992 182
270 3300032005 Ga0307411_10305562 Ga0307411_103055622 182
271 3300035090 Ga0373949_0034009 Ga0373949_0034009_278_931 182
272 3300035092 Ga0373952_0013839 Ga0373952_0013839_130_783 182
273 3300035242 Ga0373962_0099598 Ga0373962_0099598_123_776 182
274 3300041410 Ga0439461_0014172 Ga0439461_0014172_268_921 182
275 3300041496 Ga0451839_0151690 Ga0451839_0151690_19_672 182
276 3300042002 Ga0439442_013782 Ga0439442_013782_204_857 182
277 3300044683 Ga0466965_0230273 Ga0466965_0230273_104_754 182
278 3300045976 Ga0466967_1135897 Ga0466967_1135897_10_663 182
279 3300046457 Ga0495590_0106347 Ga0495590_0106347_192_845 182
280 3300046492 Ga0495585_0101767 Ga0495585_0101767_867_1520 182
281 3300046524 Ga0495648_0012039 Ga0495648_0012039_5038_5694 182
282 3300046530 Ga0495654_0035358 Ga0495654_0035358_918_1574 182
283 3300046648 Ga0495611_0045012 Ga0495611_0045012_624_1280 182
284 3300046692 Ga0495671_0125209 Ga0495671_0125209_171_827 182
285 3300047320 Ga0495672_0002334 Ga0495672_0002334_7349_8005 182
286 3300047320 Ga0495672_0054180 Ga0495672_0054180_529_1182 182
287 3300047320 Ga0495672_0057053 Ga0495672_0057053_1282_1935 182
288 3300047469 Ga0495673_0000805 Ga0495673_0000805_15216_15872 182
289 3300048903 Ga0496100_0003761 Ga0496100_0003761_2771_3424 182
290 3300048903 Ga0496100_0535105 Ga0496100_0535105_109_762 182
291 3300048904 Ga0496101_0000691 Ga0496101_0000691_3118_3771 182
292 3300048905 Ga0496102_0000415 Ga0496102_0000415_3104_3751 182
293 3300048905 Ga0496102_0000473 Ga0496102_0000473_16031_16684 182
294 3300048905 Ga0496102_0087146 Ga0496102_0087146_199_852 182
295 3300048905 Ga0496102_0103244 Ga0496102_0103244_1917_2570 182
296 3300048905 Ga0496102_0745233 Ga0496102_0745233_83_736 182
297 3300048906 Ga0496103_0000906 Ga0496103_0000906_18396_19043 182
298 3300048906 Ga0496103_0013273 Ga0496103_0013273_2965_3618 182
299 3300048907 Ga0496104_0253820 Ga0496104_0253820_843_1496 182
300 3300048907 Ga0496104_0755116 Ga0496104_0755116_145_798 182
301 3300048908 Ga0496105_0125958 Ga0496105_0125958_20_673 182
302 3300048908 Ga0496105_0520908 Ga0496105_0520908_187_840 182
303 3300048909 Ga0496106_0001016 Ga0496106_0001016_4307_4960 182
304 3300048910 Ga0496107_0016176 Ga0496107_0016176_3537_4190 182
305 3300048910 Ga0496107_0114720 Ga0496107_0114720_654_1301 182
306 3300048911 Ga0496108_0028097 Ga0496108_0028097_1491_2144 182
307 3300048912 Ga0496109_0311753 Ga0496109_0311753_343_996 182
308 3300048913 Ga0496110_0768126 Ga0496110_0768126_29_682 182
309 3300048915 Ga0496112_0028280 Ga0496112_0028280_4414_5067 182
310 3300048915 Ga0496112_0468162 Ga0496112_0468162_390_1043 182
311 3300048916 Ga0496113_0021372 Ga0496113_0021372_32_685 182
312 3300048917 Ga0496114_0000153 Ga0496114_0000153_35453_36106 182
313 3300048918 Ga0496115_0004346 Ga0496115_0004346_9445_10092 182
314 3300048918 Ga0496115_0140640 Ga0496115_0140640_1265_1918 182
315 3300048919 Ga0496116_0026069 Ga0496116_0026069_1113_1760 182
316 3300048919 Ga0496116_0209961 Ga0496116_0209961_276_884 182
317 3300048920 Ga0496117_0174642 Ga0496117_0174642_146_799 182
318 3300048921 Ga0496118_0001365 Ga0496118_0001365_19803_20450 182
