F469923

General Info

Members Datasets Scaffolds Average Seq Length
620 373 570 494

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10013846|Ga0316575_100138463
Length 515
Sequence MTELDFDKLAKQGYTRIPVVAEVRADLYTPLAVYAKLANAPYSYLLESVVGGERFGRYSFIGLACAERIEARGSTVRRLLRDARGADVCLERLDDADPFEYVRSYLKRHRVAPVPAALRFGGGLVGYFGYETVGHIESRVLSGDKPDPLGTPDMLLLVSDELAVVDNVMGKLYLVVYADPQQPDAYRAASERLERLRARLLTPLPDSMVLALAVETPAGEPAPLSRTFTEEGFLEAVRRSKEYIFAGDCMQVQISQRTTRSFEAPPLTLYRALRGLNPSPYMFYFDFGDHHVVGASPEIMVRLAGDAITLRPIAGTRPRGRTEEEDARAAEDLLSDPKERAEHVMLIDLGRNDAGRVAAIGSVRVTEKMVIERYSHVMHIVSNVEARIAPGLDAIDVFKASFPAGTVSGAPKVRAMEIIDELEPVKRGVYSGAVGYLGFNGDMDVAIAIRTAVVKDGLLHVQAAAGIVADSDPQSEWQETQHKARAILRAAEVAAAEHASGAGVAQAAAPRSATR

