F459126

General Info

Members Datasets Scaffolds Average Seq Length
524 319 1048 228

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10202739|Ga0105238_102027392
Length 254
Sequence MRRRAARRQLLANPKIAPSASRFRLLPMTPTYRIAPSILSADFARLGQEFTDVIAAGADWIHFDVMDNHYVPNLSFGPMICEALRKHAVRADGARVPIDVHLMVQPVDALAQAFAKAGADYISFHPDASTHVDRTLQLIKGAGCKAGLVFNPASPIDVLEWVIDKVDLVLVMSVNPGFGGQSFIDSALRKIERLRKVIDASGRDIRLEVDGGIKADNIRAAADAGADTFVAGSAIFGQKDYARAIADMRVALAA

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
68 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
152 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
164 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
185 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
186 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
200 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
203 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
208 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
209 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
210 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
211 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
212 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
213 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
214 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
215 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
216 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
265 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
266 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
272 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
273 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
274 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
275 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
276 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
277 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
278 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
279 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
280 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
281 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
282 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
283 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
284 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
285 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
286 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
287 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
288 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
297 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
298 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
301 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
302 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
303 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
304 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
309 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
310 2643221585 Pelomonas sp. Root662 Isolate Unclassified
311 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
312 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
313 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
314 2643221656 Pelomonas sp. Root405 Isolate Unclassified
315 2643221660 Methylibium sp. Root1272 Isolate Unclassified
316 2738541337 Pelomonas sp. BT06 Isolate Unclassified
317 2831864461 Roseateles noduli HZ7 Isolate Nodule
318 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
319 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.36
Nodule 1.34
Rhizoplane 3.05
Rhizosphere 72.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10202739 3300009551 Bacteria 1960
2 JGI24744J21845_10019589 3300002077 Bacteria 1338
3 JGI25156J39149_1000063 3300002705 Bacteria 84312
4 JGI25154J39366_1000412 3300002738 Bacteria 23116
5 JGI25157J39369_1000082 3300002741 Bacteria 84303
6 JGI25164J39214_1005704 3300002772 Bacteria 1338
7 Ga0055539_1000303 3300003752 Bacteria 26405
8 Ga0055533_1000043 3300003756 Bacteria 229262
9 Ga0055525_1001141 3300003759 Bacteria 6339
10 Ga0055535_1000859 3300003761 Bacteria 21484
11 Ga0055535_1007601 3300003761 Bacteria 2048
12 Ga0055529_1000725 3300003763 Bacteria 21544
13 Ga0055524_1000237 3300003775 Bacteria 57951
14 Ga0055524_1001902 3300003775 Bacteria 11334
15 Ga0055530_10002263 3300003791 Bacteria 12651
16 Ga0055540_1000018 3300003792 Bacteria 218360
17 Ga0055540_1027477 3300003792 Bacteria 1361
18 Ga0055531_10000022 3300003794 Bacteria 166362
19 Ga0055531_10002118 3300003794 Bacteria 13613
20 Ga0055531_10003257 3300003794 Bacteria 10418
21 Ga0055531_10022126 3300003794 Bacteria 2436
22 Ga0055543_1009661 3300004625 Bacteria 2062
23 Ga0065165_1004728 3300005262 Bacteria 8174
24 Ga0065165_1011513 3300005262 Bacteria 3679
25 Ga0065707_10437678 3300005295 Bacteria 813
26 Ga0070658_10035774 3300005327 Bacteria 4000
27 Ga0070658_10040387 3300005327 Bacteria 3764
28 Ga0070658_10042701 3300005327 Bacteria 3663
29 Ga0070658_10077134 3300005327 Bacteria 2733
30 Ga0070676_10002874 3300005328 Bacteria 8894
31 Ga0070690_100001384 3300005330 Bacteria 12638
32 Ga0070670_100005503 3300005331 Bacteria 10686
33 Ga0070670_100903400 3300005331 Bacteria 801
34 Ga0070677_10001348 3300005333 Bacteria 7834