319 3300048922 Ga0496119_0018915 Ga0496119_0018915_2056_2703 182
320 3300048923 Ga0496120_0067128 Ga0496120_0067128_1091_1738 182
321 3300048924 Ga0496121_0082139 Ga0496121_0082139_629_1276 182
322 3300048927 Ga0496124_0024263 Ga0496124_0024263_1125_1772 182
323 3300048929 Ga0496126_0005099 Ga0496126_0005099_1567_2214 182
324 3300050490 nmdc:mga03n38_162103_c1 nmdc:mga03n38_162103_c1_120_773 182
325 3300050490 nmdc:mga03n38_1711_c1 nmdc:mga03n38_1711_c1_703_1356 182
326 3300050490 nmdc:mga03n38_90510_c1 nmdc:mga03n38_90510_c1_63_716 182
327 3300050491 nmdc:mga00v17_20801_c1 nmdc:mga00v17_20801_c1_2555_3208 182
328 3300050491 nmdc:mga00v17_306446_c1 nmdc:mga00v17_306446_c1_360_1013 182
329 3300050491 nmdc:mga00v17_333923_c1 nmdc:mga00v17_333923_c1_187_840 182
330 3300050491 nmdc:mga00v17_46427_c1 nmdc:mga00v17_46427_c1_1950_2603 182
331 3300050491 nmdc:mga00v17_53384_c1 nmdc:mga00v17_53384_c1_1376_2029 182
332 3300050492 nmdc:mga0yw44_366089_c1 nmdc:mga0yw44_366089_c1_111_761 182
333 3300050492 nmdc:mga0yw44_38654_c1 nmdc:mga0yw44_38654_c1_117_770 182
334 3300050492 nmdc:mga0yw44_57995_c1 nmdc:mga0yw44_57995_c1_1665_2318 182
335 3300050492 nmdc:mga0yw44_62695_c1 nmdc:mga0yw44_62695_c1_1550_2203 182
336 3300050494 nmdc:mga06z11_88551_c1 nmdc:mga06z11_88551_c1_282_935 182
337 3300050496 nmdc:mga07m45_179374_c1 nmdc:mga07m45_179374_c1_551_1204 182
338 3300050496 nmdc:mga07m45_36992_c1 nmdc:mga07m45_36992_c1_1001_1654 182
339 3300050509 nmdc:mga0qj67_73060_c1 nmdc:mga0qj67_73060_c1_1053_1706 182
340 3300050516 nmdc:mga0sz30_3448_c1 nmdc:mga0sz30_3448_c1_136_789 182
341 3300050516 nmdc:mga0sz30_50890_c1 nmdc:mga0sz30_50890_c1_969_1622 182
342 3300050516 nmdc:mga0sz30_9944_c1 nmdc:mga0sz30_9944_c1_1168_1818 182
343 3300053090 Ga0500646_0040691 Ga0500646_0040691_503_1150 182
344 3300005435 Ga0070714_100028790 Ga0070714_1000287905 183
345 3300025929 Ga0207664_10104628 Ga0207664_101046284 183
346 3300041491 Ga0451833_1420425 Ga0451833_1420425_116_772 183
347 3300059605 Ga0587106_024612 Ga0587106_024612_218_889 183
348 3300041491 Ga0451833_0930245 Ga0451833_0930245_125_805 184
349 3300044706 Ga0466964_0125217 Ga0466964_0125217_11_655 184
350 3300049129 Ga0501309_004756 Ga0501309_004756_251_922 184
351 3300005937 Ga0081455_10009428 Ga0081455_100094283 185
352 3300031456 Ga0307513_10000001 Ga0307513_10000001754 185
353 3300031548 Ga0307408_100568448 Ga0307408_1005684482 185
354 3300031665 Ga0316575_10029870 Ga0316575_100298702 185
355 3300031691 Ga0316579_10017900 Ga0316579_100179001 185
356 3300031727 Ga0316576_10060416 Ga0316576_100604163 185
357 3300031728 Ga0316578_10209206 Ga0316578_102092062 185
358 3300031733 Ga0316577_10333461 Ga0316577_103334612 185
359 3300032004 Ga0307414_10675625 Ga0307414_106756252 185
360 3300033524 Ga0316592_1018804 Ga0316592_10188043 185
361 3300033528 Ga0316588_1099128 Ga0316588_10991281 185
362 3300033541 Ga0316596_1011082 Ga0316596_10110824 185
363 3300035398 Ga0316574_0001480 Ga0316574_0001480_4007_4663 185
364 3300036647 Ga0316582_0098538 Ga0316582_0098538_1233_1889 185
365 3300036712 Ga0316584_0065499 Ga0316584_0065499_162_818 185