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
9 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
10 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
11 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
12 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
13 2818991457 Xanthomonas translucens 569 Isolate Unclassified
14 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
15 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
16 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
17 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
18 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
19 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
20 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
21 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
22 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
23 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
24 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
25 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
26 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
27 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
28 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
29 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
30 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
31 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
32 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
33 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
34 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
35 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
36 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
37 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
38 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
39 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
40 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
41 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
42 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
43 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
44 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
45 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
46 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
47 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
50 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
53 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
62 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
65 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
68 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
69 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
73 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
82 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
85 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
86 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
93 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
94 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
95 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
96 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
97 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
98 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
99 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
150 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
151 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
225 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
226 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
227 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
235 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
238 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
247 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
248 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
249 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
259 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
260 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
261 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
262 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
263 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
264 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
265 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
266 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
267 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
271 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
272 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
273 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
274 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
275 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
276 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
277 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
278 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
279 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
280 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
281 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
293 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
294 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
298 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
315 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
330 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
341 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
346 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
362 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
363 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
364 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
365 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
369 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
370 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
371 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
372 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
373 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.13
Metatranscriptomes 0.81
Isolates 8.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 5.81
Nodule 0.16
Rhizoplane 1.61
Rhizosphere 80.48
Stem 0
Stem Tuber 0
Unclassified 11.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000154 3300001915 Bacteria 19576
2 JGI24741J21665_1000493 3300001915 Bacteria 12078
3 JGI24740J21852_10000918 3300001979 Bacteria 13085
4 JGI24740J21852_10001089 3300001979 Bacteria 12273
5 JGI24739J22299_10000294 3300001989 Bacteria 16860
6 JGI24739J22299_10007399 3300001989 Bacteria 4121
7 JGI24737J22298_10000124 3300001990 Bacteria 23444
8 JGI24737J22298_10000623 3300001990 Bacteria 12472
9 JGI24737J22298_10002339 3300001990 Bacteria 6758
10 JGI25162J39368_1000324 3300002737 Bacteria 41886
11 JGI25153J46596_10000002 3300003215 Bacteria 653569
12 Ga0055525_1000051 3300003759 Bacteria 240942
13 Ga0055542_1000020 3300003762 Bacteria 335745
14 Ga0055529_1000016 3300003763 Bacteria 364775
15 Ga0055526_1010786 3300003771 Bacteria 4206
16 Ga0055537_1000149 3300003773 Bacteria 52269
17 Ga0055536_1000957 3300003781 Bacteria 18468
18 Ga0055534_1000968 3300003784 Bacteria 12749
19 Ga0058692_1000004 3300003856 Bacteria 431119
20 Ga0058692_1000049 3300003856 Bacteria 108875
21 Ga0065165_1005025 3300005262 Bacteria 7733
22 Ga0065704_10073361 3300005289 Bacteria 7250
23 Ga0065707_10084402 3300005295 Bacteria 7235
24 Ga0070658_10003444 3300005327 Bacteria 13007
25 Ga0070676_10031406 3300005328 Bacteria 3035
26 Ga0070676_10049319 3300005328 Bacteria 2464
27 Ga0070690_100001405 3300005330 Bacteria 12568
28 Ga0070690_100043432 3300005330 Bacteria 2850
29 Ga0070670_100000068 3300005331 Bacteria 106494
30 Ga0070670_100000924 3300005331 Bacteria 23062
31 Ga0070670_100032784 3300005331 Bacteria 4475
32 Ga0068869_100000144 3300005334 Bacteria 35078
33 Ga0068869_100032962 3300005334 Bacteria 3654
34 Ga0070680_100006357 3300005336 Bacteria 8973
35 Ga0068868_100003765 3300005338 Bacteria 10594
36 Ga0070660_100010649 3300005339 Bacteria 6503
37 Ga0070660_100086270 3300005339 Bacteria 2470
38 Ga0070689_100002042 3300005340 Bacteria 13097
39 Ga0070689_100044734 3300005340 Bacteria 3406
40 Ga0070689_100146099 3300005340 Bacteria 1905
41 Ga0070691_10002693 3300005341 Bacteria 7914
42 Ga0070687_100000379 3300005343 Bacteria 15209
43 Ga0070687_100054640 3300005343 Bacteria 2082
44 Ga0070661_100004499 3300005344 Bacteria 9602
45 Ga0070692_10001458 3300005345 Bacteria 8600
46 Ga0070668_100031585 3300005347 Bacteria 4029
47 Ga0070668_100037898 3300005347 Bacteria 3683
48 Ga0070669_100008869 3300005353 Bacteria 7175
49 Ga0070669_100107301 3300005353 Bacteria 2115
50 Ga0070675_100033120 3300005354 Bacteria 4186
51 Ga0070674_100000740 3300005356 Bacteria 16717
52 Ga0070673_100056160 3300005364 Bacteria 3105
53 Ga0070688_100027873 3300005365 Bacteria 3366
54 Ga0070659_100006389 3300005366 Bacteria 8509
55 Ga0070667_100000951 3300005367 Bacteria 26620
56 Ga0070667_100172988 3300005367 Bacteria 1907
57 Ga0070703_10015864 3300005406 Bacteria 2159
58 Ga0070703_10016875 3300005406 Bacteria 2100
59 Ga0070701_10004456 3300005438 Bacteria 5677
60 Ga0070705_100001733 3300005440 Bacteria 11345
61 Ga0070700_100001920 3300005441 Bacteria 10508
62 Ga0070700_100002243 3300005441 Bacteria 9838
63 Ga0070694_100002837 3300005444 Bacteria 10295
64 Ga0070694_100011846 3300005444 Bacteria 5408
65 Ga0070678_100000011 3300005456 Bacteria 57959
66 Ga0070662_100047361 3300005457 Bacteria 3092
67 Ga0068867_100000755 3300005459 Bacteria 21746
68 Ga0068867_100001723 3300005459 Bacteria 15236
69 Ga0070699_100021479 3300005518 Bacteria 5566
70 Ga0070679_100010182 3300005530 Bacteria 8911
71 Ga0070684_100059440 3300005535 Bacteria 3342
72 Ga0070697_100003127 3300005536 Bacteria 12721
73 Ga0070697_100014791 3300005536 Bacteria 6124
74 Ga0070686_100000491 3300005544 Bacteria 23894
75 Ga0070686_100010900 3300005544 Bacteria 5145
76 Ga0070695_100000326 3300005545 Bacteria 24442
77 Ga0070695_100008154 3300005545 Bacteria 6207
78 Ga0070696_100002746 3300005546 Bacteria 11679
79 Ga0070696_100011578 3300005546 Bacteria 5911
80 Ga0070696_100012458 3300005546 Bacteria 5706
81 Ga0070693_100000206 3300005547 Bacteria 27416
82 Ga0070665_100000051 3300005548 Bacteria 249317
83 Ga0070665_100051025 3300005548 Bacteria 4150
84 Ga0070665_100099982 3300005548 Bacteria 2904
85 Ga0070704_100007065 3300005549 Bacteria 6666
86 Ga0070704_100015035 3300005549 Bacteria 4850
87 Ga0070664_100089999 3300005564 Bacteria 2655
88 Ga0068854_100002729 3300005578 Bacteria 10951
89 Ga0068854_100023221 3300005578 Bacteria 4234
90 Ga0068856_100011701 3300005614 Bacteria 8510
91 Ga0068856_100030426 3300005614 Bacteria 5277
92 Ga0068856_100084644 3300005614 Bacteria 3150
93 Ga0070702_100000102 3300005615 Bacteria 25587
94 Ga0068859_100001448 3300005617 Bacteria 24068
95 Ga0068859_100001522 3300005617 Bacteria 23651
96 Ga0068859_100026648 3300005617 Bacteria 5796
97 Ga0068859_100053549 3300005617 Bacteria 4059
98 Ga0068859_100111549 3300005617 Bacteria 2798
99 Ga0068859_100145129 3300005617 Bacteria 2448
100 Ga0068859_100168044 3300005617 Bacteria 2273
101 Ga0068864_100000019 3300005618 Bacteria 271650
102 Ga0068864_100176130 3300005618 Bacteria 1953
103 Ga0068864_100179018 3300005618 Bacteria 1937
104 Ga0068866_10001257 3300005718 Bacteria 10980
105 Ga0068866_10026282 3300005718 Bacteria 2747
