F469923
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 620 | 373 | 570 | 494 |
Family's Representative Sequence
| Representative Sequence | 3300031665|Ga0316575_10013846|Ga0316575_100138463 |
| Length | 515 |
| Sequence | MTELDFDKLAKQGYTRIPVVAEVRADLYTPLAVYAKLANAPYSYLLESVVGGERFGRYSFIGLACAERIEARGSTVRRLLRDARGADVCLERLDDADPFEYVRSYLKRHRVAPVPAALRFGGGLVGYFGYETVGHIESRVLSGDKPDPLGTPDMLLLVSDELAVVDNVMGKLYLVVYADPQQPDAYRAASERLERLRARLLTPLPDSMVLALAVETPAGEPAPLSRTFTEEGFLEAVRRSKEYIFAGDCMQVQISQRTTRSFEAPPLTLYRALRGLNPSPYMFYFDFGDHHVVGASPEIMVRLAGDAITLRPIAGTRPRGRTEEEDARAAEDLLSDPKERAEHVMLIDLGRNDAGRVAAIGSVRVTEKMVIERYSHVMHIVSNVEARIAPGLDAIDVFKASFPAGTVSGAPKVRAMEIIDELEPVKRGVYSGAVGYLGFNGDMDVAIAIRTAVVKDGLLHVQAAAGIVADSDPQSEWQETQHKARAILRAAEVAAAEHASGAGVAQAAAPRSATR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 5 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 6 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 7 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 8 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 9 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 10 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 11 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 12 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 13 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 14 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 15 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 16 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 17 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 18 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 19 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 20 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 21 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 22 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 23 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 24 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 25 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 26 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 27 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 28 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 29 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 30 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 31 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 32 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 33 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 34 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 35 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 36 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 37 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 38 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 39 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 40 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 41 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 42 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 43 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 44 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 45 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 46 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 47 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 48 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 49 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 50 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 51 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 52 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 60 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 61 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 68 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 70 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 82 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 94 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 109 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 110 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 113 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 114 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 115 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 152 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 224 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 227 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 229 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 235 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 238 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 239 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 247 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 248 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 249 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 259 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 260 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 261 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 262 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 263 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 264 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 265 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 266 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 267 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 268 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 269 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 270 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 271 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 274 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 275 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 276 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 277 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 278 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 279 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 280 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 281 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 282 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 324 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 325 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 326 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 327 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 328 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 329 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 330 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 331 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 332 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 333 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 346 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 364 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 366 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 369 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 370 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 371 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 372 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 373 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.13 |
| Metatranscriptomes | 0.81 |
| Isolates | 8.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.48 |
| Bulb | 0 |
| Endosphere | 5.81 |
| Nodule | 0.16 |
| Rhizoplane | 1.61 |
| Rhizosphere | 80.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000154 | 3300001915 | Bacteria | 19576 |
| 2 | JGI24741J21665_1000493 | 3300001915 | Bacteria | 12078 |
| 3 | JGI24740J21852_10000918 | 3300001979 | Bacteria | 13085 |
| 4 | JGI24740J21852_10001089 | 3300001979 | Bacteria | 12273 |
| 5 | JGI24739J22299_10000294 | 3300001989 | Bacteria | 16860 |
| 6 | JGI24739J22299_10007399 | 3300001989 | Bacteria | 4121 |
| 7 | JGI24737J22298_10000124 | 3300001990 | Bacteria | 23444 |
| 8 | JGI24737J22298_10000623 | 3300001990 | Bacteria | 12472 |
| 9 | JGI24737J22298_10002339 | 3300001990 | Bacteria | 6758 |
| 10 | JGI25162J39368_1000324 | 3300002737 | Bacteria | 41886 |
| 11 | JGI25153J46596_10000002 | 3300003215 | Bacteria | 653569 |
| 12 | Ga0055525_1000051 | 3300003759 | Bacteria | 240942 |
| 13 | Ga0055542_1000020 | 3300003762 | Bacteria | 335745 |
| 14 | Ga0055529_1000016 | 3300003763 | Bacteria | 364775 |
| 15 | Ga0055526_1010786 | 3300003771 | Bacteria | 4206 |
| 16 | Ga0055537_1000149 | 3300003773 | Bacteria | 52269 |
| 17 | Ga0055536_1000957 | 3300003781 | Bacteria | 18468 |
| 18 | Ga0055534_1000968 | 3300003784 | Bacteria | 12749 |
| 19 | Ga0058692_1000004 | 3300003856 | Bacteria | 431119 |
| 20 | Ga0058692_1000049 | 3300003856 | Bacteria | 108875 |
| 21 | Ga0065165_1005025 | 3300005262 | Bacteria | 7733 |
| 22 | Ga0065704_10073361 | 3300005289 | Bacteria | 7250 |
| 23 | Ga0065707_10084402 | 3300005295 | Bacteria | 7235 |
| 24 | Ga0070658_10003444 | 3300005327 | Bacteria | 13007 |
| 25 | Ga0070676_10031406 | 3300005328 | Bacteria | 3035 |
| 26 | Ga0070676_10049319 | 3300005328 | Bacteria | 2464 |
| 27 | Ga0070690_100001405 | 3300005330 | Bacteria | 12568 |
| 28 | Ga0070690_100043432 | 3300005330 | Bacteria | 2850 |
| 29 | Ga0070670_100000068 | 3300005331 | Bacteria | 106494 |
| 30 | Ga0070670_100000924 | 3300005331 | Bacteria | 23062 |
| 31 | Ga0070670_100032784 | 3300005331 | Bacteria | 4475 |
| 32 | Ga0068869_100000144 | 3300005334 | Bacteria | 35078 |
| 33 | Ga0068869_100032962 | 3300005334 | Bacteria | 3654 |
| 34 | Ga0070680_100006357 | 3300005336 | Bacteria | 8973 |
| 35 | Ga0068868_100003765 | 3300005338 | Bacteria | 10594 |
| 36 | Ga0070660_100010649 | 3300005339 | Bacteria | 6503 |
| 37 | Ga0070660_100086270 | 3300005339 | Bacteria | 2470 |
| 38 | Ga0070689_100002042 | 3300005340 | Bacteria | 13097 |
| 39 | Ga0070689_100044734 | 3300005340 | Bacteria | 3406 |
| 40 | Ga0070689_100146099 | 3300005340 | Bacteria | 1905 |
| 41 | Ga0070691_10002693 | 3300005341 | Bacteria | 7914 |
| 42 | Ga0070687_100000379 | 3300005343 | Bacteria | 15209 |
| 43 | Ga0070687_100054640 | 3300005343 | Bacteria | 2082 |
| 44 | Ga0070661_100004499 | 3300005344 | Bacteria | 9602 |
| 45 | Ga0070692_10001458 | 3300005345 | Bacteria | 8600 |
| 46 | Ga0070668_100031585 | 3300005347 | Bacteria | 4029 |
| 47 | Ga0070668_100037898 | 3300005347 | Bacteria | 3683 |
| 48 | Ga0070669_100008869 | 3300005353 | Bacteria | 7175 |
| 49 | Ga0070669_100107301 | 3300005353 | Bacteria | 2115 |
| 50 | Ga0070675_100033120 | 3300005354 | Bacteria | 4186 |
| 51 | Ga0070674_100000740 | 3300005356 | Bacteria | 16717 |
| 52 | Ga0070673_100056160 | 3300005364 | Bacteria | 3105 |
| 53 | Ga0070688_100027873 | 3300005365 | Bacteria | 3366 |
| 54 | Ga0070659_100006389 | 3300005366 | Bacteria | 8509 |
| 55 | Ga0070667_100000951 | 3300005367 | Bacteria | 26620 |
| 56 | Ga0070667_100172988 | 3300005367 | Bacteria | 1907 |
| 57 | Ga0070703_10015864 | 3300005406 | Bacteria | 2159 |
| 58 | Ga0070703_10016875 | 3300005406 | Bacteria | 2100 |
| 59 | Ga0070701_10004456 | 3300005438 | Bacteria | 5677 |
| 60 | Ga0070705_100001733 | 3300005440 | Bacteria | 11345 |
| 61 | Ga0070700_100001920 | 3300005441 | Bacteria | 10508 |
| 62 | Ga0070700_100002243 | 3300005441 | Bacteria | 9838 |