366 3300037466 Ga0395898_0468312 Ga0395898_0468312_220_870 185
367 3300038443 Ga0395901_0338158 Ga0395901_0338158_24_674 185
368 3300044683 Ga0466965_0126491 Ga0466965_0126491_551_1201 185
369 3300044684 Ga0466966_0080967 Ga0466966_0080967_1142_1792 185
370 3300044693 Ga0466961_0154795 Ga0466961_0154795_156_806 185
371 3300044765 Ga0466970_0157007 Ga0466970_0157007_339_989 185
372 3300044842 Ga0466957_0129558 Ga0466957_0129558_497_1147 185
373 3300044901 Ga0466960_0175939 Ga0466960_0175939_181_831 185
374 3300044901 Ga0466960_0292990 Ga0466960_0292990_233_889 185
375 3300045836 Ga0466958_0325999 Ga0466958_0325999_144_800 185
376 3300049127 Ga0501306_007769 Ga0501306_007769_361_1011 185
377 3300049128 Ga0501308_001262 Ga0501308_001262_201_851 185
378 3300049161 Ga0501305_003255 Ga0501305_003255_654_1304 185
379 3300049527 Ga0501311_014200 Ga0501311_014200_328_978 185
380 3300049532 Ga0501316_001281 Ga0501316_001281_1108_1758 185
381 3300049534 Ga0501318_000622 Ga0501318_000622_1072_1722 185
382 3300049537 Ga0501321_014497 Ga0501321_014497_26_682 185
383 3300059477 Ga0587084_009923 Ga0587084_009923_281_931 185
384 3300059478 Ga0587093_004188 Ga0587093_004188_171_821 185
385 3300059491 Ga0587070_035544 Ga0587070_035544_110_760 185
386 3300059508 Ga0587088_029575 Ga0587088_029575_50_700 185
387 3300059512 Ga0587092_011416 Ga0587092_011416_204_854 185
388 3300059605 Ga0587106_024093 Ga0587106_024093_184_834 185
389 3300059607 Ga0587125_018228 Ga0587125_018228_80_736 185
390 3300059622 Ga0587099_008267 Ga0587099_008267_195_845 185
391 3300059623 Ga0587101_008779 Ga0587101_008779_273_923 185
392 3300059624 Ga0587109_041569 Ga0587109_041569_118_768 185
393 3300059627 Ga0587117_013196 Ga0587117_013196_96_746 185
394 3300059628 Ga0587122_009649 Ga0587122_009649_62_712 185
395 3300059639 Ga0587062_006343 Ga0587062_006343_344_994 185
396 3300059643 Ga0587072_018139 Ga0587072_018139_262_912 185
397 3300059644 Ga0587075_003565 Ga0587075_003565_788_1438 185
398 3300059647 Ga0587079_009278 Ga0587079_009278_631_1281 185
399 3300059648 Ga0587100_001887 Ga0587100_001887_171_821 185
400 3300059649 Ga0587102_011562 Ga0587102_011562_75_725 185
401 3300059652 Ga0587107_013837 Ga0587107_013837_71_721 185
402 3300060346 Ga0587111_0050936 Ga0587111_0050936_195_845 185
403 3300031824 Ga0307413_10085143 Ga0307413_100851434 186
404 3300031903 Ga0307407_10059858 Ga0307407_100598584 186
405 3300031911 Ga0307412_10357771 Ga0307412_103577712 186
406 3300031995 Ga0307409_100267210 Ga0307409_1002672102 186
407 3300032002 Ga0307416_100160395 Ga0307416_1001603952 186
408 3300032004 Ga0307414_10172679 Ga0307414_101726792 186
409 3300032126 Ga0307415_100138218 Ga0307415_1001382182 186
410 3300044656 Ga0466969_0262021 Ga0466969_0262021_59_718 186
411 3300044658 Ga0466972_0007943 Ga0466972_0007943_1321_1980 186
412 3300044683 Ga0466965_0010425 Ga0466965_0010425_2964_3623 186
413 3300044684 Ga0466966_0279288 Ga0466966_0279288_161_817 186
414 3300044693 Ga0466961_0014059 Ga0466961_0014059_3143_3802 186
415 3300044719 Ga0466971_0030753 Ga0466971_0030753_1619_2278 186
416 3300044765 Ga0466970_0015597 Ga0466970_0015597_2925_3584 186