106 Ga0068861_100000387 3300005719 Bacteria 25418
107 Ga0068861_100000786 3300005719 Bacteria 19092
108 Ga0068861_100024917 3300005719 Bacteria 4332
109 Ga0068851_10015558 3300005834 Bacteria 3626
110 Ga0068863_100000015 3300005841 Bacteria 214824
111 Ga0068858_100007556 3300005842 Bacteria 10504
112 Ga0068860_100003981 3300005843 Bacteria 15154
113 Ga0068862_100000094 3300005844 Bacteria 106159
114 Ga0068862_100002040 3300005844 Bacteria 18259
115 Ga0068862_100006958 3300005844 Bacteria 9385
116 Ga0081539_10000365 3300005985 Bacteria 99063
117 Ga0075366_10054515 3300006195 Bacteria 2375
118 Ga0097621_100001841 3300006237 Bacteria 14543
119 Ga0097621_100007781 3300006237 Bacteria 7688
120 Ga0068871_100001033 3300006358 Bacteria 18636
121 Ga0068871_100004012 3300006358 Bacteria 10174
122 Ga0075428_100009824 3300006844 Bacteria 10639
123 Ga0075428_100048579 3300006844 Bacteria 4657
124 Ga0075428_100048872 3300006844 Bacteria 4642
125 Ga0075430_100008118 3300006846 Bacteria 8872
126 Ga0075430_100024757 3300006846 Bacteria 5106
127 Ga0075433_10005779 3300006852 Bacteria 9738
128 Ga0075434_100004040 3300006871 Bacteria 13156
129 Ga0075434_100009366 3300006871 Bacteria 9130
130 Ga0075429_100000015 3300006880 Bacteria 78823
131 Ga0075429_100000145 3300006880 Bacteria 43529
132 Ga0075429_100043912 3300006880 Bacteria 3888
133 Ga0068865_100000409 3300006881 Bacteria 23878
134 Ga0068865_100003408 3300006881 Bacteria 9515
135 Ga0075436_100000087 3300006914 Bacteria 53435
136 Ga0075436_100001016 3300006914 Bacteria 18898
137 Ga0097620_100001448 3300006931 Bacteria 24068
138 Ga0097620_100001522 3300006931 Bacteria 23651
139 Ga0097620_100026650 3300006931 Bacteria 5796
140 Ga0097620_100053549 3300006931 Bacteria 4059
141 Ga0097620_100111552 3300006931 Bacteria 2798
142 Ga0097620_100145127 3300006931 Bacteria 2448
143 Ga0097620_100168042 3300006931 Bacteria 2273
144 Ga0075435_100001994 3300007076 Bacteria 13354
145 Ga0075435_100078849 3300007076 Bacteria 2702
146 Ga0105251_10000077 3300009011 Bacteria 93505
147 Ga0105251_10000853 3300009011 Bacteria 27320
148 Ga0105251_10012544 3300009011 Bacteria 4790
149 Ga0111539_10070301 3300009094 Bacteria 4133
150 Ga0111539_10117714 3300009094 Bacteria 3114
151 Ga0111539_10128268 3300009094 Bacteria 2971
152 Ga0105245_10003008 3300009098 Bacteria 15115
153 Ga0105247_10003627 3300009101 Bacteria 10024
154 Ga0114129_10000393 3300009147 Bacteria 51077
155 Ga0114129_10034102 3300009147 Bacteria 7189
156 Ga0105243_10000760 3300009148 Bacteria 30911
157 Ga0105243_10000967 3300009148 Bacteria 26790
158 Ga0105243_10002384 3300009148 Bacteria 15742
159 Ga0105241_10001930 3300009174 Bacteria 15685
160 Ga0105241_10007668 3300009174 Bacteria 7933
161 Ga0105242_10006775 3300009176 Bacteria 8833
162 Ga0105248_10000311 3300009177 Bacteria 57870
163 Ga0105248_10133718 3300009177 Bacteria 2798
164 Ga0105248_10137907 3300009177 Bacteria 2752
165 Ga0105238_10054388 3300009551 Bacteria 4019
166 Ga0105238_10107222 3300009551 Bacteria 2775
167 Ga0105249_10000568 3300009553 Bacteria 33920
168 Ga0105249_10002850 3300009553 Bacteria 14935
169 Ga0105249_10022150 3300009553 Bacteria 5690
170 Ga0157371_10000030 3300013102 Bacteria 241585
171 Ga0157370_10001229 3300013104 Bacteria 32093
172 Ga0157370_10140493 3300013104 Bacteria 2250
173 Ga0157369_10062843 3300013105 Bacteria 4000
174 Ga0157378_10000871 3300013297 Bacteria 27876
175 Ga0157378_10014135 3300013297 Bacteria 6985
176 Ga0157372_10221477 3300013307 Bacteria 2193
177 Ga0157375_10151793 3300013308 Bacteria 2453
178 Ga0157380_10008634 3300014326 Bacteria 7283
179 Ga0157380_10021837 3300014326 Bacteria 4807
180 Ga0182008_10001732 3300014497 Bacteria 14323
181 Ga0157379_10017827 3300014968 Bacteria 6255
182 Ga0157376_10003706 3300014969 Bacteria 10558
183 Ga0157376_10023137 3300014969 Bacteria 4858
184 Ga0182007_10000052 3300015262 Bacteria 95132
185 Ga0182005_1000929 3300015265 Bacteria 12788
186 Ga0183363_1005 3300015690 Bacteria 403020
187 Ga0209563_100019 3300025230 Bacteria 697828
188 Ga0209646_1006000 3300025246 Bacteria 2070
189 Ga0209677_108363 3300025253 Bacteria 2019
190 Ga0209148_1000017 3300025254 Bacteria 787064
191 Ga0209233_1002007 3300025261 Bacteria 7711
192 Ga0209565_1000051 3300025263 Bacteria 212284
193 Ga0209455_1000005 3300025272 Bacteria 1416756
194 Ga0209673_1000069 3300025273 Bacteria 243506
195 Ga0209130_1008270 3300025284 Bacteria 3088
196 Ga0209675_1000007 3300025291 Bacteria 683430
197 Ga0209676_1000018 3300025292 Bacteria 631385
198 Ga0209676_1000052 3300025292 Bacteria 371539
199 Ga0209676_1001990 3300025292 Bacteria 16187
200 Ga0209676_1003602 3300025292 Bacteria 9328
201 Ga0209564_1000061 3300025295 Bacteria 322795
202 Ga0209758_1000001 3300025297 Bacteria 1981790
203 Ga0209050_1000109 3300025298 Bacteria 219706
204 Ga0209256_1002963 3300025299 Bacteria 12710
205 Ga0209257_1000035 3300025304 Bacteria 631463
206 Ga0209257_1007768 3300025304 Bacteria 6370
207 Ga0207656_10000528 3300025321 Bacteria 12675
208 Ga0207713_1000381 3300025735 Bacteria 48031
209 Ga0207713_1011934 3300025735 Bacteria 4686
210 Ga0207682_10000452 3300025893 Bacteria 18894
211 Ga0207642_10007494 3300025899 Bacteria 3690
212 Ga0207642_10016700 3300025899 Bacteria 2772
213 Ga0207710_10003244 3300025900 Bacteria 7267
214 Ga0207688_10025438 3300025901 Bacteria 3250
215 Ga0207680_10068210 3300025903 Bacteria 2193
216 Ga0207680_10182958 3300025903 Bacteria 1418
217 Ga0207647_10011262 3300025904 Bacteria 6278
218 Ga0207645_10016697 3300025907 Bacteria 4855
219 Ga0207645_10028783 3300025907 Bacteria 3584
220 Ga0207645_10032467 3300025907 Bacteria 3355
221 Ga0207643_10040735 3300025908 Bacteria 2616
222 Ga0207705_10000982 3300025909 Bacteria 23269
223 Ga0207695_10142308 3300025913 Bacteria 2346
224 Ga0207671_10028579 3300025914 Bacteria 4166
225 Ga0207660_10002001 3300025917 Bacteria 13572
226 Ga0207662_10000212 3300025918 Bacteria 27141
227 Ga0207662_10010902 3300025918 Bacteria 5026
228 Ga0207657_10014805 3300025919 Bacteria 7593
229 Ga0207657_10089491 3300025919 Bacteria 2571
230 Ga0207649_10001162 3300025920 Bacteria 15873
231 Ga0207681_10002005 3300025923 Bacteria 13073
232 Ga0207681_10116772 3300025923 Bacteria 1950
233 Ga0207650_10000054 3300025925 Bacteria 162602
234 Ga0207650_10003700 3300025925 Bacteria 10455
235 Ga0207687_10005384 3300025927 Bacteria 8467
236 Ga0207664_10062411 3300025929 Bacteria 2976
237 Ga0207706_10006108 3300025933 Bacteria 11185
238 Ga0207706_10011098 3300025933 Bacteria 8211
239 Ga0207706_10074272 3300025933 Bacteria 2990
240 Ga0207686_10001621 3300025934 Bacteria 12603
241 Ga0207709_10000031 3300025935 Bacteria 329046
242 Ga0207709_10001622 3300025935 Bacteria 15298
243 Ga0207709_10003140 3300025935 Bacteria 9937
244 Ga0207709_10008899 3300025935 Bacteria 5543
245 Ga0207670_10003445 3300025936 Bacteria 8390
246 Ga0207670_10039174 3300025936 Bacteria 3102
247 Ga0207669_10000073 3300025937 Bacteria 51684
248 Ga0207669_10000718 3300025937 Bacteria 14326
249 Ga0207665_10039885 3300025939 Bacteria 3132
250 Ga0207711_10000017 3300025941 Bacteria 441730
251 Ga0207689_10001581 3300025942 Bacteria 21579
252 Ga0207689_10021185 3300025942 Bacteria 5465
253 Ga0207679_10037342 3300025945 Bacteria 3452
254 Ga0207667_10000004 3300025949 Bacteria 737718
255 Ga0207667_10013574 3300025949 Bacteria 9312
256 Ga0207651_10118439 3300025960 Bacteria 2003
257 Ga0207712_10000163 3300025961 Bacteria 68522
258 Ga0207712_10001259 3300025961 Bacteria 17480
259 Ga0207712_10009895 3300025961 Bacteria 6043
260 Ga0207668_10012088 3300025972 Bacteria 5273
261 Ga0207640_10002843 3300025981 Bacteria 9286
262 Ga0207640_10008086 3300025981 Bacteria 5819
263 Ga0207640_10012020 3300025981 Bacteria 4921
264 Ga0207640_10024905 3300025981 Bacteria 3616
265 Ga0207658_10000223 3300025986 Bacteria 59510
266 Ga0207677_10018038 3300026023 Bacteria 4227
267 Ga0207703_10003857 3300026035 Bacteria 12457
268 Ga0207703_10050041 3300026035 Bacteria 3380
269 Ga0207639_10000387 3300026041 Bacteria 30349
270 Ga0207639_10001031 3300026041 Bacteria 18936
271 Ga0207639_10003181 3300026041 Bacteria 11040
272 Ga0207639_10115453 3300026041 Bacteria 2196
273 Ga0207678_10000454 3300026067 Bacteria 37044
274 Ga0207678_10001685 3300026067 Bacteria 20296
275 Ga0207708_10001389 3300026075 Bacteria 18203
276 Ga0207708_10001857 3300026075 Bacteria 15564
277 Ga0207702_10039939 3300026078 Bacteria 3933
278 Ga0207641_10000008 3300026088 Bacteria 424415
279 Ga0207648_10001735 3300026089 Bacteria 23851
280 Ga0207648_10002409 3300026089 Bacteria 20139
281 Ga0207676_10000019 3300026095 Bacteria 305653
282 Ga0207676_10110261 3300026095 Bacteria 2301
283 Ga0207676_10128474 3300026095 Bacteria 2151
284 Ga0207676_10137551 3300026095 Bacteria 2087
285 Ga0207674_10001228 3300026116 Bacteria 33445
286 Ga0207674_10006702 3300026116 Bacteria 13524
287 Ga0207674_10156594 3300026116 Bacteria 2233
288 Ga0207675_100000016 3300026118 Bacteria 126353
289 Ga0207675_100000888 3300026118 Bacteria 29866
290 Ga0207683_10000086 3300026121 Bacteria 73510
291 Ga0207683_10015331 3300026121 Bacteria 6527
292 Ga0207683_10091822 3300026121 Bacteria 2705
293 Ga0209371_1000018 3300027312 Bacteria 614700
294 Ga0209371_1000152 3300027312 Bacteria 108927
295 Ga0210000_1002198 3300027462 Bacteria 2765
296 Ga0210000_1004952 3300027462 Bacteria 1929
297 Ga0207428_10000766 3300027907 Bacteria 36583
298 Ga0207428_10051385 3300027907 Bacteria 3295
299 Ga0207428_10077355 3300027907 Bacteria 2605
300 Ga0207428_10103824 3300027907 Bacteria 2194
301 Ga0268266_10000002 3300028379 Bacteria 3059047
302 Ga0268266_10151984 3300028379 Bacteria 2087
303 Ga0268265_10000011 3300028380 Bacteria 343832
304 Ga0268265_10001159 3300028380 Bacteria 23174
305 Ga0268265_10003597 3300028380 Bacteria 11066
306 Ga0268264_10001772 3300028381 Bacteria 19738
307 Ga0268264_10143362 3300028381 Bacteria 2133
308 Ga0265336_10006403 3300028666 Bacteria 4244
309 Ga0307517_10014006 3300028786 Bacteria 10822
310 Ga0307517_10041774 3300028786 Bacteria 4940
311 Ga0265324_10000002 3300029957 Bacteria 382754
312 Ga0265324_10000616 3300029957 Bacteria 24232
313 Ga0268256_1000016 3300030500 Bacteria 614700
314 Ga0268256_1000127 3300030500 Bacteria 108927
315 Ga0316183_1052664 3300030742 Bacteria 8674
316 Ga0265328_10000016 3300031239 Bacteria 132959
317 Ga0265325_10002841 3300031241 Bacteria 11549
318 Ga0265325_10007848 3300031241 Bacteria 6354
319 Ga0265331_10015958 3300031250 Bacteria 3952
320 Ga0265327_10003217 3300031251 Bacteria 15896
321 Ga0265327_10004074 3300031251 Bacteria 13227
322 Ga0265327_10015677 3300031251 Bacteria 4872
323 Ga0265327_10045580 3300031251 Bacteria 2329
324 Ga0265316_10010443 3300031344 Bacteria 8459
325 Ga0307513_10082859 3300031456 Bacteria 3300
326 Ga0307408_100007451 3300031548 Bacteria 7235
327 Ga0307408_100042351 3300031548 Bacteria 3233
328 Ga0307408_100089007 3300031548 Bacteria 2326
329 Ga0316575_10000487 3300031665 Bacteria 11510
330 Ga0316575_10001144 3300031665 Bacteria 8299
331 Ga0316575_10008164 3300031665 Bacteria 3806
332 Ga0316575_10013846 3300031665 Bacteria 3018
333 Ga0316579_10000112 3300031691 Bacteria 21688
334 Ga0316579_10013311 3300031691 Bacteria 3536
335 Ga0316579_10014200 3300031691 Bacteria 3437
336 Ga0265314_10001144 3300031711 Bacteria 30747