| 63 | Ga0070694_100002837 | 3300005444 | Bacteria | 10295 |
| 64 | Ga0070694_100011846 | 3300005444 | Bacteria | 5408 |
| 65 | Ga0070678_100000011 | 3300005456 | Bacteria | 57959 |
| 66 | Ga0070662_100047361 | 3300005457 | Bacteria | 3092 |
| 67 | Ga0068867_100000755 | 3300005459 | Bacteria | 21746 |
| 68 | Ga0068867_100001723 | 3300005459 | Bacteria | 15236 |
| 69 | Ga0070699_100021479 | 3300005518 | Bacteria | 5566 |
| 70 | Ga0070679_100010182 | 3300005530 | Bacteria | 8911 |
| 71 | Ga0070684_100059440 | 3300005535 | Bacteria | 3342 |
| 72 | Ga0070697_100003127 | 3300005536 | Bacteria | 12721 |
| 73 | Ga0070697_100014791 | 3300005536 | Bacteria | 6124 |
| 74 | Ga0070686_100000491 | 3300005544 | Bacteria | 23894 |
| 75 | Ga0070686_100010900 | 3300005544 | Bacteria | 5145 |
| 76 | Ga0070695_100000326 | 3300005545 | Bacteria | 24442 |
| 77 | Ga0070695_100008154 | 3300005545 | Bacteria | 6207 |
| 78 | Ga0070696_100002746 | 3300005546 | Bacteria | 11679 |
| 79 | Ga0070696_100011578 | 3300005546 | Bacteria | 5911 |
| 80 | Ga0070696_100012458 | 3300005546 | Bacteria | 5706 |
| 81 | Ga0070693_100000206 | 3300005547 | Bacteria | 27416 |
| 82 | Ga0070665_100000051 | 3300005548 | Bacteria | 249317 |
| 83 | Ga0070665_100051025 | 3300005548 | Bacteria | 4150 |
| 84 | Ga0070665_100099982 | 3300005548 | Bacteria | 2904 |
| 85 | Ga0070704_100007065 | 3300005549 | Bacteria | 6666 |
| 86 | Ga0070704_100015035 | 3300005549 | Bacteria | 4850 |
| 87 | Ga0070664_100089999 | 3300005564 | Bacteria | 2655 |
| 88 | Ga0068854_100002729 | 3300005578 | Bacteria | 10951 |
| 89 | Ga0068854_100023221 | 3300005578 | Bacteria | 4234 |
| 90 | Ga0068856_100011701 | 3300005614 | Bacteria | 8510 |
| 91 | Ga0068856_100030426 | 3300005614 | Bacteria | 5277 |
| 92 | Ga0068856_100084644 | 3300005614 | Bacteria | 3150 |
| 93 | Ga0070702_100000102 | 3300005615 | Bacteria | 25587 |
| 94 | Ga0068859_100001448 | 3300005617 | Bacteria | 24068 |
| 95 | Ga0068859_100001522 | 3300005617 | Bacteria | 23651 |
| 96 | Ga0068859_100026648 | 3300005617 | Bacteria | 5796 |
| 97 | Ga0068859_100053549 | 3300005617 | Bacteria | 4059 |
| 98 | Ga0068859_100111549 | 3300005617 | Bacteria | 2798 |
| 99 | Ga0068859_100145129 | 3300005617 | Bacteria | 2448 |
| 100 | Ga0068859_100168044 | 3300005617 | Bacteria | 2273 |
| 101 | Ga0068864_100000019 | 3300005618 | Bacteria | 271650 |
| 102 | Ga0068864_100176130 | 3300005618 | Bacteria | 1953 |
| 103 | Ga0068864_100179018 | 3300005618 | Bacteria | 1937 |
| 104 | Ga0068866_10001257 | 3300005718 | Bacteria | 10980 |
| 105 | Ga0068866_10026282 | 3300005718 | Bacteria | 2747 |
| 106 | Ga0068861_100000387 | 3300005719 | Bacteria | 25418 |
| 107 | Ga0068861_100000786 | 3300005719 | Bacteria | 19092 |
| 108 | Ga0068861_100024917 | 3300005719 | Bacteria | 4332 |
| 109 | Ga0068851_10015558 | 3300005834 | Bacteria | 3626 |
| 110 | Ga0068863_100000015 | 3300005841 | Bacteria | 214824 |
| 111 | Ga0068858_100007556 | 3300005842 | Bacteria | 10504 |
| 112 | Ga0068860_100003981 | 3300005843 | Bacteria | 15154 |
| 113 | Ga0068862_100000094 | 3300005844 | Bacteria | 106159 |
| 114 | Ga0068862_100002040 | 3300005844 | Bacteria | 18259 |
| 115 | Ga0068862_100006958 | 3300005844 | Bacteria | 9385 |
| 116 | Ga0081539_10000365 | 3300005985 | Bacteria | 99063 |
| 117 | Ga0075366_10054515 | 3300006195 | Bacteria | 2375 |
| 118 | Ga0097621_100001841 | 3300006237 | Bacteria | 14543 |
| 119 | Ga0097621_100007781 | 3300006237 | Bacteria | 7688 |
| 120 | Ga0068871_100001033 | 3300006358 | Bacteria | 18636 |
| 121 | Ga0068871_100004012 | 3300006358 | Bacteria | 10174 |
| 122 | Ga0075428_100009824 | 3300006844 | Bacteria | 10639 |
| 123 | Ga0075428_100048579 | 3300006844 | Bacteria | 4657 |
| 124 | Ga0075428_100048872 | 3300006844 | Bacteria | 4642 |
| 125 | Ga0075430_100008118 | 3300006846 | Bacteria | 8872 |
| 126 | Ga0075430_100024757 | 3300006846 | Bacteria | 5106 |
| 127 | Ga0075433_10005779 | 3300006852 | Bacteria | 9738 |
| 128 | Ga0075434_100004040 | 3300006871 | Bacteria | 13156 |
| 129 | Ga0075434_100009366 | 3300006871 | Bacteria | 9130 |
| 130 | Ga0075429_100000015 | 3300006880 | Bacteria | 78823 |
| 131 | Ga0075429_100000145 | 3300006880 | Bacteria | 43529 |
| 132 | Ga0075429_100043912 | 3300006880 | Bacteria | 3888 |
| 133 | Ga0068865_100000409 | 3300006881 | Bacteria | 23878 |
| 134 | Ga0068865_100003408 | 3300006881 | Bacteria | 9515 |
| 135 | Ga0075436_100000087 | 3300006914 | Bacteria | 53435 |
| 136 | Ga0075436_100001016 | 3300006914 | Bacteria | 18898 |
| 137 | Ga0097620_100001448 | 3300006931 | Bacteria | 24068 |
| 138 | Ga0097620_100001522 | 3300006931 | Bacteria | 23651 |
| 139 | Ga0097620_100026650 | 3300006931 | Bacteria | 5796 |
| 140 | Ga0097620_100053549 | 3300006931 | Bacteria | 4059 |
| 141 | Ga0097620_100111552 | 3300006931 | Bacteria | 2798 |
| 142 | Ga0097620_100145127 | 3300006931 | Bacteria | 2448 |
| 143 | Ga0097620_100168042 | 3300006931 | Bacteria | 2273 |
| 144 | Ga0075435_100001994 | 3300007076 | Bacteria | 13354 |
| 145 | Ga0075435_100078849 | 3300007076 | Bacteria | 2702 |
| 146 | Ga0105251_10000077 | 3300009011 | Bacteria | 93505 |
| 147 | Ga0105251_10000853 | 3300009011 | Bacteria | 27320 |
| 148 | Ga0105251_10012544 | 3300009011 | Bacteria | 4790 |
| 149 | Ga0111539_10070301 | 3300009094 | Bacteria | 4133 |
| 150 | Ga0111539_10117714 | 3300009094 | Bacteria | 3114 |
| 151 | Ga0111539_10128268 | 3300009094 | Bacteria | 2971 |
| 152 | Ga0105245_10003008 | 3300009098 | Bacteria | 15115 |
| 153 | Ga0105247_10003627 | 3300009101 | Bacteria | 10024 |
| 154 | Ga0114129_10000393 | 3300009147 | Bacteria | 51077 |
| 155 | Ga0114129_10034102 | 3300009147 | Bacteria | 7189 |
| 156 | Ga0105243_10000760 | 3300009148 | Bacteria | 30911 |
| 157 | Ga0105243_10000967 | 3300009148 | Bacteria | 26790 |
| 158 | Ga0105243_10002384 | 3300009148 | Bacteria | 15742 |
| 159 | Ga0105241_10001930 | 3300009174 | Bacteria | 15685 |
| 160 | Ga0105241_10007668 | 3300009174 | Bacteria | 7933 |
| 161 | Ga0105242_10006775 | 3300009176 | Bacteria | 8833 |
| 162 | Ga0105248_10000311 | 3300009177 | Bacteria | 57870 |
| 163 | Ga0105248_10133718 | 3300009177 | Bacteria | 2798 |
| 164 | Ga0105248_10137907 | 3300009177 | Bacteria | 2752 |
| 165 | Ga0105238_10054388 | 3300009551 | Bacteria | 4019 |
| 166 | Ga0105238_10107222 | 3300009551 | Bacteria | 2775 |
| 167 | Ga0105249_10000568 | 3300009553 | Bacteria | 33920 |
| 168 | Ga0105249_10002850 | 3300009553 | Bacteria | 14935 |
| 169 | Ga0105249_10022150 | 3300009553 | Bacteria | 5690 |
| 170 | Ga0157371_10000030 | 3300013102 | Bacteria | 241585 |
| 171 | Ga0157370_10001229 | 3300013104 | Bacteria | 32093 |
| 172 | Ga0157370_10140493 | 3300013104 | Bacteria | 2250 |
| 173 | Ga0157369_10062843 | 3300013105 | Bacteria | 4000 |
| 174 | Ga0157378_10000871 | 3300013297 | Bacteria | 27876 |
| 175 | Ga0157378_10014135 | 3300013297 | Bacteria | 6985 |
| 176 | Ga0157372_10221477 | 3300013307 | Bacteria | 2193 |
| 177 | Ga0157375_10151793 | 3300013308 | Bacteria | 2453 |
| 178 | Ga0157380_10008634 | 3300014326 | Bacteria | 7283 |
| 179 | Ga0157380_10021837 | 3300014326 | Bacteria | 4807 |
| 180 | Ga0182008_10001732 | 3300014497 | Bacteria | 14323 |
| 181 | Ga0157379_10017827 | 3300014968 | Bacteria | 6255 |
| 182 | Ga0157376_10003706 | 3300014969 | Bacteria | 10558 |
| 183 | Ga0157376_10023137 | 3300014969 | Bacteria | 4858 |
| 184 | Ga0182007_10000052 | 3300015262 | Bacteria | 95132 |
| 185 | Ga0182005_1000929 | 3300015265 | Bacteria | 12788 |
| 186 | Ga0183363_1005 | 3300015690 | Bacteria | 403020 |
| 187 | Ga0209563_100019 | 3300025230 | Bacteria | 697828 |
| 188 | Ga0209646_1006000 | 3300025246 | Bacteria | 2070 |
| 189 | Ga0209677_108363 | 3300025253 | Bacteria | 2019 |
| 190 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 191 | Ga0209233_1002007 | 3300025261 | Bacteria | 7711 |
| 192 | Ga0209565_1000051 | 3300025263 | Bacteria | 212284 |
| 193 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 194 | Ga0209673_1000069 | 3300025273 | Bacteria | 243506 |
| 195 | Ga0209130_1008270 | 3300025284 | Bacteria | 3088 |
| 196 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 197 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 198 | Ga0209676_1000052 | 3300025292 | Bacteria | 371539 |
| 199 | Ga0209676_1001990 | 3300025292 | Bacteria | 16187 |
| 200 | Ga0209676_1003602 | 3300025292 | Bacteria | 9328 |
| 201 | Ga0209564_1000061 | 3300025295 | Bacteria | 322795 |
| 202 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 203 | Ga0209050_1000109 | 3300025298 | Bacteria | 219706 |
| 204 | Ga0209256_1002963 | 3300025299 | Bacteria | 12710 |
| 205 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 206 | Ga0209257_1007768 | 3300025304 | Bacteria | 6370 |
| 207 | Ga0207656_10000528 | 3300025321 | Bacteria | 12675 |
| 208 | Ga0207713_1000381 | 3300025735 | Bacteria | 48031 |
| 209 | Ga0207713_1011934 | 3300025735 | Bacteria | 4686 |
| 210 | Ga0207682_10000452 | 3300025893 | Bacteria | 18894 |
| 211 | Ga0207642_10007494 | 3300025899 | Bacteria | 3690 |
| 212 | Ga0207642_10016700 | 3300025899 | Bacteria | 2772 |
| 213 | Ga0207710_10003244 | 3300025900 | Bacteria | 7267 |
| 214 | Ga0207688_10025438 | 3300025901 | Bacteria | 3250 |
| 215 | Ga0207680_10068210 | 3300025903 | Bacteria | 2193 |
| 216 | Ga0207680_10182958 | 3300025903 | Bacteria | 1418 |
| 217 | Ga0207647_10011262 | 3300025904 | Bacteria | 6278 |
| 218 | Ga0207645_10016697 | 3300025907 | Bacteria | 4855 |
| 219 | Ga0207645_10028783 | 3300025907 | Bacteria | 3584 |
| 220 | Ga0207645_10032467 | 3300025907 | Bacteria | 3355 |
| 221 | Ga0207643_10040735 | 3300025908 | Bacteria | 2616 |
| 222 | Ga0207705_10000982 | 3300025909 | Bacteria | 23269 |
| 223 | Ga0207695_10142308 | 3300025913 | Bacteria | 2346 |
| 224 | Ga0207671_10028579 | 3300025914 | Bacteria | 4166 |
| 225 | Ga0207660_10002001 | 3300025917 | Bacteria | 13572 |
| 226 | Ga0207662_10000212 | 3300025918 | Bacteria | 27141 |
| 227 | Ga0207662_10010902 | 3300025918 | Bacteria | 5026 |
| 228 | Ga0207657_10014805 | 3300025919 | Bacteria | 7593 |
| 229 | Ga0207657_10089491 | 3300025919 | Bacteria | 2571 |
| 230 | Ga0207649_10001162 | 3300025920 | Bacteria | 15873 |
| 231 | Ga0207681_10002005 | 3300025923 | Bacteria | 13073 |
| 232 | Ga0207681_10116772 | 3300025923 | Bacteria | 1950 |
| 233 | Ga0207650_10000054 | 3300025925 | Bacteria | 162602 |
| 234 | Ga0207650_10003700 | 3300025925 | Bacteria | 10455 |
| 235 | Ga0207687_10005384 | 3300025927 | Bacteria | 8467 |
| 236 | Ga0207664_10062411 | 3300025929 | Bacteria | 2976 |
| 237 | Ga0207706_10006108 | 3300025933 | Bacteria | 11185 |
| 238 | Ga0207706_10011098 | 3300025933 | Bacteria | 8211 |
| 239 | Ga0207706_10074272 | 3300025933 | Bacteria | 2990 |
| 240 | Ga0207686_10001621 | 3300025934 | Bacteria | 12603 |
| 241 | Ga0207709_10000031 | 3300025935 | Bacteria | 329046 |
| 242 | Ga0207709_10001622 | 3300025935 | Bacteria | 15298 |
| 243 | Ga0207709_10003140 | 3300025935 | Bacteria | 9937 |
| 244 | Ga0207709_10008899 | 3300025935 | Bacteria | 5543 |