417 3300044842 Ga0466957_0040100 Ga0466957_0040100_1727_2386 186
418 3300044901 Ga0466960_0213028 Ga0466960_0213028_305_961 186
419 3300044901 Ga0466960_0380090 Ga0466960_0380090_84_743 186
420 3300045836 Ga0466958_0035085 Ga0466958_0035085_1038_1697 186
421 3300045976 Ga0466967_0013542 Ga0466967_0013542_1429_2088 186
422 3300061719 Ga0466962_0047571 Ga0466962_0047571_1284_1943 186
423 3300006048 Ga0075363_100426947 Ga0075363_1004269472 187
424 3300006051 Ga0075364_10030032 Ga0075364_100300324 187
425 3300006177 Ga0075362_10138969 Ga0075362_101389692 187
426 3300009094 Ga0111539_10754164 Ga0111539_107541642 187
427 3300017792 Ga0163161_10479832 Ga0163161_104798322 187
428 3300020069 Ga0197907_11372859 Ga0197907_113728592 187
429 3300020081 Ga0206354_10027635 Ga0206354_100276351 187
430 3300020082 Ga0206353_10868606 Ga0206353_108686062 187
431 3300031903 Ga0307407_10102065 Ga0307407_101020652 187
432 3300041459 Ga0451800_1651231 Ga0451800_1651231_113_772 187
433 3300041494 Ga0451837_1540429 Ga0451837_1540429_826_1485 187
434 3300041512 Ga0451853_1178819 Ga0451853_1178819_1379_2038 187
435 3300044765 Ga0466970_0041257 Ga0466970_0041257_245_901 187
436 3300049162 Ga0501307_005562 Ga0501307_005562_37_699 187
437 3300049575 Ga0501039_0193911 Ga0501039_0193911_228_890 187
438 3300049576 Ga0501040_0106687 Ga0501040_0106687_929_1591 187
439 3300049577 Ga0501041_0188567 Ga0501041_0188567_86_748 187
440 3300049578 Ga0501042_0094733 Ga0501042_0094733_179_841 187
441 3300049582 Ga0501048_0357014 Ga0501048_0357014_150_812 187
442 3300049583 Ga0501067_0018448 Ga0501067_0018448_963_1622 187
443 3300049588 Ga0501072_0402708 Ga0501072_0402708_216_878 187
444 3300049592 Ga0501076_0338603 Ga0501076_0338603_106_768 187
445 3300050489 nmdc:mga03683_45975_c1 nmdc:mga03683_45975_c1_331_996 187
446 3300050491 nmdc:mga00v17_21448_c1 nmdc:mga00v17_21448_c1_1194_1859 187
447 3300050496 nmdc:mga07m45_68362_c1 nmdc:mga07m45_68362_c1_632_1297 187
448 3300050511 nmdc:mga08y16_525368_c1 nmdc:mga08y16_525368_c1_376_1038 187
449 3300000041 ARcpr5oldR_c004908 ARcpr5oldR_0049082 188
450 3300000041 ARcpr5oldR_c008025 ARcpr5oldR_0080252 188
451 3300004800 Ga0058861_10027554 Ga0058861_100275542 188
452 3300004800 Ga0058861_10146493 Ga0058861_101464932 188
453 3300005327 Ga0070658_10070042 Ga0070658_100700424 188
454 3300005327 Ga0070658_10242846 Ga0070658_102428462 188
455 3300005329 Ga0070683_100012063 Ga0070683_1000120632 188
456 3300005329 Ga0070683_100055375 Ga0070683_1000553753 188
457 3300005329 Ga0070683_100182428 Ga0070683_1001824282 188
458 3300005337 Ga0070682_100123028 Ga0070682_1001230282 188
459 3300005337 Ga0070682_100425257 Ga0070682_1004252572 188
460 3300005339 Ga0070660_100599957 Ga0070660_1005999571 188
461 3300005340 Ga0070689_100496566 Ga0070689_1004965662 188
462 3300005366 Ga0070659_100065286 Ga0070659_1000652864 188
463 3300005367 Ga0070667_100643728 Ga0070667_1006437281 188
464 3300005440 Ga0070705_100262635 Ga0070705_1002626352 188
465 3300005455 Ga0070663_100495390 Ga0070663_1004953902 188
466 3300005535 Ga0070684_100139275 Ga0070684_1001392753 188
467 3300005548 Ga0070665_100247063 Ga0070665_1002470632 188