337 Ga0265314_10013371 3300031711 Bacteria 6633
338 Ga0265314_10016503 3300031711 Bacteria 5827
339 Ga0265314_10037974 3300031711 Bacteria 3484
340 Ga0316576_10000941 3300031727 Bacteria 14878
341 Ga0316576_10007815 3300031727 Bacteria 6757
342 Ga0316576_10008009 3300031727 Bacteria 6699
343 Ga0316578_10000036 3300031728 Bacteria 27635
344 Ga0316578_10040101 3300031728 Bacteria 2705
345 Ga0316578_10042632 3300031728 Bacteria 2632
346 Ga0307405_10018615 3300031731 Bacteria 3836
347 Ga0307405_10031623 3300031731 Bacteria 3117
348 Ga0316577_10000097 3300031733 Bacteria 24000
349 Ga0307413_10019557 3300031824 Bacteria 3582
350 Ga0307406_10015834 3300031901 Bacteria 4371
351 Ga0307406_10034146 3300031901 Bacteria 3118
352 Ga0307412_10072395 3300031911 Bacteria 2355
353 Ga0307416_100029044 3300032002 Bacteria 4124
354 Ga0307414_10133944 3300032004 Bacteria 1928
355 Ga0316583_10005061 3300032133 Bacteria 4719
356 Ga0316583_10010528 3300032133 Bacteria 3336
357 Ga0316583_10011643 3300032133 Bacteria 3172
358 Ga0316583_10013578 3300032133 Bacteria 2940
359 Ga0316583_10021200 3300032133 Bacteria 2330
360 Ga0316585_10000137 3300032137 Bacteria 14253
361 Ga0316580_10000114 3300032139 Bacteria 15009
362 Ga0316580_10001122 3300032139 Bacteria 6774
363 Ga0316580_10013725 3300032139 Bacteria 2468
364 Ga0316593_10000230 3300032168 Bacteria 8970
365 Ga0316593_10001819 3300032168 Bacteria 4870
366 Ga0316593_10010640 3300032168 Bacteria 2646
367 Ga0316596_1000141 3300033541 Bacteria 9849
368 Ga0316596_1001863 3300033541 Bacteria 4397
369 Ga0373932_0001303 3300035112 Bacteria 7035
370 Ga0373936_0014330 3300035113 Bacteria 3028
371 Ga0316574_0002271 3300035398 Bacteria 9571
372 Ga0316574_0002543 3300035398 Bacteria 9174
373 Ga0316574_0003574 3300035398 Bacteria 8036
374 Ga0316574_0003652 3300035398 Bacteria 7964
375 Ga0316574_0007563 3300035398 Bacteria 5965
376 Ga0316574_0038227 3300035398 Bacteria 2946
377 Ga0316574_0040331 3300035398 Bacteria 2875
378 Ga0316574_0075565 3300035398 Bacteria 2134
379 Ga0373931_0011424 3300035691 Bacteria 4290
380 Ga0373931_0034589 3300035691 Bacteria 2623
381 Ga0373935_0002303 3300035692 Bacteria 10889
382 Ga0373935_0062446 3300035692 Bacteria 2386
383 Ga0373927_0055857 3300035695 Bacteria 2552
384 Ga0373937_0098532 3300036401 Bacteria 2711
385 Ga0316582_0000029 3300036647 Bacteria 34187
386 Ga0316582_0020407 3300036647 Bacteria 3896
387 Ga0316582_0137950 3300036647 Bacteria 1643
388 Ga0316584_0003738 3300036712 Bacteria 9965
389 Ga0316584_0033074 3300036712 Bacteria 3828
390 Ga0316584_0039597 3300036712 Bacteria 3509
391 Ga0316581_0010955 3300037588 Bacteria 2526
392 Ga0237819_01221 3300038705 Bacteria 7123
393 Ga0400490_04196 3300038726 Bacteria 8292
394 Ga0400485_17163 3300038735 Bacteria 43508
395 Ga0400488_50200 3300038741 Bacteria 9554
396 Ga0400488_63642 3300038741 Bacteria 2261
397 Ga0400486_01662 3300038742 Bacteria 43450
398 Ga0400483_120916 3300039062 Bacteria 2803
399 Ga0400483_177575 3300039062 Bacteria 3055
400 Ga0400483_216953 3300039062 Bacteria 8439
401 Ga0400487_17601 3300039110 Bacteria 48398
402 Ga0400487_52635 3300039110 Bacteria 6520
403 Ga0436365_0355590 3300039437 Bacteria 2342
404 Ga0436361_0368594 3300039447 Bacteria 5839
405 Ga0439465_0000332 3300041413 Bacteria 13448
406 Ga0451800_0939899 3300041459 Bacteria 4402
407 Ga0451806_394025 3300041462 Bacteria 4621
408 Ga0451807_0921339 3300041486 Bacteria 4099
409 Ga0439449_0000008 3300042007 Bacteria 62060
410 Ga0439435_0007762 3300042436 Bacteria 2468
411 Ga0439460_0011514 3300042461 Bacteria 2281
412 Ga0451577_0000002 3300042876 Bacteria 1731375
413 Ga0451577_0000096 3300042876 Bacteria 195129
414 Ga0451577_0118655 3300042876 Bacteria 2369
415 Ga0466969_0001982 3300044656 Bacteria 10959
416 Ga0453683_0000013 3300044673 Bacteria 371932
417 Ga0466961_0003966 3300044693 Bacteria 9260
418 Ga0466964_0004827 3300044706 Bacteria 4983
419 Ga0453684_0000002 3300044712 Bacteria 1731375
420 Ga0453684_0000040 3300044712 Bacteria 690210
421 Ga0453684_0003157 3300044712 Bacteria 37940
422 Ga0453684_0010268 3300044712 Bacteria 16038
423 Ga0453684_0072447 3300044712 Bacteria 4349
424 Ga0451576_0000037 3300045051 Bacteria 372173
425 Ga0451576_0000494 3300045051 Bacteria 86988
426 Ga0451576_0002868 3300045051 Bacteria 24693
427 Ga0451576_0004225 3300045051 Bacteria 18855
428 Ga0451576_0005999 3300045051 Bacteria 15024
429 Ga0451576_0023354 3300045051 Bacteria 6696
430 Ga0451576_0024169 3300045051 Bacteria 6566
431 Ga0451576_0078594 3300045051 Bacteria 3433
432 Ga0451576_0099937 3300045051 Bacteria 3017
433 Ga0466967_0096689 3300045976 Bacteria 2694
434 Ga0495617_011142 3300046452 Bacteria 3074
435 Ga0495603_0095965 3300046455 Bacteria 1732
436 Ga0495650_0000340 3300046471 Bacteria 83278
437 Ga0495582_0126709 3300046473 Bacteria 1441
438 Ga0495639_0017849 3300046475 Bacteria 3084
439 Ga0495585_0019033 3300046492 Bacteria 3962
440 Ga0495607_0034231 3300046501 Bacteria 3083
441 Ga0495583_0000996 3300046506 Bacteria 32401
442 Ga0495583_0017942 3300046506 Bacteria 3741
443 Ga0495583_0033284 3300046506 Bacteria 2479
444 Ga0495606_0000824 3300046507 Bacteria 47072
445 Ga0495606_0015923 3300046507 Bacteria 5766
446 Ga0495637_0002189 3300046520 Bacteria 10923
447 Ga0495643_0000146 3300046522 Bacteria 114508
448 Ga0495643_0001032 3300046522 Bacteria 28383
449 Ga0495643_0002465 3300046522 Bacteria 14651
450 Ga0495648_0000439 3300046524 Bacteria 45123
451 Ga0495663_0006151 3300046525 Bacteria 3318
452 Ga0495663_0008844 3300046525 Bacteria 2794
453 Ga0495654_0000264 3300046530 Bacteria 47686
454 Ga0495586_0004479 3300046535 Bacteria 7460
455 Ga0495622_0003931 3300046557 Bacteria 6941
456 Ga0495633_0003190 3300046558 Bacteria 11071
457 Ga0495633_0003629 3300046558 Bacteria 10203
458 Ga0495668_0000007 3300046616 Bacteria 552902
459 Ga0495668_0000984 3300046616 Bacteria 31110
460 Ga0495625_0000583 3300046660 Bacteria 53056
461 Ga0495625_0038998 3300046660 Bacteria 3472
462 Ga0495625_0088204 3300046660 Bacteria 2149
463 Ga0495647_0006492 3300046681 Bacteria 3878
464 Ga0495669_0000286 3300046684 Bacteria 28731
465 Ga0495669_0002353 3300046684 Bacteria 7751
466 Ga0495671_0000100 3300046692 Bacteria 78876
467 Ga0495589_0036243 3300046794 Bacteria 2473
468 Ga0495600_0004286 3300046809 Bacteria 8529
469 Ga0495636_0003832 3300047318 Bacteria 5863
470 Ga0495672_0000273 3300047320 Bacteria 71269
471 Ga0495683_0054044 3300047323 Bacteria 2002
472 Ga0495687_000512 3300047443 Bacteria 46683
473 Ga0495687_001133 3300047443 Bacteria 25821
474 Ga0495677_0003158 3300047445 Bacteria 6426
475 Ga0495681_0007326 3300047470 Bacteria 7068
476 Ga0495686_0000120 3300047472 Bacteria 164638
477 Ga0496102_0001240 3300048905 Bacteria 23101
478 Ga0496103_0000307 3300048906 Bacteria 45142
479 Ga0496104_0058614 3300048907 Bacteria 3645
480 Ga0496105_0000190 3300048908 Bacteria 41092
481 Ga0496111_0011992 3300048914 Bacteria 5858
482 Ga0496114_0025500 3300048917 Bacteria 4833
483 Ga0496115_0000251 3300048918 Bacteria 47811
484 Ga0496116_0003152 3300048919 Bacteria 16514
485 Ga0496116_0083051 3300048919 Bacteria 1979
486 Ga0496117_0000182 3300048920 Bacteria 128076
487 Ga0496117_0003796 3300048920 Bacteria 17237
488 Ga0496117_0005077 3300048920 Bacteria 14093
489 Ga0496117_0007293 3300048920 Bacteria 10862
490 Ga0496117_0008132 3300048920 Bacteria 10024
491 Ga0496118_0000125 3300048921 Bacteria 136422
492 Ga0496118_0000870 3300048921 Bacteria 47798
493 Ga0496118_0009520 3300048921 Bacteria 9788
494 Ga0496118_0011733 3300048921 Bacteria 8516
495 Ga0496119_0000174 3300048922 Bacteria 89804
496 Ga0496119_0001413 3300048922 Bacteria 29073
497 Ga0496120_0000162 3300048923 Bacteria 112200
498 Ga0496120_0000253 3300048923 Bacteria 89798
499 Ga0496121_0000906 3300048924 Bacteria 53394
500 Ga0496121_0007552 3300048924 Bacteria 13103
501 Ga0496122_0000049 3300048925 Bacteria 268493
502 Ga0496122_0015452 3300048925 Bacteria 7298
503 Ga0496122_0027525 3300048925 Bacteria 4856
504 Ga0496123_0000042 3300048926 Bacteria 254481
505 Ga0496123_0014378 3300048926 Bacteria 6565
506 Ga0496124_0000034 3300048927 Bacteria 325332
507 Ga0496124_0000082 3300048927 Bacteria 208248
508 Ga0496124_0000621 3300048927 Bacteria 59443
509 Ga0496124_0002188 3300048927 Bacteria 26105
510 Ga0496125_0000730 3300048928 Bacteria 54485
511 Ga0496125_0013126 3300048928 Bacteria 8167
512 Ga0496125_0036192 3300048928 Bacteria 4314
513 Ga0496126_0000221 3300048929 Bacteria 124193
514 Ga0496126_0002736 3300048929 Bacteria 23301
515 Ga0501033_0071570 3300049570 Bacteria 2547
516 Ga0501036_0051318 3300049572 Bacteria 3492
517 Ga0501040_0014302 3300049576 Bacteria 5228
518 Ga0501040_0126499 3300049576 Bacteria 1795
519 Ga0501041_0003094 3300049577 Bacteria 9566
520 Ga0501041_0023137 3300049577 Bacteria 3726
521 Ga0501046_0045128 3300049580 Bacteria 3503
522 Ga0501048_0087266 3300049582 Bacteria 2201
523 Ga0501071_0007160 3300049587 Bacteria 7297
524 Ga0501071_0021240 3300049587 Bacteria 4519
525 Ga0501072_0001613 3300049588 Bacteria 16851
526 Ga0501072_0267210 3300049588 Bacteria 1361
527 Ga0501073_0046094 3300049589 Bacteria 3068
528 Ga0501075_0005223 3300049591 Bacteria 8876
529 Ga0501075_0143208 3300049591 Bacteria 1822
530 Ga0501076_0000429 3300049592 Bacteria 26487
531 Ga0501249_000356 3300049679 Bacteria 12222
532 Ga0501225_0000850 3300049705 Bacteria 9490
533 Ga0501079_0006938 3300049741 Bacteria 8536
534 Ga0501079_0035142 3300049741 Bacteria 3857
535 Ga0501080_0002142 3300049742 Bacteria 17157
536 Ga0501080_0092873 3300049742 Bacteria 2802
537 Ga0501081_0007602 3300049743 Bacteria 7027
538 Ga0501081_0022530 3300049743 Bacteria 4216
539 Ga0501081_0139598 3300049743 Bacteria 1736
540 Ga0501045_0114604 3300049824 Bacteria 1999
541 nmdc:mga0k408_41296_c1 3300050493 Bacteria 2655
542 nmdc:mga05p37_133_c1 3300050507 Bacteria 68369
543 nmdc:mga05p37_775_c1 3300050507 Bacteria 35507
544 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
545 nmdc:mga09592_684_c1 3300050508 Bacteria 25891
546 nmdc:mga0qj67_64383_c1 3300050509 Bacteria 2916
547 nmdc:mga06r32_100912_c1 3300050510 Bacteria 2832
548 nmdc:mga06r32_275048_c1 3300050510 Bacteria 1671
549 nmdc:mga08y16_18475_c1 3300050511 Bacteria 7346
550 nmdc:mga08y16_61426_c1 3300050511 Bacteria 3924
551 nmdc:mga08y16_9147_c1 3300050511 Bacteria 10398
552 nmdc:mga0n895_1259_c1 3300050512 Bacteria 18701
553 nmdc:mga0n895_13334_c1 3300050512 Bacteria 7412
554 nmdc:mga0n895_866_c1 3300050512 Bacteria 21745
555 nmdc:mga0rr50_4784_c1 3300050513 Bacteria 7990
556 nmdc:mga0rr50_59832_c1 3300050513 Bacteria 2862
557 nmdc:mga0rr50_85400_c1 3300050513 Bacteria 2446
558 nmdc:mga08x19_1067_c1 3300050514 Bacteria 17100
559 nmdc:mga08x19_1837_c1 3300050514 Bacteria 13023
560 nmdc:mga08x19_32861_c1 3300050514 Bacteria 3272
561 nmdc:mga08x19_41311_c1 3300050514 Bacteria 2937
562 nmdc:mga0a205_1164_c1 3300050515 Bacteria 21889
563 Ga0500610_0001872 3300053079 Bacteria 7459
564 Ga0500595_001141 3300053119 Bacteria 14732
565 Ga0500642_0001053 3300053130 Bacteria 7963
566 Ga0500627_0001208 3300053158 Bacteria 7101
567 Ga0500645_000080 3300053730 Bacteria 76756
568 Ga0501084_0087213 3300054114 Bacteria 2620
569 Ga0501082_0046111 3300060353 Bacteria 3758
570 Ga0530510_0023984 3300061734 Bacteria 4351