| 245 | Ga0207670_10003445 | 3300025936 | Bacteria | 8390 |
| 246 | Ga0207670_10039174 | 3300025936 | Bacteria | 3102 |
| 247 | Ga0207669_10000073 | 3300025937 | Bacteria | 51684 |
| 248 | Ga0207669_10000718 | 3300025937 | Bacteria | 14326 |
| 249 | Ga0207665_10039885 | 3300025939 | Bacteria | 3132 |
| 250 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 251 | Ga0207689_10001581 | 3300025942 | Bacteria | 21579 |
| 252 | Ga0207689_10021185 | 3300025942 | Bacteria | 5465 |
| 253 | Ga0207679_10037342 | 3300025945 | Bacteria | 3452 |
| 254 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 255 | Ga0207667_10013574 | 3300025949 | Bacteria | 9312 |
| 256 | Ga0207651_10118439 | 3300025960 | Bacteria | 2003 |
| 257 | Ga0207712_10000163 | 3300025961 | Bacteria | 68522 |
| 258 | Ga0207712_10001259 | 3300025961 | Bacteria | 17480 |
| 259 | Ga0207712_10009895 | 3300025961 | Bacteria | 6043 |
| 260 | Ga0207668_10012088 | 3300025972 | Bacteria | 5273 |
| 261 | Ga0207640_10002843 | 3300025981 | Bacteria | 9286 |
| 262 | Ga0207640_10008086 | 3300025981 | Bacteria | 5819 |
| 263 | Ga0207640_10012020 | 3300025981 | Bacteria | 4921 |
| 264 | Ga0207640_10024905 | 3300025981 | Bacteria | 3616 |
| 265 | Ga0207658_10000223 | 3300025986 | Bacteria | 59510 |
| 266 | Ga0207677_10018038 | 3300026023 | Bacteria | 4227 |
| 267 | Ga0207703_10003857 | 3300026035 | Bacteria | 12457 |
| 268 | Ga0207703_10050041 | 3300026035 | Bacteria | 3380 |
| 269 | Ga0207639_10000387 | 3300026041 | Bacteria | 30349 |
| 270 | Ga0207639_10001031 | 3300026041 | Bacteria | 18936 |
| 271 | Ga0207639_10003181 | 3300026041 | Bacteria | 11040 |
| 272 | Ga0207639_10115453 | 3300026041 | Bacteria | 2196 |
| 273 | Ga0207678_10000454 | 3300026067 | Bacteria | 37044 |
| 274 | Ga0207678_10001685 | 3300026067 | Bacteria | 20296 |
| 275 | Ga0207708_10001389 | 3300026075 | Bacteria | 18203 |
| 276 | Ga0207708_10001857 | 3300026075 | Bacteria | 15564 |
| 277 | Ga0207702_10039939 | 3300026078 | Bacteria | 3933 |
| 278 | Ga0207641_10000008 | 3300026088 | Bacteria | 424415 |
| 279 | Ga0207648_10001735 | 3300026089 | Bacteria | 23851 |
| 280 | Ga0207648_10002409 | 3300026089 | Bacteria | 20139 |
| 281 | Ga0207676_10000019 | 3300026095 | Bacteria | 305653 |
| 282 | Ga0207676_10110261 | 3300026095 | Bacteria | 2301 |
| 283 | Ga0207676_10128474 | 3300026095 | Bacteria | 2151 |
| 284 | Ga0207676_10137551 | 3300026095 | Bacteria | 2087 |
| 285 | Ga0207674_10001228 | 3300026116 | Bacteria | 33445 |
| 286 | Ga0207674_10006702 | 3300026116 | Bacteria | 13524 |
| 287 | Ga0207674_10156594 | 3300026116 | Bacteria | 2233 |
| 288 | Ga0207675_100000016 | 3300026118 | Bacteria | 126353 |
| 289 | Ga0207675_100000888 | 3300026118 | Bacteria | 29866 |
| 290 | Ga0207683_10000086 | 3300026121 | Bacteria | 73510 |
| 291 | Ga0207683_10015331 | 3300026121 | Bacteria | 6527 |
| 292 | Ga0207683_10091822 | 3300026121 | Bacteria | 2705 |
| 293 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 294 | Ga0209371_1000152 | 3300027312 | Bacteria | 108927 |
| 295 | Ga0210000_1002198 | 3300027462 | Bacteria | 2765 |
| 296 | Ga0210000_1004952 | 3300027462 | Bacteria | 1929 |
| 297 | Ga0207428_10000766 | 3300027907 | Bacteria | 36583 |
| 298 | Ga0207428_10051385 | 3300027907 | Bacteria | 3295 |
| 299 | Ga0207428_10077355 | 3300027907 | Bacteria | 2605 |
| 300 | Ga0207428_10103824 | 3300027907 | Bacteria | 2194 |
| 301 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 302 | Ga0268266_10151984 | 3300028379 | Bacteria | 2087 |
| 303 | Ga0268265_10000011 | 3300028380 | Bacteria | 343832 |
| 304 | Ga0268265_10001159 | 3300028380 | Bacteria | 23174 |
| 305 | Ga0268265_10003597 | 3300028380 | Bacteria | 11066 |
| 306 | Ga0268264_10001772 | 3300028381 | Bacteria | 19738 |
| 307 | Ga0268264_10143362 | 3300028381 | Bacteria | 2133 |
| 308 | Ga0265336_10006403 | 3300028666 | Bacteria | 4244 |
| 309 | Ga0307517_10014006 | 3300028786 | Bacteria | 10822 |
| 310 | Ga0307517_10041774 | 3300028786 | Bacteria | 4940 |
| 311 | Ga0265324_10000002 | 3300029957 | Bacteria | 382754 |
| 312 | Ga0265324_10000616 | 3300029957 | Bacteria | 24232 |
| 313 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 314 | Ga0268256_1000127 | 3300030500 | Bacteria | 108927 |
| 315 | Ga0316183_1052664 | 3300030742 | Bacteria | 8674 |
| 316 | Ga0265328_10000016 | 3300031239 | Bacteria | 132959 |
| 317 | Ga0265325_10002841 | 3300031241 | Bacteria | 11549 |
| 318 | Ga0265325_10007848 | 3300031241 | Bacteria | 6354 |
| 319 | Ga0265331_10015958 | 3300031250 | Bacteria | 3952 |
| 320 | Ga0265327_10003217 | 3300031251 | Bacteria | 15896 |
| 321 | Ga0265327_10004074 | 3300031251 | Bacteria | 13227 |
| 322 | Ga0265327_10015677 | 3300031251 | Bacteria | 4872 |
| 323 | Ga0265327_10045580 | 3300031251 | Bacteria | 2329 |
| 324 | Ga0265316_10010443 | 3300031344 | Bacteria | 8459 |
| 325 | Ga0307513_10082859 | 3300031456 | Bacteria | 3300 |
| 326 | Ga0307408_100007451 | 3300031548 | Bacteria | 7235 |
| 327 | Ga0307408_100042351 | 3300031548 | Bacteria | 3233 |
| 328 | Ga0307408_100089007 | 3300031548 | Bacteria | 2326 |
| 329 | Ga0316575_10000487 | 3300031665 | Bacteria | 11510 |
| 330 | Ga0316575_10001144 | 3300031665 | Bacteria | 8299 |
| 331 | Ga0316575_10008164 | 3300031665 | Bacteria | 3806 |
| 332 | Ga0316575_10013846 | 3300031665 | Bacteria | 3018 |
| 333 | Ga0316579_10000112 | 3300031691 | Bacteria | 21688 |
| 334 | Ga0316579_10013311 | 3300031691 | Bacteria | 3536 |
| 335 | Ga0316579_10014200 | 3300031691 | Bacteria | 3437 |
| 336 | Ga0265314_10001144 | 3300031711 | Bacteria | 30747 |
| 337 | Ga0265314_10013371 | 3300031711 | Bacteria | 6633 |
| 338 | Ga0265314_10016503 | 3300031711 | Bacteria | 5827 |
| 339 | Ga0265314_10037974 | 3300031711 | Bacteria | 3484 |
| 340 | Ga0316576_10000941 | 3300031727 | Bacteria | 14878 |
| 341 | Ga0316576_10007815 | 3300031727 | Bacteria | 6757 |
| 342 | Ga0316576_10008009 | 3300031727 | Bacteria | 6699 |
| 343 | Ga0316578_10000036 | 3300031728 | Bacteria | 27635 |
| 344 | Ga0316578_10040101 | 3300031728 | Bacteria | 2705 |
| 345 | Ga0316578_10042632 | 3300031728 | Bacteria | 2632 |
| 346 | Ga0307405_10018615 | 3300031731 | Bacteria | 3836 |
| 347 | Ga0307405_10031623 | 3300031731 | Bacteria | 3117 |
| 348 | Ga0316577_10000097 | 3300031733 | Bacteria | 24000 |
| 349 | Ga0307413_10019557 | 3300031824 | Bacteria | 3582 |
| 350 | Ga0307406_10015834 | 3300031901 | Bacteria | 4371 |
| 351 | Ga0307406_10034146 | 3300031901 | Bacteria | 3118 |
| 352 | Ga0307412_10072395 | 3300031911 | Bacteria | 2355 |
| 353 | Ga0307416_100029044 | 3300032002 | Bacteria | 4124 |
| 354 | Ga0307414_10133944 | 3300032004 | Bacteria | 1928 |
| 355 | Ga0316583_10005061 | 3300032133 | Bacteria | 4719 |
| 356 | Ga0316583_10010528 | 3300032133 | Bacteria | 3336 |
| 357 | Ga0316583_10011643 | 3300032133 | Bacteria | 3172 |
| 358 | Ga0316583_10013578 | 3300032133 | Bacteria | 2940 |
| 359 | Ga0316583_10021200 | 3300032133 | Bacteria | 2330 |
| 360 | Ga0316585_10000137 | 3300032137 | Bacteria | 14253 |
| 361 | Ga0316580_10000114 | 3300032139 | Bacteria | 15009 |
| 362 | Ga0316580_10001122 | 3300032139 | Bacteria | 6774 |
| 363 | Ga0316580_10013725 | 3300032139 | Bacteria | 2468 |
| 364 | Ga0316593_10000230 | 3300032168 | Bacteria | 8970 |
| 365 | Ga0316593_10001819 | 3300032168 | Bacteria | 4870 |
| 366 | Ga0316593_10010640 | 3300032168 | Bacteria | 2646 |
| 367 | Ga0316596_1000141 | 3300033541 | Bacteria | 9849 |
| 368 | Ga0316596_1001863 | 3300033541 | Bacteria | 4397 |
| 369 | Ga0373932_0001303 | 3300035112 | Bacteria | 7035 |
| 370 | Ga0373936_0014330 | 3300035113 | Bacteria | 3028 |
| 371 | Ga0316574_0002271 | 3300035398 | Bacteria | 9571 |
| 372 | Ga0316574_0002543 | 3300035398 | Bacteria | 9174 |
| 373 | Ga0316574_0003574 | 3300035398 | Bacteria | 8036 |
| 374 | Ga0316574_0003652 | 3300035398 | Bacteria | 7964 |
| 375 | Ga0316574_0007563 | 3300035398 | Bacteria | 5965 |
| 376 | Ga0316574_0038227 | 3300035398 | Bacteria | 2946 |
| 377 | Ga0316574_0040331 | 3300035398 | Bacteria | 2875 |
| 378 | Ga0316574_0075565 | 3300035398 | Bacteria | 2134 |
| 379 | Ga0373931_0011424 | 3300035691 | Bacteria | 4290 |
| 380 | Ga0373931_0034589 | 3300035691 | Bacteria | 2623 |
| 381 | Ga0373935_0002303 | 3300035692 | Bacteria | 10889 |
| 382 | Ga0373935_0062446 | 3300035692 | Bacteria | 2386 |
| 383 | Ga0373927_0055857 | 3300035695 | Bacteria | 2552 |
| 384 | Ga0373937_0098532 | 3300036401 | Bacteria | 2711 |
| 385 | Ga0316582_0000029 | 3300036647 | Bacteria | 34187 |
| 386 | Ga0316582_0020407 | 3300036647 | Bacteria | 3896 |
| 387 | Ga0316582_0137950 | 3300036647 | Bacteria | 1643 |
| 388 | Ga0316584_0003738 | 3300036712 | Bacteria | 9965 |
| 389 | Ga0316584_0033074 | 3300036712 | Bacteria | 3828 |
| 390 | Ga0316584_0039597 | 3300036712 | Bacteria | 3509 |
| 391 | Ga0316581_0010955 | 3300037588 | Bacteria | 2526 |
| 392 | Ga0237819_01221 | 3300038705 | Bacteria | 7123 |
| 393 | Ga0400490_04196 | 3300038726 | Bacteria | 8292 |
| 394 | Ga0400485_17163 | 3300038735 | Bacteria | 43508 |
| 395 | Ga0400488_50200 | 3300038741 | Bacteria | 9554 |
| 396 | Ga0400488_63642 | 3300038741 | Bacteria | 2261 |
| 397 | Ga0400486_01662 | 3300038742 | Bacteria | 43450 |
| 398 | Ga0400483_120916 | 3300039062 | Bacteria | 2803 |
| 399 | Ga0400483_177575 | 3300039062 | Bacteria | 3055 |
| 400 | Ga0400483_216953 | 3300039062 | Bacteria | 8439 |
| 401 | Ga0400487_17601 | 3300039110 | Bacteria | 48398 |
| 402 | Ga0400487_52635 | 3300039110 | Bacteria | 6520 |
| 403 | Ga0436365_0355590 | 3300039437 | Bacteria | 2342 |
| 404 | Ga0436361_0368594 | 3300039447 | Bacteria | 5839 |
| 405 | Ga0439465_0000332 | 3300041413 | Bacteria | 13448 |
| 406 | Ga0451800_0939899 | 3300041459 | Bacteria | 4402 |
| 407 | Ga0451806_394025 | 3300041462 | Bacteria | 4621 |
| 408 | Ga0451807_0921339 | 3300041486 | Bacteria | 4099 |
| 409 | Ga0439449_0000008 | 3300042007 | Bacteria | 62060 |
| 410 | Ga0439435_0007762 | 3300042436 | Bacteria | 2468 |
| 411 | Ga0439460_0011514 | 3300042461 | Bacteria | 2281 |
| 412 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 413 | Ga0451577_0000096 | 3300042876 | Bacteria | 195129 |
| 414 | Ga0451577_0118655 | 3300042876 | Bacteria | 2369 |
| 415 | Ga0466969_0001982 | 3300044656 | Bacteria | 10959 |
| 416 | Ga0453683_0000013 | 3300044673 | Bacteria | 371932 |
| 417 | Ga0466961_0003966 | 3300044693 | Bacteria | 9260 |
| 418 | Ga0466964_0004827 | 3300044706 | Bacteria | 4983 |
| 419 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 420 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 421 | Ga0453684_0003157 | 3300044712 | Bacteria | 37940 |
| 422 | Ga0453684_0010268 | 3300044712 | Bacteria | 16038 |
| 423 | Ga0453684_0072447 | 3300044712 | Bacteria | 4349 |
| 424 | Ga0451576_0000037 | 3300045051 | Bacteria | 372173 |
| 425 | Ga0451576_0000494 | 3300045051 | Bacteria | 86988 |
| 426 | Ga0451576_0002868 | 3300045051 | Bacteria | 24693 |
| 427 | Ga0451576_0004225 | 3300045051 | Bacteria | 18855 |
| 428 | Ga0451576_0005999 | 3300045051 | Bacteria | 15024 |
| 429 | Ga0451576_0023354 | 3300045051 | Bacteria | 6696 |
