F460299

General Info

Members Datasets Scaffolds Average Seq Length
532 228 532 196

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0118289|Ga0373925_0118289_936_1652
Length 202
Sequence MAAKKAGDLGFTVATAEDLKAPKRPPRLRNYYSKEVVPALQKEFNLKNPMQVPRLKKIVLNMGLGEAVRDPKILEGAITDIAKIAGQRPVLTKSRKSIATYKLREGMPIGCMVTLRRERMWEFLDRLVNLALPRVRDFRGLPAKMDGRGSYSLGLKEQIIFTEIDYDKVDKLRGMNITFVTSAPNDEQAKALLQHLGMPFRK

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
126 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
132 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
133 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
134 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
135 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
136 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
137 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 2.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.19
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10022301 3300002075 Bacteria 1310
2 JGI24751J29686_10027880 3300002459 Unclassified 1173
3 rootH1_10192301 3300003323 Bacteria 2114
4 Ga0058862_10066390 3300004803 Bacteria 1245
5 Ga0068869_100303430 3300005334 Bacteria 1290
6 Ga0070674_100391118 3300005356 Bacteria 1134
7 Ga0070709_10000287 3300005434 Bacteria 32074
8 Ga0070714_100001531 3300005435 Bacteria 16859
9 Ga0070714_100004422 3300005435 Bacteria 10579
10 Ga0070713_100000752 3300005436 Bacteria 20729
11 Ga0070713_100343804 3300005436 Bacteria 1383
12 Ga0070705_100019301 3300005440 Bacteria 3588
13 Ga0070705_100205422 3300005440 Bacteria 1354
14 Ga0070705_100259006 3300005440 Bacteria 1225
15 Ga0070705_100465425 3300005440 Bacteria 952
16 Ga0070700_100208627 3300005441 Bacteria 1377
17 Ga0070694_100434463 3300005444 Bacteria 1034
18 Ga0070708_100000520 3300005445 Bacteria 28904
19 Ga0070708_100009690 3300005445 Bacteria 7773
20 Ga0070708_100025518 3300005445 Bacteria 5052
21 Ga0070708_100058461 3300005445 Bacteria 3436
22 Ga0070708_100061806 3300005445 Bacteria 3347
23 Ga0070708_100069564 3300005445 Bacteria 3165
24 Ga0070708_100076124 3300005445 Bacteria 3030
25 Ga0070708_100115338 3300005445 Bacteria 2472
26 Ga0070708_100131183 3300005445 Bacteria 2319
27 Ga0070708_100170281 3300005445 Bacteria 2033
28 Ga0070708_100242524 3300005445 Bacteria 1692
29 Ga0070708_100673770 3300005445 Bacteria 974
30 Ga0070708_101143725 3300005445 Bacteria 729
31 Ga0070662_100445772 3300005457 Bacteria 1074
32 Ga0070662_100680207 3300005457 Bacteria 869
33 Ga0070681_10364783 3300005458 Bacteria 1355
34 Ga0068867_100231160 3300005459 Bacteria 1495
35 Ga0070706_100001515 3300005467 Bacteria 24359
36 Ga0070706_100001725 3300005467 Bacteria 22674
37 Ga0070706_100046673 3300005467 Bacteria 3999
38 Ga0070706_100056235 3300005467 Bacteria 3631
39 Ga0070706_100060798 3300005467 Bacteria 3487
40 Ga0070706_100111766 3300005467 Bacteria 2543
41 Ga0070706_100170537 3300005467 Bacteria 2032
42 Ga0070706_100290414 3300005467 Bacteria 1526
43 Ga0070707_100001328 3300005468 Bacteria 24359
44 Ga0070707_100027238 3300005468 Bacteria 5437
45 Ga0070707_100037172 3300005468 Bacteria 4647
46 Ga0070707_100052382 3300005468 Bacteria 3913
47 Ga0070707_100173073 3300005468 Bacteria 2104
48 Ga0070707_100232515 3300005468 Bacteria 1794
49 Ga0070707_100270942 3300005468 Bacteria 1651
50 Ga0070707_100274179 3300005468 Bacteria 1640
51 Ga0070707_100281158 3300005468 Bacteria 1617
52 Ga0070707_100293575 3300005468 Bacteria 1579
53 Ga0070707_100299646 3300005468 Bacteria 1562
54 Ga0070707_100320069 3300005468 Bacteria 1507
55 Ga0070707_100388940 3300005468 Bacteria 1354
56 Ga0070707_100399396 3300005468 Bacteria 1335
57 Ga0070707_100405463 3300005468 Bacteria 1323
58 Ga0070707_100408783 3300005468 Bacteria 1317
59 Ga0070707_100457462 3300005468 Bacteria 1237
60 Ga0070707_100502241 3300005468 Bacteria 1174
61 Ga0070698_100067542 3300005471 Bacteria 3595
62 Ga0070698_100271845 3300005471 Bacteria 1626
63 Ga0070698_100284830 3300005471 Bacteria 1584
64 Ga0070698_100430369 3300005471 Bacteria 1254
65 Ga0070699_100006640 3300005518 Bacteria 10060
66 Ga0070699_100009579 3300005518 Bacteria 8393
67 Ga0070699_100017094 3300005518 Bacteria 6229
68 Ga0070699_100032425 3300005518 Bacteria 4511
69 Ga0070699_100092761 3300005518 Bacteria 2641
70 Ga0070699_100228654 3300005518 Bacteria 1658
71 Ga0070699_100231580 3300005518 Bacteria 1647
72 Ga0070699_100241765 3300005518 Bacteria 1612
73 Ga0070699_100256450 3300005518 Bacteria 1563
74 Ga0070699_100954768 3300005518 Bacteria 786
75 Ga0070679_100264098 3300005530 Bacteria 1676
76 Ga0070679_100332499 3300005530 Bacteria 1468
77 Ga0070679_100396005 3300005530 Bacteria 1327
78 Ga0070684_100095201 3300005535 Bacteria 2653
79 Ga0070684_100675533 3300005535 Bacteria 962
80 Ga0070697_100008491 3300005536 Bacteria 8016
81 Ga0070697_100010522 3300005536 Bacteria 7221
82 Ga0070697_100010596 3300005536 Bacteria 7196
83 Ga0070697_100037290 3300005536 Bacteria 3927
84 Ga0070697_100050931 3300005536 Bacteria 3363
85 Ga0070697_100051727 3300005536 Bacteria 3338
86 Ga0070697_100054661 3300005536 Bacteria 3245
87 Ga0070697_100254571 3300005536 Bacteria 1502
88 Ga0070697_100361976 3300005536 Bacteria 1254
89 Ga0070697_100475326 3300005536 Bacteria 1091
90 Ga0070697_100687115 3300005536 Bacteria 902
91 Ga0070697_101524252 3300005536 Bacteria 597
92 Ga0070695_100086178 3300005545 Bacteria 2087
93 Ga0070695_100192801 3300005545 Bacteria 1451
94 Ga0070695_100283759 3300005545 Bacteria 1218
95 Ga0070695_100600801 3300005545 Bacteria 864
96 Ga0070696_100143548 3300005546 Bacteria 1747
97 Ga0070696_100267397 3300005546 Bacteria 1299
98 Ga0070696_100292715 3300005546 Bacteria 1244
99 Ga0070696_101070097 3300005546 Bacteria 677
100 Ga0070693_100139680 3300005547 Bacteria 1523
101 Ga0070704_100006730 3300005549 Bacteria 6802
102 Ga0070704_100022112 3300005549 Bacteria 4135
103 Ga0070704_100035824 3300005549 Bacteria 3376
104 Ga0070704_100036887 3300005549 Bacteria 3334
105 Ga0068859_100058681 3300005617 Bacteria 3877
106 Ga0068864_100605907 3300005618 Bacteria 1063
107 Ga0068861_100038447 3300005719 Bacteria 3564
108 Ga0068863_100060448 3300005841 Bacteria 3584
109 Ga0068858_100248049 3300005842 Bacteria 1691
110 Ga0068858_100419666 3300005842 Bacteria 1287
111 Ga0068860_100021824 3300005843 Bacteria 6194
112 Ga0068862_100000032 3300005844 Bacteria 179887
113 Ga0068862_100014391 3300005844 Bacteria 6564
114 Ga0081455_10003850 3300005937 Bacteria 17117
115 Ga0081538_10134491 3300005981 Bacteria 1155
116 Ga0081539_10068117 3300005985 Bacteria 1922
117 Ga0070717_10008962 3300006028 Bacteria 7501
118 Ga0070717_10194751 3300006028 Bacteria 1772
119 Ga0070717_10456020 3300006028 Bacteria 1153
120 Ga0075432_10060557 3300006058 Bacteria 1347
121 Ga0070716_100021139 3300006173 Bacteria 3426
122 Ga0075433_10012940 3300006852 Bacteria 6763
123 Ga0075433_10016581 3300006852 Bacteria 6077
124 Ga0075433_10185365 3300006852 Bacteria 1852
125 Ga0075433_10426382 3300006852 Bacteria 1170
126 Ga0075434_100003064 3300006871 Bacteria 14886
127 Ga0075434_100030203 3300006871 Bacteria 5335
128 Ga0075434_100078534 3300006871 Bacteria 3296
129 Ga0075434_100148563 3300006871 Bacteria 2363
130 Ga0075434_100154316 3300006871 Bacteria 2316
131 Ga0075434_100398832 3300006871 Bacteria 1397
132 Ga0075436_100080919 3300006914 Bacteria 2251
133 Ga0075436_100098259 3300006914 Bacteria 2037
134 Ga0075436_100474136 3300006914 Bacteria 913
135 Ga0097620_100058681 3300006931 Bacteria 3877
136 Ga0075435_100011712 3300007076 Bacteria 6468
137 Ga0075435_100028105 3300007076 Bacteria 4408
138 Ga0075435_100206698 3300007076 Bacteria 1664