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10062843 Ga0157369_100628432 340
2 3300049582 Ga0501048_0087266 Ga0501048_0087266_16_1248 396
3 3300039062 Ga0400483_120916 Ga0400483_120916_144_1385 398
4 3300049588 Ga0501072_0267210 Ga0501072_0267210_28_1308 410
5 3300025903 Ga0207680_10182958 Ga0207680_101829582 411
6 3300036647 Ga0316582_0137950 Ga0316582_0137950_84_1358 412
7 iso_pu_bacteria 2651869719 2652546471 412
8 3300006844 Ga0075428_100048579 Ga0075428_1000485794 416
9 3300035692 Ga0373935_0062446 Ga0373935_0062446_1052_2362 416
10 3300046473 Ga0495582_0126709 Ga0495582_0126709_23_1333 416
11 3300039062 Ga0400483_177575 Ga0400483_177575_1115_2419 419
12 3300047318 Ga0495636_0003832 Ga0495636_0003832_2479_3801 420
13 3300032004 Ga0307414_10133944 Ga0307414_101339442 430
14 3300006844 Ga0075428_100048872 Ga0075428_1000488723 451
15 3300006880 Ga0075429_100000015 Ga0075429_10000001572 451
16 3300009147 Ga0114129_10034102 Ga0114129_100341025 451
17 3300050507 nmdc:mga05p37_133_c1 nmdc:mga05p37_133_c1_25172_26686 451
18 3300050508 nmdc:mga09592_26_c1 nmdc:mga09592_26_c1_29734_31248 451
19 3300005353 Ga0070669_100008869 Ga0070669_1000088692 457
20 3300005406 Ga0070703_10015864 Ga0070703_100158642 457
21 3300005441 Ga0070700_100002243 Ga0070700_1000022433 457
22 3300005459 Ga0068867_100000755 Ga0068867_1000007552 457
23 3300005719 Ga0068861_100024917 Ga0068861_1000249172 457
24 3300005844 Ga0068862_100006958 Ga0068862_10000695810 457
25 3300006881 Ga0068865_100003408 Ga0068865_1000034089 457
26 3300009148 Ga0105243_10002384 Ga0105243_100023845 457
27 3300009553 Ga0105249_10022150 Ga0105249_100221502 457
28 3300013308 Ga0157375_10151793 Ga0157375_101517933 457
29 3300014326 Ga0157380_10021837 Ga0157380_100218374 457
30 3300025899 Ga0207642_10016700 Ga0207642_100167002 457
31 3300025908 Ga0207643_10040735 Ga0207643_100407352 457
32 3300025923 Ga0207681_10002005 Ga0207681_100020054 457
33 3300025961 Ga0207712_10001259 Ga0207712_1000125919 457
34 3300025972 Ga0207668_10012088 Ga0207668_100120885 457
35 3300026089 Ga0207648_10002409 Ga0207648_1000240916 457
36 3300027907 Ga0207428_10077355 Ga0207428_100773552 457
37 3300028380 Ga0268265_10001159 Ga0268265_1000115916 457
38 3300050511 nmdc:mga08y16_61426_c1 nmdc:mga08y16_61426_c1_1254_2690 457
39 3300035398 Ga0316574_0007563 Ga0316574_0007563_1446_2852 459
40 3300049591 Ga0501075_0005223 Ga0501075_0005223_4337_5773 459
41 3300006880 Ga0075429_100043912 Ga0075429_1000439125 460
42 3300027462 Ga0210000_1002198 Ga0210000_10021982 460
43 3300025292 Ga0209676_1000052 Ga0209676_100005291 461
44 3300025929 Ga0207664_10062411 Ga0207664_100624113 462
45 3300031251 Ga0265327_10045580 Ga0265327_100455801 462
46 3300050510 nmdc:mga06r32_275048_c1 nmdc:mga06r32_275048_c1_192_1616 463
47 3300049570 Ga0501033_0071570 Ga0501033_0071570_121_1572 464
48 3300049572 Ga0501036_0051318 Ga0501036_0051318_1064_2515 464
49 3300049576 Ga0501040_0014302 Ga0501040_0014302_941_2392 464
50 3300049577 Ga0501041_0003094 Ga0501041_0003094_6862_8313 464
51 3300049580 Ga0501046_0045128 Ga0501046_0045128_146_1597 464
52 3300049588 Ga0501072_0001613 Ga0501072_0001613_2355_3806 464
53 3300049592 Ga0501076_0000429 Ga0501076_0000429_7904_9355 464
54 3300049741 Ga0501079_0006938 Ga0501079_0006938_2831_4282 464
55 3300049742 Ga0501080_0092873 Ga0501080_0092873_365_1816 464
56 3300049743 Ga0501081_0007602 Ga0501081_0007602_2468_3919 464
57 3300054114 Ga0501084_0087213 Ga0501084_0087213_45_1496 464
58 3300060353 Ga0501082_0046111 Ga0501082_0046111_162_1613 464
59 3300061734 Ga0530510_0023984 Ga0530510_0023984_1115_2566 464
60 3300005328 Ga0070676_10049319 Ga0070676_100493192 465
61 3300005334 Ga0068869_100032962 Ga0068869_1000329622 465
62 3300005354 Ga0070675_100033120 Ga0070675_1000331203 465
63 3300009094 Ga0111539_10117714 Ga0111539_101177143 465
64 3300025907 Ga0207645_10032467 Ga0207645_100324672 465
65 3300025933 Ga0207706_10074272 Ga0207706_100742722 465
66 3300025942 Ga0207689_10021185 Ga0207689_100211856 465
67 3300027907 Ga0207428_10051385 Ga0207428_100513853 465
68 3300045051 Ga0451576_0078594 Ga0451576_0078594_1709_3157 465
69 3300049587 Ga0501071_0007160 Ga0501071_0007160_3471_4964 465
70 3300049589 Ga0501073_0046094 Ga0501073_0046094_368_1861 465
71 3300049742 Ga0501080_0002142 Ga0501080_0002142_6286_7779 465
72 3300049743 Ga0501081_0139598 Ga0501081_0139598_115_1608 465
73 3300050510 nmdc:mga06r32_100912_c1 nmdc:mga06r32_100912_c1_473_1909 465
74 3300050511 nmdc:mga08y16_9147_c1 nmdc:mga08y16_9147_c1_315_1763 465
75 3300032133 Ga0316583_10021200 Ga0316583_100212003 466
76 3300044656 Ga0466969_0001982 Ga0466969_0001982_344_1807 466
77 3300044693 Ga0466961_0003966 Ga0466961_0003966_3315_4778 466
78 3300006846 Ga0075430_100008118 Ga0075430_1000081187 467
79 3300006846 Ga0075430_100024757 Ga0075430_1000247573 467
80 3300050509 nmdc:mga0qj67_64383_c1 nmdc:mga0qj67_64383_c1_1410_2855 467
81 3300035398 Ga0316574_0038227 Ga0316574_0038227_69_1541 468
82 3300049591 Ga0501075_0143208 Ga0501075_0143208_200_1663 468
83 3300005444 Ga0070694_100011846 Ga0070694_1000118464 469
84 3300031911 Ga0307412_10072395 Ga0307412_100723952 469
85 3300005295 Ga0065707_10084402 Ga0065707_100844022 470
86 3300005549 Ga0070704_100007065 Ga0070704_1000070655 470
87 3300014326 Ga0157380_10008634 Ga0157380_100086347 470
88 3300050512 nmdc:mga0n895_13334_c1 nmdc:mga0n895_13334_c1_3408_4898 471
89 3300050513 nmdc:mga0rr50_85400_c1 nmdc:mga0rr50_85400_c1_696_2186 471
90 3300005330 Ga0070690_100043432 Ga0070690_1000434322 472
91 3300005340 Ga0070689_100044734 Ga0070689_1000447342 472
92 3300005343 Ga0070687_100054640 Ga0070687_1000546402 472
93 3300005347 Ga0070668_100037898 Ga0070668_1000378982 472
94 3300005364 Ga0070673_100056160 Ga0070673_1000561602 472
95 3300005365 Ga0070688_100027873 Ga0070688_1000278733 472
96 3300005367 Ga0070667_100172988 Ga0070667_1001729882 472
97 3300005457 Ga0070662_100047361 Ga0070662_1000473612 472
98 3300005535 Ga0070684_100059440 Ga0070684_1000594403 472
99 3300005544 Ga0070686_100010900 Ga0070686_1000109001 472
100 3300005548 Ga0070665_100051025 Ga0070665_1000510252 472
101 3300005617 Ga0068859_100168044 Ga0068859_1001680442 472
102 3300005618 Ga0068864_100179018 Ga0068864_1001790182 472
103 3300005718 Ga0068866_10026282 Ga0068866_100262822 472
104 3300006237 Ga0097621_100007781 Ga0097621_10000778110 472
105 3300006358 Ga0068871_100001033 Ga0068871_1000010336 472
106 3300006931 Ga0097620_100168042 Ga0097620_1001680422 472
107 3300009094 Ga0111539_10128268 Ga0111539_101282682 472
108 3300009176 Ga0105242_10006775 Ga0105242_100067752 472
109 3300009177 Ga0105248_10133718 Ga0105248_101337182 472
110 3300014969 Ga0157376_10023137 Ga0157376_100231374 472
111 3300025893 Ga0207682_10000452 Ga0207682_1000045214 472
112 3300025901 Ga0207688_10025438 Ga0207688_100254382 472
113 3300025903 Ga0207680_10068210 Ga0207680_100682102 472
114 3300025907 Ga0207645_10016697 Ga0207645_100166972 472
115 3300025918 Ga0207662_10010902 Ga0207662_100109024 472
116 3300025935 Ga0207709_10008899 Ga0207709_100088992 472
117 3300026075 Ga0207708_10001857 Ga0207708_1000185710 472
118 3300026095 Ga0207676_10110261 Ga0207676_101102612 472
119 3300026116 Ga0207674_10156594 Ga0207674_101565942 472
120 3300026121 Ga0207683_10015331 Ga0207683_100153312 472
121 3300027907 Ga0207428_10103824 Ga0207428_101038242 472
122 3300028381 Ga0268264_10143362 Ga0268264_101433622 472
123 3300049577 Ga0501041_0023137 Ga0501041_0023137_548_2032 472
124 3300049743 Ga0501081_0022530 Ga0501081_0022530_790_2274 472
125 3300042436 Ga0439435_0007762 Ga0439435_0007762_151_1641 473
126 3300042461 Ga0439460_0011514 Ga0439460_0011514_430_1920 473
127 3300005549 Ga0070704_100015035 Ga0070704_1000150352 475
128 3300006871 Ga0075434_100009366 Ga0075434_1000093662 475
129 3300007076 Ga0075435_100078849 Ga0075435_1000788493 475
130 3300026095 Ga0207676_10137551 Ga0207676_101375512 475
131 3300049705 Ga0501225_0000850 Ga0501225_0000850_4979_6469 475
132 3300050512 nmdc:mga0n895_866_c1 nmdc:mga0n895_866_c1_3968_5449 475
133 3300050513 nmdc:mga0rr50_59832_c1 nmdc:mga0rr50_59832_c1_1154_2635 475
134 3300005536 Ga0070697_100003127 Ga0070697_1000031273 476
135 3300005842 Ga0068858_100007556 Ga0068858_10000755614 476
136 3300045976 Ga0466967_0096689 Ga0466967_0096689_47_1534 476
137 iso_pu_bacteria 2547132103 2547371690 476
138 iso_pu_bacteria 2843690924 2843692921 476
139 iso_pu_bacteria 2998344455 2998346750 476
140 3300027462 Ga0210000_1004952 Ga0210000_10049521 477
141 3300039447 Ga0436361_0368594 Ga0436361_0368594_3123_4586 477
142 3300049576 Ga0501040_0126499 Ga0501040_0126499_293_1780 477
143 3300049587 Ga0501071_0021240 Ga0501071_0021240_421_1908 477
144 3300049824 Ga0501045_0114604 Ga0501045_0114604_331_1818 477
145 3300050514 nmdc:mga08x19_41311_c1 nmdc:mga08x19_41311_c1_1303_2793 477
146 iso_pu_bacteria 2846033681 2846036736 477
147 iso_pu_bacteria 2846037992 2846042160 477
148 3300003771 Ga0055526_1010786 Ga0055526_10107862 478
149 3300003773 Ga0055537_1000149 Ga0055537_100014935 478
150 3300003781 Ga0055536_1000957 Ga0055536_100095711 478
151 3300003784 Ga0055534_1000968 Ga0055534_10009682 478
152 3300003856 Ga0058692_1000004 Ga0058692_1000004139 478
153 3300003856 Ga0058692_1000049 Ga0058692_10000491 478
154 3300005289 Ga0065704_10073361 Ga0065704_100733611 478
155 3300005331 Ga0070670_100000924 Ga0070670_10000092421 478
156 3300005406 Ga0070703_10016875 Ga0070703_100168752 478
157 3300005518 Ga0070699_100021479 Ga0070699_1000214794 478
158 3300005536 Ga0070697_100014791 Ga0070697_1000147912 478
159 3300005545 Ga0070695_100008154 Ga0070695_1000081543 478
160 3300005546 Ga0070696_100012458 Ga0070696_1000124581 478
161 3300005548 Ga0070665_100099982 Ga0070665_1000999822 478
162 3300005617 Ga0068859_100145129 Ga0068859_1001451292 478
163 3300005985 Ga0081539_10000365 Ga0081539_1000036589 478
164 3300006914 Ga0075436_100000087 Ga0075436_10000008755 478
165 3300006931 Ga0097620_100145127 Ga0097620_1001451272 478
166 3300009011 Ga0105251_10000077 Ga0105251_1000007769 478
167 3300009011 Ga0105251_10012544 Ga0105251_100125445 478
168 3300014497 Ga0182008_10001732 Ga0182008_100017326 478
169 3300015262 Ga0182007_10000052 Ga0182007_1000005247 478
170 3300015265 Ga0182005_1000929 Ga0182005_100092913 478
171 3300025261 Ga0209233_1002007 Ga0209233_10020072 478
172 3300025263 Ga0209565_1000051 Ga0209565_1000051177 478
173 3300025273 Ga0209673_1000069 Ga0209673_100006955 478
174 3300025284 Ga0209130_1008270 Ga0209130_10082701 478
175 3300025291 Ga0209675_1000007 Ga0209675_1000007276 478
176 3300025292 Ga0209676_1000018 Ga0209676_1000018298 478
177 3300025292 Ga0209676_1001990 Ga0209676_10019909 478
178 3300025292 Ga0209676_1003602 Ga0209676_10036022 478
179 3300025295 Ga0209564_1000061 Ga0209564_100006149 478
180 3300025298 Ga0209050_1000109 Ga0209050_100010916 478
181 3300025299 Ga0209256_1002963 Ga0209256_10029636 478
182 3300025304 Ga0209257_1000035 Ga0209257_1000035298 478
183 3300025304 Ga0209257_1007768 Ga0209257_10077685 478
184 3300025735 Ga0207713_1000381 Ga0207713_100038120 478
185 3300025735 Ga0207713_1011934 Ga0207713_10119342 478
186 3300025925 Ga0207650_10003700 Ga0207650_100037001 478
187 3300025935 Ga0207709_10003140 Ga0207709_100031404 478
188 3300027312 Ga0209371_1000018 Ga0209371_1000018254 478
189 3300027312 Ga0209371_1000152 Ga0209371_10001521 478
190 3300028379 Ga0268266_10151984 Ga0268266_101519842 478
191 3300030500 Ga0268256_1000016 Ga0268256_1000016254 478
192 3300030500 Ga0268256_1000127 Ga0268256_1000127107 478
193 3300030742 Ga0316183_1052664 Ga0316183_10526642 478
194 3300038705 Ga0237819_01221 Ga0237819_01221_462_1952 478
195 3300041459 Ga0451800_0939899 Ga0451800_0939899_1098_2573 478
196 3300041462 Ga0451806_394025 Ga0451806_394025_411_1886 478
197 3300041486 Ga0451807_0921339 Ga0451807_0921339_1612_3087 478
198 3300046558 Ga0495633_0003190 Ga0495633_0003190_5284_6774 478
199 3300047320 Ga0495672_0000273 Ga0495672_0000273_7162_8637 478
200 3300048920 Ga0496117_0005077 Ga0496117_0005077_4169_5644 478
201 3300048920 Ga0496117_0007293 Ga0496117_0007293_6025_7500 478
202 3300048920 Ga0496117_0008132 Ga0496117_0008132_8207_9682 478
203 3300048921 Ga0496118_0009520 Ga0496118_0009520_8282_9757 478
204 3300048921 Ga0496118_0011733 Ga0496118_0011733_6618_8093 478
205 3300048922 Ga0496119_0000174 Ga0496119_0000174_47808_49283 478
206 3300048922 Ga0496119_0001413 Ga0496119_0001413_14380_15855 478