| 430 | Ga0451576_0024169 | 3300045051 | Bacteria | 6566 |
| 431 | Ga0451576_0078594 | 3300045051 | Bacteria | 3433 |
| 432 | Ga0451576_0099937 | 3300045051 | Bacteria | 3017 |
| 433 | Ga0466967_0096689 | 3300045976 | Bacteria | 2694 |
| 434 | Ga0495617_011142 | 3300046452 | Bacteria | 3074 |
| 435 | Ga0495603_0095965 | 3300046455 | Bacteria | 1732 |
| 436 | Ga0495650_0000340 | 3300046471 | Bacteria | 83278 |
| 437 | Ga0495582_0126709 | 3300046473 | Bacteria | 1441 |
| 438 | Ga0495639_0017849 | 3300046475 | Bacteria | 3084 |
| 439 | Ga0495585_0019033 | 3300046492 | Bacteria | 3962 |
| 440 | Ga0495607_0034231 | 3300046501 | Bacteria | 3083 |
| 441 | Ga0495583_0000996 | 3300046506 | Bacteria | 32401 |
| 442 | Ga0495583_0017942 | 3300046506 | Bacteria | 3741 |
| 443 | Ga0495583_0033284 | 3300046506 | Bacteria | 2479 |
| 444 | Ga0495606_0000824 | 3300046507 | Bacteria | 47072 |
| 445 | Ga0495606_0015923 | 3300046507 | Bacteria | 5766 |
| 446 | Ga0495637_0002189 | 3300046520 | Bacteria | 10923 |
| 447 | Ga0495643_0000146 | 3300046522 | Bacteria | 114508 |
| 448 | Ga0495643_0001032 | 3300046522 | Bacteria | 28383 |
| 449 | Ga0495643_0002465 | 3300046522 | Bacteria | 14651 |
| 450 | Ga0495648_0000439 | 3300046524 | Bacteria | 45123 |
| 451 | Ga0495663_0006151 | 3300046525 | Bacteria | 3318 |
| 452 | Ga0495663_0008844 | 3300046525 | Bacteria | 2794 |
| 453 | Ga0495654_0000264 | 3300046530 | Bacteria | 47686 |
| 454 | Ga0495586_0004479 | 3300046535 | Bacteria | 7460 |
| 455 | Ga0495622_0003931 | 3300046557 | Bacteria | 6941 |
| 456 | Ga0495633_0003190 | 3300046558 | Bacteria | 11071 |
| 457 | Ga0495633_0003629 | 3300046558 | Bacteria | 10203 |
| 458 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 459 | Ga0495668_0000984 | 3300046616 | Bacteria | 31110 |
| 460 | Ga0495625_0000583 | 3300046660 | Bacteria | 53056 |
| 461 | Ga0495625_0038998 | 3300046660 | Bacteria | 3472 |
| 462 | Ga0495625_0088204 | 3300046660 | Bacteria | 2149 |
| 463 | Ga0495647_0006492 | 3300046681 | Bacteria | 3878 |
| 464 | Ga0495669_0000286 | 3300046684 | Bacteria | 28731 |
| 465 | Ga0495669_0002353 | 3300046684 | Bacteria | 7751 |
| 466 | Ga0495671_0000100 | 3300046692 | Bacteria | 78876 |
| 467 | Ga0495589_0036243 | 3300046794 | Bacteria | 2473 |
| 468 | Ga0495600_0004286 | 3300046809 | Bacteria | 8529 |
| 469 | Ga0495636_0003832 | 3300047318 | Bacteria | 5863 |
| 470 | Ga0495672_0000273 | 3300047320 | Bacteria | 71269 |
| 471 | Ga0495683_0054044 | 3300047323 | Bacteria | 2002 |
| 472 | Ga0495687_000512 | 3300047443 | Bacteria | 46683 |
| 473 | Ga0495687_001133 | 3300047443 | Bacteria | 25821 |
| 474 | Ga0495677_0003158 | 3300047445 | Bacteria | 6426 |
| 475 | Ga0495681_0007326 | 3300047470 | Bacteria | 7068 |
| 476 | Ga0495686_0000120 | 3300047472 | Bacteria | 164638 |
| 477 | Ga0496102_0001240 | 3300048905 | Bacteria | 23101 |
| 478 | Ga0496103_0000307 | 3300048906 | Bacteria | 45142 |
| 479 | Ga0496104_0058614 | 3300048907 | Bacteria | 3645 |
| 480 | Ga0496105_0000190 | 3300048908 | Bacteria | 41092 |
| 481 | Ga0496111_0011992 | 3300048914 | Bacteria | 5858 |
| 482 | Ga0496114_0025500 | 3300048917 | Bacteria | 4833 |
| 483 | Ga0496115_0000251 | 3300048918 | Bacteria | 47811 |
| 484 | Ga0496116_0003152 | 3300048919 | Bacteria | 16514 |
| 485 | Ga0496116_0083051 | 3300048919 | Bacteria | 1979 |
| 486 | Ga0496117_0000182 | 3300048920 | Bacteria | 128076 |
| 487 | Ga0496117_0003796 | 3300048920 | Bacteria | 17237 |
| 488 | Ga0496117_0005077 | 3300048920 | Bacteria | 14093 |
| 489 | Ga0496117_0007293 | 3300048920 | Bacteria | 10862 |
| 490 | Ga0496117_0008132 | 3300048920 | Bacteria | 10024 |
| 491 | Ga0496118_0000125 | 3300048921 | Bacteria | 136422 |
| 492 | Ga0496118_0000870 | 3300048921 | Bacteria | 47798 |
| 493 | Ga0496118_0009520 | 3300048921 | Bacteria | 9788 |
| 494 | Ga0496118_0011733 | 3300048921 | Bacteria | 8516 |
| 495 | Ga0496119_0000174 | 3300048922 | Bacteria | 89804 |
| 496 | Ga0496119_0001413 | 3300048922 | Bacteria | 29073 |
| 497 | Ga0496120_0000162 | 3300048923 | Bacteria | 112200 |
| 498 | Ga0496120_0000253 | 3300048923 | Bacteria | 89798 |
| 499 | Ga0496121_0000906 | 3300048924 | Bacteria | 53394 |
| 500 | Ga0496121_0007552 | 3300048924 | Bacteria | 13103 |
| 501 | Ga0496122_0000049 | 3300048925 | Bacteria | 268493 |
| 502 | Ga0496122_0015452 | 3300048925 | Bacteria | 7298 |
| 503 | Ga0496122_0027525 | 3300048925 | Bacteria | 4856 |
| 504 | Ga0496123_0000042 | 3300048926 | Bacteria | 254481 |
| 505 | Ga0496123_0014378 | 3300048926 | Bacteria | 6565 |
| 506 | Ga0496124_0000034 | 3300048927 | Bacteria | 325332 |
| 507 | Ga0496124_0000082 | 3300048927 | Bacteria | 208248 |
| 508 | Ga0496124_0000621 | 3300048927 | Bacteria | 59443 |
| 509 | Ga0496124_0002188 | 3300048927 | Bacteria | 26105 |
| 510 | Ga0496125_0000730 | 3300048928 | Bacteria | 54485 |
| 511 | Ga0496125_0013126 | 3300048928 | Bacteria | 8167 |
| 512 | Ga0496125_0036192 | 3300048928 | Bacteria | 4314 |
| 513 | Ga0496126_0000221 | 3300048929 | Bacteria | 124193 |
| 514 | Ga0496126_0002736 | 3300048929 | Bacteria | 23301 |
| 515 | Ga0501033_0071570 | 3300049570 | Bacteria | 2547 |
| 516 | Ga0501036_0051318 | 3300049572 | Bacteria | 3492 |
| 517 | Ga0501040_0014302 | 3300049576 | Bacteria | 5228 |
| 518 | Ga0501040_0126499 | 3300049576 | Bacteria | 1795 |
| 519 | Ga0501041_0003094 | 3300049577 | Bacteria | 9566 |
| 520 | Ga0501041_0023137 | 3300049577 | Bacteria | 3726 |
| 521 | Ga0501046_0045128 | 3300049580 | Bacteria | 3503 |
| 522 | Ga0501048_0087266 | 3300049582 | Bacteria | 2201 |
| 523 | Ga0501071_0007160 | 3300049587 | Bacteria | 7297 |
| 524 | Ga0501071_0021240 | 3300049587 | Bacteria | 4519 |
| 525 | Ga0501072_0001613 | 3300049588 | Bacteria | 16851 |
| 526 | Ga0501072_0267210 | 3300049588 | Bacteria | 1361 |
| 527 | Ga0501073_0046094 | 3300049589 | Bacteria | 3068 |
| 528 | Ga0501075_0005223 | 3300049591 | Bacteria | 8876 |
| 529 | Ga0501075_0143208 | 3300049591 | Bacteria | 1822 |
| 530 | Ga0501076_0000429 | 3300049592 | Bacteria | 26487 |
| 531 | Ga0501249_000356 | 3300049679 | Bacteria | 12222 |
| 532 | Ga0501225_0000850 | 3300049705 | Bacteria | 9490 |
| 533 | Ga0501079_0006938 | 3300049741 | Bacteria | 8536 |
| 534 | Ga0501079_0035142 | 3300049741 | Bacteria | 3857 |
| 535 | Ga0501080_0002142 | 3300049742 | Bacteria | 17157 |
| 536 | Ga0501080_0092873 | 3300049742 | Bacteria | 2802 |
| 537 | Ga0501081_0007602 | 3300049743 | Bacteria | 7027 |
| 538 | Ga0501081_0022530 | 3300049743 | Bacteria | 4216 |
| 539 | Ga0501081_0139598 | 3300049743 | Bacteria | 1736 |
| 540 | Ga0501045_0114604 | 3300049824 | Bacteria | 1999 |
| 541 | nmdc:mga0k408_41296_c1 | 3300050493 | Bacteria | 2655 |
| 542 | nmdc:mga05p37_133_c1 | 3300050507 | Bacteria | 68369 |
| 543 | nmdc:mga05p37_775_c1 | 3300050507 | Bacteria | 35507 |
| 544 | nmdc:mga09592_26_c1 | 3300050508 | Bacteria | 84260 |
| 545 | nmdc:mga09592_684_c1 | 3300050508 | Bacteria | 25891 |
| 546 | nmdc:mga0qj67_64383_c1 | 3300050509 | Bacteria | 2916 |
| 547 | nmdc:mga06r32_100912_c1 | 3300050510 | Bacteria | 2832 |
| 548 | nmdc:mga06r32_275048_c1 | 3300050510 | Bacteria | 1671 |
| 549 | nmdc:mga08y16_18475_c1 | 3300050511 | Bacteria | 7346 |
| 550 | nmdc:mga08y16_61426_c1 | 3300050511 | Bacteria | 3924 |
| 551 | nmdc:mga08y16_9147_c1 | 3300050511 | Bacteria | 10398 |
| 552 | nmdc:mga0n895_1259_c1 | 3300050512 | Bacteria | 18701 |
| 553 | nmdc:mga0n895_13334_c1 | 3300050512 | Bacteria | 7412 |
| 554 | nmdc:mga0n895_866_c1 | 3300050512 | Bacteria | 21745 |
| 555 | nmdc:mga0rr50_4784_c1 | 3300050513 | Bacteria | 7990 |
| 556 | nmdc:mga0rr50_59832_c1 | 3300050513 | Bacteria | 2862 |
| 557 | nmdc:mga0rr50_85400_c1 | 3300050513 | Bacteria | 2446 |
| 558 | nmdc:mga08x19_1067_c1 | 3300050514 | Bacteria | 17100 |
| 559 | nmdc:mga08x19_1837_c1 | 3300050514 | Bacteria | 13023 |
| 560 | nmdc:mga08x19_32861_c1 | 3300050514 | Bacteria | 3272 |
| 561 | nmdc:mga08x19_41311_c1 | 3300050514 | Bacteria | 2937 |
| 562 | nmdc:mga0a205_1164_c1 | 3300050515 | Bacteria | 21889 |
| 563 | Ga0500610_0001872 | 3300053079 | Bacteria | 7459 |
| 564 | Ga0500595_001141 | 3300053119 | Bacteria | 14732 |
| 565 | Ga0500642_0001053 | 3300053130 | Bacteria | 7963 |
| 566 | Ga0500627_0001208 | 3300053158 | Bacteria | 7101 |
| 567 | Ga0500645_000080 | 3300053730 | Bacteria | 76756 |
| 568 | Ga0501084_0087213 | 3300054114 | Bacteria | 2620 |
| 569 | Ga0501082_0046111 | 3300060353 | Bacteria | 3758 |
| 570 | Ga0530510_0023984 | 3300061734 | Bacteria | 4351 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10062843 | Ga0157369_100628432 | 340 |
| 2 | 3300049582 | Ga0501048_0087266 | Ga0501048_0087266_16_1248 | 396 |
| 3 | 3300039062 | Ga0400483_120916 | Ga0400483_120916_144_1385 | 398 |
| 4 | 3300049588 | Ga0501072_0267210 | Ga0501072_0267210_28_1308 | 410 |
| 5 | 3300025903 | Ga0207680_10182958 | Ga0207680_101829582 | 411 |
| 6 | 3300036647 | Ga0316582_0137950 | Ga0316582_0137950_84_1358 | 412 |
| 7 | iso_pu_bacteria | 2651869719 | 2652546471 | 412 |
| 8 | 3300006844 | Ga0075428_100048579 | Ga0075428_1000485794 | 416 |
| 9 | 3300035692 | Ga0373935_0062446 | Ga0373935_0062446_1052_2362 | 416 |
| 10 | 3300046473 | Ga0495582_0126709 | Ga0495582_0126709_23_1333 | 416 |
| 11 | 3300039062 | Ga0400483_177575 | Ga0400483_177575_1115_2419 | 419 |
| 12 | 3300047318 | Ga0495636_0003832 | Ga0495636_0003832_2479_3801 | 420 |
| 13 | 3300032004 | Ga0307414_10133944 | Ga0307414_101339442 | 430 |
| 14 | 3300006844 | Ga0075428_100048872 | Ga0075428_1000488723 | 451 |
| 15 | 3300006880 | Ga0075429_100000015 | Ga0075429_10000001572 | 451 |
| 16 | 3300009147 | Ga0114129_10034102 | Ga0114129_100341025 | 451 |
| 17 | 3300050507 | nmdc:mga05p37_133_c1 | nmdc:mga05p37_133_c1_25172_26686 | 451 |
| 18 | 3300050508 | nmdc:mga09592_26_c1 | nmdc:mga09592_26_c1_29734_31248 | 451 |
| 19 | 3300005353 | Ga0070669_100008869 | Ga0070669_1000088692 | 457 |
| 20 | 3300005406 | Ga0070703_10015864 | Ga0070703_100158642 | 457 |
| 21 | 3300005441 | Ga0070700_100002243 | Ga0070700_1000022433 | 457 |
| 22 | 3300005459 | Ga0068867_100000755 | Ga0068867_1000007552 | 457 |
| 23 | 3300005719 | Ga0068861_100024917 | Ga0068861_1000249172 | 457 |
| 24 | 3300005844 | Ga0068862_100006958 | Ga0068862_10000695810 | 457 |
| 25 | 3300006881 | Ga0068865_100003408 | Ga0068865_1000034089 | 457 |
| 26 | 3300009148 | Ga0105243_10002384 | Ga0105243_100023845 | 457 |
| 27 | 3300009553 | Ga0105249_10022150 | Ga0105249_100221502 | 457 |
| 28 | 3300013308 | Ga0157375_10151793 | Ga0157375_101517933 | 457 |
| 29 | 3300014326 | Ga0157380_10021837 | Ga0157380_100218374 | 457 |
| 30 | 3300025899 | Ga0207642_10016700 | Ga0207642_100167002 | 457 |
| 31 | 3300025908 | Ga0207643_10040735 | Ga0207643_100407352 | 457 |
| 32 | 3300025923 | Ga0207681_10002005 | Ga0207681_100020054 | 457 |
| 33 | 3300025961 | Ga0207712_10001259 | Ga0207712_1000125919 | 457 |
| 34 | 3300025972 | Ga0207668_10012088 | Ga0207668_100120885 | 457 |
| 35 | 3300026089 | Ga0207648_10002409 | Ga0207648_1000240916 | 457 |