139 Ga0075435_100270828 3300007076 Bacteria 1448
140 Ga0099794_10000117 3300007265 Bacteria 29179
141 Ga0099794_10113672 3300007265 Bacteria 1358
142 Ga0099794_10136102 3300007265 Bacteria 1243
143 Ga0099794_10179246 3300007265 Bacteria 1081
144 Ga0105240_10318052 3300009093 Bacteria 1775
145 Ga0111539_10305760 3300009094 Bacteria 1850
146 Ga0111539_10575838 3300009094 Bacteria 1311
147 Ga0111539_11100747 3300009094 Bacteria 923
148 Ga0111539_12126074 3300009094 Bacteria 651
149 Ga0105247_10029355 3300009101 Bacteria 3332
150 Ga0114129_10096524 3300009147 Bacteria 4092
151 Ga0114129_10149325 3300009147 Bacteria 3199
152 Ga0114129_10186665 3300009147 Bacteria 2817
153 Ga0114129_11406148 3300009147 Bacteria 861
154 Ga0105243_10448426 3300009148 Bacteria 1210
155 Ga0105241_10746742 3300009174 Bacteria 897
156 Ga0105249_10000017 3300009553 Bacteria 277115
157 Ga0157375_10686320 3300013308 Bacteria 1178
158 Ga0163163_10326983 3300014325 Bacteria 1587
159 Ga0163163_10756423 3300014325 Bacteria 1035
160 Ga0206356_10494157 3300020070 Bacteria 4765
161 Ga0206356_11567545 3300020070 Bacteria 2859
162 Ga0206356_11798093 3300020070 Bacteria 2239
163 Ga0206349_1612507 3300020075 Bacteria 1616
164 Ga0206350_10810608 3300020080 Bacteria 5805
165 Ga0206353_10285067 3300020082 Bacteria 1378
166 Ga0224712_10000184 3300022467 Bacteria 10959
167 Ga0224712_10002547 3300022467 Bacteria 4524
168 Ga0224712_10017922 3300022467 Bacteria 2357
169 Ga0207710_10006206 3300025900 Bacteria 5114
170 Ga0207699_10000308 3300025906 Bacteria 26108
171 Ga0207684_10000026 3300025910 Bacteria 316711
172 Ga0207684_10000148 3300025910 Bacteria 124604
173 Ga0207684_10000231 3300025910 Bacteria 84968
174 Ga0207684_10048483 3300025910 Bacteria 3602
175 Ga0207684_10068282 3300025910 Bacteria 3021
176 Ga0207684_10190569 3300025910 Bacteria 1769
177 Ga0207684_10341243 3300025910 Bacteria 1290
178 Ga0207707_10072752 3300025912 Bacteria 2996
179 Ga0207662_10053819 3300025918 Bacteria 2398
180 Ga0207662_10099568 3300025918 Bacteria 1800
181 Ga0207652_10195329 3300025921 Bacteria 1820
182 Ga0207652_10389289 3300025921 Bacteria 1258
183 Ga0207646_10000093 3300025922 Bacteria 119533
184 Ga0207646_10000394 3300025922 Bacteria 58624
185 Ga0207646_10000668 3300025922 Bacteria 44376
186 Ga0207646_10007605 3300025922 Bacteria 10977
187 Ga0207646_10009160 3300025922 Bacteria 9818
188 Ga0207646_10013194 3300025922 Bacteria 7908
189 Ga0207646_10013601 3300025922 Bacteria 7772
190 Ga0207646_10018156 3300025922 Bacteria 6567
191 Ga0207646_10026822 3300025922 Bacteria 5254
192 Ga0207646_10033122 3300025922 Bacteria 4675
193 Ga0207646_10080613 3300025922 Bacteria 2910
194 Ga0207646_10082944 3300025922 Bacteria 2867
195 Ga0207646_10112123 3300025922 Bacteria 2448
196 Ga0207646_10252972 3300025922 Bacteria 1592
197 Ga0207646_10265902 3300025922 Bacteria 1550
198 Ga0207646_10268490 3300025922 Bacteria 1542
199 Ga0207646_10271908 3300025922 Bacteria 1532
200 Ga0207646_10389286 3300025922 Bacteria 1259
201 Ga0207646_10431026 3300025922 Bacteria 1190
202 Ga0207681_10032383 3300025923 Bacteria 3422
203 Ga0207700_10003258 3300025928 Bacteria 9389
204 Ga0207700_10005510 3300025928 Bacteria 7590
205 Ga0207664_10001273 3300025929 Bacteria 16631
206 Ga0207664_10327604 3300025929 Bacteria 1352
207 Ga0207690_10335874 3300025932 Bacteria 1191
208 Ga0207706_10048865 3300025933 Bacteria 3741
209 Ga0207709_10106368 3300025935 Bacteria 1866
210 Ga0207704_10529637 3300025938 Unclassified 954
211 Ga0207665_10137619 3300025939 Bacteria 1739
212 Ga0207691_10192033 3300025940 Bacteria 1781
213 Ga0207689_10189475 3300025942 Bacteria 1697
214 Ga0207689_10210850 3300025942 Bacteria 1605
215 Ga0207661_10002899 3300025944 Bacteria 11851
216 Ga0207712_10000012 3300025961 Bacteria 392363
217 Ga0207640_10309631 3300025981 Bacteria 1253
218 Ga0207703_11115463 3300026035 Bacteria 758
219 Ga0207708_10003758 3300026075 Bacteria 11187
220 Ga0207641_10046746 3300026088 Bacteria 3649
221 Ga0207648_10070446 3300026089 Bacteria 3048
222 Ga0207648_10105904 3300026089 Bacteria 2467
223 Ga0207675_100094742 3300026118 Bacteria 2808
224 Ga0207675_100578146 3300026118 Bacteria 1125
225 Ga0209588_1000036 3300027671 Bacteria 65612
226 Ga0209966_1012696 3300027695 Bacteria 1550
227 Ga0209998_10000069 3300027717 Bacteria 41068
228 Ga0209974_10007634 3300027876 Bacteria 3723
229 Ga0209974_10014674 3300027876 Bacteria 2605
230 Ga0268265_10000125 3300028380 Bacteria 96710
231 Ga0268264_10000347 3300028381 Bacteria 70884
232 Ga0268264_10514931 3300028381 Bacteria 1169
233 Ga0265319_1000855 3300028563 Bacteria 19414
234 Ga0265334_10006763 3300028573 Bacteria 4926
235 Ga0265318_10001874 3300028577 Bacteria 11823
236 Ga0265320_10006662 3300031240 Bacteria 7257
237 Ga0265325_10005781 3300031241 Bacteria 7584
238 Ga0265340_10004378 3300031247 Bacteria 7907
239 Ga0265339_10028538 3300031249 Bacteria 3172
240 Ga0265316_10011068 3300031344 Bacteria 8171
241 Ga0307408_100172798 3300031548 Bacteria 1727
242 Ga0265313_10027465 3300031595 Bacteria 2978
243 Ga0265314_10016207 3300031711 Bacteria 5899
244 Ga0265342_10007420 3300031712 Bacteria 8028
245 Ga0316577_10081775 3300031733 Unclassified 1806
246 Ga0307407_10019951 3300031903 Bacteria 3423
247 Ga0307409_100042522 3300031995 Bacteria 3404
248 Ga0307416_100054291 3300032002 Bacteria 3220
249 Ga0307414_10818416 3300032004 Bacteria 850
250 Ga0307415_100145156 3300032126 Bacteria 1818
251 Ga0316593_10051242 3300032168 Bacteria 1395
252 Ga0373926_0001122 3300035083 Bacteria 7940
253 Ga0373951_0152537 3300035091 Bacteria 649
254 Ga0373945_0018377 3300035116 Bacteria 2378
255 Ga0373945_0084273 3300035116 Bacteria 1222
256 Ga0373943_0006870 3300035170 Bacteria 5105
257 Ga0373942_0021589 3300035207 Bacteria 1626
258 Ga0316574_0205832 3300035398 Bacteria 1263
259 Ga0373931_0177930 3300035691 Bacteria 1258
260 Ga0373935_0051065 3300035692 Bacteria 2625
261 Ga0373935_0057637 3300035692 Bacteria 2478
262 Ga0373927_0005589 3300035695 Bacteria 8642
263 Ga0373927_0050141 3300035695 Bacteria 2698
264 Ga0373933_0195718 3300035724 Bacteria 1292
265 Ga0373947_0006238 3300035725 Bacteria 6931
266 Ga0373947_0011070 3300035725 Bacteria 5178
267 Ga0373937_0018696 3300036401 Bacteria 6192
268 Ga0373937_0032630 3300036401 Bacteria 4724
269 Ga0373937_0076114 3300036401 Bacteria 3099
270 Ga0373937_0311322 3300036401 Bacteria 1489
271 Ga0373925_0001662 3300037068 Bacteria 18731
272 Ga0373925_0118289 3300037068 Bacteria 2055
273 Ga0395901_0547813 3300038443 Bacteria 1173
274 Ga0242420_082966 3300038996 Bacteria 664
275 Ga0400483_003112 3300039062 Bacteria 4314
276 Ga0400483_217638 3300039062 Bacteria 24445
277 Ga0400483_291615 3300039062 Bacteria 2549
278 Ga0436360_0166796 3300039438 Bacteria 922
279 Ga0436360_1021365 3300039438 Bacteria 1139
280 Ga0436361_0911810 3300039447 Bacteria 1833
281 Ga0436363_0875424 3300039450 Bacteria 1816
282 Ga0436362_0295958 3300039453 Bacteria 661
283 Ga0436362_1211017 3300039453 Bacteria 1962
284 Ga0451802_0510671 3300041460 Bacteria 1284
285 Ga0451837_0812999 3300041494 Bacteria 682
286 Ga0439441_001960 3300042001 Bacteria 2825
287 Ga0450922_001758 3300042124 Bacteria 2098
288 Ga0450923_008588 3300042125 Bacteria 1762
289 Ga0450910_001045 3300042147 Bacteria 3387
290 Ga0450918_004764 3300042531 Bacteria 2460
291 Ga0451577_0187775 3300042876 Bacteria 1864
292 Ga0466969_0043342 3300044656 Bacteria 2242
293 Ga0453683_0038395 3300044673 Unclassified 3010
294 Ga0453683_0097843 3300044673 Bacteria 1842
295 Ga0466966_0502250 3300044684 Bacteria 729
296 Ga0453684_0001518 3300044712 Bacteria 65070
297 Ga0453684_1239370 3300044712 Bacteria 781
298 Ga0466971_0063956 3300044719 Bacteria 1665
299 Ga0466970_0099218 3300044765 Bacteria 1585
300 Ga0466957_0011212 3300044842 Bacteria 5162
301 Ga0466959_0175651 3300045049 Bacteria 1500
302 Ga0451576_0070530 3300045051 Bacteria 3638
303 Ga0451576_0194350 3300045051 Bacteria 2119
304 Ga0451576_0347889 3300045051 Bacteria 1552
305 Ga0451576_1064856 3300045051 Bacteria 847
306 Ga0466958_0022910 3300045836 Bacteria 3661
307 Ga0495603_0000280 3300046455 Bacteria 27139
308 Ga0495629_0000177 3300046459 Bacteria 56906
309 Ga0495641_0029673 3300046461 Bacteria 2633
310 Ga0495651_0128525 3300046462 Bacteria 1852
311 Ga0495653_0015203 3300046463 Bacteria 6274
312 Ga0495580_0185958 3300046472 Bacteria 1434
313 Ga0495580_0909842 3300046472 Bacteria 565
314 Ga0495582_0000185 3300046473 Bacteria 34065
315 Ga0495639_0001788 3300046475 Bacteria 9521
316 Ga0495594_0000224 3300046499 Bacteria 27588
317 Ga0495608_0191106 3300046511 Bacteria 1292
318 Ga0495628_0042913 3300046516 Bacteria 3605
319 Ga0495630_0147445 3300046517 Bacteria 1790
320 Ga0495630_0665676 3300046517 Bacteria 797
321 Ga0495666_0020979 3300046526 Bacteria 3235
322 Ga0495665_0048045 3300046531 Bacteria 2263
323 Ga0495640_0240089 3300046533 Bacteria 1137
324 Ga0495587_0068425 3300046536 Bacteria 2068
325 Ga0495645_0071915 3300046543 Bacteria 2493
326 Ga0495622_0000916 3300046557 Bacteria 15986
327 Ga0495634_0003557 3300046642 Bacteria 12469
328 Ga0495634_0011087 3300046642 Bacteria 6575
329 Ga0495635_0104295 3300046663 Bacteria 1938
330 Ga0495588_0000617 3300046674 Bacteria 16755
331 Ga0495599_0049077 3300046678 Bacteria 2646
332 Ga0495647_0001129 3300046681 Bacteria 8180
333 Ga0495613_0037438 3300046689 Bacteria 3596
334 Ga0495670_0295850 3300046691 Bacteria 867
335 Ga0495581_0001367 3300047315 Bacteria 13506
336 Ga0495674_0066935 3300047319 Bacteria 3114
337 Ga0495680_0016752 3300047322 Bacteria 6284
338 Ga0495684_0057456 3300047471 Bacteria 2965
339 Ga0495593_0001943 3300047673 Bacteria 12328
340 Ga0495602_0144083 3300048088 Bacteria 1882
341 Ga0495602_0390832 3300048088 Bacteria 994
342 Ga0495614_0000618 3300048089 Bacteria 14895
343 Ga0501031_0001065 3300049568 Bacteria 16649
344 Ga0501031_0063316 3300049568 Bacteria 2409
345 Ga0501031_0296773 3300049568 Bacteria 1047
346 Ga0501033_0235722 3300049570 Bacteria 1299
347 Ga0501033_0355518 3300049570 Bacteria 1026
348 Ga0501034_0592138 3300049571 Bacteria 1015
349 Ga0501036_0006100 3300049572 Bacteria 9780
350 Ga0501036_0035115 3300049572 Bacteria 4241
351 Ga0501036_0180114 3300049572 Bacteria 1779
352 Ga0501036_0261388 3300049572 Bacteria 1450
353 Ga0501037_0013503 3300049573 Bacteria 6015
354 Ga0501037_0109324 3300049573 Bacteria 1992
355 Ga0501038_0035027 3300049574 Bacteria 4411
356 Ga0501038_0131595 3300049574 Bacteria 2053
357 Ga0501038_0140618 3300049574 Bacteria 1975
358 Ga0501038_0634696 3300049574 Bacteria 805
359 Ga0501038_1080700 3300049574 Bacteria 586
360 Ga0501039_0006755 3300049575 Bacteria 8733
361 Ga0501039_0161214 3300049575 Bacteria 1763
362 Ga0501039_0335792 3300049575 Bacteria 1187
363 Ga0501039_0376690 3300049575 Bacteria 1115
364 Ga0501040_0015256 3300049576 Bacteria 5077
365 Ga0501040_0036056 3300049576 Bacteria 3355
366 Ga0501040_0043738 3300049576 Bacteria 3053
367 Ga0501040_0071047 3300049576 Bacteria 2403
368 Ga0501040_0524151 3300049576 Bacteria 855
369 Ga0501041_0194350 3300049577 Bacteria 1271
370 Ga0501042_0000354 3300049578 Bacteria 23064
371 Ga0501042_0123145 3300049578 Bacteria 1867
372 Ga0501042_0255639 3300049578 Bacteria 1264
373 Ga0501042_0380953 3300049578 Bacteria 1021
374 Ga0501043_0089690 3300049579 Bacteria 2417
375 Ga0501043_0310665 3300049579 Bacteria 1203
376 Ga0501046_0015927 3300049580 Bacteria 6305
377 Ga0501046_0019268 3300049580 Bacteria 5660
378 Ga0501046_0137902 3300049580 Bacteria 1847
379 Ga0501046_0422311 3300049580 Bacteria 961
380 Ga0501046_0425732 3300049580 Bacteria 957
381 Ga0501046_0451790 3300049580 Bacteria 924
382 Ga0501047_0135598 3300049581 Bacteria 2342
383 Ga0501047_0540059 3300049581 Bacteria 991
384 Ga0501048_0004627 3300049582 Bacteria 10470
385 Ga0501048_0010300 3300049582 Bacteria 6988
386 Ga0501048_0034399 3300049582 Bacteria 3655
387 Ga0501048_0338670 3300049582 Bacteria 1072
388 Ga0501048_0669544 3300049582 Bacteria 745
389 Ga0501067_0003479 3300049583 Bacteria 8651
390 Ga0501067_0014142 3300049583 Bacteria 4420
391 Ga0501067_0063030 3300049583 Bacteria 2053
392 Ga0501067_0132217 3300049583 Bacteria 1389
393 Ga0501068_0022513 3300049584 Bacteria 3686
394 Ga0501068_0141842 3300049584 Bacteria 1506
395 Ga0501068_0145715 3300049584 Bacteria 1486
396 Ga0501068_0186828 3300049584 Bacteria 1311
397 Ga0501068_0488053 3300049584 Bacteria 798
398 Ga0501069_0002595 3300049585 Bacteria 9217
399 Ga0501069_0033283 3300049585 Bacteria 2839
400 Ga0501069_0070932 3300049585 Bacteria 1952
401 Ga0501069_0331088 3300049585 Bacteria 896
402 Ga0501069_0359759 3300049585 Bacteria 859
403 Ga0501069_0414601 3300049585 Bacteria 798
404 Ga0501070_0027575 3300049586 Bacteria 4763
405 Ga0501070_0062678 3300049586 Bacteria 3080
406 Ga0501070_0064891 3300049586 Bacteria 3023
407 Ga0501071_0000434 3300049587 Bacteria 20944
408 Ga0501071_0002073 3300049587 Bacteria 12021
409 Ga0501071_0017047 3300049587 Bacteria 5003
410 Ga0501071_0036797 3300049587 Bacteria 3491
411 Ga0501071_0048476 3300049587 Bacteria 3055
412 Ga0501071_0145403 3300049587 Bacteria 1767
413 Ga0501071_0182646 3300049587 Bacteria 1572
414 Ga0501071_0531887 3300049587 Bacteria 902
415 Ga0501072_0000902 3300049588 Bacteria 21781
416 Ga0501072_0017291 3300049588 Bacteria 5542
417 Ga0501072_0027960 3300049588 Bacteria 4402
418 Ga0501072_0062527 3300049588 Bacteria 2937
419 Ga0501072_0072991 3300049588 Bacteria 2712
420 Ga0501072_0081999 3300049588 Bacteria 2557
421 Ga0501072_0220208 3300049588 Bacteria 1513
422 Ga0501072_0348092 3300049588 Bacteria 1176
423 Ga0501073_0022746 3300049589 Bacteria 4510
424 Ga0501074_0008194 3300049590 Bacteria 7575
425 Ga0501074_0018289 3300049590 Bacteria 5091
426 Ga0501074_0070277 3300049590 Bacteria 2517
427 Ga0501074_0077534 3300049590 Bacteria 2385
428 Ga0501074_0167412 3300049590 Bacteria 1569
429 Ga0501074_0494119 3300049590 Bacteria 867
430 Ga0501074_0671825 3300049590 Bacteria 731
431 Ga0501075_0003239 3300049591 Bacteria 10896
432 Ga0501075_0013108 3300049591 Bacteria 5910
433 Ga0501075_0052733 3300049591 Bacteria 3058
434 Ga0501075_0174910 3300049591 Bacteria 1638
435 Ga0501075_0349605 3300049591 Bacteria 1126
436 Ga0501075_0371612 3300049591 Bacteria 1090
437 Ga0501076_0003279 3300049592 Bacteria 11337
438 Ga0501076_0006725 3300049592 Bacteria 8339
439 Ga0501076_0013191 3300049592 Bacteria 6191
440 Ga0501076_0015095 3300049592 Bacteria 5833
441 Ga0501076_0100308 3300049592 Bacteria 2332
442 Ga0501076_0349783 3300049592 Bacteria 1213
443 Ga0501077_0011146 3300049593 Bacteria 5609
444 Ga0501077_0017689 3300049593 Bacteria 4502
445 Ga0501077_0131740 3300049593 Bacteria 1585
446 Ga0501077_0149515 3300049593 Bacteria 1482
447 Ga0501079_0001191 3300049741 Bacteria 18223
448 Ga0501079_0020937 3300049741 Bacteria 4999
449 Ga0501079_0032289 3300049741 Bacteria 4025
450 Ga0501079_0034512 3300049741 Bacteria 3892
451 Ga0501079_0076322 3300049741 Bacteria 2592
452 Ga0501079_0117506 3300049741 Bacteria 2067
453 Ga0501079_0134038 3300049741 Bacteria 1928
454 Ga0501079_0237104 3300049741 Bacteria 1425
455 Ga0501079_0337170 3300049741 Bacteria 1181
456 Ga0501080_0048954 3300049742 Bacteria 3933
457 Ga0501080_0106014 3300049742 Bacteria 2605
458 Ga0501080_0229437 3300049742 Bacteria 1697
459 Ga0501081_0006904 3300049743 Bacteria 7377
460 Ga0501081_0012582 3300049743 Bacteria 5564
461 Ga0501081_0015726 3300049743 Bacteria 4994
462 Ga0501081_0044529 3300049743 Bacteria 3046
463 Ga0501081_0129388 3300049743 Bacteria 1803
464 Ga0501081_0263305 3300049743 Bacteria 1260
465 Ga0501083_0001752 3300049744 Bacteria 14807
466 Ga0501083_0028437 3300049744 Bacteria 3852
467 Ga0501083_0044284 3300049744 Bacteria 3013
468 Ga0501083_0128178 3300049744 Bacteria 1663
469 Ga0501263_008649 3300049760 Bacteria 1219
470 Ga0501035_0100072 3300049822 Bacteria 2545
471 Ga0501035_0292051 3300049822 Bacteria 1376
472 Ga0501035_0392798 3300049822 Bacteria 1155
473 Ga0501035_0700259 3300049822 Bacteria 817
474 Ga0501044_0558780 3300049823 Bacteria 1041
475 Ga0501045_0007919 3300049824 Bacteria 7399
476 Ga0501045_0011442 3300049824 Bacteria 6233
477 Ga0501045_0014382 3300049824 Bacteria 5608
478 Ga0501045_0041857 3300049824 Bacteria 3333
479 Ga0501045_0180748 3300049824 Bacteria 1572
480 nmdc:mga05p37_48110_c1 3300050507 Bacteria 5245
481 nmdc:mga05p37_632090_c1 3300050507 Bacteria 1202
482 nmdc:mga0n895_184450_c1 3300050512 Bacteria 2118
483 nmdc:mga0n895_505929_c1 3300050512 Bacteria 1217
484 nmdc:mga0n895_5414_c1 3300050512 Bacteria 10663
485 nmdc:mga0n895_74669_c1 3300050512 Bacteria 3369
486 nmdc:mga0n895_889546_c1 3300050512 Bacteria 876
487 nmdc:mga0rr50_288093_c1 3300050513 Bacteria 1372
488 nmdc:mga0rr50_32848_c1 3300050513 Bacteria 3703
489 nmdc:mga0rr50_336982_c1 3300050513 Bacteria 1267
490 nmdc:mga08x19_161976_c1 3300050514 Bacteria 1520
491 nmdc:mga08x19_194498_c1 3300050514 Bacteria 1389
492 nmdc:mga08x19_402304_c1 3300050514 Bacteria 960
493 nmdc:mga08x19_44690_c1 3300050514 Bacteria 2829
494 nmdc:mga08x19_464469_c1 3300050514 Bacteria 892
495 nmdc:mga0a205_111918_c1 3300050515 Bacteria 2629
496 nmdc:mga0a205_37103_c1 3300050515 Bacteria 4686
497 nmdc:mga0a205_426580_c1 3300050515 Bacteria 1188
498 Ga0495601_0005352 3300053077 Bacteria 7476
499 Ga0495612_0035366 3300053078 Bacteria 2025
500 Ga0495612_0150358 3300053078 Bacteria 1013
501 Ga0495595_0024335 3300053084 Bacteria 2674
502 Ga0495619_0001164 3300053085 Bacteria 17272
503 Ga0495619_0005930 3300053085 Bacteria 7740
504 Ga0501084_0006343 3300054114 Bacteria 9718
505 Ga0501084_0006405 3300054114 Bacteria 9676
506 Ga0501084_0006436 3300054114 Bacteria 9651
507 Ga0501084_0016596 3300054114 Bacteria 6114
508 Ga0501084_0040399 3300054114 Bacteria 3902
509 Ga0501084_0065361 3300054114 Bacteria 3043
510 Ga0501084_0114764 3300054114 Bacteria 2264
511 Ga0501084_0137292 3300054114 Bacteria 2058
512 Ga0501084_0182623 3300054114 Bacteria 1771
513 Ga0501084_0276240 3300054114 Bacteria 1419
514 Ga0501084_0441864 3300054114 Bacteria 1100
515 Ga0501084_0790541 3300054114 Bacteria 799
516 Ga0590071_047319 3300059421 Bacteria 1040
517 Ga0590074_013053 3300059423 Bacteria 1401
518 Ga0501082_0019689 3300060353 Bacteria 5819
519 Ga0501082_0024695 3300060353 Bacteria 5180
520 Ga0501082_0050717 3300060353 Bacteria 3578
521 Ga0501082_0061444 3300060353 Bacteria 3234
522 Ga0501082_0069836 3300060353 Bacteria 3025
523 Ga0501082_0145436 3300060353 Bacteria 2058
524 Ga0501082_0147662 3300060353 Bacteria 2041
525 Ga0501082_0281290 3300060353 Bacteria 1448
526 Ga0466962_0031275 3300061719 Bacteria 2548
527 Ga0530510_0013315 3300061734 Bacteria 5781
528 Ga0530510_0032747 3300061734 Bacteria 3741
529 Ga0530510_0050946 3300061734 Bacteria 2991
530 Ga0530510_0087463 3300061734 Bacteria 2270
531 Ga0530510_0097159 3300061734 Bacteria 2153
532 Ga0530510_1021667 3300061734 Bacteria 633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0134038 Ga0501079_0134038_745_1311 144
2 3300013308 Ga0157375_10686320 Ga0157375_106863201 145
3 3300004803 Ga0058862_10066390 Ga0058862_100663902 160
4 3300009094 Ga0111539_11100747 Ga0111539_111007472 160
5 3300037068 Ga0373925_0118289 Ga0373925_0118289_936_1652 160
6 3300049574 Ga0501038_1080700 Ga0501038_1080700_30_521 160
7 3300049822 Ga0501035_0700259 Ga0501035_0700259_316_807 160
8 3300050515 nmdc:mga0a205_111918_c1 nmdc:mga0a205_111918_c1_2115_2606 160
9 3300002459 JGI24751J29686_10027880 JGI24751J29686_100278802 161
10 3300005356 Ga0070674_100391118 Ga0070674_1003911181 161
11 3300005440 Ga0070705_100205422 Ga0070705_1002054223 161
12 3300005440 Ga0070705_100259006 Ga0070705_1002590063 161
13 3300005440 Ga0070705_100465425 Ga0070705_1004654252 161
14 3300005445 Ga0070708_100025518 Ga0070708_1000255184 161
15 3300005445 Ga0070708_100061806 Ga0070708_1000618064 161
16 3300005445 Ga0070708_100170281 Ga0070708_1001702815 161
17 3300005445 Ga0070708_101143725 Ga0070708_1011437252 161
18 3300005457 Ga0070662_100680207 Ga0070662_1006802072 161
19 3300005459 Ga0068867_100231160 Ga0068867_1002311602 161
20 3300005467 Ga0070706_100056235 Ga0070706_1000562357 161
21 3300005467 Ga0070706_100111766 Ga0070706_1001117664 161
22 3300005467 Ga0070706_100290414 Ga0070706_1002904141 161
23 3300005468 Ga0070707_100399396 Ga0070707_1003993962 161
24 3300005468 Ga0070707_100408783 Ga0070707_1004087832 161
25 3300005468 Ga0070707_100502241 Ga0070707_1005022411 161
26 3300005471 Ga0070698_100067542 Ga0070698_1000675425 161
27 3300005471 Ga0070698_100284830 Ga0070698_1002848302 161
28 3300005518 Ga0070699_100006640 Ga0070699_1000066409 161
29 3300005518 Ga0070699_100241765 Ga0070699_1002417653 161
30 3300005518 Ga0070699_100256450 Ga0070699_1002564503 161
31 3300005536 Ga0070697_100051727 Ga0070697_1000517276 161
32 3300005536 Ga0070697_100054661 Ga0070697_1000546611 161
33 3300005536 Ga0070697_100254571 Ga0070697_1002545713 161
34 3300005536 Ga0070697_100475326 Ga0070697_1004753263 161
35 3300005536 Ga0070697_101524252 Ga0070697_1015242521 161
36 3300005545 Ga0070695_100192801 Ga0070695_1001928012 161
37 3300005545 Ga0070695_100283759 Ga0070695_1002837592 161
38 3300005546 Ga0070696_100143548 Ga0070696_1001435484 161
39 3300005546 Ga0070696_100267397 Ga0070696_1002673973 161
40 3300005546 Ga0070696_101070097 Ga0070696_1010700971 161
41 3300005549 Ga0070704_100006730 Ga0070704_1000067303 161
42 3300005549 Ga0070704_100036887 Ga0070704_1000368876 161
43 3300005618 Ga0068864_100605907 Ga0068864_1006059072 161
44 3300005719 Ga0068861_100038447 Ga0068861_1000384474 161
45 3300005842 Ga0068858_100248049 Ga0068858_1002480493 161
46 3300005842 Ga0068858_100419666 Ga0068858_1004196662 161
47 3300005844 Ga0068862_100014391 Ga0068862_10001439110 161
48 3300005937 Ga0081455_10003850 Ga0081455_1000385020 161
49 3300006852 Ga0075433_10185365 Ga0075433_101853653 161
50 3300006852 Ga0075433_10426382 Ga0075433_104263822 161
51 3300006871 Ga0075434_100030203 Ga0075434_1000302036 161
52 3300009093 Ga0105240_10318052 Ga0105240_103180523 161
53 3300009147 Ga0114129_11406148 Ga0114129_114061482 161
54 3300009148 Ga0105243_10448426 Ga0105243_104484263 161
55 3300009174 Ga0105241_10746742 Ga0105241_107467421 161
56 3300014325 Ga0163163_10326983 Ga0163163_103269833 161
57 3300014325 Ga0163163_10756423 Ga0163163_107564232 161
58 3300025910 Ga0207684_10048483 Ga0207684_100484837 161
59 3300025910 Ga0207684_10190569 Ga0207684_101905694 161
60 3300025910 Ga0207684_10341243 Ga0207684_103412433 161
61 3300025918 Ga0207662_10053819 Ga0207662_100538194 161
62 3300025918 Ga0207662_10099568 Ga0207662_100995682 161
63 3300025922 Ga0207646_10033122 Ga0207646_100331222 161
64 3300025922 Ga0207646_10080613 Ga0207646_100806134 161
65 3300025923 Ga0207681_10032383 Ga0207681_100323835 161
66 3300025933 Ga0207706_10048865 Ga0207706_100488653 161
67 3300025935 Ga0207709_10106368 Ga0207709_101063682 161
68 3300025938 Ga0207704_10529637 Ga0207704_105296372 161
69 3300025940 Ga0207691_10192033 Ga0207691_101920332 161
70 3300025942 Ga0207689_10210850 Ga0207689_102108504 161
71 3300026075 Ga0207708_10003758 Ga0207708_100037589 161
72 3300026089 Ga0207648_10070446 Ga0207648_100704466 161
73 3300026118 Ga0207675_100094742 Ga0207675_1000947424 161
74 3300027695 Ga0209966_1012696 Ga0209966_10126962 161
75 3300027876 Ga0209974_10014674 Ga0209974_100146744 161
76 3300028381 Ga0268264_10514931 Ga0268264_105149311 161
77 3300028563 Ga0265319_1000855 Ga0265319_100085524 161
78 3300028573 Ga0265334_10006763 Ga0265334_100067632 161
79 3300028577 Ga0265318_10001874 Ga0265318_1000187412 161
80 3300031240 Ga0265320_10006662 Ga0265320_1000666210 161
81 3300031241 Ga0265325_10005781 Ga0265325_100057818 161
82 3300031247 Ga0265340_10004378 Ga0265340_1000437812 161
83 3300031249 Ga0265339_10028538 Ga0265339_100285386 161
84 3300031344 Ga0265316_10011068 Ga0265316_100110688 161
85 3300031595 Ga0265313_10027465 Ga0265313_100274657 161
86 3300031711 Ga0265314_10016207 Ga0265314_100162075 161
87 3300031712 Ga0265342_10007420 Ga0265342_100074208 161
88 3300032168 Ga0316593_10051242 Ga0316593_100512421 161
89 3300035083 Ga0373926_0001122 Ga0373926_0001122_4767_5312 161
90 3300035091 Ga0373951_0152537 Ga0373951_0152537_20_562 161
91 3300035116 Ga0373945_0018377 Ga0373945_0018377_414_959 161
92 3300035116 Ga0373945_0084273 Ga0373945_0084273_174_731 161
93 3300035170 Ga0373943_0006870 Ga0373943_0006870_425_982 161
94 3300035207 Ga0373942_0021589 Ga0373942_0021589_359_1192 161
95 3300035691 Ga0373931_0177930 Ga0373931_0177930_234_1067 161
96 3300035692 Ga0373935_0051065 Ga0373935_0051065_864_1409 161
97 3300035692 Ga0373935_0057637 Ga0373935_0057637_1001_1558 161
98 3300035695 Ga0373927_0005589 Ga0373927_0005589_1058_1603 161
99 3300035695 Ga0373927_0050141 Ga0373927_0050141_24_581 161
100 3300035724 Ga0373933_0195718 Ga0373933_0195718_167_712 161
101 3300035725 Ga0373947_0006238 Ga0373947_0006238_724_1281 161
102 3300035725 Ga0373947_0011070 Ga0373947_0011070_688_1233 161
103 3300036401 Ga0373937_0018696 Ga0373937_0018696_1755_2306 161
104 3300036401 Ga0373937_0032630 Ga0373937_0032630_3481_4245 161
105 3300036401 Ga0373937_0076114 Ga0373937_0076114_1714_2259 161
106 3300036401 Ga0373937_0311322 Ga0373937_0311322_356_913 161
107 3300037068 Ga0373925_0001662 Ga0373925_0001662_8037_8582 161
108 3300038996 Ga0242420_082966 Ga0242420_082966_11_553 161
109 3300041494 Ga0451837_0812999 Ga0451837_0812999_89_640 161
110 3300042876 Ga0451577_0187775 Ga0451577_0187775_539_1228 161
111 3300044656 Ga0466969_0043342 Ga0466969_0043342_132_680 161
112 3300044673 Ga0453683_0038395 Ga0453683_0038395_1540_2097 161
113 3300044684 Ga0466966_0502250 Ga0466966_0502250_38_586 161
114 3300044719 Ga0466971_0063956 Ga0466971_0063956_275_823 161
115 3300044765 Ga0466970_0099218 Ga0466970_0099218_912_1460 161
116 3300044842 Ga0466957_0011212 Ga0466957_0011212_1588_2136 161
117 3300045049 Ga0466959_0175651 Ga0466959_0175651_667_1215 161
118 3300045051 Ga0451576_0070530 Ga0451576_0070530_2869_3558 161
119 3300045051 Ga0451576_0347889 Ga0451576_0347889_612_1154 161
120 3300045051 Ga0451576_1064856 Ga0451576_1064856_170_727 161
121 3300045836 Ga0466958_0022910 Ga0466958_0022910_2343_2891 161
122 3300046455 Ga0495603_0000280 Ga0495603_0000280_21861_22418 161
123 3300046459 Ga0495629_0000177 Ga0495629_0000177_31008_31565 161
124 3300046461 Ga0495641_0029673 Ga0495641_0029673_1605_2162 161
125 3300046462 Ga0495651_0128525 Ga0495651_0128525_319_1083 161
126 3300046463 Ga0495653_0015203 Ga0495653_0015203_3409_4173 161
127 3300046472 Ga0495580_0185958 Ga0495580_0185958_502_1047 161
128 3300046472 Ga0495580_0909842 Ga0495580_0909842_26_529 161
129 3300046473 Ga0495582_0000185 Ga0495582_0000185_15305_15862 161
130 3300046475 Ga0495639_0001788 Ga0495639_0001788_1839_2396 161
131 3300046499 Ga0495594_0000224 Ga0495594_0000224_3775_4332 161
132 3300046511 Ga0495608_0191106 Ga0495608_0191106_388_1152 161
133 3300046516 Ga0495628_0042913 Ga0495628_0042913_1307_2071 161
134 3300046517 Ga0495630_0147445 Ga0495630_0147445_1044_1601 161
135 3300046517 Ga0495630_0665676 Ga0495630_0665676_141_692 161
136 3300046526 Ga0495666_0020979 Ga0495666_0020979_724_1281 161
137 3300046531 Ga0495665_0048045 Ga0495665_0048045_900_1457 161
138 3300046533 Ga0495640_0240089 Ga0495640_0240089_220_777 161
139 3300046536 Ga0495587_0068425 Ga0495587_0068425_401_1165 161
140 3300046543 Ga0495645_0071915 Ga0495645_0071915_273_1037 161
141 3300046557 Ga0495622_0000916 Ga0495622_0000916_6042_6599 161
142 3300046642 Ga0495634_0003557 Ga0495634_0003557_8695_9252 161
143 3300046642 Ga0495634_0011087 Ga0495634_0011087_280_1044 161
144 3300046663 Ga0495635_0104295 Ga0495635_0104295_604_1368 161
145 3300046674 Ga0495588_0000617 Ga0495588_0000617_3797_4354 161
146 3300046678 Ga0495599_0049077 Ga0495599_0049077_1595_2359 161
147 3300046681 Ga0495647_0001129 Ga0495647_0001129_6844_7401 161
148 3300046689 Ga0495613_0037438 Ga0495613_0037438_762_1319 161
149 3300047315 Ga0495581_0001367 Ga0495581_0001367_8702_9259 161
150 3300047319 Ga0495674_0066935 Ga0495674_0066935_1523_2287 161
151 3300047322 Ga0495680_0016752 Ga0495680_0016752_5313_6077 161
152 3300047471 Ga0495684_0057456 Ga0495684_0057456_855_1619 161
153 3300047673 Ga0495593_0001943 Ga0495593_0001943_6497_7054 161
154 3300048088 Ga0495602_0390832 Ga0495602_0390832_22_669 161
155 3300048089 Ga0495614_0000618 Ga0495614_0000618_10443_11000 161
156 3300049575 Ga0501039_0376690 Ga0501039_0376690_356_886 161
157 3300049581 Ga0501047_0135598 Ga0501047_0135598_575_1126 161
158 3300049583 Ga0501067_0063030 Ga0501067_0063030_853_1707 161
159 3300049585 Ga0501069_0331088 Ga0501069_0331088_20_676 161
160 3300049585 Ga0501069_0414601 Ga0501069_0414601_104_646 161
161 3300049587 Ga0501071_0182646 Ga0501071_0182646_14_544 161
162 3300049592 Ga0501076_0015095 Ga0501076_0015095_2925_3455 161
163 3300049743 Ga0501081_0263305 Ga0501081_0263305_707_1237 161
164 3300049744 Ga0501083_0001752 Ga0501083_0001752_10633_11184 161
165 3300049760 Ga0501263_008649 Ga0501263_008649_392_943 161
166 3300050512 nmdc:mga0n895_5414_c1 nmdc:mga0n895_5414_c1_7240_7782 161
167 3300050513 nmdc:mga0rr50_336982_c1 nmdc:mga0rr50_336982_c1_222_764 161
168 3300050514 nmdc:mga08x19_402304_c1 nmdc:mga08x19_402304_c1_112_654 161
169 3300050515 nmdc:mga0a205_426580_c1 nmdc:mga0a205_426580_c1_532_1074 161
170 3300053077 Ga0495601_0005352 Ga0495601_0005352_6450_7214 161
171 3300053078 Ga0495612_0035366 Ga0495612_0035366_53_817 161
172 3300053084 Ga0495595_0024335 Ga0495595_0024335_1750_2514 161
173 3300053085 Ga0495619_0001164 Ga0495619_0001164_7160_7717 161
174 3300053085 Ga0495619_0005930 Ga0495619_0005930_3939_4703 161
175 3300054114 Ga0501084_0006405 Ga0501084_0006405_5030_5581 161
176 3300054114 Ga0501084_0276240 Ga0501084_0276240_390_1271 161
177 3300060353 Ga0501082_0069836 Ga0501082_0069836_1115_1666 161
178 3300061719 Ga0466962_0031275 Ga0466962_0031275_707_1255 161
179 3300061734 Ga0530510_1021667 Ga0530510_1021667_47_589 161
180 3300003323 rootH1_10192301 rootH1_101923012 162
181 3300005334 Ga0068869_100303430 Ga0068869_1003034302 162
182 3300005435 Ga0070714_100004422 Ga0070714_10000442212 162
183 3300005436 Ga0070713_100343804 Ga0070713_1003438043 162
184 3300005440 Ga0070705_100019301 Ga0070705_1000193017 162
185 3300005441 Ga0070700_100208627 Ga0070700_1002086272 162
186 3300005444 Ga0070694_100434463 Ga0070694_1004344631 162
187 3300005445 Ga0070708_100000520 Ga0070708_10000052026 162
188 3300005445 Ga0070708_100009690 Ga0070708_1000096902 162
189 3300005445 Ga0070708_100058461 Ga0070708_1000584617 162
190 3300005445 Ga0070708_100069564 Ga0070708_1000695643 162
191 3300005445 Ga0070708_100076124 Ga0070708_1000761242 162
192 3300005445 Ga0070708_100115338 Ga0070708_1001153383 162
193 3300005445 Ga0070708_100131183 Ga0070708_1001311834 162
194 3300005457 Ga0070662_100445772 Ga0070662_1004457722 162
195 3300005458 Ga0070681_10364783 Ga0070681_103647832 162
196 3300005467 Ga0070706_100001515 Ga0070706_10000151526 162
197 3300005467 Ga0070706_100001725 Ga0070706_10000172526 162
198 3300005467 Ga0070706_100060798 Ga0070706_1000607984 162
199 3300005467 Ga0070706_100170537 Ga0070706_1001705372 162
200 3300005468 Ga0070707_100001328 Ga0070707_10000132826 162
201 3300005468 Ga0070707_100027238 Ga0070707_1000272387 162
202 3300005468 Ga0070707_100037172 Ga0070707_1000371728 162
203 3300005468 Ga0070707_100052382 Ga0070707_1000523823 162
204 3300005468 Ga0070707_100232515 Ga0070707_1002325153 162
205 3300005468 Ga0070707_100270942 Ga0070707_1002709423 162
206 3300005468 Ga0070707_100274179 Ga0070707_1002741794 162
207 3300005468 Ga0070707_100281158 Ga0070707_1002811583 162
208 3300005468 Ga0070707_100293575 Ga0070707_1002935753 162
209 3300005468 Ga0070707_100299646 Ga0070707_1002996463 162
210 3300005468 Ga0070707_100320069 Ga0070707_1003200692 162
211 3300005468 Ga0070707_100388940 Ga0070707_1003889403 162
212 3300005468 Ga0070707_100405463 Ga0070707_1004054632 162
213 3300005468 Ga0070707_100457462 Ga0070707_1004574623 162
214 3300005471 Ga0070698_100271845 Ga0070698_1002718452 162
215 3300005471 Ga0070698_100430369 Ga0070698_1004303693 162
216 3300005518 Ga0070699_100009579 Ga0070699_10000957914 162
217 3300005518 Ga0070699_100017094 Ga0070699_1000170947 162
218 3300005518 Ga0070699_100032425 Ga0070699_1000324256 162
219 3300005518 Ga0070699_100092761 Ga0070699_1000927614 162
220 3300005518 Ga0070699_100228654 Ga0070699_1002286543 162
221 3300005518 Ga0070699_100231580 Ga0070699_1002315804 162
222 3300005518 Ga0070699_100954768 Ga0070699_1009547681 162
223 3300005530 Ga0070679_100264098 Ga0070679_1002640982 162
224 3300005530 Ga0070679_100332499 Ga0070679_1003324993 162
225 3300005535 Ga0070684_100095201 Ga0070684_1000952016 162
226 3300005536 Ga0070697_100008491 Ga0070697_10000849112 162
227 3300005536 Ga0070697_100010522 Ga0070697_10001052210 162
228 3300005536 Ga0070697_100010596 Ga0070697_10001059613 162
229 3300005536 Ga0070697_100037290 Ga0070697_1000372907 162
230 3300005536 Ga0070697_100050931 Ga0070697_1000509312 162
231 3300005536 Ga0070697_100361976 Ga0070697_1003619761 162
232 3300005536 Ga0070697_100687115 Ga0070697_1006871152 162
233 3300005545 Ga0070695_100086178 Ga0070695_1000861782 162
234 3300005545 Ga0070695_100600801 Ga0070695_1006008011 162
235 3300005546 Ga0070696_100292715 Ga0070696_1002927151 162
236 3300005547 Ga0070693_100139680 Ga0070693_1001396801 162
237 3300005549 Ga0070704_100022112 Ga0070704_1000221128 162
238 3300005549 Ga0070704_100035824 Ga0070704_1000358242 162
239 3300005981 Ga0081538_10134491 Ga0081538_101344913 162
240 3300005985 Ga0081539_10068117 Ga0081539_100681173 162
241 3300006028 Ga0070717_10008962 Ga0070717_1000896211 162
242 3300006028 Ga0070717_10194751 Ga0070717_101947514 162
243 3300006028 Ga0070717_10456020 Ga0070717_104560202 162
244 3300006058 Ga0075432_10060557 Ga0075432_100605572 162
245 3300006852 Ga0075433_10012940 Ga0075433_100129402 162
246 3300006852 Ga0075433_10016581 Ga0075433_100165813 162
247 3300006871 Ga0075434_100003064 Ga0075434_10000306420 162
248 3300006871 Ga0075434_100078534 Ga0075434_1000785344 162
249 3300006871 Ga0075434_100148563 Ga0075434_1001485632 162
250 3300006871 Ga0075434_100154316 Ga0075434_1001543164 162
251 3300006871 Ga0075434_100398832 Ga0075434_1003988323 162
252 3300006914 Ga0075436_100080919 Ga0075436_1000809193 162
253 3300006914 Ga0075436_100098259 Ga0075436_1000982594 162
254 3300006914 Ga0075436_100474136 Ga0075436_1004741362 162
255 3300007076 Ga0075435_100011712 Ga0075435_1000117122 162
256 3300007076 Ga0075435_100028105 Ga0075435_1000281055 162
257 3300007076 Ga0075435_100206698 Ga0075435_1002066983 162
258 3300007076 Ga0075435_100270828 Ga0075435_1002708282 162
259 3300007265 Ga0099794_10000117 Ga0099794_1000011733 162
260 3300007265 Ga0099794_10113672 Ga0099794_101136721 162
261 3300007265 Ga0099794_10136102 Ga0099794_101361023 162
262 3300007265 Ga0099794_10179246 Ga0099794_101792461 162
263 3300009094 Ga0111539_10305760 Ga0111539_103057603 162
264 3300009094 Ga0111539_10575838 Ga0111539_105758382 162
265 3300009094 Ga0111539_12126074 Ga0111539_121260741 162
266 3300009147 Ga0114129_10096524 Ga0114129_100965247 162
267 3300009147 Ga0114129_10149325 Ga0114129_101493253 162
268 3300009147 Ga0114129_10186665 Ga0114129_101866654 162
269 3300020070 Ga0206356_10494157 Ga0206356_104941579 162
270 3300020080 Ga0206350_10810608 Ga0206350_108106086 162
271 3300022467 Ga0224712_10000184 Ga0224712_1000018415 162
272 3300025910 Ga0207684_10000026 Ga0207684_1000002626 162
273 3300025910 Ga0207684_10000148 Ga0207684_1000014827 162
274 3300025910 Ga0207684_10000231 Ga0207684_100002319 162
275 3300025910 Ga0207684_10068282 Ga0207684_100682826 162
276 3300025912 Ga0207707_10072752 Ga0207707_100727526 162
277 3300025921 Ga0207652_10195329 Ga0207652_101953292 162
278 3300025922 Ga0207646_10000093 Ga0207646_10000093122 162
279 3300025922 Ga0207646_10000394 Ga0207646_1000039427 162
280 3300025922 Ga0207646_10000668 Ga0207646_1000066848 162
281 3300025922 Ga0207646_10009160 Ga0207646_100091608 162
282 3300025922 Ga0207646_10013194 Ga0207646_100131944 162
283 3300025922 Ga0207646_10013601 Ga0207646_100136013 162
284 3300025922 Ga0207646_10018156 Ga0207646_100181568 162
285 3300025922 Ga0207646_10026822 Ga0207646_100268222 162
286 3300025922 Ga0207646_10082944 Ga0207646_100829445 162
287 3300025922 Ga0207646_10112123 Ga0207646_101121235 162
288 3300025922 Ga0207646_10252972 Ga0207646_102529722 162
289 3300025922 Ga0207646_10265902 Ga0207646_102659023 162
290 3300025922 Ga0207646_10268490 Ga0207646_102684901 162
291 3300025922 Ga0207646_10271908 Ga0207646_102719083 162
292 3300025922 Ga0207646_10431026 Ga0207646_104310262 162
293 3300025928 Ga0207700_10005510 Ga0207700_100055106 162
294 3300025929 Ga0207664_10001273 Ga0207664_1000127313 162
295 3300025932 Ga0207690_10335874 Ga0207690_103358742 162
296 3300025942 Ga0207689_10189475 Ga0207689_101894752 162
297 3300025944 Ga0207661_10002899 Ga0207661_100028994 162
298 3300025981 Ga0207640_10309631 Ga0207640_103096312 162
299 3300026035 Ga0207703_11115463 Ga0207703_111154631 162
300 3300026089 Ga0207648_10105904 Ga0207648_101059043 162
301 3300026118 Ga0207675_100578146 Ga0207675_1005781462 162
302 3300027671 Ga0209588_1000036 Ga0209588_100003654 162
303 3300027717 Ga0209998_10000069 Ga0209998_1000006948 162
304 3300027876 Ga0209974_10007634 Ga0209974_100076345 162
305 3300031548 Ga0307408_100172798 Ga0307408_1001727983 162
306 3300031733 Ga0316577_10081775 Ga0316577_100817753 162
307 3300031903 Ga0307407_10019951 Ga0307407_100199513 162
308 3300031995 Ga0307409_100042522 Ga0307409_1000425226 162
309 3300032002 Ga0307416_100054291 Ga0307416_1000542916 162
310 3300032004 Ga0307414_10818416 Ga0307414_108184162 162
311 3300032126 Ga0307415_100145156 Ga0307415_1001451563 162
312 3300035398 Ga0316574_0205832 Ga0316574_0205832_172_807 162
313 3300038443 Ga0395901_0547813 Ga0395901_0547813_421_990 162
314 3300039438 Ga0436360_0166796 Ga0436360_0166796_306_869 162
315 3300039438 Ga0436360_1021365 Ga0436360_1021365_31_594 162
316 3300039450 Ga0436363_0875424 Ga0436363_0875424_67_630 162
317 3300039453 Ga0436362_0295958 Ga0436362_0295958_51_614 162
318 3300039453 Ga0436362_1211017 Ga0436362_1211017_1031_1594 162
319 3300041460 Ga0451802_0510671 Ga0451802_0510671_367_1014 162
320 3300042001 Ga0439441_001960 Ga0439441_001960_2151_2798 162
321 3300042124 Ga0450922_001758 Ga0450922_001758_386_1033 162
322 3300042125 Ga0450923_008588 Ga0450923_008588_62_709 162
323 3300042147 Ga0450910_001045 Ga0450910_001045_1501_2148 162
324 3300042531 Ga0450918_004764 Ga0450918_004764_755_1402 162
325 3300044673 Ga0453683_0097843 Ga0453683_0097843_103_732 162
326 3300044712 Ga0453684_0001518 Ga0453684_0001518_7875_8555 162
327 3300044712 Ga0453684_1239370 Ga0453684_1239370_80_730 162
328 3300046691 Ga0495670_0295850 Ga0495670_0295850_57_812 162
329 3300048088 Ga0495602_0144083 Ga0495602_0144083_398_955 162
330 3300049568 Ga0501031_0001065 Ga0501031_0001065_3294_3938 162
331 3300049568 Ga0501031_0063316 Ga0501031_0063316_990_1652 162
332 3300049568 Ga0501031_0296773 Ga0501031_0296773_270_932 162
333 3300049570 Ga0501033_0235722 Ga0501033_0235722_344_1036 162
334 3300049570 Ga0501033_0355518 Ga0501033_0355518_223_936 162
335 3300049571 Ga0501034_0592138 Ga0501034_0592138_138_800 162
336 3300049572 Ga0501036_0006100 Ga0501036_0006100_4346_5008 162
337 3300049572 Ga0501036_0035115 Ga0501036_0035115_3339_4028 162
338 3300049572 Ga0501036_0180114 Ga0501036_0180114_258_950 162
339 3300049572 Ga0501036_0261388 Ga0501036_0261388_550_1200 162
340 3300049573 Ga0501037_0013503 Ga0501037_0013503_3532_4176 162
341 3300049573 Ga0501037_0109324 Ga0501037_0109324_905_1567 162
342 3300049574 Ga0501038_0035027 Ga0501038_0035027_2996_3658 162
343 3300049574 Ga0501038_0131595 Ga0501038_0131595_1373_2017 162
344 3300049574 Ga0501038_0140618 Ga0501038_0140618_46_738 162
345 3300049574 Ga0501038_0634696 Ga0501038_0634696_17_574 162
346 3300049575 Ga0501039_0006755 Ga0501039_0006755_4860_5522 162
347 3300049575 Ga0501039_0161214 Ga0501039_0161214_984_1700 162
348 3300049575 Ga0501039_0335792 Ga0501039_0335792_106_750 162
349 3300049576 Ga0501040_0015256 Ga0501040_0015256_3153_3797 162
350 3300049576 Ga0501040_0036056 Ga0501040_0036056_827_1471 162
351 3300049576 Ga0501040_0043738 Ga0501040_0043738_1773_2435 162
352 3300049576 Ga0501040_0524151 Ga0501040_0524151_208_828 162
353 3300049578 Ga0501042_0000354 Ga0501042_0000354_21881_22543 162
354 3300049578 Ga0501042_0123145 Ga0501042_0123145_579_1292 162
355 3300049578 Ga0501042_0380953 Ga0501042_0380953_170_814 162
356 3300049579 Ga0501043_0089690 Ga0501043_0089690_1699_2361 162
357 3300049579 Ga0501043_0310665 Ga0501043_0310665_84_767 162
358 3300049580 Ga0501046_0015927 Ga0501046_0015927_3171_3815 162
359 3300049580 Ga0501046_0019268 Ga0501046_0019268_4111_4794 162
360 3300049580 Ga0501046_0137902 Ga0501046_0137902_475_1188 162
361 3300049580 Ga0501046_0422311 Ga0501046_0422311_146_745 162
362 3300049580 Ga0501046_0451790 Ga0501046_0451790_11_673 162
363 3300049581 Ga0501047_0540059 Ga0501047_0540059_222_926 162
364 3300049582 Ga0501048_0004627 Ga0501048_0004627_9503_10165 162
365 3300049582 Ga0501048_0010300 Ga0501048_0010300_3096_3740 162
366 3300049582 Ga0501048_0034399 Ga0501048_0034399_1788_2471 162
367 3300049582 Ga0501048_0338670 Ga0501048_0338670_145_861 162
368 3300049582 Ga0501048_0669544 Ga0501048_0669544_29_733 162
369 3300049583 Ga0501067_0003479 Ga0501067_0003479_6532_7248 162
370 3300049583 Ga0501067_0014142 Ga0501067_0014142_2920_3612 162
371 3300049583 Ga0501067_0132217 Ga0501067_0132217_546_1196 162
372 3300049584 Ga0501068_0022513 Ga0501068_0022513_2460_3149 162
373 3300049584 Ga0501068_0141842 Ga0501068_0141842_554_1246 162
374 3300049584 Ga0501068_0145715 Ga0501068_0145715_621_1274 162
375 3300049584 Ga0501068_0186828 Ga0501068_0186828_565_1215 162
376 3300049584 Ga0501068_0488053 Ga0501068_0488053_57_707 162
377 3300049585 Ga0501069_0002595 Ga0501069_0002595_6100_6816 162
378 3300049585 Ga0501069_0033283 Ga0501069_0033283_1970_2662 162
379 3300049585 Ga0501069_0070932 Ga0501069_0070932_42_686 162
380 3300049585 Ga0501069_0359759 Ga0501069_0359759_10_726 162
381 3300049586 Ga0501070_0027575 Ga0501070_0027575_1842_2534 162
382 3300049586 Ga0501070_0062678 Ga0501070_0062678_727_1371 162
383 3300049586 Ga0501070_0064891 Ga0501070_0064891_199_852 162
384 3300049587 Ga0501071_0000434 Ga0501071_0000434_17247_17939 162
385 3300049587 Ga0501071_0002073 Ga0501071_0002073_10630_11292 162
386 3300049587 Ga0501071_0017047 Ga0501071_0017047_3765_4409 162
387 3300049587 Ga0501071_0036797 Ga0501071_0036797_1683_2282 162
388 3300049587 Ga0501071_0145403 Ga0501071_0145403_428_1078 162
389 3300049587 Ga0501071_0531887 Ga0501071_0531887_159_803 162
390 3300049588 Ga0501072_0000902 Ga0501072_0000902_1599_2261 162
391 3300049588 Ga0501072_0017291 Ga0501072_0017291_3586_4290 162
392 3300049588 Ga0501072_0027960 Ga0501072_0027960_271_963 162
393 3300049588 Ga0501072_0062527 Ga0501072_0062527_1395_2045 162
394 3300049588 Ga0501072_0072991 Ga0501072_0072991_1348_2064 162
395 3300049588 Ga0501072_0220208 Ga0501072_0220208_677_1297 162
396 3300049588 Ga0501072_0348092 Ga0501072_0348092_225_908 162
397 3300049589 Ga0501073_0022746 Ga0501073_0022746_1990_2682 162
398 3300049590 Ga0501074_0008194 Ga0501074_0008194_1855_2547 162
399 3300049590 Ga0501074_0018289 Ga0501074_0018289_4124_4768 162
400 3300049590 Ga0501074_0070277 Ga0501074_0070277_1771_2397 162
401 3300049590 Ga0501074_0077534 Ga0501074_0077534_1151_1855 162
402 3300049590 Ga0501074_0167412 Ga0501074_0167412_532_1194 162
403 3300049590 Ga0501074_0494119 Ga0501074_0494119_43_696 162
404 3300049590 Ga0501074_0671825 Ga0501074_0671825_22_621 162
405 3300049591 Ga0501075_0003239 Ga0501075_0003239_1958_2620 162
406 3300049591 Ga0501075_0013108 Ga0501075_0013108_36_680 162
407 3300049591 Ga0501075_0174910 Ga0501075_0174910_248_940 162
408 3300049591 Ga0501075_0349605 Ga0501075_0349605_233_916 162
409 3300049591 Ga0501075_0371612 Ga0501075_0371612_207_857 162
410 3300049592 Ga0501076_0006725 Ga0501076_0006725_89_733 162
411 3300049592 Ga0501076_0013191 Ga0501076_0013191_1789_2481 162
412 3300049592 Ga0501076_0100308 Ga0501076_0100308_1245_1907 162
413 3300049592 Ga0501076_0349783 Ga0501076_0349783_190_903 162
414 3300049593 Ga0501077_0011146 Ga0501077_0011146_4605_5309 162
415 3300049593 Ga0501077_0017689 Ga0501077_0017689_3530_4222 162
416 3300049593 Ga0501077_0149515 Ga0501077_0149515_257_919 162
417 3300049741 Ga0501079_0001191 Ga0501079_0001191_232_915 162
418 3300049741 Ga0501079_0020937 Ga0501079_0020937_3360_4022 162
419 3300049741 Ga0501079_0032289 Ga0501079_0032289_72_776 162
420 3300049741 Ga0501079_0034512 Ga0501079_0034512_117_809 162
421 3300049741 Ga0501079_0117506 Ga0501079_0117506_305_904 162
422 3300049741 Ga0501079_0237104 Ga0501079_0237104_611_1261 162
423 3300049741 Ga0501079_0337170 Ga0501079_0337170_158_880 162
424 3300049742 Ga0501080_0048954 Ga0501080_0048954_1906_2598 162
425 3300049742 Ga0501080_0229437 Ga0501080_0229437_494_1156 162
426 3300049743 Ga0501081_0006904 Ga0501081_0006904_3548_4192 162
427 3300049743 Ga0501081_0015726 Ga0501081_0015726_434_1096 162
428 3300049743 Ga0501081_0044529 Ga0501081_0044529_1092_1805 162
429 3300049743 Ga0501081_0129388 Ga0501081_0129388_644_1336 162
430 3300049744 Ga0501083_0028437 Ga0501083_0028437_1642_2334 162
431 3300049744 Ga0501083_0044284 Ga0501083_0044284_229_918 162
432 3300049744 Ga0501083_0128178 Ga0501083_0128178_181_843 162
433 3300049822 Ga0501035_0100072 Ga0501035_0100072_153_836 162
434 3300049822 Ga0501035_0292051 Ga0501035_0292051_101_700 162
435 3300049822 Ga0501035_0392798 Ga0501035_0392798_20_670 162
436 3300049823 Ga0501044_0558780 Ga0501044_0558780_288_932 162
437 3300049824 Ga0501045_0007919 Ga0501045_0007919_3199_3843 162
438 3300049824 Ga0501045_0011442 Ga0501045_0011442_2771_3463 162
439 3300049824 Ga0501045_0041857 Ga0501045_0041857_195_857 162
440 3300049824 Ga0501045_0180748 Ga0501045_0180748_824_1474 162
441 3300050507 nmdc:mga05p37_48110_c1 nmdc:mga05p37_48110_c1_2486_3193 162
442 3300050507 nmdc:mga05p37_632090_c1 nmdc:mga05p37_632090_c1_216_830 162
443 3300050512 nmdc:mga0n895_184450_c1 nmdc:mga0n895_184450_c1_643_1209 162
444 3300050512 nmdc:mga0n895_505929_c1 nmdc:mga0n895_505929_c1_92_706 162
445 3300050512 nmdc:mga0n895_74669_c1 nmdc:mga0n895_74669_c1_619_1233 162
446 3300050512 nmdc:mga0n895_889546_c1 nmdc:mga0n895_889546_c1_170_856 162
447 3300050513 nmdc:mga0rr50_288093_c1 nmdc:mga0rr50_288093_c1_563_1180 162
448 3300050513 nmdc:mga0rr50_32848_c1 nmdc:mga0rr50_32848_c1_2410_3024 162
449 3300050514 nmdc:mga08x19_161976_c1 nmdc:mga08x19_161976_c1_62_676 162
450 3300050514 nmdc:mga08x19_194498_c1 nmdc:mga08x19_194498_c1_692_1315 162
451 3300050514 nmdc:mga08x19_44690_c1 nmdc:mga08x19_44690_c1_514_1161 162
452 3300050514 nmdc:mga08x19_464469_c1 nmdc:mga08x19_464469_c1_64_678 162
453 3300050515 nmdc:mga0a205_37103_c1 nmdc:mga0a205_37103_c1_788_1402 162
454 3300053078 Ga0495612_0150358 Ga0495612_0150358_154_711 162
455 3300054114 Ga0501084_0006343 Ga0501084_0006343_7950_8549 162
456 3300054114 Ga0501084_0006436 Ga0501084_0006436_6128_6820 162
457 3300054114 Ga0501084_0016596 Ga0501084_0016596_1466_2110 162
458 3300054114 Ga0501084_0040399 Ga0501084_0040399_232_894 162
459 3300054114 Ga0501084_0065361 Ga0501084_0065361_26_688 162
460 3300054114 Ga0501084_0137292 Ga0501084_0137292_1193_1876 162
461 3300054114 Ga0501084_0182623 Ga0501084_0182623_76_726 162
462 3300054114 Ga0501084_0441864 Ga0501084_0441864_308_1021 162
463 3300054114 Ga0501084_0790541 Ga0501084_0790541_64_777 162
464 3300059421 Ga0590071_047319 Ga0590071_047319_104_799 162
465 3300059423 Ga0590074_013053 Ga0590074_013053_513_1208 162
466 3300060353 Ga0501082_0024695 Ga0501082_0024695_1029_1718 162
467 3300060353 Ga0501082_0050717 Ga0501082_0050717_618_1262 162
468 3300060353 Ga0501082_0061444 Ga0501082_0061444_1080_1772 162
469 3300060353 Ga0501082_0145436 Ga0501082_0145436_692_1345 162
470 3300060353 Ga0501082_0147662 Ga0501082_0147662_341_1003 162
471 3300060353 Ga0501082_0281290 Ga0501082_0281290_497_1159 162
472 3300061734 Ga0530510_0032747 Ga0530510_0032747_2890_3543 162
473 3300061734 Ga0530510_0050946 Ga0530510_0050946_985_1689 162
474 3300061734 Ga0530510_0087463 Ga0530510_0087463_1538_2254 162
475 3300061734 Ga0530510_0097159 Ga0530510_0097159_672_1334 162
476 3300020070 Ga0206356_11567545 Ga0206356_115675454 163
477 3300020082 Ga0206353_10285067 Ga0206353_102850673 163
478 3300045051 Ga0451576_0194350 Ga0451576_0194350_936_1607 163
479 3300002075 JGI24738J21930_10022301 JGI24738J21930_100223013 164
480 3300005434 Ga0070709_10000287 Ga0070709_100002877 164
481 3300005435 Ga0070714_100001531 Ga0070714_10000153116 164
482 3300005436 Ga0070713_100000752 Ga0070713_10000075224 164
483 3300005445 Ga0070708_100242524 Ga0070708_1002425243 164
484 3300005445 Ga0070708_100673770 Ga0070708_1006737702 164
485 3300005467 Ga0070706_100046673 Ga0070706_1000466737 164
486 3300005468 Ga0070707_100173073 Ga0070707_1001730733 164
487 3300005530 Ga0070679_100396005 Ga0070679_1003960051 164
488 3300005535 Ga0070684_100675533 Ga0070684_1006755331 164
489 3300005617 Ga0068859_100058681 Ga0068859_1000586817 164
490 3300005841 Ga0068863_100060448 Ga0068863_1000604487 164
491 3300005843 Ga0068860_100021824 Ga0068860_10002182411 164
492 3300005844 Ga0068862_100000032 Ga0068862_100000032148 164
493 3300006173 Ga0070716_100021139 Ga0070716_1000211396 164
494 3300006931 Ga0097620_100058681 Ga0097620_1000586813 164
495 3300009101 Ga0105247_10029355 Ga0105247_100293554 164
496 3300009553 Ga0105249_10000017 Ga0105249_10000017133 164
497 3300020070 Ga0206356_11798093 Ga0206356_117980934 164
498 3300020075 Ga0206349_1612507 Ga0206349_16125071 164
499 3300022467 Ga0224712_10002547 Ga0224712_100025478 164
500 3300022467 Ga0224712_10017922 Ga0224712_100179224 164
501 3300025900 Ga0207710_10006206 Ga0207710_1000620610 164
502 3300025906 Ga0207699_10000308 Ga0207699_1000030825 164
503 3300025921 Ga0207652_10389289 Ga0207652_103892892 164
504 3300025922 Ga0207646_10007605 Ga0207646_100076057 164
505 3300025922 Ga0207646_10389286 Ga0207646_103892863 164
506 3300025928 Ga0207700_10003258 Ga0207700_1000325813 164
507 3300025929 Ga0207664_10327604 Ga0207664_103276042 164
508 3300025939 Ga0207665_10137619 Ga0207665_101376193 164
509 3300025961 Ga0207712_10000012 Ga0207712_10000012216 164
510 3300026088 Ga0207641_10046746 Ga0207641_100467464 164
511 3300028380 Ga0268265_10000125 Ga0268265_1000012566 164
512 3300028381 Ga0268264_10000347 Ga0268264_1000034784 164
513 3300039062 Ga0400483_003112 Ga0400483_003112_1673_2257 164
514 3300039062 Ga0400483_217638 Ga0400483_217638_7106_7690 164
515 3300039062 Ga0400483_291615 Ga0400483_291615_468_1055 164
516 3300039447 Ga0436361_0911810 Ga0436361_0911810_470_1048 164
517 3300049576 Ga0501040_0071047 Ga0501040_0071047_1799_2356 164
518 3300049577 Ga0501041_0194350 Ga0501041_0194350_660_1217 164
519 3300049578 Ga0501042_0255639 Ga0501042_0255639_612_1169 164
520 3300049580 Ga0501046_0425732 Ga0501046_0425732_144_701 164
521 3300049587 Ga0501071_0048476 Ga0501071_0048476_18_575 164
522 3300049588 Ga0501072_0081999 Ga0501072_0081999_80_637 164
523 3300049591 Ga0501075_0052733 Ga0501075_0052733_945_1502 164
524 3300049592 Ga0501076_0003279 Ga0501076_0003279_8762_9319 164
525 3300049593 Ga0501077_0131740 Ga0501077_0131740_205_762 164
526 3300049741 Ga0501079_0076322 Ga0501079_0076322_792_1349 164
527 3300049742 Ga0501080_0106014 Ga0501080_0106014_21_578 164
528 3300049743 Ga0501081_0012582 Ga0501081_0012582_2936_3493 164
529 3300049824 Ga0501045_0014382 Ga0501045_0014382_4709_5266 164
530 3300054114 Ga0501084_0114764 Ga0501084_0114764_1476_2033 164
531 3300060353 Ga0501082_0019689 Ga0501082_0019689_1876_2433 164
532 3300061734 Ga0530510_0013315 Ga0530510_0013315_4479_5036 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

48

104

1

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

108

200

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a63-assembly1.cif.gz_J cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9749 2 158
7azo-assembly1.cif.gz_L5A 70s thermus thermophilus ribosome with bound antibiotic lead seq-977 0.9685 2 158
5mmm-assembly1.cif.gz_F structure of the 70s chloroplast ribosome 0.9667 2 158
8fn2-assembly1.cif.gz_G the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9624 2 158
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9599 2 158
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9585 2 157 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9341 7 158 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9227 7 157 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9138 7 154 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9132 2 157 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A3A4NVN9-F1-model_v4 Large ribosomal subunit protein uL5 0.9858 2 158 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1Q6V1V9-F1-model_v4 Large ribosomal subunit protein uL5 0.9855 2 158 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7M1XJH4-F1-model_v4 Large ribosomal subunit protein uL5 0.9851 2 155 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Z9Y9W5-F1-model_v4 50S ribosomal protein L5 0.985 2 94 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2M6Y4L6-F1-model_v4 Large ribosomal subunit protein uL5 0.9847 2 158 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
84.86 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map