35 Ga0068869_100159697 3300005334 Bacteria 1754
36 Ga0070680_100011528 3300005336 Bacteria 6840
37 Ga0068868_100026663 3300005338 Bacteria 4407
38 Ga0068868_100064294 3300005338 Bacteria 2912
39 Ga0068868_100233858 3300005338 Bacteria 1542
40 Ga0068868_100287208 3300005338 Bacteria 1394
41 Ga0070660_100007225 3300005339 Bacteria 7728
42 Ga0070660_100042187 3300005339 Bacteria 3481
43 Ga0070661_100002747 3300005344 Bacteria 12066
44 Ga0070669_100013992 3300005353 Bacteria 5706
45 Ga0070669_100286674 3300005353 Bacteria 1321
46 Ga0070675_100000811 3300005354 Bacteria 22016
47 Ga0070675_100111215 3300005354 Bacteria 2318
48 Ga0070675_100178089 3300005354 Bacteria 1837
49 Ga0070671_100031206 3300005355 Bacteria 4401
50 Ga0070671_100039892 3300005355 Bacteria 3898
51 Ga0070671_100043264 3300005355 Bacteria 3743
52 Ga0070674_100135835 3300005356 Bacteria 1839
53 Ga0070673_100024442 3300005364 Bacteria 4431
54 Ga0070673_100027447 3300005364 Bacteria 4221
55 Ga0070659_100487393 3300005366 Bacteria 1050
56 Ga0070667_100138974 3300005367 Bacteria 2126
57 Ga0070667_100934525 3300005367 Bacteria 808
58 Ga0070700_100030713 3300005441 Bacteria 3214
59 Ga0070663_100025593 3300005455 Bacteria 3986
60 Ga0070678_100151514 3300005456 Bacteria 1868
61 Ga0070678_100543378 3300005456 Bacteria 1031
62 Ga0070662_100015890 3300005457 Bacteria 5048
63 Ga0070681_10051826 3300005458 Bacteria 4093
64 Ga0068867_100004831 3300005459 Bacteria 9487
65 Ga0068867_100017549 3300005459 Bacteria 5082
66 Ga0070679_100004370 3300005530 Bacteria 13060
67 Ga0070679_100013748 3300005530 Bacteria 7754
68 Ga0070672_100003173 3300005543 Bacteria 10629
69 Ga0070672_100261125 3300005543 Bacteria 1460
70 Ga0070672_100330451 3300005543 Bacteria 1297
71 Ga0070665_100215373 3300005548 Bacteria 1921
72 Ga0068855_100002610 3300005563 Bacteria 22210
73 Ga0068855_100026805 3300005563 Bacteria 6895
74 Ga0068855_100230391 3300005563 Bacteria 2075
75 Ga0068855_100310504 3300005563 Bacteria 1745
76 Ga0068855_100519686 3300005563 Bacteria 1292
77 Ga0070664_100034684 3300005564 Bacteria 4233
78 Ga0070664_100069788 3300005564 Bacteria 3007
79 Ga0068857_100231051 3300005577 Bacteria 1692
80 Ga0068854_100013818 3300005578 Bacteria 5309
81 Ga0068856_100031958 3300005614 Bacteria 5151
82 Ga0068852_100155488 3300005616 Bacteria 2130
83 Ga0068852_100178414 3300005616 Bacteria 1996
84 Ga0068852_100598264 3300005616 Bacteria 1107
85 Ga0068859_100125104 3300005617 Bacteria 2640
86 Ga0068864_100030940 3300005618 Bacteria 4539
87 Ga0068864_100063063 3300005618 Bacteria 3212
88 Ga0068866_10070746 3300005718 Bacteria 1843
89 Ga0068861_100020666 3300005719 Bacteria 4720
90 Ga0068863_100080286 3300005841 Bacteria 3090
91 Ga0068863_100198929 3300005841 Bacteria 1927
92 Ga0068860_100005715 3300005843 Bacteria 12554
93 Ga0068860_100333222 3300005843 Bacteria 1491
94 Ga0068860_100499706 3300005843 Bacteria 1214
95 Ga0068862_100144571 3300005844 Bacteria 2113
96 Ga0075362_10106188 3300006177 Bacteria 1318
97 Ga0075367_10033772 3300006178 Bacteria 2951
98 Ga0075366_10003496 3300006195 Bacteria 8299
99 Ga0075366_10019431 3300006195 Bacteria 3931
100 Ga0075366_10040134 3300006195 Bacteria 2768
101 Ga0075366_10204000 3300006195 Bacteria 1203
102 Ga0097621_100244064 3300006237 Bacteria 1571
103 Ga0075370_10007537 3300006353 Bacteria 5547
104 Ga0068871_100277268 3300006358 Bacteria 1466
105 Ga0075429_100039772 3300006880 Bacteria 4093
106 Ga0075429_100290329 3300006880 Bacteria 1432
107 Ga0068865_100006375 3300006881 Bacteria 7189
108 Ga0097620_100125108 3300006931 Bacteria 2640
109 Ga0099824_1029368 3300006942 Bacteria 2357
110 Ga0099823_1000025 3300006944 Bacteria 73278
111 Ga0079104_1000012 3300006946 Bacteria 355143
112 Ga0105240_10011452 3300009093 Bacteria 12348
113 Ga0105240_10048660 3300009093 Bacteria 5356
114 Ga0105240_10054818 3300009093 Bacteria 4994
115 Ga0105240_10614670 3300009093 Bacteria 1195
116 Ga0114129_11138960 3300009147 Bacteria 975
117 Ga0114129_11183984 3300009147 Bacteria 953
118 Ga0105243_10097752 3300009148 Bacteria 2431
119 Ga0105243_10853083 3300009148 Bacteria 902
120 Ga0105241_10073789 3300009174 Bacteria 2655
121 Ga0105242_10050389 3300009176 Bacteria 3390
122 Ga0105248_10004608 3300009177 Bacteria 15258
123 Ga0105248_10304458 3300009177 Bacteria 1795
124 Ga0105238_10053610 3300009551 Bacteria 4052
125 Ga0105238_10962953 3300009551 Bacteria 873
126 Ga0105239_10273564 3300010375 Bacteria 1900
127 Ga0105246_10209343 3300011119 Bacteria 1521
128 Ga0157319_1000014 3300012497 Bacteria 139356
129 Ga0157369_10406512 3300013105 Bacteria 1412
130 Ga0157374_10080482 3300013296 Bacteria 3090
131 Ga0157374_10194554 3300013296 Bacteria 1984
132 Ga0157378_10007501 3300013297 Bacteria 9526
133 Ga0157378_10217402 3300013297 Bacteria 1815
134 Ga0163162_10004897 3300013306 Bacteria 12909
135 Ga0157372_10388610 3300013307 Bacteria 1626
136 Ga0157372_10602780 3300013307 Bacteria 1280
137 Ga0157380_10024475 3300014326 Bacteria 4570
138 Ga0157379_10013046 3300014968 Bacteria 7276
139 Ga0157379_10066550 3300014968 Bacteria 3221
140 Ga0157379_10470616 3300014968 Bacteria 1162
141 Ga0157376_10016281 3300014969 Bacteria 5640
142 Ga0182007_10071353 3300015262 Bacteria 1138
143 Ga0163161_10009036 3300017792 Bacteria 6892