| 36 | 3300027907 | Ga0207428_10077355 | Ga0207428_100773552 | 457 |
| 37 | 3300028380 | Ga0268265_10001159 | Ga0268265_1000115916 | 457 |
| 38 | 3300050511 | nmdc:mga08y16_61426_c1 | nmdc:mga08y16_61426_c1_1254_2690 | 457 |
| 39 | 3300035398 | Ga0316574_0007563 | Ga0316574_0007563_1446_2852 | 459 |
| 40 | 3300049591 | Ga0501075_0005223 | Ga0501075_0005223_4337_5773 | 459 |
| 41 | 3300006880 | Ga0075429_100043912 | Ga0075429_1000439125 | 460 |
| 42 | 3300027462 | Ga0210000_1002198 | Ga0210000_10021982 | 460 |
| 43 | 3300025292 | Ga0209676_1000052 | Ga0209676_100005291 | 461 |
| 44 | 3300025929 | Ga0207664_10062411 | Ga0207664_100624113 | 462 |
| 45 | 3300031251 | Ga0265327_10045580 | Ga0265327_100455801 | 462 |
| 46 | 3300050510 | nmdc:mga06r32_275048_c1 | nmdc:mga06r32_275048_c1_192_1616 | 463 |
| 47 | 3300049570 | Ga0501033_0071570 | Ga0501033_0071570_121_1572 | 464 |
| 48 | 3300049572 | Ga0501036_0051318 | Ga0501036_0051318_1064_2515 | 464 |
| 49 | 3300049576 | Ga0501040_0014302 | Ga0501040_0014302_941_2392 | 464 |
| 50 | 3300049577 | Ga0501041_0003094 | Ga0501041_0003094_6862_8313 | 464 |
| 51 | 3300049580 | Ga0501046_0045128 | Ga0501046_0045128_146_1597 | 464 |
| 52 | 3300049588 | Ga0501072_0001613 | Ga0501072_0001613_2355_3806 | 464 |
| 53 | 3300049592 | Ga0501076_0000429 | Ga0501076_0000429_7904_9355 | 464 |
| 54 | 3300049741 | Ga0501079_0006938 | Ga0501079_0006938_2831_4282 | 464 |
| 55 | 3300049742 | Ga0501080_0092873 | Ga0501080_0092873_365_1816 | 464 |
| 56 | 3300049743 | Ga0501081_0007602 | Ga0501081_0007602_2468_3919 | 464 |
| 57 | 3300054114 | Ga0501084_0087213 | Ga0501084_0087213_45_1496 | 464 |
| 58 | 3300060353 | Ga0501082_0046111 | Ga0501082_0046111_162_1613 | 464 |
| 59 | 3300061734 | Ga0530510_0023984 | Ga0530510_0023984_1115_2566 | 464 |
| 60 | 3300005328 | Ga0070676_10049319 | Ga0070676_100493192 | 465 |
| 61 | 3300005334 | Ga0068869_100032962 | Ga0068869_1000329622 | 465 |
| 62 | 3300005354 | Ga0070675_100033120 | Ga0070675_1000331203 | 465 |
| 63 | 3300009094 | Ga0111539_10117714 | Ga0111539_101177143 | 465 |
| 64 | 3300025907 | Ga0207645_10032467 | Ga0207645_100324672 | 465 |
| 65 | 3300025933 | Ga0207706_10074272 | Ga0207706_100742722 | 465 |
| 66 | 3300025942 | Ga0207689_10021185 | Ga0207689_100211856 | 465 |
| 67 | 3300027907 | Ga0207428_10051385 | Ga0207428_100513853 | 465 |
| 68 | 3300045051 | Ga0451576_0078594 | Ga0451576_0078594_1709_3157 | 465 |
| 69 | 3300049587 | Ga0501071_0007160 | Ga0501071_0007160_3471_4964 | 465 |
| 70 | 3300049589 | Ga0501073_0046094 | Ga0501073_0046094_368_1861 | 465 |
| 71 | 3300049742 | Ga0501080_0002142 | Ga0501080_0002142_6286_7779 | 465 |
| 72 | 3300049743 | Ga0501081_0139598 | Ga0501081_0139598_115_1608 | 465 |
| 73 | 3300050510 | nmdc:mga06r32_100912_c1 | nmdc:mga06r32_100912_c1_473_1909 | 465 |
| 74 | 3300050511 | nmdc:mga08y16_9147_c1 | nmdc:mga08y16_9147_c1_315_1763 | 465 |
| 75 | 3300032133 | Ga0316583_10021200 | Ga0316583_100212003 | 466 |
| 76 | 3300044656 | Ga0466969_0001982 | Ga0466969_0001982_344_1807 | 466 |
| 77 | 3300044693 | Ga0466961_0003966 | Ga0466961_0003966_3315_4778 | 466 |
| 78 | 3300006846 | Ga0075430_100008118 | Ga0075430_1000081187 | 467 |
| 79 | 3300006846 | Ga0075430_100024757 | Ga0075430_1000247573 | 467 |
| 80 | 3300050509 | nmdc:mga0qj67_64383_c1 | nmdc:mga0qj67_64383_c1_1410_2855 | 467 |
| 81 | 3300035398 | Ga0316574_0038227 | Ga0316574_0038227_69_1541 | 468 |
| 82 | 3300049591 | Ga0501075_0143208 | Ga0501075_0143208_200_1663 | 468 |
| 83 | 3300005444 | Ga0070694_100011846 | Ga0070694_1000118464 | 469 |
| 84 | 3300031911 | Ga0307412_10072395 | Ga0307412_100723952 | 469 |
| 85 | 3300005295 | Ga0065707_10084402 | Ga0065707_100844022 | 470 |
| 86 | 3300005549 | Ga0070704_100007065 | Ga0070704_1000070655 | 470 |
| 87 | 3300014326 | Ga0157380_10008634 | Ga0157380_100086347 | 470 |
| 88 | 3300050512 | nmdc:mga0n895_13334_c1 | nmdc:mga0n895_13334_c1_3408_4898 | 471 |
| 89 | 3300050513 | nmdc:mga0rr50_85400_c1 | nmdc:mga0rr50_85400_c1_696_2186 | 471 |
| 90 | 3300005330 | Ga0070690_100043432 | Ga0070690_1000434322 | 472 |
| 91 | 3300005340 | Ga0070689_100044734 | Ga0070689_1000447342 | 472 |
| 92 | 3300005343 | Ga0070687_100054640 | Ga0070687_1000546402 | 472 |
| 93 | 3300005347 | Ga0070668_100037898 | Ga0070668_1000378982 | 472 |
| 94 | 3300005364 | Ga0070673_100056160 | Ga0070673_1000561602 | 472 |
| 95 | 3300005365 | Ga0070688_100027873 | Ga0070688_1000278733 | 472 |
| 96 | 3300005367 | Ga0070667_100172988 | Ga0070667_1001729882 | 472 |
| 97 | 3300005457 | Ga0070662_100047361 | Ga0070662_1000473612 | 472 |
| 98 | 3300005535 | Ga0070684_100059440 | Ga0070684_1000594403 | 472 |
| 99 | 3300005544 | Ga0070686_100010900 | Ga0070686_1000109001 | 472 |
| 100 | 3300005548 | Ga0070665_100051025 | Ga0070665_1000510252 | 472 |
| 101 | 3300005617 | Ga0068859_100168044 | Ga0068859_1001680442 | 472 |
| 102 | 3300005618 | Ga0068864_100179018 | Ga0068864_1001790182 | 472 |
| 103 | 3300005718 | Ga0068866_10026282 | Ga0068866_100262822 | 472 |
| 104 | 3300006237 | Ga0097621_100007781 | Ga0097621_10000778110 | 472 |
| 105 | 3300006358 | Ga0068871_100001033 | Ga0068871_1000010336 | 472 |
| 106 | 3300006931 | Ga0097620_100168042 | Ga0097620_1001680422 | 472 |
| 107 | 3300009094 | Ga0111539_10128268 | Ga0111539_101282682 | 472 |
| 108 | 3300009176 | Ga0105242_10006775 | Ga0105242_100067752 | 472 |
| 109 | 3300009177 | Ga0105248_10133718 | Ga0105248_101337182 | 472 |
| 110 | 3300014969 | Ga0157376_10023137 | Ga0157376_100231374 | 472 |
| 111 | 3300025893 | Ga0207682_10000452 | Ga0207682_1000045214 | 472 |
| 112 | 3300025901 | Ga0207688_10025438 | Ga0207688_100254382 | 472 |
| 113 | 3300025903 | Ga0207680_10068210 | Ga0207680_100682102 | 472 |
| 114 | 3300025907 | Ga0207645_10016697 | Ga0207645_100166972 | 472 |
| 115 | 3300025918 | Ga0207662_10010902 | Ga0207662_100109024 | 472 |
| 116 | 3300025935 | Ga0207709_10008899 | Ga0207709_100088992 | 472 |
| 117 | 3300026075 | Ga0207708_10001857 | Ga0207708_1000185710 | 472 |
| 118 | 3300026095 | Ga0207676_10110261 | Ga0207676_101102612 | 472 |
| 119 | 3300026116 | Ga0207674_10156594 | Ga0207674_101565942 | 472 |
| 120 | 3300026121 | Ga0207683_10015331 | Ga0207683_100153312 | 472 |
| 121 | 3300027907 | Ga0207428_10103824 | Ga0207428_101038242 | 472 |
| 122 | 3300028381 | Ga0268264_10143362 | Ga0268264_101433622 | 472 |
| 123 | 3300049577 | Ga0501041_0023137 | Ga0501041_0023137_548_2032 | 472 |
| 124 | 3300049743 | Ga0501081_0022530 | Ga0501081_0022530_790_2274 | 472 |
| 125 | 3300042436 | Ga0439435_0007762 | Ga0439435_0007762_151_1641 | 473 |
| 126 | 3300042461 | Ga0439460_0011514 | Ga0439460_0011514_430_1920 | 473 |
| 127 | 3300005549 | Ga0070704_100015035 | Ga0070704_1000150352 | 475 |
| 128 | 3300006871 | Ga0075434_100009366 | Ga0075434_1000093662 | 475 |
| 129 | 3300007076 | Ga0075435_100078849 | Ga0075435_1000788493 | 475 |
| 130 | 3300026095 | Ga0207676_10137551 | Ga0207676_101375512 | 475 |
| 131 | 3300049705 | Ga0501225_0000850 | Ga0501225_0000850_4979_6469 | 475 |
| 132 | 3300050512 | nmdc:mga0n895_866_c1 | nmdc:mga0n895_866_c1_3968_5449 | 475 |
| 133 | 3300050513 | nmdc:mga0rr50_59832_c1 | nmdc:mga0rr50_59832_c1_1154_2635 | 475 |
| 134 | 3300005536 | Ga0070697_100003127 | Ga0070697_1000031273 | 476 |
| 135 | 3300005842 | Ga0068858_100007556 | Ga0068858_10000755614 | 476 |
| 136 | 3300045976 | Ga0466967_0096689 | Ga0466967_0096689_47_1534 | 476 |
| 137 | iso_pu_bacteria | 2547132103 | 2547371690 | 476 |
| 138 | iso_pu_bacteria | 2843690924 | 2843692921 | 476 |
| 139 | iso_pu_bacteria | 2998344455 | 2998346750 | 476 |
| 140 | 3300027462 | Ga0210000_1004952 | Ga0210000_10049521 | 477 |
| 141 | 3300039447 | Ga0436361_0368594 | Ga0436361_0368594_3123_4586 | 477 |
| 142 | 3300049576 | Ga0501040_0126499 | Ga0501040_0126499_293_1780 | 477 |
| 143 | 3300049587 | Ga0501071_0021240 | Ga0501071_0021240_421_1908 | 477 |
| 144 | 3300049824 | Ga0501045_0114604 | Ga0501045_0114604_331_1818 | 477 |
| 145 | 3300050514 | nmdc:mga08x19_41311_c1 | nmdc:mga08x19_41311_c1_1303_2793 | 477 |
| 146 | iso_pu_bacteria | 2846033681 | 2846036736 | 477 |
| 147 | iso_pu_bacteria | 2846037992 | 2846042160 | 477 |
| 148 | 3300003771 | Ga0055526_1010786 | Ga0055526_10107862 | 478 |
| 149 | 3300003773 | Ga0055537_1000149 | Ga0055537_100014935 | 478 |
| 150 | 3300003781 | Ga0055536_1000957 | Ga0055536_100095711 | 478 |
| 151 | 3300003784 | Ga0055534_1000968 | Ga0055534_10009682 | 478 |
| 152 | 3300003856 | Ga0058692_1000004 | Ga0058692_1000004139 | 478 |
| 153 | 3300003856 | Ga0058692_1000049 | Ga0058692_10000491 | 478 |
| 154 | 3300005289 | Ga0065704_10073361 | Ga0065704_100733611 | 478 |
| 155 | 3300005331 | Ga0070670_100000924 | Ga0070670_10000092421 | 478 |
| 156 | 3300005406 | Ga0070703_10016875 | Ga0070703_100168752 | 478 |
| 157 | 3300005518 | Ga0070699_100021479 | Ga0070699_1000214794 | 478 |
| 158 | 3300005536 | Ga0070697_100014791 | Ga0070697_1000147912 | 478 |
| 159 | 3300005545 | Ga0070695_100008154 | Ga0070695_1000081543 | 478 |
| 160 | 3300005546 | Ga0070696_100012458 | Ga0070696_1000124581 | 478 |
| 161 | 3300005548 | Ga0070665_100099982 | Ga0070665_1000999822 | 478 |
| 162 | 3300005617 | Ga0068859_100145129 | Ga0068859_1001451292 | 478 |
| 163 | 3300005985 | Ga0081539_10000365 | Ga0081539_1000036589 | 478 |
| 164 | 3300006914 | Ga0075436_100000087 | Ga0075436_10000008755 | 478 |
| 165 | 3300006931 | Ga0097620_100145127 | Ga0097620_1001451272 | 478 |
| 166 | 3300009011 | Ga0105251_10000077 | Ga0105251_1000007769 | 478 |
| 167 | 3300009011 | Ga0105251_10012544 | Ga0105251_100125445 | 478 |
| 168 | 3300014497 | Ga0182008_10001732 | Ga0182008_100017326 | 478 |
| 169 | 3300015262 | Ga0182007_10000052 | Ga0182007_1000005247 | 478 |
| 170 | 3300015265 | Ga0182005_1000929 | Ga0182005_100092913 | 478 |
| 171 | 3300025261 | Ga0209233_1002007 | Ga0209233_10020072 | 478 |
| 172 | 3300025263 | Ga0209565_1000051 | Ga0209565_1000051177 | 478 |
| 173 | 3300025273 | Ga0209673_1000069 | Ga0209673_100006955 | 478 |
| 174 | 3300025284 | Ga0209130_1008270 | Ga0209130_10082701 | 478 |
| 175 | 3300025291 | Ga0209675_1000007 | Ga0209675_1000007276 | 478 |
| 176 | 3300025292 | Ga0209676_1000018 | Ga0209676_1000018298 | 478 |
| 177 | 3300025292 | Ga0209676_1001990 | Ga0209676_10019909 | 478 |
| 178 | 3300025292 | Ga0209676_1003602 | Ga0209676_10036022 | 478 |
| 179 | 3300025295 | Ga0209564_1000061 | Ga0209564_100006149 | 478 |
| 180 | 3300025298 | Ga0209050_1000109 | Ga0209050_100010916 | 478 |
| 181 | 3300025299 | Ga0209256_1002963 | Ga0209256_10029636 | 478 |
| 182 | 3300025304 | Ga0209257_1000035 | Ga0209257_1000035298 | 478 |
| 183 | 3300025304 | Ga0209257_1007768 | Ga0209257_10077685 | 478 |
| 184 | 3300025735 | Ga0207713_1000381 | Ga0207713_100038120 | 478 |
| 185 | 3300025735 | Ga0207713_1011934 | Ga0207713_10119342 | 478 |
| 186 | 3300025925 | Ga0207650_10003700 | Ga0207650_100037001 | 478 |
| 187 | 3300025935 | Ga0207709_10003140 | Ga0207709_100031404 | 478 |
| 188 | 3300027312 | Ga0209371_1000018 | Ga0209371_1000018254 | 478 |
| 189 | 3300027312 | Ga0209371_1000152 | Ga0209371_10001521 | 478 |