207 3300048923 Ga0496120_0000162 Ga0496120_0000162_28041_29516 478
208 3300048923 Ga0496120_0000253 Ga0496120_0000253_48298_49773 478
209 3300048924 Ga0496121_0007552 Ga0496121_0007552_3291_4766 478
210 3300048925 Ga0496122_0000049 Ga0496122_0000049_123044_124519 478
211 3300048925 Ga0496122_0027525 Ga0496122_0027525_132_1607 478
212 3300048926 Ga0496123_0000042 Ga0496123_0000042_129941_131416 478
213 3300048926 Ga0496123_0014378 Ga0496123_0014378_132_1607 478
214 3300048927 Ga0496124_0000621 Ga0496124_0000621_27254_28729 478
215 3300048927 Ga0496124_0002188 Ga0496124_0002188_1225_2700 478
216 3300048928 Ga0496125_0013126 Ga0496125_0013126_3323_4798 478
217 3300048928 Ga0496125_0036192 Ga0496125_0036192_127_1602 478
218 3300048929 Ga0496126_0002736 Ga0496126_0002736_16870_18345 478
219 3300049741 Ga0501079_0035142 Ga0501079_0035142_2024_3517 478
220 3300050514 nmdc:mga08x19_1067_c1 nmdc:mga08x19_1067_c1_1624_3117 478
221 3300050514 nmdc:mga08x19_32861_c1 nmdc:mga08x19_32861_c1_530_2023 478
222 iso_pu_bacteria 2547132130 2547503154 478
223 iso_pu_bacteria 2576861471 2578456647 478
224 iso_pu_bacteria 2747842428 2747949039 478
225 iso_pu_bacteria 2765235840 2765580841 478
226 iso_pu_bacteria 2816332141 2816518172 478
227 iso_pu_bacteria 2818991457 2819662199 478
228 iso_pu_bacteria 2842391507 2842395130 478
229 iso_pu_bacteria 2842757796 2842760977 478
230 iso_pu_bacteria 2852649853 2852651851 478
231 iso_pu_bacteria 2852684882 2852688096 478
232 iso_pu_bacteria 2857442823 2857444916 478
233 iso_pu_bacteria 2874220319 2874223485 478
234 iso_pu_bacteria 2919089067 2919092247 478
235 iso_pu_bacteria 2919130084 2919132835 478
236 iso_pu_bacteria 2919134579 2919136702 478
237 iso_pu_bacteria 2928496128 2928497131 478
238 iso_pu_bacteria 2929195423 2929199528 478
239 iso_pu_bacteria 2931380184 2931383103 478
240 iso_pu_bacteria 2937610967 2937614033 478
241 iso_pu_bacteria 2939589442 2939590120 478
242 iso_pu_bacteria 2939622612 2939623742 478
243 iso_pu_bacteria 2939626828 2939630799 478
244 iso_pu_bacteria 2941475908 2941478488 478
245 iso_pu_bacteria 2961047084 2961050249 478
246 iso_pu_bacteria 2961064222 2961064605 478
247 iso_pu_bacteria 2974307012 2974307278 478
248 iso_pu_bacteria 2977247770 2977248025 478
249 iso_pu_bacteria 2984514374 2984517521 478
250 iso_pu_bacteria 8002869464 8002869860 478
251 iso_pu_bacteria 8021622325 8021625403 478
252 iso_pu_bacteria 8021626552 8021628456 478
253 iso_pu_bacteria 8021648035 8021649294 478
254 3300031250 Ga0265331_10015958 Ga0265331_100159582 479
255 3300035398 Ga0316574_0075565 Ga0316574_0075565_169_1644 479
256 3300046501 Ga0495607_0034231 Ga0495607_0034231_111_1601 479
257 3300046507 Ga0495606_0015923 Ga0495606_0015923_2294_3784 479
258 3300048927 Ga0496124_0000034 Ga0496124_0000034_221557_223047 479
259 iso_pu_bacteria 2842780639 2842782073 479
260 3300005340 Ga0070689_100146099 Ga0070689_1001460992 480
261 3300005617 Ga0068859_100026648 Ga0068859_1000266484 480
262 3300006931 Ga0097620_100026650 Ga0097620_1000266505 480
263 3300025936 Ga0207670_10039174 Ga0207670_100391742 480
264 3300036401 Ga0373937_0098532 Ga0373937_0098532_97_1593 480
265 3300039437 Ga0436365_0355590 Ga0436365_0355590_421_1869 480
266 3300046684 Ga0495669_0002353 Ga0495669_0002353_2109_3617 480
267 3300050511 nmdc:mga08y16_18475_c1 nmdc:mga08y16_18475_c1_1911_3413 480
268 3300013297 Ga0157378_10014135 Ga0157378_100141354 481
269 3300028666 Ga0265336_10006403 Ga0265336_100064033 481
270 3300029957 Ga0265324_10000002 Ga0265324_10000002122 481
271 3300029957 Ga0265324_10000616 Ga0265324_100006165 481
272 3300031241 Ga0265325_10002841 Ga0265325_100028418 481
273 3300031241 Ga0265325_10007848 Ga0265325_100078483 481
274 3300031251 Ga0265327_10003217 Ga0265327_1000321710 481
275 3300031251 Ga0265327_10015677 Ga0265327_100156776 481
276 3300031665 Ga0316575_10001144 Ga0316575_100011449 481
277 3300031711 Ga0265314_10001144 Ga0265314_100011445 481
278 3300031711 Ga0265314_10016503 Ga0265314_100165032 481
279 3300031711 Ga0265314_10037974 Ga0265314_100379742 481
280 3300041413 Ga0439465_0000332 Ga0439465_0000332_4360_5880 481
281 3300042007 Ga0439449_0000008 Ga0439449_0000008_43481_45001 481
282 3300042876 Ga0451577_0000002 Ga0451577_0000002_1440781_1442268 481
283 3300042876 Ga0451577_0118655 Ga0451577_0118655_268_1773 481
284 3300044673 Ga0453683_0000013 Ga0453683_0000013_81338_82825 481
285 3300044712 Ga0453684_0000002 Ga0453684_0000002_289108_290595 481
286 3300044712 Ga0453684_0000040 Ga0453684_0000040_412832_414319 481
287 3300044712 Ga0453684_0010268 Ga0453684_0010268_10724_12211 481
288 3300045051 Ga0451576_0000037 Ga0451576_0000037_81579_83066 481
289 3300045051 Ga0451576_0002868 Ga0451576_0002868_12470_13957 481
290 3300045051 Ga0451576_0005999 Ga0451576_0005999_4507_5994 481
291 3300045051 Ga0451576_0023354 Ga0451576_0023354_1627_3132 481
292 3300045051 Ga0451576_0024169 Ga0451576_0024169_4268_5755 481
293 3300045051 Ga0451576_0099937 Ga0451576_0099937_1469_2956 481
294 iso_pu_bacteria 2842854478 2842855322 481
295 3300005330 Ga0070690_100001405 Ga0070690_10000140512 482
296 3300005334 Ga0068869_100000144 Ga0068869_10000014428 482
297 3300005336 Ga0070680_100006357 Ga0070680_1000063579 482
298 3300005338 Ga0068868_100003765 Ga0068868_1000037658 482
299 3300005340 Ga0070689_100002042 Ga0070689_10000204210 482
300 3300005341 Ga0070691_10002693 Ga0070691_100026935 482
301 3300005343 Ga0070687_100000379 Ga0070687_10000037916 482
302 3300005345 Ga0070692_10001458 Ga0070692_100014587 482
303 3300005353 Ga0070669_100107301 Ga0070669_1001073012 482
304 3300005438 Ga0070701_10004456 Ga0070701_100044563 482
305 3300005440 Ga0070705_100001733 Ga0070705_1000017333 482
306 3300005441 Ga0070700_100001920 Ga0070700_1000019202 482
307 3300005444 Ga0070694_100002837 Ga0070694_1000028378 482
308 3300005459 Ga0068867_100001723 Ga0068867_1000017237 482
309 3300005544 Ga0070686_100000491 Ga0070686_1000004918 482
310 3300005545 Ga0070695_100000326 Ga0070695_10000032618 482
311 3300005546 Ga0070696_100002746 Ga0070696_1000027467 482
312 3300005546 Ga0070696_100011578 Ga0070696_1000115786 482
313 3300005547 Ga0070693_100000206 Ga0070693_10000020616 482
314 3300005578 Ga0068854_100002729 Ga0068854_10000272913 482
315 3300005614 Ga0068856_100011701 Ga0068856_1000117017 482
316 3300005615 Ga0070702_100000102 Ga0070702_10000010218 482
317 3300005617 Ga0068859_100001522 Ga0068859_1000015229 482
318 3300005618 Ga0068864_100176130 Ga0068864_1001761302 482
319 3300005718 Ga0068866_10001257 Ga0068866_1000125713 482
320 3300005719 Ga0068861_100000786 Ga0068861_1000007868 482
321 3300005843 Ga0068860_100003981 Ga0068860_10000398113 482
322 3300005844 Ga0068862_100002040 Ga0068862_1000020408 482
323 3300006237 Ga0097621_100001841 Ga0097621_10000184112 482
324 3300006358 Ga0068871_100004012 Ga0068871_10000401211 482
325 3300006844 Ga0075428_100009824 Ga0075428_1000098244 482
326 3300006852 Ga0075433_10005779 Ga0075433_100057792 482
327 3300006871 Ga0075434_100004040 Ga0075434_1000040408 482
328 3300006880 Ga0075429_100000145 Ga0075429_10000014526 482
329 3300006881 Ga0068865_100000409 Ga0068865_1000004097 482
330 3300006914 Ga0075436_100001016 Ga0075436_10000101615 482
331 3300006931 Ga0097620_100001522 Ga0097620_1000015229 482
332 3300007076 Ga0075435_100001994 Ga0075435_1000019945 482
333 3300009094 Ga0111539_10070301 Ga0111539_100703013 482
334 3300009098 Ga0105245_10003008 Ga0105245_100030088 482
335 3300009147 Ga0114129_10000393 Ga0114129_1000039317 482
336 3300009148 Ga0105243_10000967 Ga0105243_1000096718 482
337 3300009177 Ga0105248_10137907 Ga0105248_101379072 482
338 3300009553 Ga0105249_10002850 Ga0105249_100028509 482
339 3300013297 Ga0157378_10000871 Ga0157378_1000087126 482
340 3300014969 Ga0157376_10003706 Ga0157376_100037064 482
341 3300025899 Ga0207642_10007494 Ga0207642_100074942 482
342 3300025917 Ga0207660_10002001 Ga0207660_100020017 482
343 3300025918 Ga0207662_10000212 Ga0207662_1000021227 482
344 3300025923 Ga0207681_10116772 Ga0207681_101167722 482
345 3300025927 Ga0207687_10005384 Ga0207687_100053847 482
346 3300025934 Ga0207686_10001621 Ga0207686_100016216 482
347 3300025935 Ga0207709_10001622 Ga0207709_1000162211 482
348 3300025936 Ga0207670_10003445 Ga0207670_100034453 482
349 3300025939 Ga0207665_10039885 Ga0207665_100398853 482
350 3300025942 Ga0207689_10001581 Ga0207689_1000158113 482
351 3300025949 Ga0207667_10013574 Ga0207667_100135746 482
352 3300025960 Ga0207651_10118439 Ga0207651_101184392 482
353 3300025961 Ga0207712_10009895 Ga0207712_100098952 482
354 3300025981 Ga0207640_10008086 Ga0207640_100080863 482
355 3300026023 Ga0207677_10018038 Ga0207677_100180383 482
356 3300026035 Ga0207703_10003857 Ga0207703_100038577 482
357 3300026075 Ga0207708_10001389 Ga0207708_100013898 482
358 3300026089 Ga0207648_10001735 Ga0207648_100017358 482
359 3300026095 Ga0207676_10128474 Ga0207676_101284742 482
360 3300026118 Ga0207675_100000888 Ga0207675_10000088826 482
361 3300027907 Ga0207428_10000766 Ga0207428_1000076625 482
362 3300028380 Ga0268265_10003597 Ga0268265_100035977 482
363 3300028381 Ga0268264_10001772 Ga0268264_100017727 482
364 3300031239 Ga0265328_10000016 Ga0265328_1000001688 482
365 3300035112 Ga0373932_0001303 Ga0373932_0001303_2962_4479 482
366 3300035398 Ga0316574_0002271 Ga0316574_0002271_1054_2592 482
367 3300035691 Ga0373931_0011424 Ga0373931_0011424_1887_3404 482
368 3300035691 Ga0373931_0034589 Ga0373931_0034589_639_2156 482
369 3300035695 Ga0373927_0055857 Ga0373927_0055857_104_1621 482
370 3300038726 Ga0400490_04196 Ga0400490_04196_4935_6446 482
371 3300045051 Ga0451576_0004225 Ga0451576_0004225_16177_17694 482
372 3300046455 Ga0495603_0095965 Ga0495603_0095965_133_1650 482
373 3300046475 Ga0495639_0017849 Ga0495639_0017849_23_1540 482
374 3300046535 Ga0495586_0004479 Ga0495586_0004479_3296_4813 482
375 3300046681 Ga0495647_0006492 Ga0495647_0006492_1104_2621 482
376 3300050507 nmdc:mga05p37_775_c1 nmdc:mga05p37_775_c1_31391_32908 482
377 3300050508 nmdc:mga09592_684_c1 nmdc:mga09592_684_c1_13685_15202 482
378 3300050512 nmdc:mga0n895_1259_c1 nmdc:mga0n895_1259_c1_5826_7343 482
379 3300050513 nmdc:mga0rr50_4784_c1 nmdc:mga0rr50_4784_c1_413_1930 482
380 3300050514 nmdc:mga08x19_1837_c1 nmdc:mga08x19_1837_c1_4131_5648 482
381 3300050515 nmdc:mga0a205_1164_c1 nmdc:mga0a205_1164_c1_7660_9177 482
382 3300005617 Ga0068859_100053549 Ga0068859_1000535495 483
383 3300006931 Ga0097620_100053549 Ga0097620_1000535495 483
384 3300035113 Ga0373936_0014330 Ga0373936_0014330_384_1898 483
385 3300035692 Ga0373935_0002303 Ga0373935_0002303_624_2138 483
386 iso_pu_bacteria 8001522603 8001525874 483
387 3300002737 JGI25162J39368_1000324 JGI25162J39368_100032417 484
388 3300031251 Ga0265327_10004074 Ga0265327_1000407414 484
389 3300031344 Ga0265316_10010443 Ga0265316_100104436 484
390 3300031691 Ga0316579_10013311 Ga0316579_100133113 484
391 3300031711 Ga0265314_10013371 Ga0265314_100133713 484
392 3300031728 Ga0316578_10040101 Ga0316578_100401013 484
393 3300032133 Ga0316583_10005061 Ga0316583_100050613 484
394 3300032133 Ga0316583_10011643 Ga0316583_100116433 484
395 3300032139 Ga0316580_10013725 Ga0316580_100137251 484
396 3300032168 Ga0316593_10000230 Ga0316593_100002308 484
397 3300032168 Ga0316593_10001819 Ga0316593_100018193 484
398 3300032168 Ga0316593_10010640 Ga0316593_100106402 484
399 3300033541 Ga0316596_1000141 Ga0316596_10001413 484
400 3300035398 Ga0316574_0040331 Ga0316574_0040331_522_2045 484
401 3300036712 Ga0316584_0039597 Ga0316584_0039597_1472_2971 484
402 3300037588 Ga0316581_0010955 Ga0316581_0010955_666_2165 484
403 3300038735 Ga0400485_17163 Ga0400485_17163_32057_33553 484
404 3300038741 Ga0400488_50200 Ga0400488_50200_5482_6978 484
405 3300038741 Ga0400488_63642 Ga0400488_63642_398_1906 484
406 3300038742 Ga0400486_01662 Ga0400486_01662_31977_33473 484
407 3300039062 Ga0400483_216953 Ga0400483_216953_1717_3282 484
408 3300039110 Ga0400487_17601 Ga0400487_17601_10064_11560 484
409 3300042876 Ga0451577_0000096 Ga0451577_0000096_114747_116231 484
410 3300044712 Ga0453684_0003157 Ga0453684_0003157_3112_4596 484
411 3300044712 Ga0453684_0072447 Ga0453684_0072447_1601_3085 484
412 3300045051 Ga0451576_0000494 Ga0451576_0000494_17782_19269 484
413 3300031665 Ga0316575_10000487 Ga0316575_100004874 485
414 3300031665 Ga0316575_10008164 Ga0316575_100081642 485
415 3300031665 Ga0316575_10013846 Ga0316575_100138463 485
416 3300031691 Ga0316579_10000112 Ga0316579_1000011218 485