468 3300005563 Ga0068855_100115656 Ga0068855_1001156562 188
469 3300005564 Ga0070664_100029753 Ga0070664_1000297531 188
470 3300005564 Ga0070664_100266001 Ga0070664_1002660012 188
471 3300005614 Ga0068856_100359438 Ga0068856_1003594382 188
472 3300005843 Ga0068860_100132625 Ga0068860_1001326252 188
473 3300006881 Ga0068865_100018320 Ga0068865_1000183202 188
474 3300006914 Ga0075436_100602186 Ga0075436_1006021862 188
475 3300009148 Ga0105243_10620823 Ga0105243_106208232 188
476 3300009177 Ga0105248_10638408 Ga0105248_106384082 188
477 3300009545 Ga0105237_10555823 Ga0105237_105558232 188
478 3300009553 Ga0105249_11648003 Ga0105249_116480031 188
479 3300010375 Ga0105239_10020346 Ga0105239_100203467 188
480 3300010375 Ga0105239_10070207 Ga0105239_100702076 188
481 3300011119 Ga0105246_10056393 Ga0105246_100563934 188
482 3300013105 Ga0157369_10646799 Ga0157369_106467992 188
483 3300014325 Ga0163163_10532098 Ga0163163_105320981 188
484 3300020069 Ga0197907_10411015 Ga0197907_104110152 188
485 3300020069 Ga0197907_10657930 Ga0197907_106579301 188
486 3300020070 Ga0206356_10222980 Ga0206356_102229802 188
487 3300020070 Ga0206356_10674529 Ga0206356_106745292 188
488 3300020070 Ga0206356_11070515 Ga0206356_110705151 188
489 3300020075 Ga0206349_1383707 Ga0206349_13837072 188
490 3300020075 Ga0206349_1385645 Ga0206349_13856451 188
491 3300020075 Ga0206349_1856980 Ga0206349_18569802 188
492 3300020076 Ga0206355_1085941 Ga0206355_10859412 188
493 3300020076 Ga0206355_1389932 Ga0206355_13899324 188
494 3300020076 Ga0206355_1722261 Ga0206355_17222612 188
495 3300020077 Ga0206351_10216479 Ga0206351_102164792 188
496 3300020078 Ga0206352_10436074 Ga0206352_104360742 188
497 3300020080 Ga0206350_11629593 Ga0206350_116295932 188
498 3300020081 Ga0206354_10163218 Ga0206354_101632182 188
499 3300020082 Ga0206353_10876636 Ga0206353_108766362 188
500 3300020082 Ga0206353_11714178 Ga0206353_117141782 188
501 3300020610 Ga0154015_1488494 Ga0154015_14884943 188
502 3300021384 Ga0213876_10116052 Ga0213876_101160522 188
503 3300022467 Ga0224712_10076882 Ga0224712_100768822 188
504 3300025901 Ga0207688_10190974 Ga0207688_101909742 188
505 3300025901 Ga0207688_10278208 Ga0207688_102782082 188
506 3300025909 Ga0207705_10251390 Ga0207705_102513902 188
507 3300025909 Ga0207705_10394563 Ga0207705_103945632 188
508 3300025919 Ga0207657_10406817 Ga0207657_104068172 188
509 3300025920 Ga0207649_10434486 Ga0207649_104344861 188
510 3300025921 Ga0207652_10118242 Ga0207652_101182423 188
511 3300025927 Ga0207687_10052326 Ga0207687_100523262 188
512 3300025936 Ga0207670_10530134 Ga0207670_105301342 188
513 3300025941 Ga0207711_10471905 Ga0207711_104719052 188
514 3300025944 Ga0207661_10017317 Ga0207661_100173173 188
515 3300025944 Ga0207661_10060501 Ga0207661_100605012 188
516 3300025944 Ga0207661_10068581 Ga0207661_100685814 188
517 3300025944 Ga0207661_10188638 Ga0207661_101886382 188
518 3300025945 Ga0207679_10087528 Ga0207679_100875284 188
519 3300025949 Ga0207667_10106388 Ga0207667_101063883 188
520 3300025986 Ga0207658_10108439 Ga0207658_101084392 188
521 3300026035 Ga0207703_10067219 Ga0207703_100672192 188