| 190 | 3300028379 | Ga0268266_10151984 | Ga0268266_101519842 | 478 |
| 191 | 3300030500 | Ga0268256_1000016 | Ga0268256_1000016254 | 478 |
| 192 | 3300030500 | Ga0268256_1000127 | Ga0268256_1000127107 | 478 |
| 193 | 3300030742 | Ga0316183_1052664 | Ga0316183_10526642 | 478 |
| 194 | 3300038705 | Ga0237819_01221 | Ga0237819_01221_462_1952 | 478 |
| 195 | 3300041459 | Ga0451800_0939899 | Ga0451800_0939899_1098_2573 | 478 |
| 196 | 3300041462 | Ga0451806_394025 | Ga0451806_394025_411_1886 | 478 |
| 197 | 3300041486 | Ga0451807_0921339 | Ga0451807_0921339_1612_3087 | 478 |
| 198 | 3300046558 | Ga0495633_0003190 | Ga0495633_0003190_5284_6774 | 478 |
| 199 | 3300047320 | Ga0495672_0000273 | Ga0495672_0000273_7162_8637 | 478 |
| 200 | 3300048920 | Ga0496117_0005077 | Ga0496117_0005077_4169_5644 | 478 |
| 201 | 3300048920 | Ga0496117_0007293 | Ga0496117_0007293_6025_7500 | 478 |
| 202 | 3300048920 | Ga0496117_0008132 | Ga0496117_0008132_8207_9682 | 478 |
| 203 | 3300048921 | Ga0496118_0009520 | Ga0496118_0009520_8282_9757 | 478 |
| 204 | 3300048921 | Ga0496118_0011733 | Ga0496118_0011733_6618_8093 | 478 |
| 205 | 3300048922 | Ga0496119_0000174 | Ga0496119_0000174_47808_49283 | 478 |
| 206 | 3300048922 | Ga0496119_0001413 | Ga0496119_0001413_14380_15855 | 478 |
| 207 | 3300048923 | Ga0496120_0000162 | Ga0496120_0000162_28041_29516 | 478 |
| 208 | 3300048923 | Ga0496120_0000253 | Ga0496120_0000253_48298_49773 | 478 |
| 209 | 3300048924 | Ga0496121_0007552 | Ga0496121_0007552_3291_4766 | 478 |
| 210 | 3300048925 | Ga0496122_0000049 | Ga0496122_0000049_123044_124519 | 478 |
| 211 | 3300048925 | Ga0496122_0027525 | Ga0496122_0027525_132_1607 | 478 |
| 212 | 3300048926 | Ga0496123_0000042 | Ga0496123_0000042_129941_131416 | 478 |
| 213 | 3300048926 | Ga0496123_0014378 | Ga0496123_0014378_132_1607 | 478 |
| 214 | 3300048927 | Ga0496124_0000621 | Ga0496124_0000621_27254_28729 | 478 |
| 215 | 3300048927 | Ga0496124_0002188 | Ga0496124_0002188_1225_2700 | 478 |
| 216 | 3300048928 | Ga0496125_0013126 | Ga0496125_0013126_3323_4798 | 478 |
| 217 | 3300048928 | Ga0496125_0036192 | Ga0496125_0036192_127_1602 | 478 |
| 218 | 3300048929 | Ga0496126_0002736 | Ga0496126_0002736_16870_18345 | 478 |
| 219 | 3300049741 | Ga0501079_0035142 | Ga0501079_0035142_2024_3517 | 478 |
| 220 | 3300050514 | nmdc:mga08x19_1067_c1 | nmdc:mga08x19_1067_c1_1624_3117 | 478 |
| 221 | 3300050514 | nmdc:mga08x19_32861_c1 | nmdc:mga08x19_32861_c1_530_2023 | 478 |
| 222 | iso_pu_bacteria | 2547132130 | 2547503154 | 478 |
| 223 | iso_pu_bacteria | 2576861471 | 2578456647 | 478 |
| 224 | iso_pu_bacteria | 2747842428 | 2747949039 | 478 |
| 225 | iso_pu_bacteria | 2765235840 | 2765580841 | 478 |
| 226 | iso_pu_bacteria | 2816332141 | 2816518172 | 478 |
| 227 | iso_pu_bacteria | 2818991457 | 2819662199 | 478 |
| 228 | iso_pu_bacteria | 2842391507 | 2842395130 | 478 |
| 229 | iso_pu_bacteria | 2842757796 | 2842760977 | 478 |
| 230 | iso_pu_bacteria | 2852649853 | 2852651851 | 478 |
| 231 | iso_pu_bacteria | 2852684882 | 2852688096 | 478 |
| 232 | iso_pu_bacteria | 2857442823 | 2857444916 | 478 |
| 233 | iso_pu_bacteria | 2874220319 | 2874223485 | 478 |
| 234 | iso_pu_bacteria | 2919089067 | 2919092247 | 478 |
| 235 | iso_pu_bacteria | 2919130084 | 2919132835 | 478 |
| 236 | iso_pu_bacteria | 2919134579 | 2919136702 | 478 |
| 237 | iso_pu_bacteria | 2928496128 | 2928497131 | 478 |
| 238 | iso_pu_bacteria | 2929195423 | 2929199528 | 478 |
| 239 | iso_pu_bacteria | 2931380184 | 2931383103 | 478 |
| 240 | iso_pu_bacteria | 2937610967 | 2937614033 | 478 |
| 241 | iso_pu_bacteria | 2939589442 | 2939590120 | 478 |
| 242 | iso_pu_bacteria | 2939622612 | 2939623742 | 478 |
| 243 | iso_pu_bacteria | 2939626828 | 2939630799 | 478 |
| 244 | iso_pu_bacteria | 2941475908 | 2941478488 | 478 |
| 245 | iso_pu_bacteria | 2961047084 | 2961050249 | 478 |
| 246 | iso_pu_bacteria | 2961064222 | 2961064605 | 478 |
| 247 | iso_pu_bacteria | 2974307012 | 2974307278 | 478 |
| 248 | iso_pu_bacteria | 2977247770 | 2977248025 | 478 |
| 249 | iso_pu_bacteria | 2984514374 | 2984517521 | 478 |
| 250 | iso_pu_bacteria | 8002869464 | 8002869860 | 478 |
| 251 | iso_pu_bacteria | 8021622325 | 8021625403 | 478 |
| 252 | iso_pu_bacteria | 8021626552 | 8021628456 | 478 |
| 253 | iso_pu_bacteria | 8021648035 | 8021649294 | 478 |
| 254 | 3300031250 | Ga0265331_10015958 | Ga0265331_100159582 | 479 |
| 255 | 3300035398 | Ga0316574_0075565 | Ga0316574_0075565_169_1644 | 479 |
| 256 | 3300046501 | Ga0495607_0034231 | Ga0495607_0034231_111_1601 | 479 |
| 257 | 3300046507 | Ga0495606_0015923 | Ga0495606_0015923_2294_3784 | 479 |
| 258 | 3300048927 | Ga0496124_0000034 | Ga0496124_0000034_221557_223047 | 479 |
| 259 | iso_pu_bacteria | 2842780639 | 2842782073 | 479 |
| 260 | 3300005340 | Ga0070689_100146099 | Ga0070689_1001460992 | 480 |
| 261 | 3300005617 | Ga0068859_100026648 | Ga0068859_1000266484 | 480 |
| 262 | 3300006931 | Ga0097620_100026650 | Ga0097620_1000266505 | 480 |
| 263 | 3300025936 | Ga0207670_10039174 | Ga0207670_100391742 | 480 |
| 264 | 3300036401 | Ga0373937_0098532 | Ga0373937_0098532_97_1593 | 480 |
| 265 | 3300039437 | Ga0436365_0355590 | Ga0436365_0355590_421_1869 | 480 |
| 266 | 3300046684 | Ga0495669_0002353 | Ga0495669_0002353_2109_3617 | 480 |
| 267 | 3300050511 | nmdc:mga08y16_18475_c1 | nmdc:mga08y16_18475_c1_1911_3413 | 480 |
| 268 | 3300013297 | Ga0157378_10014135 | Ga0157378_100141354 | 481 |
| 269 | 3300028666 | Ga0265336_10006403 | Ga0265336_100064033 | 481 |
| 270 | 3300029957 | Ga0265324_10000002 | Ga0265324_10000002122 | 481 |
| 271 | 3300029957 | Ga0265324_10000616 | Ga0265324_100006165 | 481 |
| 272 | 3300031241 | Ga0265325_10002841 | Ga0265325_100028418 | 481 |
| 273 | 3300031241 | Ga0265325_10007848 | Ga0265325_100078483 | 481 |
| 274 | 3300031251 | Ga0265327_10003217 | Ga0265327_1000321710 | 481 |
| 275 | 3300031251 | Ga0265327_10015677 | Ga0265327_100156776 | 481 |
| 276 | 3300031665 | Ga0316575_10001144 | Ga0316575_100011449 | 481 |
| 277 | 3300031711 | Ga0265314_10001144 | Ga0265314_100011445 | 481 |
| 278 | 3300031711 | Ga0265314_10016503 | Ga0265314_100165032 | 481 |
| 279 | 3300031711 | Ga0265314_10037974 | Ga0265314_100379742 | 481 |
| 280 | 3300041413 | Ga0439465_0000332 | Ga0439465_0000332_4360_5880 | 481 |
| 281 | 3300042007 | Ga0439449_0000008 | Ga0439449_0000008_43481_45001 | 481 |
| 282 | 3300042876 | Ga0451577_0000002 | Ga0451577_0000002_1440781_1442268 | 481 |
| 283 | 3300042876 | Ga0451577_0118655 | Ga0451577_0118655_268_1773 | 481 |
| 284 | 3300044673 | Ga0453683_0000013 | Ga0453683_0000013_81338_82825 | 481 |
| 285 | 3300044712 | Ga0453684_0000002 | Ga0453684_0000002_289108_290595 | 481 |
| 286 | 3300044712 | Ga0453684_0000040 | Ga0453684_0000040_412832_414319 | 481 |
| 287 | 3300044712 | Ga0453684_0010268 | Ga0453684_0010268_10724_12211 | 481 |
| 288 | 3300045051 | Ga0451576_0000037 | Ga0451576_0000037_81579_83066 | 481 |
| 289 | 3300045051 | Ga0451576_0002868 | Ga0451576_0002868_12470_13957 | 481 |
| 290 | 3300045051 | Ga0451576_0005999 | Ga0451576_0005999_4507_5994 | 481 |
| 291 | 3300045051 | Ga0451576_0023354 | Ga0451576_0023354_1627_3132 | 481 |
| 292 | 3300045051 | Ga0451576_0024169 | Ga0451576_0024169_4268_5755 | 481 |
| 293 | 3300045051 | Ga0451576_0099937 | Ga0451576_0099937_1469_2956 | 481 |
| 294 | iso_pu_bacteria | 2842854478 | 2842855322 | 481 |
| 295 | 3300005330 | Ga0070690_100001405 | Ga0070690_10000140512 | 482 |
| 296 | 3300005334 | Ga0068869_100000144 | Ga0068869_10000014428 | 482 |
| 297 | 3300005336 | Ga0070680_100006357 | Ga0070680_1000063579 | 482 |
| 298 | 3300005338 | Ga0068868_100003765 | Ga0068868_1000037658 | 482 |
| 299 | 3300005340 | Ga0070689_100002042 | Ga0070689_10000204210 | 482 |
| 300 | 3300005341 | Ga0070691_10002693 | Ga0070691_100026935 | 482 |
| 301 | 3300005343 | Ga0070687_100000379 | Ga0070687_10000037916 | 482 |
| 302 | 3300005345 | Ga0070692_10001458 | Ga0070692_100014587 | 482 |
| 303 | 3300005353 | Ga0070669_100107301 | Ga0070669_1001073012 | 482 |
| 304 | 3300005438 | Ga0070701_10004456 | Ga0070701_100044563 | 482 |
| 305 | 3300005440 | Ga0070705_100001733 | Ga0070705_1000017333 | 482 |
| 306 | 3300005441 | Ga0070700_100001920 | Ga0070700_1000019202 | 482 |
| 307 | 3300005444 | Ga0070694_100002837 | Ga0070694_1000028378 | 482 |
| 308 | 3300005459 | Ga0068867_100001723 | Ga0068867_1000017237 | 482 |
| 309 | 3300005544 | Ga0070686_100000491 | Ga0070686_1000004918 | 482 |
| 310 | 3300005545 | Ga0070695_100000326 | Ga0070695_10000032618 | 482 |
| 311 | 3300005546 | Ga0070696_100002746 | Ga0070696_1000027467 | 482 |
| 312 | 3300005546 | Ga0070696_100011578 | Ga0070696_1000115786 | 482 |
| 313 | 3300005547 | Ga0070693_100000206 | Ga0070693_10000020616 | 482 |
| 314 | 3300005578 | Ga0068854_100002729 | Ga0068854_10000272913 | 482 |
| 315 | 3300005614 | Ga0068856_100011701 | Ga0068856_1000117017 | 482 |
| 316 | 3300005615 | Ga0070702_100000102 | Ga0070702_10000010218 | 482 |
| 317 | 3300005617 | Ga0068859_100001522 | Ga0068859_1000015229 | 482 |
| 318 | 3300005618 | Ga0068864_100176130 | Ga0068864_1001761302 | 482 |
| 319 | 3300005718 | Ga0068866_10001257 | Ga0068866_1000125713 | 482 |
| 320 | 3300005719 | Ga0068861_100000786 | Ga0068861_1000007868 | 482 |
| 321 | 3300005843 | Ga0068860_100003981 | Ga0068860_10000398113 | 482 |
| 322 | 3300005844 | Ga0068862_100002040 | Ga0068862_1000020408 | 482 |
| 323 | 3300006237 | Ga0097621_100001841 | Ga0097621_10000184112 | 482 |
| 324 | 3300006358 | Ga0068871_100004012 | Ga0068871_10000401211 | 482 |
| 325 | 3300006844 | Ga0075428_100009824 | Ga0075428_1000098244 | 482 |
| 326 | 3300006852 | Ga0075433_10005779 | Ga0075433_100057792 | 482 |
| 327 | 3300006871 | Ga0075434_100004040 | Ga0075434_1000040408 | 482 |
| 328 | 3300006880 | Ga0075429_100000145 | Ga0075429_10000014526 | 482 |
| 329 | 3300006881 | Ga0068865_100000409 | Ga0068865_1000004097 | 482 |
| 330 | 3300006914 | Ga0075436_100001016 | Ga0075436_10000101615 | 482 |
| 331 | 3300006931 | Ga0097620_100001522 | Ga0097620_1000015229 | 482 |
| 332 | 3300007076 | Ga0075435_100001994 | Ga0075435_1000019945 | 482 |
| 333 | 3300009094 | Ga0111539_10070301 | Ga0111539_100703013 | 482 |
| 334 | 3300009098 | Ga0105245_10003008 | Ga0105245_100030088 | 482 |
| 335 | 3300009147 | Ga0114129_10000393 | Ga0114129_1000039317 | 482 |
| 336 | 3300009148 | Ga0105243_10000967 | Ga0105243_1000096718 | 482 |
| 337 | 3300009177 | Ga0105248_10137907 | Ga0105248_101379072 | 482 |
| 338 | 3300009553 | Ga0105249_10002850 | Ga0105249_100028509 | 482 |
| 339 | 3300013297 | Ga0157378_10000871 | Ga0157378_1000087126 | 482 |
| 340 | 3300014969 | Ga0157376_10003706 | Ga0157376_100037064 | 482 |
| 341 | 3300025899 | Ga0207642_10007494 | Ga0207642_100074942 | 482 |
| 342 | 3300025917 | Ga0207660_10002001 | Ga0207660_100020017 | 482 |
| 343 | 3300025918 | Ga0207662_10000212 | Ga0207662_1000021227 | 482 |
| 344 | 3300025923 | Ga0207681_10116772 | Ga0207681_101167722 | 482 |
| 345 | 3300025927 | Ga0207687_10005384 | Ga0207687_100053847 | 482 |