417 3300031691 Ga0316579_10014200 Ga0316579_100142003 485
418 3300031727 Ga0316576_10000941 Ga0316576_1000094112 485
419 3300031727 Ga0316576_10008009 Ga0316576_100080092 485
420 3300031728 Ga0316578_10000036 Ga0316578_1000003620 485
421 3300031728 Ga0316578_10042632 Ga0316578_100426323 485
422 3300031733 Ga0316577_10000097 Ga0316577_100000972 485
423 3300032133 Ga0316583_10010528 Ga0316583_100105284 485
424 3300032133 Ga0316583_10013578 Ga0316583_100135782 485
425 3300032137 Ga0316585_10000137 Ga0316585_1000013715 485
426 3300032139 Ga0316580_10000114 Ga0316580_100001147 485
427 3300033541 Ga0316596_1001863 Ga0316596_10018634 485
428 3300035398 Ga0316574_0003574 Ga0316574_0003574_4023_5519 485
429 3300035398 Ga0316574_0003652 Ga0316574_0003652_1254_2744 485
430 3300036647 Ga0316582_0000029 Ga0316582_0000029_21333_22823 485
431 3300036647 Ga0316582_0020407 Ga0316582_0020407_669_2216 485
432 3300036712 Ga0316584_0003738 Ga0316584_0003738_3255_4745 485
433 3300036712 Ga0316584_0033074 Ga0316584_0033074_1196_2686 485
434 3300013104 Ga0157370_10001229 Ga0157370_1000122927 486
435 3300031727 Ga0316576_10007815 Ga0316576_100078157 486
436 3300032139 Ga0316580_10001122 Ga0316580_100011224 486
437 3300035398 Ga0316574_0002543 Ga0316574_0002543_5114_6601 486
438 3300039110 Ga0400487_52635 Ga0400487_52635_3251_4756 486
439 3300047472 Ga0495686_0000120 Ga0495686_0000120_40823_42334 487
440 iso_pu_bacteria 2946787523 2946788853 492
441 3300001989 JGI24739J22299_10007399 JGI24739J22299_100073992 493
442 3300025933 Ga0207706_10006108 Ga0207706_100061088 493
443 3300026041 Ga0207639_10115453 Ga0207639_101154532 493
444 3300026116 Ga0207674_10006702 Ga0207674_1000670212 493
445 3300031731 Ga0307405_10031623 Ga0307405_100316232 493
446 iso_pu_bacteria 2775507255 2778123901 496
447 3300005530 Ga0070679_100010182 Ga0070679_1000101822 498
448 3300026035 Ga0207703_10050041 Ga0207703_100500414 498
449 3300048919 Ga0496116_0083051 Ga0496116_0083051_243_1769 498
450 iso_pu_bacteria 2643221541 2643729329 498
451 iso_pu_bacteria 2643221606 2644045805 498
452 iso_pu_bacteria 2643221671 2644393382 498
453 iso_pu_bacteria 2990265787 2990266433 498
454 iso_pu_bacteria 2993693658 2993695774 498
455 3300001915 JGI24741J21665_1000493 JGI24741J21665_10004933 499
456 3300001979 JGI24740J21852_10000918 JGI24740J21852_100009184 499
457 3300001990 JGI24737J22298_10000623 JGI24737J22298_1000062310 499
458 3300001990 JGI24737J22298_10002339 JGI24737J22298_100023393 499
459 3300003215 JGI25153J46596_10000002 JGI25153J46596_10000002510 499
460 3300003759 Ga0055525_1000051 Ga0055525_100005113 499
461 3300003762 Ga0055542_1000020 Ga0055542_1000020130 499
462 3300003763 Ga0055529_1000016 Ga0055529_1000016217 499
463 3300005262 Ga0065165_1005025 Ga0065165_10050255 499
464 3300005327 Ga0070658_10003444 Ga0070658_1000344411 499
465 3300005328 Ga0070676_10031406 Ga0070676_100314062 499
466 3300005331 Ga0070670_100000068 Ga0070670_10000006829 499
467 3300005331 Ga0070670_100032784 Ga0070670_1000327843 499
468 3300005339 Ga0070660_100010649 Ga0070660_1000106495 499
469 3300005339 Ga0070660_100086270 Ga0070660_1000862702 499
470 3300005344 Ga0070661_100004499 Ga0070661_1000044992 499
471 3300005347 Ga0070668_100031585 Ga0070668_1000315852 499
472 3300005356 Ga0070674_100000740 Ga0070674_10000074011 499
473 3300005366 Ga0070659_100006389 Ga0070659_1000063895 499
474 3300005367 Ga0070667_100000951 Ga0070667_10000095124 499
475 3300005456 Ga0070678_100000011 Ga0070678_10000001163 499
476 3300005548 Ga0070665_100000051 Ga0070665_100000051211 499
477 3300005614 Ga0068856_100084644 Ga0068856_1000846443 499
478 3300005617 Ga0068859_100001448 Ga0068859_1000014484 499
479 3300005617 Ga0068859_100111549 Ga0068859_1001115492 499
480 3300005618 Ga0068864_100000019 Ga0068864_10000001931 499
481 3300005719 Ga0068861_100000387 Ga0068861_1000003872 499
482 3300005834 Ga0068851_10015558 Ga0068851_100155582 499
483 3300005841 Ga0068863_100000015 Ga0068863_10000001531 499
484 3300005844 Ga0068862_100000094 Ga0068862_10000009429 499
485 3300006931 Ga0097620_100001448 Ga0097620_1000014484 499
486 3300006931 Ga0097620_100111552 Ga0097620_1001115522 499
487 3300009011 Ga0105251_10000853 Ga0105251_1000085324 499
488 3300009101 Ga0105247_10003627 Ga0105247_100036278 499
489 3300009148 Ga0105243_10000760 Ga0105243_1000076025 499
490 3300009174 Ga0105241_10007668 Ga0105241_100076688 499
491 3300009177 Ga0105248_10000311 Ga0105248_1000031144 499
492 3300009551 Ga0105238_10054388 Ga0105238_100543882 499
493 3300009553 Ga0105249_10000568 Ga0105249_1000056826 499
494 3300013102 Ga0157371_10000030 Ga0157371_10000030195 499
495 3300013307 Ga0157372_10221477 Ga0157372_102214772 499
496 3300014968 Ga0157379_10017827 Ga0157379_100178272 499
497 3300015690 Ga0183363_1005 Ga0183363_100573 499
498 3300025230 Ga0209563_100019 Ga0209563_100019493 499
499 3300025246 Ga0209646_1006000 Ga0209646_10060002 499
500 3300025253 Ga0209677_108363 Ga0209677_1083631 499
501 3300025254 Ga0209148_1000017 Ga0209148_1000017531 499
502 3300025272 Ga0209455_1000005 Ga0209455_1000005531 499
503 3300025297 Ga0209758_1000001 Ga0209758_10000011307 499
504 3300025321 Ga0207656_10000528 Ga0207656_100005288 499
505 3300025900 Ga0207710_10003244 Ga0207710_100032445 499
506 3300025907 Ga0207645_10028783 Ga0207645_100287833 499
507 3300025909 Ga0207705_10000982 Ga0207705_1000098219 499
508 3300025914 Ga0207671_10028579 Ga0207671_100285794 499
509 3300025919 Ga0207657_10089491 Ga0207657_100894912 499
510 3300025920 Ga0207649_10001162 Ga0207649_100011627 499
511 3300025925 Ga0207650_10000054 Ga0207650_1000005446 499
512 3300025933 Ga0207706_10011098 Ga0207706_100110986 499
513 3300025935 Ga0207709_10000031 Ga0207709_1000003154 499
514 3300025937 Ga0207669_10000073 Ga0207669_1000007365 499
515 3300025937 Ga0207669_10000718 Ga0207669_1000071812 499
516 3300025941 Ga0207711_10000017 Ga0207711_10000017112 499
517 3300025945 Ga0207679_10037342 Ga0207679_100373423 499
518 3300025949 Ga0207667_10000004 Ga0207667_10000004340 499
519 3300025961 Ga0207712_10000163 Ga0207712_1000016348 499
520 3300025981 Ga0207640_10002843 Ga0207640_100028436 499
521 3300025986 Ga0207658_10000223 Ga0207658_1000022344 499
522 3300026041 Ga0207639_10001031 Ga0207639_100010318 499
523 3300026067 Ga0207678_10000454 Ga0207678_1000045424 499
524 3300026088 Ga0207641_10000008 Ga0207641_10000008145 499
525 3300026095 Ga0207676_10000019 Ga0207676_1000001929 499
526 3300026116 Ga0207674_10001228 Ga0207674_1000122824 499
527 3300026118 Ga0207675_100000016 Ga0207675_10000001626 499
528 3300026121 Ga0207683_10000086 Ga0207683_1000008667 499
529 3300026121 Ga0207683_10091822 Ga0207683_100918222 499
530 3300028379 Ga0268266_10000002 Ga0268266_100000022578 499
531 3300028380 Ga0268265_10000011 Ga0268265_10000011145 499
532 3300028786 Ga0307517_10014006 Ga0307517_100140062 499
533 3300028786 Ga0307517_10041774 Ga0307517_100417742 499
534 3300031456 Ga0307513_10082859 Ga0307513_100828592 499
535 3300031901 Ga0307406_10015834 Ga0307406_100158343 499
536 3300044706 Ga0466964_0004827 Ga0466964_0004827_1761_3275 499
537 3300046452 Ga0495617_011142 Ga0495617_011142_231_1739 499
538 3300046471 Ga0495650_0000340 Ga0495650_0000340_52981_54489 499
539 3300046492 Ga0495585_0019033 Ga0495585_0019033_43_1551 499
540 3300046506 Ga0495583_0000996 Ga0495583_0000996_10621_12129 499
541 3300046506 Ga0495583_0017942 Ga0495583_0017942_1240_2748 499
542 3300046506 Ga0495583_0033284 Ga0495583_0033284_732_2318 499
543 3300046507 Ga0495606_0000824 Ga0495606_0000824_36175_37683 499
544 3300046522 Ga0495643_0001032 Ga0495643_0001032_17787_19295 499
545 3300046522 Ga0495643_0002465 Ga0495643_0002465_8107_9693 499
546 3300046524 Ga0495648_0000439 Ga0495648_0000439_8894_10402 499
547 3300046525 Ga0495663_0006151 Ga0495663_0006151_1638_3152 499
548 3300046525 Ga0495663_0008844 Ga0495663_0008844_951_2459 499
549 3300046530 Ga0495654_0000264 Ga0495654_0000264_20657_22171 499
550 3300046557 Ga0495622_0003931 Ga0495622_0003931_1756_3264 499
551 3300046558 Ga0495633_0003629 Ga0495633_0003629_5619_7127 499
552 3300046616 Ga0495668_0000007 Ga0495668_0000007_233698_235206 499
553 3300046616 Ga0495668_0000984 Ga0495668_0000984_10878_12392 499
554 3300046660 Ga0495625_0000583 Ga0495625_0000583_8795_10303 499
555 3300046660 Ga0495625_0038998 Ga0495625_0038998_1405_2913 499
556 3300046660 Ga0495625_0088204 Ga0495625_0088204_424_1932 499
557 3300046684 Ga0495669_0000286 Ga0495669_0000286_27145_28653 499
558 3300046794 Ga0495589_0036243 Ga0495589_0036243_230_1744 499
559 3300046809 Ga0495600_0004286 Ga0495600_0004286_1122_2630 499
560 3300047323 Ga0495683_0054044 Ga0495683_0054044_448_1956 499
561 3300047443 Ga0495687_000512 Ga0495687_000512_16926_18434 499
562 3300047443 Ga0495687_001133 Ga0495687_001133_89_1597 499
563 3300047445 Ga0495677_0003158 Ga0495677_0003158_312_1898 499
564 3300048905 Ga0496102_0001240 Ga0496102_0001240_4172_5680 499
565 3300048906 Ga0496103_0000307 Ga0496103_0000307_8253_9761 499
566 3300048907 Ga0496104_0058614 Ga0496104_0058614_1277_2785 499
567 3300048908 Ga0496105_0000190 Ga0496105_0000190_18274_19782 499
568 3300048914 Ga0496111_0011992 Ga0496111_0011992_1420_2928 499
569 3300048917 Ga0496114_0025500 Ga0496114_0025500_444_1952 499
570 3300048918 Ga0496115_0000251 Ga0496115_0000251_28813_30321 499
571 3300048919 Ga0496116_0003152 Ga0496116_0003152_5305_6813 499
572 3300048920 Ga0496117_0000182 Ga0496117_0000182_32500_34008 499
573 3300048920 Ga0496117_0003796 Ga0496117_0003796_14196_15710 499
574 3300048921 Ga0496118_0000125 Ga0496118_0000125_94029_95537 499
575 3300048921 Ga0496118_0000870 Ga0496118_0000870_28609_30123 499
576 3300048924 Ga0496121_0000906 Ga0496121_0000906_17644_19152 499
577 3300048925 Ga0496122_0015452 Ga0496122_0015452_4078_5586 499
578 3300048927 Ga0496124_0000082 Ga0496124_0000082_40871_42379 499
579 3300048928 Ga0496125_0000730 Ga0496125_0000730_35030_36538 499
580 3300048929 Ga0496126_0000221 Ga0496126_0000221_28661_30169 499
581 3300053079 Ga0500610_0001872 Ga0500610_0001872_83_1591 499
582 3300053119 Ga0500595_001141 Ga0500595_001141_11231_12739 499
583 3300053130 Ga0500642_0001053 Ga0500642_0001053_1813_3321 499
584 3300053158 Ga0500627_0001208 Ga0500627_0001208_1523_3037 499
585 3300053730 Ga0500645_000080 Ga0500645_000080_75_1583 499
586 iso_pu_bacteria 2643221605 2644040612 499
587 iso_pu_bacteria 2848297114 2848299179 499
588 3300001915 JGI24741J21665_1000154 JGI24741J21665_10001546 500
589 3300001979 JGI24740J21852_10001089 JGI24740J21852_100010897 500
590 3300001989 JGI24739J22299_10000294 JGI24739J22299_1000029413 500
591 3300001990 JGI24737J22298_10000124 JGI24737J22298_1000012424 500
592 3300005564 Ga0070664_100089999 Ga0070664_1000899992 500
593 3300005578 Ga0068854_100023221 Ga0068854_1000232212 500
594 3300005614 Ga0068856_100030426 Ga0068856_1000304263 500
595 3300006195 Ga0075366_10054515 Ga0075366_100545152 500
596 3300009174 Ga0105241_10001930 Ga0105241_1000193013 500
597 3300009551 Ga0105238_10107222 Ga0105238_101072222 500
598 3300013104 Ga0157370_10140493 Ga0157370_101404932 500
599 3300025904 Ga0207647_10011262 Ga0207647_100112625 500
600 3300025913 Ga0207695_10142308 Ga0207695_101423081 500
601 3300025919 Ga0207657_10014805 Ga0207657_100148057 500
602 3300025981 Ga0207640_10012020 Ga0207640_100120202 500
603 3300025981 Ga0207640_10024905 Ga0207640_100249053 500
604 3300026041 Ga0207639_10000387 Ga0207639_100003873 500
605 3300026041 Ga0207639_10003181 Ga0207639_100031812 500
606 3300026067 Ga0207678_10001685 Ga0207678_100016856 500
607 3300026078 Ga0207702_10039939 Ga0207702_100399392 500
608 3300031548 Ga0307408_100007451 Ga0307408_1000074512 500
609 3300031548 Ga0307408_100042351 Ga0307408_1000423512 500
610 3300031548 Ga0307408_100089007 Ga0307408_1000890072 500
611 3300031731 Ga0307405_10018615 Ga0307405_100186154 500
612 3300031824 Ga0307413_10019557 Ga0307413_100195572 500
613 3300031901 Ga0307406_10034146 Ga0307406_100341462 500
614 3300032002 Ga0307416_100029044 Ga0307416_1000290443 500
615 3300046520 Ga0495637_0002189 Ga0495637_0002189_3053_4573 500
616 3300046522 Ga0495643_0000146 Ga0495643_0000146_71338_72858 500
617 3300046692 Ga0495671_0000100 Ga0495671_0000100_65956_67476 500
618 3300047470 Ga0495681_0007326 Ga0495681_0007326_2878_4398 500
619 3300049679 Ga0501249_000356 Ga0501249_000356_10336_11844 500
620 3300050493 nmdc:mga0k408_41296_c1 nmdc:mga0k408_41296_c1_457_1968 500