522 3300026067 Ga0207678_10473257 Ga0207678_104732572 188
523 3300026075 Ga0207708_10640998 Ga0207708_106409982 188
524 3300026095 Ga0207676_10451290 Ga0207676_104512902 188
525 3300026116 Ga0207674_10131631 Ga0207674_101316312 188
526 3300028381 Ga0268264_10126961 Ga0268264_101269614 188
527 3300030521 Ga0307511_10056191 Ga0307511_100561912 188
528 3300030732 Ga0316176_1120777 Ga0316176_11207773 188
529 3300030742 Ga0316183_1035066 Ga0316183_10350661 188
530 3300031852 Ga0307410_10599975 Ga0307410_105999751 188
531 3300032126 Ga0307415_100400896 Ga0307415_1004008962 188
532 3300034819 Ga0373958_0021254 Ga0373958_0021254_77_745 188
533 3300035241 Ga0373961_0096863 Ga0373961_0096863_180_848 188
534 3300035691 Ga0373931_0166372 Ga0373931_0166372_329_997 188
535 3300037466 Ga0395898_0181056 Ga0395898_0181056_900_1568 188
536 3300038996 Ga0242420_017563 Ga0242420_017563_59_727 188
537 3300039437 Ga0436365_1912815 Ga0436365_1912815_341_1003 188
538 3300041404 Ga0439436_0017852 Ga0439436_0017852_465_1112 188
539 3300041405 Ga0439438_052351 Ga0439438_052351_41_688 188
540 3300041406 Ga0439439_0001664 Ga0439439_0001664_3328_3975 188
541 3300041411 Ga0439466_0052307 Ga0439466_0052307_377_1024 188
542 3300042002 Ga0439442_041753 Ga0439442_041753_62_709 188
543 3300042005 Ga0439448_0090578 Ga0439448_0090578_175_834 188
544 3300042007 Ga0439449_0063432 Ga0439449_0063432_649_1296 188
545 3300042014 Ga0439457_002215 Ga0439457_002215_832_1479 188
546 3300042184 Ga0450908_020399 Ga0450908_020399_415_1062 188
547 3300044683 Ga0466965_0139494 Ga0466965_0139494_200_862 188
548 3300044694 Ga0466963_0049053 Ga0466963_0049053_1920_2582 188
549 3300044842 Ga0466957_0258112 Ga0466957_0258112_209_874 188
550 3300044901 Ga0466960_0046852 Ga0466960_0046852_420_1115 188
551 3300044901 Ga0466960_0060274 Ga0466960_0060274_1012_1674 188
552 3300044901 Ga0466960_0095993 Ga0466960_0095993_131_802 188
553 3300044901 Ga0466960_0115977 Ga0466960_0115977_163_822 188
554 3300045976 Ga0466967_0005418 Ga0466967_0005418_1518_2180 188
555 3300045976 Ga0466967_0031836 Ga0466967_0031836_659_1321 188
556 3300045976 Ga0466967_0082261 Ga0466967_0082261_1826_2488 188
557 3300045976 Ga0466967_0149309 Ga0466967_0149309_1184_1846 188
558 3300045976 Ga0466967_0180952 Ga0466967_0180952_1179_1841 188
559 3300045976 Ga0466967_0194515 Ga0466967_0194515_835_1509 188
560 3300045976 Ga0466967_0531400 Ga0466967_0531400_222_881 188
561 3300045976 Ga0466967_0543790 Ga0466967_0543790_240_935 188
562 3300046473 Ga0495582_0137551 Ga0495582_0137551_224_886 188
563 3300046683 Ga0495658_0349217 Ga0495658_0349217_148_810 188
564 3300047321 Ga0495676_0097315 Ga0495676_0097315_964_1626 188
565 3300047673 Ga0495593_0112535 Ga0495593_0112535_601_1263 188
566 3300048905 Ga0496102_0004268 Ga0496102_0004268_3699_4367 188
567 3300048906 Ga0496103_0002413 Ga0496103_0002413_2498_3166 188
568 3300048906 Ga0496103_0116562 Ga0496103_0116562_201_863 188
569 3300048907 Ga0496104_0042002 Ga0496104_0042002_839_1507 188
570 3300048908 Ga0496105_0267499 Ga0496105_0267499_211_879 188
571 3300048909 Ga0496106_0005923 Ga0496106_0005923_4724_5392 188
572 3300048911 Ga0496108_0263958 Ga0496108_0263958_434_1102 188
573 3300048912 Ga0496109_0058601 Ga0496109_0058601_1142_1810 188
574 3300048912 Ga0496109_0287633 Ga0496109_0287633_252_914 188
575 3300048912 Ga0496109_0502992 Ga0496109_0502992_330_989 188
576 3300048913 Ga0496110_0002566 Ga0496110_0002566_12762_13424 188
577 3300048913 Ga0496110_0003020 Ga0496110_0003020_3511_4179 188
578 3300048914 Ga0496111_0021913 Ga0496111_0021913_691_1359 188
579 3300048914 Ga0496111_0176614 Ga0496111_0176614_741_1403 188
580 3300048915 Ga0496112_0186348 Ga0496112_0186348_860_1528 188
581 3300048917 Ga0496114_0107141 Ga0496114_0107141_1574_2242 188
582 3300049127 Ga0501306_013397 Ga0501306_013397_259_936 188
583 3300049128 Ga0501308_009318 Ga0501308_009318_328_1002 188
584 3300049130 Ga0501310_021008 Ga0501310_021008_65_748 188
585 3300049160 Ga0501304_002286 Ga0501304_002286_530_1195 188
586 3300049527 Ga0501311_004092 Ga0501311_004092_60_725 188
587 3300049529 Ga0501313_019064 Ga0501313_019064_132_809 188
588 3300049532 Ga0501316_000783 Ga0501316_000783_403_1068 188
589 3300049533 Ga0501317_000435 Ga0501317_000435_636_1301 188
590 3300049533 Ga0501317_015612 Ga0501317_015612_175_840 188
591 3300049534 Ga0501318_004378 Ga0501318_004378_339_1004 188
592 3300049534 Ga0501318_006608 Ga0501318_006608_376_1041 188
593 3300049534 Ga0501318_013676 Ga0501318_013676_197_862 188
594 3300049534 Ga0501318_014478 Ga0501318_014478_74_739 188
595 3300049537 Ga0501321_000446 Ga0501321_000446_630_1295 188
596 3300049571 Ga0501034_0365623 Ga0501034_0365623_362_1021 188
597 3300049572 Ga0501036_0089550 Ga0501036_0089550_1857_2522 188
598 3300049575 Ga0501039_0349800 Ga0501039_0349800_275_940 188
599 3300049575 Ga0501039_0450267 Ga0501039_0450267_155_820 188
600 3300049575 Ga0501039_0685713 Ga0501039_0685713_75_740 188
601 3300049575 Ga0501039_0793613 Ga0501039_0793613_56_727 188
602 3300049576 Ga0501040_0047321 Ga0501040_0047321_708_1370 188
603 3300049576 Ga0501040_0274266 Ga0501040_0274266_378_1043 188
604 3300049577 Ga0501041_0239630 Ga0501041_0239630_345_1010 188
605 3300049578 Ga0501042_0166457 Ga0501042_0166457_136_801 188
606 3300049578 Ga0501042_0347868 Ga0501042_0347868_117_782 188
607 3300049579 Ga0501043_0668646 Ga0501043_0668646_19_684 188
608 3300049580 Ga0501046_0282482 Ga0501046_0282482_431_1093 188
609 3300049581 Ga0501047_0674618 Ga0501047_0674618_90_764 188
610 3300049583 Ga0501067_0047395 Ga0501067_0047395_1553_2215 188
611 3300049583 Ga0501067_0056320 Ga0501067_0056320_537_1205 188
612 3300049584 Ga0501068_0005522 Ga0501068_0005522_5164_5826 188
613 3300049585 Ga0501069_0143732 Ga0501069_0143732_321_995 188
614 3300049586 Ga0501070_0012735 Ga0501070_0012735_5322_5996 188
615 3300049586 Ga0501070_0051285 Ga0501070_0051285_2567_3229 188
616 3300049587 Ga0501071_0473734 Ga0501071_0473734_147_809 188
617 3300049587 Ga0501071_0641317 Ga0501071_0641317_55_729 188
618 3300049588 Ga0501072_0020572 Ga0501072_0020572_499_1161 188
619 3300049589 Ga0501073_0009585 Ga0501073_0009585_1553_2215 188
620 3300049590 Ga0501074_0012602 Ga0501074_0012602_408_1070 188
621 3300049590 Ga0501074_0289478 Ga0501074_0289478_149_829 188
622 3300049590 Ga0501074_0368651 Ga0501074_0368651_138_803 188
623 3300049593 Ga0501077_0052062 Ga0501077_0052062_1383_2045 188
624 3300049593 Ga0501077_0518364 Ga0501077_0518364_91_750 188
625 3300049741 Ga0501079_0182081 Ga0501079_0182081_638_1312 188
626 3300049741 Ga0501079_0247014 Ga0501079_0247014_242_904 188
627 3300049741 Ga0501079_0458501 Ga0501079_0458501_311_973 188
628 3300049742 Ga0501080_0161166 Ga0501080_0161166_174_836 188
629 3300049743 Ga0501081_0314113 Ga0501081_0314113_266_931 188
630 3300049744 Ga0501083_0060051 Ga0501083_0060051_278_940 188
631 3300049823 Ga0501044_0254784 Ga0501044_0254784_322_987 188
632 3300049824 Ga0501045_0059228 Ga0501045_0059228_1064_1729 188
633 3300049824 Ga0501045_0161508 Ga0501045_0161508_485_1147 188
634 3300049824 Ga0501045_0646918 Ga0501045_0646918_42_707 188
635 3300053085 Ga0495619_0239729 Ga0495619_0239729_325_984 188
636 3300054114 Ga0501084_0081326 Ga0501084_0081326_45_707 188
637 3300054114 Ga0501084_0390289 Ga0501084_0390289_299_964 188
638 3300054114 Ga0501084_0480212 Ga0501084_0480212_163_828 188
639 3300059492 Ga0587073_0026157 Ga0587073_0026157_39_698 188
640 3300059492 Ga0587073_0035387 Ga0587073_0035387_330_989 188
641 3300059630 Ga0587128_012632 Ga0587128_012632_291_953 188
642 3300059651 Ga0587105_004755 Ga0587105_004755_90_752 188
643 3300059652 Ga0587107_005072 Ga0587107_005072_80_739 188
644 3300059652 Ga0587107_014561 Ga0587107_014561_309_971 188
645 3300059658 Ga0587119_020478 Ga0587119_020478_89_748 188
646 3300060344 Ga0587071_027839 Ga0587071_027839_318_980 188
647 3300060346 Ga0587111_0002748 Ga0587111_0002748_1140_1799 188
648 3300060353 Ga0501082_0003723 Ga0501082_0003723_196_858 188
649 3300061734 Ga0530510_0228964 Ga0530510_0228964_308_976 188
650 3300061734 Ga0530510_0415616 Ga0530510_0415616_40_705 188

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8278 7 187
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8252 6 182
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8134 7 187
6ppf-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class b 0.8076 6 185
6ppf-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class b 0.803 6 185
ID Description Score Start End Superfamily
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9103 37 100 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8943 37 97 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8811 37 97 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.863 37 100 3.30.160.810
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8603 37 100 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A087B7P6-F1-model_v4 deleted 0.9302 1 106
AF-A0A845Y1H4-F1-model_v4 50S ribosomal protein L3 0.9179 6 107 GO:0003735
GO:0006412
GO:0022625
AF-A0A6P0ZZ13-F1-model_v4 50S ribosomal protein L3 0.892 6 101 GO:0003735
GO:0006412
GO:0022625
AF-A0A2D7RYG7-F1-model_v4 50S ribosomal protein L3 0.8914 6 98 GO:0003735
GO:0006412
GO:0022625
AF-A0A485AH68-F1-model_v4 50S ribosomal protein L3 0.8871 4 104 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
75.98 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map