| 346 | 3300025934 | Ga0207686_10001621 | Ga0207686_100016216 | 482 |
| 347 | 3300025935 | Ga0207709_10001622 | Ga0207709_1000162211 | 482 |
| 348 | 3300025936 | Ga0207670_10003445 | Ga0207670_100034453 | 482 |
| 349 | 3300025939 | Ga0207665_10039885 | Ga0207665_100398853 | 482 |
| 350 | 3300025942 | Ga0207689_10001581 | Ga0207689_1000158113 | 482 |
| 351 | 3300025949 | Ga0207667_10013574 | Ga0207667_100135746 | 482 |
| 352 | 3300025960 | Ga0207651_10118439 | Ga0207651_101184392 | 482 |
| 353 | 3300025961 | Ga0207712_10009895 | Ga0207712_100098952 | 482 |
| 354 | 3300025981 | Ga0207640_10008086 | Ga0207640_100080863 | 482 |
| 355 | 3300026023 | Ga0207677_10018038 | Ga0207677_100180383 | 482 |
| 356 | 3300026035 | Ga0207703_10003857 | Ga0207703_100038577 | 482 |
| 357 | 3300026075 | Ga0207708_10001389 | Ga0207708_100013898 | 482 |
| 358 | 3300026089 | Ga0207648_10001735 | Ga0207648_100017358 | 482 |
| 359 | 3300026095 | Ga0207676_10128474 | Ga0207676_101284742 | 482 |
| 360 | 3300026118 | Ga0207675_100000888 | Ga0207675_10000088826 | 482 |
| 361 | 3300027907 | Ga0207428_10000766 | Ga0207428_1000076625 | 482 |
| 362 | 3300028380 | Ga0268265_10003597 | Ga0268265_100035977 | 482 |
| 363 | 3300028381 | Ga0268264_10001772 | Ga0268264_100017727 | 482 |
| 364 | 3300031239 | Ga0265328_10000016 | Ga0265328_1000001688 | 482 |
| 365 | 3300035112 | Ga0373932_0001303 | Ga0373932_0001303_2962_4479 | 482 |
| 366 | 3300035398 | Ga0316574_0002271 | Ga0316574_0002271_1054_2592 | 482 |
| 367 | 3300035691 | Ga0373931_0011424 | Ga0373931_0011424_1887_3404 | 482 |
| 368 | 3300035691 | Ga0373931_0034589 | Ga0373931_0034589_639_2156 | 482 |
| 369 | 3300035695 | Ga0373927_0055857 | Ga0373927_0055857_104_1621 | 482 |
| 370 | 3300038726 | Ga0400490_04196 | Ga0400490_04196_4935_6446 | 482 |
| 371 | 3300045051 | Ga0451576_0004225 | Ga0451576_0004225_16177_17694 | 482 |
| 372 | 3300046455 | Ga0495603_0095965 | Ga0495603_0095965_133_1650 | 482 |
| 373 | 3300046475 | Ga0495639_0017849 | Ga0495639_0017849_23_1540 | 482 |
| 374 | 3300046535 | Ga0495586_0004479 | Ga0495586_0004479_3296_4813 | 482 |
| 375 | 3300046681 | Ga0495647_0006492 | Ga0495647_0006492_1104_2621 | 482 |
| 376 | 3300050507 | nmdc:mga05p37_775_c1 | nmdc:mga05p37_775_c1_31391_32908 | 482 |
| 377 | 3300050508 | nmdc:mga09592_684_c1 | nmdc:mga09592_684_c1_13685_15202 | 482 |
| 378 | 3300050512 | nmdc:mga0n895_1259_c1 | nmdc:mga0n895_1259_c1_5826_7343 | 482 |
| 379 | 3300050513 | nmdc:mga0rr50_4784_c1 | nmdc:mga0rr50_4784_c1_413_1930 | 482 |
| 380 | 3300050514 | nmdc:mga08x19_1837_c1 | nmdc:mga08x19_1837_c1_4131_5648 | 482 |
| 381 | 3300050515 | nmdc:mga0a205_1164_c1 | nmdc:mga0a205_1164_c1_7660_9177 | 482 |
| 382 | 3300005617 | Ga0068859_100053549 | Ga0068859_1000535495 | 483 |
| 383 | 3300006931 | Ga0097620_100053549 | Ga0097620_1000535495 | 483 |
| 384 | 3300035113 | Ga0373936_0014330 | Ga0373936_0014330_384_1898 | 483 |
| 385 | 3300035692 | Ga0373935_0002303 | Ga0373935_0002303_624_2138 | 483 |
| 386 | iso_pu_bacteria | 8001522603 | 8001525874 | 483 |
| 387 | 3300002737 | JGI25162J39368_1000324 | JGI25162J39368_100032417 | 484 |
| 388 | 3300031251 | Ga0265327_10004074 | Ga0265327_1000407414 | 484 |
| 389 | 3300031344 | Ga0265316_10010443 | Ga0265316_100104436 | 484 |
| 390 | 3300031691 | Ga0316579_10013311 | Ga0316579_100133113 | 484 |
| 391 | 3300031711 | Ga0265314_10013371 | Ga0265314_100133713 | 484 |
| 392 | 3300031728 | Ga0316578_10040101 | Ga0316578_100401013 | 484 |
| 393 | 3300032133 | Ga0316583_10005061 | Ga0316583_100050613 | 484 |
| 394 | 3300032133 | Ga0316583_10011643 | Ga0316583_100116433 | 484 |
| 395 | 3300032139 | Ga0316580_10013725 | Ga0316580_100137251 | 484 |
| 396 | 3300032168 | Ga0316593_10000230 | Ga0316593_100002308 | 484 |
| 397 | 3300032168 | Ga0316593_10001819 | Ga0316593_100018193 | 484 |
| 398 | 3300032168 | Ga0316593_10010640 | Ga0316593_100106402 | 484 |
| 399 | 3300033541 | Ga0316596_1000141 | Ga0316596_10001413 | 484 |
| 400 | 3300035398 | Ga0316574_0040331 | Ga0316574_0040331_522_2045 | 484 |
| 401 | 3300036712 | Ga0316584_0039597 | Ga0316584_0039597_1472_2971 | 484 |
| 402 | 3300037588 | Ga0316581_0010955 | Ga0316581_0010955_666_2165 | 484 |
| 403 | 3300038735 | Ga0400485_17163 | Ga0400485_17163_32057_33553 | 484 |
| 404 | 3300038741 | Ga0400488_50200 | Ga0400488_50200_5482_6978 | 484 |
| 405 | 3300038741 | Ga0400488_63642 | Ga0400488_63642_398_1906 | 484 |
| 406 | 3300038742 | Ga0400486_01662 | Ga0400486_01662_31977_33473 | 484 |
| 407 | 3300039062 | Ga0400483_216953 | Ga0400483_216953_1717_3282 | 484 |
| 408 | 3300039110 | Ga0400487_17601 | Ga0400487_17601_10064_11560 | 484 |
| 409 | 3300042876 | Ga0451577_0000096 | Ga0451577_0000096_114747_116231 | 484 |
| 410 | 3300044712 | Ga0453684_0003157 | Ga0453684_0003157_3112_4596 | 484 |
| 411 | 3300044712 | Ga0453684_0072447 | Ga0453684_0072447_1601_3085 | 484 |
| 412 | 3300045051 | Ga0451576_0000494 | Ga0451576_0000494_17782_19269 | 484 |
| 413 | 3300031665 | Ga0316575_10000487 | Ga0316575_100004874 | 485 |
| 414 | 3300031665 | Ga0316575_10008164 | Ga0316575_100081642 | 485 |
| 415 | 3300031665 | Ga0316575_10013846 | Ga0316575_100138463 | 485 |
| 416 | 3300031691 | Ga0316579_10000112 | Ga0316579_1000011218 | 485 |
| 417 | 3300031691 | Ga0316579_10014200 | Ga0316579_100142003 | 485 |
| 418 | 3300031727 | Ga0316576_10000941 | Ga0316576_1000094112 | 485 |
| 419 | 3300031727 | Ga0316576_10008009 | Ga0316576_100080092 | 485 |
| 420 | 3300031728 | Ga0316578_10000036 | Ga0316578_1000003620 | 485 |
| 421 | 3300031728 | Ga0316578_10042632 | Ga0316578_100426323 | 485 |
| 422 | 3300031733 | Ga0316577_10000097 | Ga0316577_100000972 | 485 |
| 423 | 3300032133 | Ga0316583_10010528 | Ga0316583_100105284 | 485 |
| 424 | 3300032133 | Ga0316583_10013578 | Ga0316583_100135782 | 485 |
| 425 | 3300032137 | Ga0316585_10000137 | Ga0316585_1000013715 | 485 |
| 426 | 3300032139 | Ga0316580_10000114 | Ga0316580_100001147 | 485 |
| 427 | 3300033541 | Ga0316596_1001863 | Ga0316596_10018634 | 485 |
| 428 | 3300035398 | Ga0316574_0003574 | Ga0316574_0003574_4023_5519 | 485 |
| 429 | 3300035398 | Ga0316574_0003652 | Ga0316574_0003652_1254_2744 | 485 |
| 430 | 3300036647 | Ga0316582_0000029 | Ga0316582_0000029_21333_22823 | 485 |
| 431 | 3300036647 | Ga0316582_0020407 | Ga0316582_0020407_669_2216 | 485 |
| 432 | 3300036712 | Ga0316584_0003738 | Ga0316584_0003738_3255_4745 | 485 |
| 433 | 3300036712 | Ga0316584_0033074 | Ga0316584_0033074_1196_2686 | 485 |
| 434 | 3300013104 | Ga0157370_10001229 | Ga0157370_1000122927 | 486 |
| 435 | 3300031727 | Ga0316576_10007815 | Ga0316576_100078157 | 486 |
| 436 | 3300032139 | Ga0316580_10001122 | Ga0316580_100011224 | 486 |
| 437 | 3300035398 | Ga0316574_0002543 | Ga0316574_0002543_5114_6601 | 486 |
| 438 | 3300039110 | Ga0400487_52635 | Ga0400487_52635_3251_4756 | 486 |
| 439 | 3300047472 | Ga0495686_0000120 | Ga0495686_0000120_40823_42334 | 487 |
| 440 | iso_pu_bacteria | 2946787523 | 2946788853 | 492 |
| 441 | 3300001989 | JGI24739J22299_10007399 | JGI24739J22299_100073992 | 493 |
| 442 | 3300025933 | Ga0207706_10006108 | Ga0207706_100061088 | 493 |
| 443 | 3300026041 | Ga0207639_10115453 | Ga0207639_101154532 | 493 |
| 444 | 3300026116 | Ga0207674_10006702 | Ga0207674_1000670212 | 493 |
| 445 | 3300031731 | Ga0307405_10031623 | Ga0307405_100316232 | 493 |
| 446 | iso_pu_bacteria | 2775507255 | 2778123901 | 496 |
| 447 | 3300005530 | Ga0070679_100010182 | Ga0070679_1000101822 | 498 |
| 448 | 3300026035 | Ga0207703_10050041 | Ga0207703_100500414 | 498 |
| 449 | 3300048919 | Ga0496116_0083051 | Ga0496116_0083051_243_1769 | 498 |
| 450 | iso_pu_bacteria | 2643221541 | 2643729329 | 498 |
| 451 | iso_pu_bacteria | 2643221606 | 2644045805 | 498 |
| 452 | iso_pu_bacteria | 2643221671 | 2644393382 | 498 |
| 453 | iso_pu_bacteria | 2990265787 | 2990266433 | 498 |
| 454 | iso_pu_bacteria | 2993693658 | 2993695774 | 498 |
| 455 | 3300001915 | JGI24741J21665_1000493 | JGI24741J21665_10004933 | 499 |
| 456 | 3300001979 | JGI24740J21852_10000918 | JGI24740J21852_100009184 | 499 |
| 457 | 3300001990 | JGI24737J22298_10000623 | JGI24737J22298_1000062310 | 499 |
| 458 | 3300001990 | JGI24737J22298_10002339 | JGI24737J22298_100023393 | 499 |
| 459 | 3300003215 | JGI25153J46596_10000002 | JGI25153J46596_10000002510 | 499 |
| 460 | 3300003759 | Ga0055525_1000051 | Ga0055525_100005113 | 499 |
| 461 | 3300003762 | Ga0055542_1000020 | Ga0055542_1000020130 | 499 |
| 462 | 3300003763 | Ga0055529_1000016 | Ga0055529_1000016217 | 499 |
| 463 | 3300005262 | Ga0065165_1005025 | Ga0065165_10050255 | 499 |
| 464 | 3300005327 | Ga0070658_10003444 | Ga0070658_1000344411 | 499 |
| 465 | 3300005328 | Ga0070676_10031406 | Ga0070676_100314062 | 499 |
| 466 | 3300005331 | Ga0070670_100000068 | Ga0070670_10000006829 | 499 |
| 467 | 3300005331 | Ga0070670_100032784 | Ga0070670_1000327843 | 499 |
| 468 | 3300005339 | Ga0070660_100010649 | Ga0070660_1000106495 | 499 |
| 469 | 3300005339 | Ga0070660_100086270 | Ga0070660_1000862702 | 499 |
| 470 | 3300005344 | Ga0070661_100004499 | Ga0070661_1000044992 | 499 |
| 471 | 3300005347 | Ga0070668_100031585 | Ga0070668_1000315852 | 499 |
| 472 | 3300005356 | Ga0070674_100000740 | Ga0070674_10000074011 | 499 |
| 473 | 3300005366 | Ga0070659_100006389 | Ga0070659_1000063895 | 499 |
| 474 | 3300005367 | Ga0070667_100000951 | Ga0070667_10000095124 | 499 |
| 475 | 3300005456 | Ga0070678_100000011 | Ga0070678_10000001163 | 499 |
| 476 | 3300005548 | Ga0070665_100000051 | Ga0070665_100000051211 | 499 |
| 477 | 3300005614 | Ga0068856_100084644 | Ga0068856_1000846443 | 499 |
| 478 | 3300005617 | Ga0068859_100001448 | Ga0068859_1000014484 | 499 |
| 479 | 3300005617 | Ga0068859_100111549 | Ga0068859_1001115492 | 499 |
| 480 | 3300005618 | Ga0068864_100000019 | Ga0068864_10000001931 | 499 |
| 481 | 3300005719 | Ga0068861_100000387 | Ga0068861_1000003872 | 499 |
| 482 | 3300005834 | Ga0068851_10015558 | Ga0068851_100155582 | 499 |
| 483 | 3300005841 | Ga0068863_100000015 | Ga0068863_10000001531 | 499 |
| 484 | 3300005844 | Ga0068862_100000094 | Ga0068862_10000009429 | 499 |
| 485 | 3300006931 | Ga0097620_100001448 | Ga0097620_1000014484 | 499 |
| 486 | 3300006931 | Ga0097620_100111552 | Ga0097620_1001115522 | 499 |
| 487 | 3300009011 | Ga0105251_10000853 | Ga0105251_1000085324 | 499 |
| 488 | 3300009101 | Ga0105247_10003627 | Ga0105247_100036278 | 499 |
| 489 | 3300009148 | Ga0105243_10000760 | Ga0105243_1000076025 | 499 |
| 490 | 3300009174 | Ga0105241_10007668 | Ga0105241_100076688 | 499 |
| 491 | 3300009177 | Ga0105248_10000311 | Ga0105248_1000031144 | 499 |
| 492 | 3300009551 | Ga0105238_10054388 | Ga0105238_100543882 | 499 |
| 493 | 3300009553 | Ga0105249_10000568 | Ga0105249_1000056826 | 499 |
| 494 | 3300013102 | Ga0157371_10000030 | Ga0157371_10000030195 | 499 |
| 495 | 3300013307 | Ga0157372_10221477 | Ga0157372_102214772 | 499 |
| 496 | 3300014968 | Ga0157379_10017827 | Ga0157379_100178272 | 499 |
| 497 | 3300015690 | Ga0183363_1005 | Ga0183363_100573 | 499 |
| 498 | 3300025230 | Ga0209563_100019 | Ga0209563_100019493 | 499 |