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00425

Chorismate_bind

chorismate binding enzyme

229

483

0.98

PF04715

Anth_synt_I_N

Anthranilate synthase component I, N terminal region

26

174

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pi1-assembly1.cif.gz_AAA bacillus subtilis pabb 0.9209 15 489
7qu9-assembly1.cif.gz_A structure of aminodeoxychorismate synthase component 1 (pabb) from bacillus subtilis spizizenii. 0.9204 15 489
7qu9-assembly1.cif.gz_A structure of aminodeoxychorismate synthase component 1 (pabb) from bacillus subtilis spizizenii. 0.9166 15 489
7qu9-assembly2.cif.gz_B structure of aminodeoxychorismate synthase component 1 (pabb) from bacillus subtilis spizizenii. 0.9123 15 489
7bvd-assembly1.cif.gz_B anthranilate synthase component i (trpe)[mycolicibacterium smegmatis] 0.9082 2 491
ID Description Score Start End Superfamily
af_O94582_1_484_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.9301 5 493 3.60.120.10
af_O94582_1_484_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.9097 5 493 3.60.120.10
af_A0A1D6LA98_50_603_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.9065 5 490 3.60.120.10
5cwaA00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.9028 4 491 3.60.120.10
af_Q2FYR9_3_467_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8929 19 483 3.60.120.10
ID Description Score Start End GO Terms
AF-A0A699Q9B5-F1-model_v4 Anthranilate synthase component 0.9927 291 399 GO:0000162
GO:0016829
GO:0046872
AF-D2XTK3-F1-model_v4 Anthranilate synthase component I (EC 4.1.3.27) 0.9846 289 406 GO:0000162
GO:0004049
GO:0046872
AF-L8GVC0-F1-model_v4 Anthranilate synthase component I, putative 0.9768 232 458 GO:0000162
AF-A0A6I2VF08-F1-model_v4 Anthranilate synthase component I 0.9717 211 493 GO:0000162
GO:0016829
GO:0046872
AF-A0A6N8LV50-F1-model_v4 Anthranilate synthase component 1 (EC 4.1.3.27) 0.9704 7 500 GO:0000162
GO:0004049
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map