144 Ga0213872_10000023 3300021361 Bacteria 157443
145 Ga0213872_10000122 3300021361 Bacteria 73335
146 Ga0213872_10000162 3300021361 Bacteria 61158
147 Ga0213872_10002326 3300021361 Bacteria 11313
148 Ga0213872_10006071 3300021361 Bacteria 6109
149 Ga0213872_10032587 3300021361 Bacteria 2388
150 Ga0213872_10037539 3300021361 Bacteria 2212
151 Ga0209674_100067 3300025226 Bacteria 253824
152 Ga0209672_106752 3300025228 Bacteria 1832
153 Ga0209563_100068 3300025230 Bacteria 254802
154 Ga0207427_100959 3300025231 Bacteria 12286
155 Ga0209258_100129 3300025242 Bacteria 176515
156 Ga0209258_100459 3300025242 Bacteria 44386
157 Ga0209258_110420 3300025242 Bacteria 1207
158 Ga0209646_1000244 3300025246 Bacteria 55661
159 Ga0209026_1000004 3300025250 Bacteria 949012
160 Ga0209677_100049 3300025253 Bacteria 180721
161 Ga0209677_100413 3300025253 Bacteria 25541
162 Ga0209677_101817 3300025253 Bacteria 8730
163 Ga0209148_1010676 3300025254 Bacteria 1732
164 Ga0209759_1000003 3300025256 Bacteria 792130
165 Ga0209759_1001180 3300025256 Bacteria 16394
166 Ga0209759_1001872 3300025256 Bacteria 10432
167 Ga0209759_1022062 3300025256 Bacteria 1432
168 Ga0209759_1022746 3300025256 Bacteria 1395
169 Ga0209565_1014164 3300025263 Bacteria 1841
170 Ga0209455_1000083 3300025272 Bacteria 255660
171 Ga0209673_1005414 3300025273 Bacteria 6424
172 Ga0209673_1007010 3300025273 Bacteria 5303
173 Ga0209675_1012001 3300025291 Bacteria 2821
174 Ga0209564_1000120 3300025295 Bacteria 204226
175 Ga0209050_1000683 3300025298 Bacteria 50985
176 Ga0209050_1005322 3300025298 Bacteria 8160
177 Ga0209256_1000045 3300025299 Bacteria 325506
178 Ga0209256_1000391 3300025299 Bacteria 69634
179 Ga0209256_1001821 3300025299 Bacteria 19995
180 Ga0209051_1000004 3300025303 Bacteria 1155596
181 Ga0209051_1001247 3300025303 Bacteria 22789
182 Ga0209051_1012430 3300025303 Bacteria 4118
183 Ga0209257_1000061 3300025304 Bacteria 367698
184 Ga0209257_1001646 3300025304 Bacteria 25494
185 Ga0209257_1001738 3300025304 Bacteria 24206
186 Ga0209257_1002988 3300025304 Bacteria 15386
187 Ga0209257_1004812 3300025304 Bacteria 10035
188 Ga0207697_10017407 3300025315 Bacteria 2954
189 Ga0207682_10000902 3300025893 Bacteria 13752
190 Ga0207642_10006776 3300025899 Bacteria 3831
191 Ga0207688_10028015 3300025901 Bacteria 3099
192 Ga0207645_10033862 3300025907 Bacteria 3283
193 Ga0207705_10114741 3300025909 Bacteria 1993
194 Ga0207705_10268557 3300025909 Bacteria 1304
195 Ga0207705_10396889 3300025909 Bacteria 1066
196 Ga0207654_10099726 3300025911 Bacteria 1787
197 Ga0207695_10020855 3300025913 Bacteria 7488
198 Ga0207695_10021598 3300025913 Bacteria 7339
199 Ga0207695_10039240 3300025913 Bacteria 5090
200 Ga0207695_10076608 3300025913 Bacteria 3399
201 Ga0207660_10063628 3300025917 Bacteria 2660
202 Ga0207657_10011661 3300025919 Bacteria 8712
203 Ga0207657_10018776 3300025919 Bacteria 6586
204 Ga0207657_10087710 3300025919 Bacteria 2603
205 Ga0207652_10016775 3300025921 Bacteria 5984
206 Ga0207652_10039369 3300025921 Bacteria 4012
207 Ga0207681_10013530 3300025923 Bacteria 5052
208 Ga0207681_10031596 3300025923 Bacteria 3459
209 Ga0207681_10331976 3300025923 Bacteria 1212
210 Ga0207694_10049263 3300025924 Bacteria 3261
211 Ga0207694_10057398 3300025924 Bacteria 3026
212 Ga0207650_10000580 3300025925 Bacteria 29427
213 Ga0207650_10754831 3300025925 Bacteria 823
214 Ga0207659_10001304 3300025926 Bacteria 14888
215 Ga0207659_10047347 3300025926 Bacteria 3041
216 Ga0207664_10096772 3300025929 Bacteria 2431
217 Ga0207644_10003339 3300025931 Bacteria 10351
218 Ga0207644_10097568 3300025931 Bacteria 2201
219 Ga0207644_10101367 3300025931 Bacteria 2163
220 Ga0207690_10004539 3300025932 Bacteria 8197
221 Ga0207690_10022633 3300025932 Bacteria 3911
222 Ga0207690_10116964 3300025932 Bacteria 1929
223 Ga0207706_10008677 3300025933 Bacteria 9362
224 Ga0207709_10099056 3300025935 Bacteria 1923
225 Ga0207709_10525896 3300025935 Bacteria 927
226 Ga0207704_10006505 3300025938 Bacteria 5454
227 Ga0207691_10009625 3300025940 Bacteria 9272
228 Ga0207691_10338205 3300025940 Bacteria 1289
229 Ga0207691_10560973 3300025940 Bacteria 968
230 Ga0207711_10012180 3300025941 Bacteria 7149
231 Ga0207689_10021600 3300025942 Bacteria 5411
232 Ga0207689_10162222 3300025942 Bacteria 1842
233 Ga0207689_10684480 3300025942 Bacteria 864
234 Ga0207689_10700093 3300025942 Bacteria 854
235 Ga0207679_10003287 3300025945 Bacteria 9976
236 Ga0207679_10014824 3300025945 Bacteria 5135
237 Ga0207667_10026339 3300025949 Bacteria 6356
238 Ga0207667_10068589 3300025949 Bacteria 3692
239 Ga0207667_10102002 3300025949 Bacteria 2960
240 Ga0207667_10644916 3300025949 Bacteria 1065
241 Ga0207651_10001927 3300025960 Bacteria 9738
242 Ga0207651_10014111 3300025960 Bacteria 4601
243 Ga0207668_10010949 3300025972 Bacteria 5498
244 Ga0207640_10018683 3300025981 Bacteria 4079
245 Ga0207658_10677771 3300025986 Bacteria 931
246 Ga0207677_10021075 3300026023 Bacteria 3975
247 Ga0207677_10024773 3300026023 Bacteria 3733
248 Ga0207703_10153413 3300026035 Bacteria 2011
249 Ga0207678_10041156 3300026067 Bacteria 4006
250 Ga0207708_10125598 3300026075 Bacteria 2002
251 Ga0207702_10001231 3300026078 Bacteria 25873
252 Ga0207702_10036306 3300026078 Bacteria 4122
253 Ga0207641_10240611 3300026088 Bacteria 1686
254 Ga0207648_10003741 3300026089 Bacteria 15906
255 Ga0207648_10004810 3300026089 Bacteria 13779
256 Ga0207648_10007743 3300026089 Bacteria 10498
257 Ga0207676_10064135 3300026095 Bacteria 2920
258 Ga0207674_10273197 3300026116 Bacteria 1638
259 Ga0207675_100125089 3300026118 Bacteria 2435
260 Ga0207683_10083642 3300026121 Bacteria 2836
261 Ga0207683_10233347 3300026121 Bacteria 1678
262 Ga0207698_10229089 3300026142 Bacteria 1686
263 Ga0207698_10564086 3300026142 Bacteria 1118
264 Ga0207698_11175502 3300026142 Bacteria 781
265 Ga0209281_1000039 3300027111 Bacteria 355150
266 Ga0209389_1000215 3300027296 Bacteria 40569
267 Ga0209371_1012929 3300027312 Bacteria 2381
268 Ga0209974_10000744 3300027876 Bacteria 11146
269 Ga0268266_10967519 3300028379 Bacteria 824
270 Ga0268265_10122235 3300028380 Bacteria 2147
271 Ga0268264_10002041 3300028381 Bacteria 18038
272 Ga0268264_10031285 3300028381 Bacteria 4364
273 Ga0265334_10041449 3300028573 Bacteria 1800
274 Ga0265336_10000087 3300028666 Bacteria 72636
275 Ga0307517_10052252 3300028786 Bacteria 4101
276 Ga0307515_10001889 3300028794 Bacteria 46606
277 Ga0307515_10009997 3300028794 Bacteria 18266
278 Ga0307515_10015728 3300028794 Bacteria 13920
279 Ga0307515_10070937 3300028794 Bacteria 4731
280 Ga0307515_10117799 3300028794 Bacteria 3036
281 Ga0307515_10263873 3300028794 Bacteria 1454
282 Ga0265324_10001568 3300029957 Bacteria 12759
283 Ga0268256_1014160 3300030500 Bacteria 2381
284 Ga0307511_10043501 3300030521 Bacteria 3752
285 Ga0265328_10003651 3300031239 Bacteria 6781
286 Ga0265328_10044115 3300031239 Bacteria 1640
287 Ga0265328_10129919 3300031239 Bacteria 942
288 Ga0265331_10001207 3300031250 Bacteria 19482
289 Ga0265331_10004062 3300031250 Bacteria 9210
290 Ga0265327_10000149 3300031251 Bacteria 150385
291 Ga0265327_10000674 3300031251 Bacteria 54882
292 Ga0265316_10003046 3300031344 Bacteria 17107
293 Ga0307513_10004025 3300031456 Bacteria 19726
294 Ga0307513_10060904 3300031456 Bacteria 3999
295 Ga0307513_10113502 3300031456 Bacteria 2697
296 Ga0307513_10219478 3300031456 Bacteria 1724
297 Ga0307509_10041981 3300031507 Bacteria 4959
298 Ga0307509_10138441 3300031507 Bacteria 2375
299 Ga0307509_10164724 3300031507 Bacteria 2108
300 Ga0307408_100000012 3300031548 Bacteria 408153
301 Ga0307408_100039804 3300031548 Bacteria 3325
302 Ga0307408_100196211 3300031548 Bacteria 1630
303 Ga0307408_100620484 3300031548 Bacteria 963
304 Ga0307508_10000269 3300031616 Bacteria 63656
305 Ga0307508_10145749 3300031616 Bacteria 1972
306 Ga0307514_10000339 3300031649 Bacteria 111130
307 Ga0307514_10001696 3300031649 Bacteria 25432
308 Ga0265314_10080142 3300031711 Bacteria 2157
309 Ga0307516_10000428 3300031730 Bacteria 55216
310 Ga0307516_10000506 3300031730 Bacteria 51918
311 Ga0307516_10003103 3300031730 Bacteria 21610
312 Ga0307516_10004805 3300031730 Bacteria 16463
313 Ga0307516_10340056 3300031730 Bacteria 1168
314 Ga0307405_10015836 3300031731 Bacteria 4094
315 Ga0307410_10040884 3300031852 Bacteria 3054
316 Ga0307406_10006930 3300031901 Bacteria 6276
317 Ga0307412_10002558 3300031911 Bacteria 10107
318 Ga0307416_100247983 3300032002 Bacteria 1731
319 Ga0307416_100835996 3300032002 Bacteria 1018
320 Ga0307414_10003512 3300032004 Bacteria 8381
321 Ga0307414_10493151 3300032004 Bacteria 1082
322 Ga0307411_10000059 3300032005 Bacteria 32679
323 Ga0307411_10070639 3300032005 Bacteria 2363
324 Ga0307411_10454708 3300032005 Bacteria 1072
325 Ga0307411_10847510 3300032005 Bacteria 808
326 Ga0307415_100089606 3300032126 Bacteria 2222
327 Ga0307507_10384183 3300033179 Bacteria 807
328 Ga0373950_0004000 3300034818 Bacteria 2145
329 Ga0373958_0034303 3300034819 Bacteria 1010
330 Ga0373951_0018221 3300035091 Bacteria 1594
331 Ga0373939_0000096 3300035114 Bacteria 27559
332 Ga0373960_0001418 3300035121 Bacteria 5309
333 Ga0373962_0022550 3300035242 Bacteria 1670
334 Ga0373931_0000060 3300035691 Bacteria 55084
335 Ga0373931_0010020 3300035691 Bacteria 4544
336 Ga0373931_0203914 3300035691 Bacteria 1183
337 Ga0373935_0273681 3300035692 Bacteria 1187
338 Ga0395900_0000904 3300037418 Bacteria 39054
339 Ga0395900_0757423 3300037418 Bacteria 901
340 Ga0395898_0001196 3300037466 Bacteria 39243
341 Ga0395898_0043864 3300037466 Bacteria 4406
342 Ga0395905_0000161 3300037471 Bacteria 111197
343 Ga0395905_0008486 3300037471 Bacteria 10130
344 Ga0395905_0041159 3300037471 Bacteria 4335
345 Ga0395905_0045614 3300037471 Bacteria 4111
346 Ga0395905_0097142 3300037471 Bacteria 2765
347 Ga0395905_0106793 3300037471 Bacteria 2628
348 Ga0395905_0348796 3300037471 Bacteria 1372
349 Ga0395905_0619055 3300037471 Bacteria 984
350 Ga0395901_0027074 3300038443 Bacteria 5889
351 Ga0395901_0125791 3300038443 Bacteria 2694
352 Ga0395901_0164152 3300038443 Bacteria 2332
353 Ga0436365_0170617 3300039437 Bacteria 962
354 Ga0436361_0060434 3300039447 Bacteria 165633
355 Ga0436361_0368573 3300039447 Bacteria 4282
356 Ga0436361_0669705 3300039447 Bacteria 6955
357 Ga0436361_0744625 3300039447 Bacteria 32370
358 Ga0436361_0806170 3300039447 Bacteria 32451
359 Ga0436361_0813098 3300039447 Bacteria 136133
360 Ga0436361_1029632 3300039447 Bacteria 7528
361 Ga0439461_0073784 3300041410 Bacteria 795
362 Ga0451800_0278309 3300041459 Bacteria 1663
363 Ga0439431_0065534 3300041997 Bacteria 961
364 Ga0439437_001839 3300042000 Bacteria 2251
365 Ga0439443_020812 3300042003 Bacteria 1033
366 Ga0439455_0018951 3300042012 Bacteria 1618
367 Ga0439455_0097386 3300042012 Bacteria 810
368 Ga0439457_039203 3300042014 Bacteria 1055
369 Ga0439462_0012755 3300042015 Bacteria 2150
370 Ga0450917_000160 3300042120 Bacteria 4517
371 Ga0450919_000220 3300042121 Bacteria 6343
372 Ga0450888_000634 3300042126 Bacteria 3343
373 Ga0450890_001042 3300042127 Bacteria 4026
374 Ga0450890_003149 3300042127 Bacteria 2209
375 Ga0450892_000776 3300042130 Bacteria 3539
376 Ga0450898_003440 3300042134 Bacteria 2277
377 Ga0450899_005887 3300042135 Bacteria 1321
378 Ga0450889_000622 3300042144 Bacteria 3936
379 Ga0439446_0030408 3300042156 Bacteria 1561
380 Ga0439459_0001178 3300042438 Bacteria 3803
381 Ga0451577_0158626 3300042876 Bacteria 2037
382 Ga0466969_0001180 3300044656 Bacteria 14095
383 Ga0466969_0004563 3300044656 Bacteria 7377
384 Ga0466969_0056226 3300044656 Bacteria 1921
385 Ga0466972_0001507 3300044658 Bacteria 11329
386 Ga0466972_0005493 3300044658 Bacteria 6351
387 Ga0466965_0000221 3300044683 Bacteria 18087
388 Ga0466965_0086589 3300044683 Bacteria 1589
389 Ga0466966_0014305 3300044684 Bacteria 5253
390 Ga0466961_0004381 3300044693 Bacteria 8842
391 Ga0466961_0059528 3300044693 Bacteria 2429
392 Ga0466963_0013932 3300044694 Bacteria 4951
393 Ga0466963_0042802 3300044694 Bacteria 2975
394 Ga0466963_0051303 3300044694 Bacteria 2734
395 Ga0466963_0408563 3300044694 Bacteria 957
396 Ga0466964_0001219 3300044706 Bacteria 8711
397 Ga0466964_0005203 3300044706 Bacteria 4822
398 Ga0466964_0046812 3300044706 Bacteria 1764
399 Ga0453684_0010373 3300044712 Bacteria 15944
400 Ga0453684_0027199 3300044712 Bacteria 8213
401 Ga0466971_0021546 3300044719 Bacteria 2867
402 Ga0466970_0049231 3300044765 Bacteria 2247
403 Ga0466970_0109858 3300044765 Bacteria 1505
404 Ga0466957_0007124 3300044842 Bacteria 6321
405 Ga0466957_0082577 3300044842 Bacteria 2003
406 Ga0466957_0472448 3300044842 Bacteria 866
407 Ga0466960_0005688 3300044901 Bacteria 4950
408 Ga0466960_0084280 3300044901 Bacteria 1608
409 Ga0466959_0000916 3300045049 Bacteria 17453
410 Ga0466959_0022658 3300045049 Bacteria 4643
411 Ga0466959_0035191 3300045049 Bacteria 3705
412 Ga0466959_0089710 3300045049 Bacteria 2208
413 Ga0451576_0006649 3300045051 Bacteria 14112
414 Ga0451576_0018917 3300045051 Bacteria 7528
415 Ga0451576_0138635 3300045051 Bacteria 2537
416 Ga0466958_0124035 3300045836 Bacteria 1618
417 Ga0466967_0059773 3300045976 Bacteria 3375
418 Ga0466967_0327611 3300045976 Bacteria 1478
419 Ga0495590_0013951 3300046457 Bacteria 2944
420 Ga0495650_0007972 3300046471 Bacteria 6268
421 Ga0495639_0009055 3300046475 Bacteria 4270
422 Ga0495664_0116619 3300046477 Bacteria 1614
423 Ga0495583_0000517 3300046506 Bacteria 55159
424 Ga0495606_0000600 3300046507 Bacteria 57013
425 Ga0495606_0294083 3300046507 Bacteria 883
426 Ga0495610_0211426 3300046512 Bacteria 788
427 Ga0495620_0082599 3300046515 Bacteria 1298
428 Ga0495632_0065981 3300046519 Bacteria 1747
429 Ga0495632_0197833 3300046519 Bacteria 916
430 Ga0495586_0063432 3300046535 Bacteria 2013
431 Ga0495597_0000717 3300046542 Bacteria 26586
432 Ga0495633_0004749 3300046558 Bacteria 8529
433 Ga0495625_0001712 3300046660 Bacteria 25517
434 Ga0495625_0033619 3300046660 Bacteria 3789
435 Ga0495670_0006578 3300046691 Bacteria 5714
436 Ga0495649_0000702 3300046694 Bacteria 27319
437 Ga0495660_0150987 3300046810 Bacteria 1147
438 Ga0495677_0090611 3300047445 Bacteria 1152
439 Ga0495686_0120579 3300047472 Bacteria 1563
440 Ga0496102_0003913 3300048905 Bacteria 12613
441 Ga0496102_0004617 3300048905 Bacteria 11657
442 Ga0496105_0334504 3300048908 Bacteria 1212
443 Ga0496109_0011501 3300048912 Bacteria 7612
444 Ga0496109_0193607 3300048912 Bacteria 1911
445 Ga0496109_0435709 3300048912 Bacteria 1238
446 Ga0496109_0519441 3300048912 Bacteria 1124
447 Ga0496109_0751299 3300048912 Bacteria 913
448 Ga0496110_0033407 3300048913 Bacteria 4450
449 Ga0496110_0272238 3300048913 Bacteria 1542
450 Ga0496111_0358639 3300048914 Bacteria 1079
451 Ga0496112_0072656 3300048915 Bacteria 3400
452 Ga0496113_0034081 3300048916 Bacteria 3712
453 Ga0496113_0402022 3300048916 Bacteria 1100
454 Ga0496114_0009119 3300048917 Bacteria 7865
455 Ga0496121_0030663 3300048924 Bacteria 4934
456 Ga0496124_0000089 3300048927 Bacteria 192423
457 Ga0496124_0021114 3300048927 Bacteria 6005
458 Ga0496125_0041417 3300048928 Bacteria 3937
459 Ga0496126_0139975 3300048929 Bacteria 2084
460 Ga0501297_006732 3300049520 Bacteria 1233
461 Ga0501298_009853 3300049521 Bacteria 1633
462 Ga0501298_058296 3300049521 Bacteria 813
463 Ga0501302_001542 3300049525 Bacteria 1273
464 Ga0501043_0000012 3300049579 Bacteria 188907
465 Ga0501046_0000030 3300049580 Bacteria 187803
466 Ga0501047_0000049 3300049581 Bacteria 162513
467 Ga0501048_0001813 3300049582 Bacteria 16227
468 Ga0501199_016556 3300049650 Bacteria 831
469 Ga0501202_005308 3300049652 Bacteria 2282
470 Ga0501207_027533 3300049654 Bacteria 941
471 Ga0501211_001674 3300049658 Bacteria 2373
472 Ga0501222_000698 3300049662 Bacteria 4908
473 Ga0501223_037586 3300049663 Bacteria 940
474 Ga0501235_009513 3300049669 Bacteria 2124
475 Ga0501246_010240 3300049676 Bacteria 854
476 Ga0501253_010607 3300049683 Bacteria 1393
477 Ga0501221_000111 3300049704 Bacteria 10017
478 Ga0501229_007815 3300049706 Bacteria 1332
479 Ga0501232_002463 3300049757 Bacteria 1611
480 Ga0501262_005832 3300049759 Bacteria 1461
481 Ga0501262_008508 3300049759 Bacteria 1257
482 Ga0501265_000673 3300049762 Bacteria 3719
483 Ga0501265_001880 3300049762 Bacteria 2387
484 Ga0501267_000078 3300049764 Bacteria 5791
485 Ga0501268_002386 3300049765 Bacteria 2471
486 Ga0501272_001066 3300049769 Bacteria 2528
487 Ga0501282_001298 3300049778 Bacteria 2787
488 Ga0501035_0085887 3300049822 Bacteria 2773
489 Ga0501044_0278471 3300049823 Bacteria 1607
490 Ga0501044_0340774 3300049823 Bacteria 1420
491 Ga0501045_0002489 3300049824 Bacteria 12533
492 nmdc:mga0k408_12620_c1 3300050493 Bacteria 4618
493 nmdc:mga0k408_195590_c1 3300050493 Bacteria 1207
494 nmdc:mga0k408_908_c1 3300050493 Bacteria 16172
495 nmdc:mga07m45_22166_c1 3300050496 Bacteria 3467
496 nmdc:mga07m45_332350_c1 3300050496 Bacteria 883
497 nmdc:mga07m45_62792_c1 3300050496 Bacteria 2106
498 nmdc:mga05p37_1143235_c1 3300050507 Bacteria 811
499 nmdc:mga09592_359076_c1 3300050508 Bacteria 1261
500 nmdc:mga09592_9937_c1 3300050508 Bacteria 7741
501 Ga0500635_0000293 3300053080 Bacteria 18004
502 Ga0500651_0096763 3300053093 Bacteria 1814
503 Ga0500593_000143 3300053117 Bacteria 28662
504 Ga0500559_0109410 3300053136 Bacteria 1279
505 Ga0500590_006185 3300053148 Bacteria 5818
506 Ga0500619_000121 3300053154 Bacteria 20412
507 Ga0500622_0012927 3300053156 Bacteria 4509
508 Ga0500636_0006633 3300053177 Bacteria 6654
509 Ga0590071_003317 3300059421 Bacteria 3964
510 Ga0590074_009639 3300059423 Bacteria 1609
511 Ga0590075_025251 3300059424 Bacteria 1493
512 Ga0466962_0005193 3300061719 Bacteria 6265
513 2587758026 2585428062 Bacteria 6842168
514 2643744853 2643221544 Bacteria 5886209
515 2643934263 2643221585 Bacteria 5812563
516 2644219519 2643221639 Bacteria 6649903
517 2644245270 2643221644 Bacteria 6865017
518 2644255948 2643221646 Bacteria 6433402
519 2644315750 2643221656 Bacteria 5809961
520 2644339151 2643221660 Bacteria 4208257
521 2739054407 2738541337 Bacteria 6183410
522 2831869000 2831864461 Bacteria 6502356
523 2886852507 2886848708 Bacteria 5632523
524 2894023698 2894023352 Bacteria 5167372
525 Ga0105238_10202739
526 JGI24744J21845_10019589
527 JGI25156J39149_1000063
528 JGI25154J39366_1000412
529 JGI25157J39369_1000082
530 JGI25164J39214_1005704
531 Ga0055539_1000303
532 Ga0055533_1000043
533 Ga0055525_1001141
534 Ga0055535_1000859
535 Ga0055535_1007601
536 Ga0055529_1000725
537 Ga0055524_1000237
538 Ga0055524_1001902
539 Ga0055530_10002263
540 Ga0055540_1000018
541 Ga0055540_1027477
542 Ga0055531_10000022
543 Ga0055531_10002118
544 Ga0055531_10003257
545 Ga0055531_10022126
546 Ga0055543_1009661
547 Ga0065165_1004728
548 Ga0065165_1011513
549 Ga0065707_10437678
550 Ga0070658_10035774
551 Ga0070658_10040387
552 Ga0070658_10042701
553 Ga0070658_10077134
554 Ga0070676_10002874
555 Ga0070690_100001384
556 Ga0070670_100005503
557 Ga0070670_100903400
558 Ga0070677_10001348
559 Ga0068869_100159697
560 Ga0070680_100011528
561 Ga0068868_100026663
562 Ga0068868_100064294
563 Ga0068868_100233858
564 Ga0068868_100287208
565 Ga0070660_100007225
566 Ga0070660_100042187
567 Ga0070661_100002747
568 Ga0070669_100013992
569 Ga0070669_100286674
570 Ga0070675_100000811
571 Ga0070675_100111215
572 Ga0070675_100178089
573 Ga0070671_100031206
574 Ga0070671_100039892
575 Ga0070671_100043264
576 Ga0070674_100135835
577 Ga0070673_100024442
578 Ga0070673_100027447
579 Ga0070659_100487393
580 Ga0070667_100138974
581 Ga0070667_100934525
582 Ga0070700_100030713
583 Ga0070663_100025593
584 Ga0070678_100151514
585 Ga0070678_100543378
586 Ga0070662_100015890
587 Ga0070681_10051826
588 Ga0068867_100004831
589 Ga0068867_100017549
590 Ga0070679_100004370
591 Ga0070679_100013748
592 Ga0070672_100003173
593 Ga0070672_100261125
594 Ga0070672_100330451
595 Ga0070665_100215373
596 Ga0068855_100002610
597 Ga0068855_100026805
598 Ga0068855_100230391
599 Ga0068855_100310504
600 Ga0068855_100519686
601 Ga0070664_100034684
602 Ga0070664_100069788
603 Ga0068857_100231051
604 Ga0068854_100013818
605 Ga0068856_100031958
606 Ga0068852_100155488
607 Ga0068852_100178414
608 Ga0068852_100598264
609 Ga0068859_100125104
610 Ga0068864_100030940
611 Ga0068864_100063063
612 Ga0068866_10070746
613 Ga0068861_100020666
614 Ga0068863_100080286
615 Ga0068863_100198929
616 Ga0068860_100005715
617 Ga0068860_100333222
618 Ga0068860_100499706
619 Ga0068862_100144571
620 Ga0075362_10106188
621 Ga0075367_10033772
622 Ga0075366_10003496
623 Ga0075366_10019431
624 Ga0075366_10040134
625 Ga0075366_10204000
626 Ga0097621_100244064
627 Ga0075370_10007537
628 Ga0068871_100277268
629 Ga0075429_100039772
630 Ga0075429_100290329
631 Ga0068865_100006375
632 Ga0097620_100125108
633 Ga0099824_1029368
634 Ga0099823_1000025
635 Ga0079104_1000012
636 Ga0105240_10011452
637 Ga0105240_10048660
638 Ga0105240_10054818
639 Ga0105240_10614670
640 Ga0114129_11138960
641 Ga0114129_11183984
642 Ga0105243_10097752
643 Ga0105243_10853083
644 Ga0105241_10073789
645 Ga0105242_10050389
646 Ga0105248_10004608
647 Ga0105248_10304458
648 Ga0105238_10053610
649 Ga0105238_10962953
650 Ga0105239_10273564
651 Ga0105246_10209343
652 Ga0157319_1000014
653 Ga0157369_10406512
654 Ga0157374_10080482
655 Ga0157374_10194554
656 Ga0157378_10007501
657 Ga0157378_10217402
658 Ga0163162_10004897
659 Ga0157372_10388610
660 Ga0157372_10602780
661 Ga0157380_10024475
662 Ga0157379_10013046
663 Ga0157379_10066550
664 Ga0157379_10470616
665 Ga0157376_10016281
666 Ga0182007_10071353
667 Ga0163161_10009036
668 Ga0213872_10000023
669 Ga0213872_10000122
670 Ga0213872_10000162
671 Ga0213872_10002326
672 Ga0213872_10006071
673 Ga0213872_10032587
674 Ga0213872_10037539
675 Ga0209674_100067
676 Ga0209672_106752
677 Ga0209563_100068
678 Ga0207427_100959
679 Ga0209258_100129
680 Ga0209258_100459
681 Ga0209258_110420
682 Ga0209646_1000244
683 Ga0209026_1000004
684 Ga0209677_100049
685 Ga0209677_100413
686 Ga0209677_101817
687 Ga0209148_1010676
688 Ga0209759_1000003
689 Ga0209759_1001180
690 Ga0209759_1001872
691 Ga0209759_1022062
692 Ga0209759_1022746
693 Ga0209565_1014164
694 Ga0209455_1000083
695 Ga0209673_1005414
696 Ga0209673_1007010
697 Ga0209675_1012001
698 Ga0209564_1000120
699 Ga0209050_1000683
700 Ga0209050_1005322
701 Ga0209256_1000045
702 Ga0209256_1000391
703 Ga0209256_1001821
704 Ga0209051_1000004
705 Ga0209051_1001247
706 Ga0209051_1012430
707 Ga0209257_1000061
708 Ga0209257_1001646
709 Ga0209257_1001738
710 Ga0209257_1002988
711 Ga0209257_1004812
712 Ga0207697_10017407
713 Ga0207682_10000902
714 Ga0207642_10006776
715 Ga0207688_10028015
716 Ga0207645_10033862
717 Ga0207705_10114741
718 Ga0207705_10268557
719 Ga0207705_10396889
720 Ga0207654_10099726
721 Ga0207695_10020855
722 Ga0207695_10021598
723 Ga0207695_10039240
724 Ga0207695_10076608
725 Ga0207660_10063628
726 Ga0207657_10011661
727 Ga0207657_10018776
728 Ga0207657_10087710
729 Ga0207652_10016775
730 Ga0207652_10039369
731 Ga0207681_10013530
732 Ga0207681_10031596
733 Ga0207681_10331976
734 Ga0207694_10049263
735 Ga0207694_10057398
736 Ga0207650_10000580
737 Ga0207650_10754831
738 Ga0207659_10001304
739 Ga0207659_10047347
740 Ga0207664_10096772
741 Ga0207644_10003339
742 Ga0207644_10097568
743 Ga0207644_10101367
744 Ga0207690_10004539
745 Ga0207690_10022633
746 Ga0207690_10116964
747 Ga0207706_10008677
748 Ga0207709_10099056
749 Ga0207709_10525896
750 Ga0207704_10006505
751 Ga0207691_10009625
752 Ga0207691_10338205
753 Ga0207691_10560973
754 Ga0207711_10012180
755 Ga0207689_10021600
756 Ga0207689_10162222
757 Ga0207689_10684480
758 Ga0207689_10700093
759 Ga0207679_10003287
760 Ga0207679_10014824
761 Ga0207667_10026339
762 Ga0207667_10068589
763 Ga0207667_10102002
764 Ga0207667_10644916
765 Ga0207651_10001927
766 Ga0207651_10014111
767 Ga0207668_10010949
768 Ga0207640_10018683
769 Ga0207658_10677771
770 Ga0207677_10021075
771 Ga0207677_10024773
772 Ga0207703_10153413
773 Ga0207678_10041156
774 Ga0207708_10125598
775 Ga0207702_10001231
776 Ga0207702_10036306
777 Ga0207641_10240611
778 Ga0207648_10003741
779 Ga0207648_10004810
780 Ga0207648_10007743
781 Ga0207676_10064135
782 Ga0207674_10273197
783 Ga0207675_100125089
784 Ga0207683_10083642
785 Ga0207683_10233347
786 Ga0207698_10229089
787 Ga0207698_10564086
788 Ga0207698_11175502
789 Ga0209281_1000039
790 Ga0209389_1000215
791 Ga0209371_1012929
792 Ga0209974_10000744
793 Ga0268266_10967519
794 Ga0268265_10122235
795 Ga0268264_10002041
796 Ga0268264_10031285
797 Ga0265334_10041449
798 Ga0265336_10000087
799 Ga0307517_10052252
800 Ga0307515_10001889
801 Ga0307515_10009997
802 Ga0307515_10015728
803 Ga0307515_10070937
804 Ga0307515_10117799
805 Ga0307515_10263873
806 Ga0265324_10001568
807 Ga0268256_1014160
808 Ga0307511_10043501
809 Ga0265328_10003651
810 Ga0265328_10044115
811 Ga0265328_10129919
812 Ga0265331_10001207
813 Ga0265331_10004062
814 Ga0265327_10000149
815 Ga0265327_10000674
816 Ga0265316_10003046
817 Ga0307513_10004025
818 Ga0307513_10060904
819 Ga0307513_10113502
820 Ga0307513_10219478
821 Ga0307509_10041981
822 Ga0307509_10138441
823 Ga0307509_10164724
824 Ga0307408_100000012
825 Ga0307408_100039804
826 Ga0307408_100196211
827 Ga0307408_100620484
828 Ga0307508_10000269
829 Ga0307508_10145749
830 Ga0307514_10000339
831 Ga0307514_10001696
832 Ga0265314_10080142
833 Ga0307516_10000428
834 Ga0307516_10000506
835 Ga0307516_10003103
836 Ga0307516_10004805
837 Ga0307516_10340056
838 Ga0307405_10015836
839 Ga0307410_10040884
840 Ga0307406_10006930
841 Ga0307412_10002558
842 Ga0307416_100247983
843 Ga0307416_100835996
844 Ga0307414_10003512
845 Ga0307414_10493151
846 Ga0307411_10000059
847 Ga0307411_10070639
848 Ga0307411_10454708
849 Ga0307411_10847510
850 Ga0307415_100089606
851 Ga0307507_10384183
852 Ga0373950_0004000
853 Ga0373958_0034303
854 Ga0373951_0018221
855 Ga0373939_0000096
856 Ga0373960_0001418
857 Ga0373962_0022550
858 Ga0373931_0000060
859 Ga0373931_0010020
860 Ga0373931_0203914
861 Ga0373935_0273681
862 Ga0395900_0000904
863 Ga0395900_0757423
864 Ga0395898_0001196
865 Ga0395898_0043864
866 Ga0395905_0000161
867 Ga0395905_0008486
868 Ga0395905_0041159
869 Ga0395905_0045614
870 Ga0395905_0097142
871 Ga0395905_0106793
872 Ga0395905_0348796
873 Ga0395905_0619055
874 Ga0395901_0027074
875 Ga0395901_0125791
876 Ga0395901_0164152
877 Ga0436365_0170617
878 Ga0436361_0060434
879 Ga0436361_0368573
880 Ga0436361_0669705
881 Ga0436361_0744625
882 Ga0436361_0806170
883 Ga0436361_0813098
884 Ga0436361_1029632
885 Ga0439461_0073784
886 Ga0451800_0278309
887 Ga0439431_0065534
888 Ga0439437_001839
889 Ga0439443_020812
890 Ga0439455_0018951
891 Ga0439455_0097386
892 Ga0439457_039203
893 Ga0439462_0012755
894 Ga0450917_000160
895 Ga0450919_000220
896 Ga0450888_000634
897 Ga0450890_001042
898 Ga0450890_003149
899 Ga0450892_000776
900 Ga0450898_003440
901 Ga0450899_005887
902 Ga0450889_000622
903 Ga0439446_0030408
904 Ga0439459_0001178
905 Ga0451577_0158626
906 Ga0466969_0001180
907 Ga0466969_0004563
908 Ga0466969_0056226
909 Ga0466972_0001507
910 Ga0466972_0005493
911 Ga0466965_0000221
912 Ga0466965_0086589
913 Ga0466966_0014305
914 Ga0466961_0004381
915 Ga0466961_0059528
916 Ga0466963_0013932
917 Ga0466963_0042802
918 Ga0466963_0051303
919 Ga0466963_0408563
920 Ga0466964_0001219
921 Ga0466964_0005203
922 Ga0466964_0046812
923 Ga0453684_0010373
924 Ga0453684_0027199
925 Ga0466971_0021546
926 Ga0466970_0049231
927 Ga0466970_0109858
928 Ga0466957_0007124
929 Ga0466957_0082577
930 Ga0466957_0472448
931 Ga0466960_0005688
932 Ga0466960_0084280
933 Ga0466959_0000916
934 Ga0466959_0022658
935 Ga0466959_0035191
936 Ga0466959_0089710
937 Ga0451576_0006649
938 Ga0451576_0018917
939 Ga0451576_0138635
940 Ga0466958_0124035
941 Ga0466967_0059773
942 Ga0466967_0327611
943 Ga0495590_0013951
944 Ga0495650_0007972
945 Ga0495639_0009055
946 Ga0495664_0116619
947 Ga0495583_0000517
948 Ga0495606_0000600
949 Ga0495606_0294083
950 Ga0495610_0211426
951 Ga0495620_0082599
952 Ga0495632_0065981
953 Ga0495632_0197833
954 Ga0495586_0063432
955 Ga0495597_0000717
956 Ga0495633_0004749
957 Ga0495625_0001712
958 Ga0495625_0033619
959 Ga0495670_0006578
960 Ga0495649_0000702
961 Ga0495660_0150987
962 Ga0495677_0090611
963 Ga0495686_0120579
964 Ga0496102_0003913
965 Ga0496102_0004617
966 Ga0496105_0334504
967 Ga0496109_0011501
968 Ga0496109_0193607
969 Ga0496109_0435709
970 Ga0496109_0519441
971 Ga0496109_0751299
972 Ga0496110_0033407
973 Ga0496110_0272238
974 Ga0496111_0358639
975 Ga0496112_0072656
976 Ga0496113_0034081
977 Ga0496113_0402022
978 Ga0496114_0009119
979 Ga0496121_0030663
980 Ga0496124_0000089
981 Ga0496124_0021114
982 Ga0496125_0041417
983 Ga0496126_0139975
984 Ga0501297_006732
985 Ga0501298_009853
986 Ga0501298_058296
987 Ga0501302_001542
988 Ga0501043_0000012
989 Ga0501046_0000030
990 Ga0501047_0000049
991 Ga0501048_0001813
992 Ga0501199_016556
993 Ga0501202_005308
994 Ga0501207_027533
995 Ga0501211_001674
996 Ga0501222_000698
997 Ga0501223_037586
998 Ga0501235_009513
999 Ga0501246_010240
1000 Ga0501253_010607
1001 Ga0501221_000111
1002 Ga0501229_007815
1003 Ga0501232_002463
1004 Ga0501262_005832
1005 Ga0501262_008508
1006 Ga0501265_000673
1007 Ga0501265_001880
1008 Ga0501267_000078
1009 Ga0501268_002386
1010 Ga0501272_001066
1011 Ga0501282_001298
1012 Ga0501035_0085887
1013 Ga0501044_0278471
1014 Ga0501044_0340774
1015 Ga0501045_0002489
1016 nmdc:mga0k408_12620_c1
1017 nmdc:mga0k408_195590_c1
1018 nmdc:mga0k408_908_c1
1019 nmdc:mga07m45_22166_c1
1020 nmdc:mga07m45_332350_c1
1021 nmdc:mga07m45_62792_c1
1022 nmdc:mga05p37_1143235_c1
1023 nmdc:mga09592_359076_c1
1024 nmdc:mga09592_9937_c1
1025 Ga0500635_0000293
1026 Ga0500651_0096763
1027 Ga0500593_000143
1028 Ga0500559_0109410
1029 Ga0500590_006185
1030 Ga0500619_000121
1031 Ga0500622_0012927
1032 Ga0500636_0006633
1033 Ga0590071_003317
1034 Ga0590074_009639
1035 Ga0590075_025251
1036 Ga0466962_0005193
1037 2587758026
1038 2643744853
1039 2643934263
1040 2644219519
1041 2644245270
1042 2644255948
1043 2644315750
1044 2644339151
1045 2739054407
1046 2831869000
1047 2886852507
1048 2894023698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

33

236

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3inp-assembly1.cif.gz_A 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. 0.9578 4 224
7u5y-assembly1.cif.gz_E crystal structure of ribulose-phosphate 3-epimerase from pseudomonas aeruginosa 0.9523 1 224
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9518 5 224
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9455 4 224
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9408 4 224
ID Description Score Start End Superfamily
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9577 1 224 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.946 3 224 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9412 3 224 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9367 1 224 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9321 3 223 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6M1CNY9-F1-model_v4 deleted 0.9939 69 224
AF-A0A4U6LJ12-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9934 91 225 GO:0005975
GO:0016857
AF-K2EK91-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9924 92 225 GO:0005975
GO:0016857
AF-A0A520RZK4-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9909 80 224 GO:0005975
GO:0016857
AF-A0A4U6LJ12-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9861 91 225 GO:0005975
GO:0016857

Map