| 499 | 3300025246 | Ga0209646_1006000 | Ga0209646_10060002 | 499 |
| 500 | 3300025253 | Ga0209677_108363 | Ga0209677_1083631 | 499 |
| 501 | 3300025254 | Ga0209148_1000017 | Ga0209148_1000017531 | 499 |
| 502 | 3300025272 | Ga0209455_1000005 | Ga0209455_1000005531 | 499 |
| 503 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011307 | 499 |
| 504 | 3300025321 | Ga0207656_10000528 | Ga0207656_100005288 | 499 |
| 505 | 3300025900 | Ga0207710_10003244 | Ga0207710_100032445 | 499 |
| 506 | 3300025907 | Ga0207645_10028783 | Ga0207645_100287833 | 499 |
| 507 | 3300025909 | Ga0207705_10000982 | Ga0207705_1000098219 | 499 |
| 508 | 3300025914 | Ga0207671_10028579 | Ga0207671_100285794 | 499 |
| 509 | 3300025919 | Ga0207657_10089491 | Ga0207657_100894912 | 499 |
| 510 | 3300025920 | Ga0207649_10001162 | Ga0207649_100011627 | 499 |
| 511 | 3300025925 | Ga0207650_10000054 | Ga0207650_1000005446 | 499 |
| 512 | 3300025933 | Ga0207706_10011098 | Ga0207706_100110986 | 499 |
| 513 | 3300025935 | Ga0207709_10000031 | Ga0207709_1000003154 | 499 |
| 514 | 3300025937 | Ga0207669_10000073 | Ga0207669_1000007365 | 499 |
| 515 | 3300025937 | Ga0207669_10000718 | Ga0207669_1000071812 | 499 |
| 516 | 3300025941 | Ga0207711_10000017 | Ga0207711_10000017112 | 499 |
| 517 | 3300025945 | Ga0207679_10037342 | Ga0207679_100373423 | 499 |
| 518 | 3300025949 | Ga0207667_10000004 | Ga0207667_10000004340 | 499 |
| 519 | 3300025961 | Ga0207712_10000163 | Ga0207712_1000016348 | 499 |
| 520 | 3300025981 | Ga0207640_10002843 | Ga0207640_100028436 | 499 |
| 521 | 3300025986 | Ga0207658_10000223 | Ga0207658_1000022344 | 499 |
| 522 | 3300026041 | Ga0207639_10001031 | Ga0207639_100010318 | 499 |
| 523 | 3300026067 | Ga0207678_10000454 | Ga0207678_1000045424 | 499 |
| 524 | 3300026088 | Ga0207641_10000008 | Ga0207641_10000008145 | 499 |
| 525 | 3300026095 | Ga0207676_10000019 | Ga0207676_1000001929 | 499 |
| 526 | 3300026116 | Ga0207674_10001228 | Ga0207674_1000122824 | 499 |
| 527 | 3300026118 | Ga0207675_100000016 | Ga0207675_10000001626 | 499 |
| 528 | 3300026121 | Ga0207683_10000086 | Ga0207683_1000008667 | 499 |
| 529 | 3300026121 | Ga0207683_10091822 | Ga0207683_100918222 | 499 |
| 530 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022578 | 499 |
| 531 | 3300028380 | Ga0268265_10000011 | Ga0268265_10000011145 | 499 |
| 532 | 3300028786 | Ga0307517_10014006 | Ga0307517_100140062 | 499 |
| 533 | 3300028786 | Ga0307517_10041774 | Ga0307517_100417742 | 499 |
| 534 | 3300031456 | Ga0307513_10082859 | Ga0307513_100828592 | 499 |
| 535 | 3300031901 | Ga0307406_10015834 | Ga0307406_100158343 | 499 |
| 536 | 3300044706 | Ga0466964_0004827 | Ga0466964_0004827_1761_3275 | 499 |
| 537 | 3300046452 | Ga0495617_011142 | Ga0495617_011142_231_1739 | 499 |
| 538 | 3300046471 | Ga0495650_0000340 | Ga0495650_0000340_52981_54489 | 499 |
| 539 | 3300046492 | Ga0495585_0019033 | Ga0495585_0019033_43_1551 | 499 |
| 540 | 3300046506 | Ga0495583_0000996 | Ga0495583_0000996_10621_12129 | 499 |
| 541 | 3300046506 | Ga0495583_0017942 | Ga0495583_0017942_1240_2748 | 499 |
| 542 | 3300046506 | Ga0495583_0033284 | Ga0495583_0033284_732_2318 | 499 |
| 543 | 3300046507 | Ga0495606_0000824 | Ga0495606_0000824_36175_37683 | 499 |
| 544 | 3300046522 | Ga0495643_0001032 | Ga0495643_0001032_17787_19295 | 499 |
| 545 | 3300046522 | Ga0495643_0002465 | Ga0495643_0002465_8107_9693 | 499 |
| 546 | 3300046524 | Ga0495648_0000439 | Ga0495648_0000439_8894_10402 | 499 |
| 547 | 3300046525 | Ga0495663_0006151 | Ga0495663_0006151_1638_3152 | 499 |
| 548 | 3300046525 | Ga0495663_0008844 | Ga0495663_0008844_951_2459 | 499 |
| 549 | 3300046530 | Ga0495654_0000264 | Ga0495654_0000264_20657_22171 | 499 |
| 550 | 3300046557 | Ga0495622_0003931 | Ga0495622_0003931_1756_3264 | 499 |
| 551 | 3300046558 | Ga0495633_0003629 | Ga0495633_0003629_5619_7127 | 499 |
| 552 | 3300046616 | Ga0495668_0000007 | Ga0495668_0000007_233698_235206 | 499 |
| 553 | 3300046616 | Ga0495668_0000984 | Ga0495668_0000984_10878_12392 | 499 |
| 554 | 3300046660 | Ga0495625_0000583 | Ga0495625_0000583_8795_10303 | 499 |
| 555 | 3300046660 | Ga0495625_0038998 | Ga0495625_0038998_1405_2913 | 499 |
| 556 | 3300046660 | Ga0495625_0088204 | Ga0495625_0088204_424_1932 | 499 |
| 557 | 3300046684 | Ga0495669_0000286 | Ga0495669_0000286_27145_28653 | 499 |
| 558 | 3300046794 | Ga0495589_0036243 | Ga0495589_0036243_230_1744 | 499 |
| 559 | 3300046809 | Ga0495600_0004286 | Ga0495600_0004286_1122_2630 | 499 |
| 560 | 3300047323 | Ga0495683_0054044 | Ga0495683_0054044_448_1956 | 499 |
| 561 | 3300047443 | Ga0495687_000512 | Ga0495687_000512_16926_18434 | 499 |
| 562 | 3300047443 | Ga0495687_001133 | Ga0495687_001133_89_1597 | 499 |
| 563 | 3300047445 | Ga0495677_0003158 | Ga0495677_0003158_312_1898 | 499 |
| 564 | 3300048905 | Ga0496102_0001240 | Ga0496102_0001240_4172_5680 | 499 |
| 565 | 3300048906 | Ga0496103_0000307 | Ga0496103_0000307_8253_9761 | 499 |
| 566 | 3300048907 | Ga0496104_0058614 | Ga0496104_0058614_1277_2785 | 499 |
| 567 | 3300048908 | Ga0496105_0000190 | Ga0496105_0000190_18274_19782 | 499 |
| 568 | 3300048914 | Ga0496111_0011992 | Ga0496111_0011992_1420_2928 | 499 |
| 569 | 3300048917 | Ga0496114_0025500 | Ga0496114_0025500_444_1952 | 499 |
| 570 | 3300048918 | Ga0496115_0000251 | Ga0496115_0000251_28813_30321 | 499 |
| 571 | 3300048919 | Ga0496116_0003152 | Ga0496116_0003152_5305_6813 | 499 |
| 572 | 3300048920 | Ga0496117_0000182 | Ga0496117_0000182_32500_34008 | 499 |
| 573 | 3300048920 | Ga0496117_0003796 | Ga0496117_0003796_14196_15710 | 499 |
| 574 | 3300048921 | Ga0496118_0000125 | Ga0496118_0000125_94029_95537 | 499 |
| 575 | 3300048921 | Ga0496118_0000870 | Ga0496118_0000870_28609_30123 | 499 |
| 576 | 3300048924 | Ga0496121_0000906 | Ga0496121_0000906_17644_19152 | 499 |
| 577 | 3300048925 | Ga0496122_0015452 | Ga0496122_0015452_4078_5586 | 499 |
| 578 | 3300048927 | Ga0496124_0000082 | Ga0496124_0000082_40871_42379 | 499 |
| 579 | 3300048928 | Ga0496125_0000730 | Ga0496125_0000730_35030_36538 | 499 |
| 580 | 3300048929 | Ga0496126_0000221 | Ga0496126_0000221_28661_30169 | 499 |
| 581 | 3300053079 | Ga0500610_0001872 | Ga0500610_0001872_83_1591 | 499 |
| 582 | 3300053119 | Ga0500595_001141 | Ga0500595_001141_11231_12739 | 499 |
| 583 | 3300053130 | Ga0500642_0001053 | Ga0500642_0001053_1813_3321 | 499 |
| 584 | 3300053158 | Ga0500627_0001208 | Ga0500627_0001208_1523_3037 | 499 |
| 585 | 3300053730 | Ga0500645_000080 | Ga0500645_000080_75_1583 | 499 |
| 586 | iso_pu_bacteria | 2643221605 | 2644040612 | 499 |
| 587 | iso_pu_bacteria | 2848297114 | 2848299179 | 499 |
| 588 | 3300001915 | JGI24741J21665_1000154 | JGI24741J21665_10001546 | 500 |
| 589 | 3300001979 | JGI24740J21852_10001089 | JGI24740J21852_100010897 | 500 |
| 590 | 3300001989 | JGI24739J22299_10000294 | JGI24739J22299_1000029413 | 500 |
| 591 | 3300001990 | JGI24737J22298_10000124 | JGI24737J22298_1000012424 | 500 |
| 592 | 3300005564 | Ga0070664_100089999 | Ga0070664_1000899992 | 500 |
| 593 | 3300005578 | Ga0068854_100023221 | Ga0068854_1000232212 | 500 |
| 594 | 3300005614 | Ga0068856_100030426 | Ga0068856_1000304263 | 500 |
| 595 | 3300006195 | Ga0075366_10054515 | Ga0075366_100545152 | 500 |
| 596 | 3300009174 | Ga0105241_10001930 | Ga0105241_1000193013 | 500 |
| 597 | 3300009551 | Ga0105238_10107222 | Ga0105238_101072222 | 500 |
| 598 | 3300013104 | Ga0157370_10140493 | Ga0157370_101404932 | 500 |
| 599 | 3300025904 | Ga0207647_10011262 | Ga0207647_100112625 | 500 |
| 600 | 3300025913 | Ga0207695_10142308 | Ga0207695_101423081 | 500 |
| 601 | 3300025919 | Ga0207657_10014805 | Ga0207657_100148057 | 500 |
| 602 | 3300025981 | Ga0207640_10012020 | Ga0207640_100120202 | 500 |
| 603 | 3300025981 | Ga0207640_10024905 | Ga0207640_100249053 | 500 |
| 604 | 3300026041 | Ga0207639_10000387 | Ga0207639_100003873 | 500 |
| 605 | 3300026041 | Ga0207639_10003181 | Ga0207639_100031812 | 500 |
| 606 | 3300026067 | Ga0207678_10001685 | Ga0207678_100016856 | 500 |
| 607 | 3300026078 | Ga0207702_10039939 | Ga0207702_100399392 | 500 |
| 608 | 3300031548 | Ga0307408_100007451 | Ga0307408_1000074512 | 500 |
| 609 | 3300031548 | Ga0307408_100042351 | Ga0307408_1000423512 | 500 |
| 610 | 3300031548 | Ga0307408_100089007 | Ga0307408_1000890072 | 500 |
| 611 | 3300031731 | Ga0307405_10018615 | Ga0307405_100186154 | 500 |
| 612 | 3300031824 | Ga0307413_10019557 | Ga0307413_100195572 | 500 |
| 613 | 3300031901 | Ga0307406_10034146 | Ga0307406_100341462 | 500 |
| 614 | 3300032002 | Ga0307416_100029044 | Ga0307416_1000290443 | 500 |
| 615 | 3300046520 | Ga0495637_0002189 | Ga0495637_0002189_3053_4573 | 500 |
| 616 | 3300046522 | Ga0495643_0000146 | Ga0495643_0000146_71338_72858 | 500 |
| 617 | 3300046692 | Ga0495671_0000100 | Ga0495671_0000100_65956_67476 | 500 |
| 618 | 3300047470 | Ga0495681_0007326 | Ga0495681_0007326_2878_4398 | 500 |
| 619 | 3300049679 | Ga0501249_000356 | Ga0501249_000356_10336_11844 | 500 |
| 620 | 3300050493 | nmdc:mga0k408_41296_c1 | nmdc:mga0k408_41296_c1_457_1968 | 500 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pi1-assembly1.cif.gz_AAA | bacillus subtilis pabb | 0.9209 | 15 | 489 |
| 7qu9-assembly1.cif.gz_A | structure of aminodeoxychorismate synthase component 1 (pabb) from bacillus subtilis spizizenii. | 0.9204 | 15 | 489 |
| 7qu9-assembly1.cif.gz_A | structure of aminodeoxychorismate synthase component 1 (pabb) from bacillus subtilis spizizenii. | 0.9166 | 15 | 489 |
| 7qu9-assembly2.cif.gz_B | structure of aminodeoxychorismate synthase component 1 (pabb) from bacillus subtilis spizizenii. | 0.9123 | 15 | 489 |
| 7bvd-assembly1.cif.gz_B | anthranilate synthase component i (trpe)[mycolicibacterium smegmatis] | 0.9082 | 2 | 491 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O94582_1_484_3.60.120.10 | Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase | 0.9301 | 5 | 493 | 3.60.120.10 |
| af_O94582_1_484_3.60.120.10 | Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase | 0.9097 | 5 | 493 | 3.60.120.10 |
| af_A0A1D6LA98_50_603_3.60.120.10 | Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase | 0.9065 | 5 | 490 | 3.60.120.10 |
| 5cwaA00 | Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase | 0.9028 | 4 | 491 | 3.60.120.10 |
| af_Q2FYR9_3_467_3.60.120.10 | Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase | 0.8929 | 19 | 483 | 3.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A699Q9B5-F1-model_v4 | Anthranilate synthase component | 0.9927 | 291 | 399 |
GO:0000162
GO:0016829 GO:0046872 |
| AF-D2XTK3-F1-model_v4 | Anthranilate synthase component I (EC 4.1.3.27) | 0.9846 | 289 | 406 |
GO:0000162
GO:0004049 GO:0046872 |
| AF-L8GVC0-F1-model_v4 | Anthranilate synthase component I, putative | 0.9768 | 232 | 458 |
GO:0000162
|
| AF-A0A6I2VF08-F1-model_v4 | Anthranilate synthase component I | 0.9717 | 211 | 493 |
GO:0000162
GO:0016829 GO:0046872 |
| AF-A0A6N8LV50-F1-model_v4 | Anthranilate synthase component 1 (EC 4.1.3.27) | 0.9704 | 7 | 500 |
GO:0000162
GO:0004049 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar