F455227

General Info

Members Datasets Scaffolds Average Seq Length
498 305 996 249

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_071358|Ga0400483_071358_110_946
Length 278
Sequence MSRYVAGMQWRPLGSPHPSTIGEARMKVLVPVKRVIDYNVKVRVKPDGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKAEEIVAVSIGVEKAQETLRTALAMGADRAILVTATDDVNTDIEPLAVAKILKAVIDEEQPGLVLLGKQAIDNDMNATGQMLAALLGWSQATFASELAVEGDHALVTREVDGGLQKIKVAMPAIVSVDLRLNEPRYASLPNIMKAKKKPLDKKAPADLGVDVAPRLTVVSTTEPEARKAGVRVESVAELVEKLKTEAGVI

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
50 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
90 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
118 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
119 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
126 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
127 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
241 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
246 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
247 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
248 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
249 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
250 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
251 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
252 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
253 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
254 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
255 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
256 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
257 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
258 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
259 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
260 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
261 2643221582 Rhizobium sp. Root651 Isolate Unclassified
262 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
263 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
264 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
265 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
266 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
267 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
268 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
269 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
270 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
271 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
272 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
273 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
274 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
275 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
276 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
277 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
278 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
279 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
280 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
281 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
282 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
283 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
284 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
285 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
286 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
287 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
288 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
289 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
290 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
291 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
292 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
293 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
294 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
295 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
296 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
297 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
298 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
299 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
300 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
301 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
302 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
303 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
304 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
305 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.53
Metatranscriptomes 1.81
Isolates 15.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 1.61
Nodule 3.21
Rhizoplane 4.62
Rhizosphere 75.1
Stem 0
Stem Tuber 0.2
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_071358 3300039062 Bacteria 1129
2 JGI24740J21852_10000321 3300001979 Bacteria 20355
3 JGI24739J22299_10003749 3300001989 Bacteria 5802
4 JGI24735J21928_10000185 3300002067 Bacteria 22276
5 JGI24735J21928_10000536 3300002067 Bacteria 13384
6 JGI24738J21930_10008608 3300002075 Bacteria 2318
7 JGI25406J46586_10000707 3300003203 Bacteria 15594
8 Ga0007409J51694_1022478 3300003575 Bacteria 1169
9 Ga0007409J51694_1033728 3300003575 Bacteria 932
10 Ga0055525_1001632 3300003759 Bacteria 3485
11 Ga0055540_1013687 3300003792 Bacteria 2462
12 Ga0065714_10068786 3300005288 Bacteria 4546
13 Ga0070658_10009845 3300005327 Bacteria 7678
14 Ga0070658_10018549 3300005327 Bacteria 5571
15 Ga0070658_10309121 3300005327 Bacteria 1349
16 Ga0070658_10459200 3300005327 Bacteria 1098
17 Ga0070690_100196601 3300005330 Bacteria 1401
18 Ga0070680_100025975 3300005336 Bacteria 4684
19 Ga0070675_100142125 3300005354 Bacteria 2052
20 Ga0070673_100348371 3300005364 Bacteria 1314
21 Ga0070659_100139129 3300005366 Bacteria 1976
22 Ga0070705_100021147 3300005440 Bacteria 3456
23 Ga0070663_100057164 3300005455 Bacteria 2797
24 Ga0070663_100119645 3300005455 Bacteria 1988
25 Ga0070679_100022584 3300005530 Bacteria 6150
26 Ga0068853_100603228 3300005539 Bacteria 1043
27 Ga0070665_100018494 3300005548 Bacteria 6984
28 Ga0070665_100587718 3300005548 Bacteria 1126
29 Ga0070704_100055363 3300005549 Bacteria 2812
30 Ga0068855_100004807 3300005563 Bacteria 16490
31 Ga0068855_100277965 3300005563 Bacteria 1860
32 Ga0068855_100458709 3300005563 Bacteria 1390
33 Ga0068855_100510115 3300005563 Bacteria 1306
34 Ga0068857_100293752 3300005577 Bacteria 1497
35 Ga0068856_100228370 3300005614 Bacteria 1877
36 Ga0068856_100259230 3300005614 Bacteria 1754
37 Ga0068856_100942907 3300005614 Bacteria 882
38 Ga0068852_100388627 3300005616 Bacteria 1370
39 Ga0068859_100023328 3300005617 Bacteria 6210
40 Ga0068862_100025030 3300005844 Bacteria 5010
41 Ga0068862_100081412 3300005844 Bacteria 2809
42 Ga0081539_10000054 3300005985 Bacteria 259053
43 Ga0075428_100173706 3300006844 Bacteria 2335
44 Ga0075430_100059073 3300006846 Bacteria 3224
45 Ga0075429_100148146 3300006880 Bacteria 2055
46 Ga0068865_100101216 3300006881 Bacteria 2110
47 Ga0097620_100023328 3300006931 Bacteria 6210
48 Ga0105251_10000789 3300009011 Bacteria 28691
49 Ga0105251_10021755 3300009011 Bacteria 3342
50 Ga0105240_10000528 3300009093 Bacteria 70421
51 Ga0105240_10009265 3300009093 Bacteria 13964
52 Ga0105240_10167754 3300009093 Bacteria 2602
53 Ga0105240_10205516 3300009093 Bacteria 2305
54 Ga0105240_10213170 3300009093 Bacteria 2255
55 Ga0105240_10238803 3300009093 Bacteria 2108
56 Ga0105241_10073576 3300009174 Bacteria 2659
57 Ga0105241_10154617 3300009174 Bacteria 1880
58 Ga0105241_10196389 3300009174 Bacteria 1683
59 Ga0105241_10233552 3300009174 Bacteria 1551
60 Ga0105237_10032573 3300009545 Bacteria 5276
61 Ga0105237_10056325 3300009545 Bacteria 3935
62 Ga0105238_10126502 3300009551 Bacteria 2534
63 Ga0105238_10162234 3300009551 Bacteria 2211
64 Ga0105238_10250654 3300009551 Bacteria 1749
65 Ga0105239_10099382 3300010375 Bacteria 3217
66 Ga0105239_10102953 3300010375 Bacteria 3160
67 Ga0105239_10106923 3300010375 Bacteria 3099
68 Ga0105239_10191626 3300010375 Bacteria 2288
69 Ga0105239_10297698 3300010375 Bacteria 1817
70 Ga0157373_10249457 3300013100 Bacteria 1255
71 Ga0157371_10008332 3300013102 Bacteria 8273
72 Ga0157370_10023816 3300013104 Bacteria 6074
73 Ga0157370_10028282 3300013104 Bacteria 5517
74 Ga0157370_10075991 3300013104 Bacteria 3165
75 Ga0157370_10126782 3300013104 Bacteria 2382
76 Ga0157369_10000126 3300013105 Bacteria 109644
77 Ga0157369_10007456 3300013105 Bacteria 12599
78 Ga0157369_10167853 3300013105 Bacteria 2313
79 Ga0157372_10115275 3300013307 Bacteria 3080
80 Ga0157380_10137776 3300014326 Bacteria 2092
81 Ga0182008_10050262 3300014497 Bacteria 2069
82 Ga0182006_1044595 3300015261 Bacteria 1729
83 Ga0183363_1005 3300015690 Bacteria 403020
84 Ga0183361_10002 3300016635 Bacteria 907642
85 Ga0183361_10039 3300016635 Bacteria 25237
86 Ga0163161_10049491 3300017792 Bacteria 3038
87 Ga0163161_10226702 3300017792 Bacteria 1449
88 Ga0197907_10533598 3300020069 Bacteria 957
89 Ga0206349_1389287 3300020075 Bacteria 1058
90 Ga0206350_10498766 3300020080 Bacteria 1993
91 Ga0206354_11162103 3300020081 Bacteria 3329
92 Ga0213872_10043710 3300021361 Bacteria 2041
93 Ga0213875_10019792 3300021388 Bacteria 3235
94 Ga0224712_10016383 3300022467 Bacteria 2434
95 Ga0209233_1029195 3300025261 Bacteria 1315
96 Ga0207713_1001874 3300025735 Bacteria 15974
97 Ga0207705_10000909 3300025909 Bacteria 24236
98 Ga0207705_10008134 3300025909 Bacteria 7680
99 Ga0207705_10409579 3300025909 Bacteria 1049
100 Ga0207654_10025279 3300025911 Bacteria 3201
101 Ga0207654_10040815 3300025911 Bacteria 2617
102 Ga0207654_10079946 3300025911 Bacteria 1965
103 Ga0207695_10001649 3300025913 Bacteria 35962
104 Ga0207695_10057015 3300025913 Bacteria 4061
105 Ga0207695_10092956 3300025913 Bacteria 3026
106 Ga0207695_10096687 3300025913 Bacteria 2955
107 Ga0207695_10098468 3300025913 Bacteria 2923
108 Ga0207695_10243967 3300025913 Bacteria 1697
109 Ga0207695_10426145 3300025913 Bacteria 1211
110 Ga0207671_10162637 3300025914 Bacteria 1729
111 Ga0207671_10187577 3300025914 Bacteria 1611
112 Ga0207660_10047341 3300025917 Bacteria 3039
113 Ga0207657_10237941 3300025919 Bacteria 1454
114 Ga0207649_10179012 3300025920 Bacteria 1483
115 Ga0207652_10008279 3300025921 Bacteria 8360
116 Ga0207694_10075189 3300025924 Bacteria 2644
117 Ga0207659_10091733 3300025926 Bacteria 2270
118 Ga0207690_10058112 3300025932 Bacteria 2615
119 Ga0207709_10224066 3300025935 Bacteria 1358
120 Ga0207670_10348293 3300025936 Bacteria 1172
121 Ga0207669_10046192 3300025937 Bacteria 2572
122 Ga0207711_10191826 3300025941 Bacteria 1862
123 Ga0207667_10005385 3300025949 Bacteria 15603
124 Ga0207667_10183027 3300025949 Bacteria 2151
125 Ga0207667_10270906 3300025949 Bacteria 1736
126 Ga0207667_10305436 3300025949 Bacteria 1625
127 Ga0207667_10727265 3300025949 Bacteria 993
128 Ga0207651_10260339 3300025960 Bacteria 1424
129 Ga0207639_10032334 3300026041 Bacteria 3851
130 Ga0207678_10077300 3300026067 Bacteria 2851
131 Ga0207678_10217882 3300026067 Bacteria 1633
132 Ga0207678_10234215 3300026067 Bacteria 1572
133 Ga0207702_10453034 3300026078 Bacteria 1245
134 Ga0207648_10091050 3300026089 Bacteria 2666
135 Ga0207674_10063707 3300026116 Bacteria 3720
136 Ga0209983_1016437 3300027665 Bacteria 1528
137 Ga0209966_1010685 3300027695 Bacteria 1661
138 Ga0209966_1014767 3300027695 Bacteria 1461
139 Ga0209974_10039044 3300027876 Bacteria 1579
140 Ga0268266_10055699 3300028379 Bacteria 3399
141 Ga0268265_10041130 3300028380 Bacteria 3418
142 Ga0268265_10622831 3300028380 Bacteria 1034
143 Ga0265323_10004666 3300028653 Bacteria 5881
144 Ga0265324_10008485 3300029957 Bacteria 4079
145 Ga0265324_10012600 3300029957 Bacteria 3184
146 Ga0237817_11579 3300030083 Bacteria 1099
147 Ga0265330_10002470 3300031235 Bacteria 10054
148 Ga0265340_10000353 3300031247 Bacteria 24451
149 Ga0265340_10001830 3300031247 Bacteria 12157
150 Ga0265340_10178668 3300031247 Bacteria 960
151 Ga0265339_10015108 3300031249 Bacteria 4639
152 Ga0265339_10130288 3300031249 Bacteria 1287
153 Ga0265331_10022694 3300031250 Bacteria 3200
154 Ga0265331_10039047 3300031250 Bacteria 2317
155 Ga0265316_10022994 3300031344 Bacteria 5244
156 Ga0265316_10032425 3300031344 Bacteria 4263
157 Ga0265316_10106641 3300031344 Bacteria 2125
158 Ga0265316_10117251 3300031344 Bacteria 2013
159 Ga0265316_10180089 3300031344 Bacteria 1574
160 Ga0307513_10116644 3300031456 Unclassified 2649
161 Ga0307509_10103946 3300031507 Bacteria 2867
162 Ga0307408_100288238 3300031548 Bacteria 1370
163 Ga0265313_10005546 3300031595 Bacteria 9249
164 Ga0265314_10040683 3300031711 Bacteria 3334
165 Ga0265314_10077461 3300031711 Bacteria 2205
166 Ga0265314_10102259 3300031711 Bacteria 1839
167 Ga0265342_10014194 3300031712 Bacteria 5298
168 Ga0316576_10008183 3300031727 Bacteria 6645
169 Ga0307405_10344407 3300031731 Bacteria 1147
170 Ga0307416_100129991 3300032002 Bacteria 2265
171 Ga0316593_10046868 3300032168 Bacteria 1452
172 Ga0373934_0184746 3300035086 Bacteria 857
173 Ga0373931_0040154 3300035691 Bacteria 2454
174 Ga0373925_0017082 3300037068 Bacteria 5253
175 Ga0373925_0515301 3300037068 Bacteria 982
176 Ga0395899_0000005 3300037312 Bacteria 772966
177 Ga0395899_0000041 3300037312 Bacteria 255615
178 Ga0395899_0005775 3300037312 Bacteria 9606
179 Ga0395900_0000077 3300037418 Bacteria 179525
180 Ga0395900_0000090 3300037418 Bacteria 169213
181 Ga0395900_0000097 3300037418 Bacteria 161598
182 Ga0395900_0058918 3300037418 Bacteria 3953
183 Ga0395900_0205411 3300037418 Bacteria 1991
184 Ga0395900_0903915 3300037418 Bacteria 806
185 Ga0395898_0000003 3300037466 Bacteria 772986
186 Ga0395898_0000220 3300037466 Bacteria 146473
187 Ga0395898_0142502 3300037466 Bacteria 2294
188 Ga0395898_0545405 3300037466 Bacteria 1101
189 Ga0395905_0053858 3300037471 Bacteria 3765
190 Ga0395905_0466454 3300037471 Bacteria 1161
191 Ga0436364_0107567 3300037853 Bacteria 975
192 Ga0436364_0210663 3300037853 Bacteria 9471
193 Ga0436364_0836559 3300037853 Bacteria 4449
194 Ga0395901_0000096 3300038443 Bacteria 118723
195 Ga0395901_0001807 3300038443 Bacteria 22099
196 Ga0395901_0032893 3300038443 Bacteria 5350
197 Ga0400483_038604 3300039062 Bacteria 2294
198 Ga0400483_074493 3300039062 Bacteria 1324
199 Ga0400483_167249 3300039062 Bacteria 2817
200 Ga0400483_213659 3300039062 Bacteria 2007
201 Ga0400483_264211 3300039062 Bacteria 4013
202 Ga0436361_0178339 3300039447 Bacteria 3425
203 Ga0436363_0732576 3300039450 Bacteria 1913
204 Ga0439453_0024531 3300041408 Bacteria 1107
205 Ga0451841_0799575 3300041498 Bacteria 1311
206 Ga0439441_005529 3300042001 Bacteria 1970
207 Ga0439435_0005347 3300042436 Bacteria 2819
208 Ga0439444_0007101 3300042437 Bacteria 1711
209 Ga0451577_0000186 3300042876 Bacteria 131630
210 Ga0451577_0007642 3300042876 Bacteria 10601
211 Ga0451577_0016740 3300042876 Bacteria 6781
212 Ga0451577_0040155 3300042876 Bacteria 4202
213 Ga0466969_0011145 3300044656 Bacteria 4762
214 Ga0466969_0017288 3300044656 Bacteria 3768
215 Ga0466969_0026644 3300044656 Bacteria 2963
216 Ga0466969_0054663 3300044656 Bacteria 1955
217 Ga0466972_0026427 3300044658 Bacteria 2878
218 Ga0466973_0015470 3300044659 Bacteria 7211
219 Ga0466977_0000158 3300044666 Bacteria 16846
220 Ga0466978_0213382 3300044671 Bacteria 1143
221 Ga0453683_0137708 3300044673 Bacteria 1540
222 Ga0466965_0000245 3300044683 Bacteria 17435
223 Ga0466965_0018157 3300044683 Bacteria 3368
224 Ga0466966_0000002 3300044684 Bacteria 370962
225 Ga0466966_0000033 3300044684 Bacteria 101862
226 Ga0466966_0049025 3300044684 Bacteria 2690
227 Ga0466966_0128542 3300044684 Bacteria 1552
228 Ga0466961_0000061 3300044693 Bacteria 64795
229 Ga0466961_0001363 3300044693 Bacteria 15069
230 Ga0466961_0034112 3300044693 Bacteria 3267
231 Ga0466961_0302725 3300044693 Bacteria 976
232 Ga0466963_0003013 3300044694 Bacteria 9526
233 Ga0466963_0067160 3300044694 Bacteria 2406
234 Ga0466964_0002043 3300044706 Bacteria 7098
235 Ga0466964_0030792 3300044706 Bacteria 2125
236 Ga0453684_0000121 3300044712 Bacteria 341067
237 Ga0453684_0026586 3300044712 Bacteria 8346
238 Ga0466971_0038874 3300044719 Bacteria 2135
239 Ga0466971_0298253 3300044719 Bacteria 773
240 Ga0466968_0046064 3300044735 Bacteria 1852
241 Ga0466970_0001731 3300044765 Bacteria 10520
242 Ga0466970_0111582 3300044765 Bacteria 1493
243 Ga0466970_0178515 3300044765 Bacteria 1178
244 Ga0466957_0002815 3300044842 Bacteria 9408
245 Ga0466957_0008605 3300044842 Bacteria 5807
246 Ga0466957_0034095 3300044842 Bacteria 3054
247 Ga0466957_0217358 3300044842 Bacteria 1261
248 Ga0466959_0003607 3300045049 Bacteria 10204
249 Ga0466959_0039385 3300045049 Bacteria 3492
250 Ga0466959_0140168 3300045049 Bacteria 1709
251 Ga0451576_0005812 3300045051 Bacteria 15341
252 Ga0451576_0373609 3300045051 Bacteria 1494
253 Ga0466958_0003344 3300045836 Bacteria 8311
254 Ga0466958_0004230 3300045836 Bacteria 7548
255 Ga0466958_0006705 3300045836 Bacteria 6283
256 Ga0466958_0010621 3300045836 Bacteria 5162
257 Ga0466958_0137250 3300045836 Bacteria 1538
258 Ga0466967_0920450 3300045976 Bacteria 870
259 Ga0495603_0077869 3300046455 Bacteria 1945
260 Ga0495603_0098484 3300046455 Bacteria 1707
261 Ga0495590_0008310 3300046457 Bacteria 3965
262 Ga0495591_002588 3300046458 Bacteria 9931
263 Ga0495629_0222597 3300046459 Bacteria 1301
264 Ga0495653_0056724 3300046463 Bacteria 2984
265 Ga0495580_0000758 3300046472 Bacteria 27688
266 Ga0495580_0001122 3300046472 Bacteria 23573
267 Ga0495580_0143763 3300046472 Bacteria 1653
268 Ga0495580_0461836 3300046472 Bacteria 851
269 Ga0495582_0033474 3300046473 Bacteria 2825
270 Ga0495582_0036064 3300046473 Bacteria 2720
271 Ga0495662_0077267 3300046476 Bacteria 1617
272 Ga0495664_0058951 3300046477 Bacteria 2284
273 Ga0495584_0000990 3300046491 Bacteria 17819
274 Ga0495585_0021023 3300046492 Bacteria 3748
275 Ga0495596_0026911 3300046500 Bacteria 2315
276 Ga0495596_0072614 3300046500 Bacteria 1336
277 Ga0495607_0025653 3300046501 Bacteria 3663
278 Ga0495606_0025424 3300046507 Bacteria 4240
279 Ga0495606_0222100 3300046507 Bacteria 1064
280 Ga0495608_0045574 3300046511 Bacteria 2921
281 Ga0495620_0016698 3300046515 Bacteria 3677
282 Ga0495628_0282080 3300046516 Bacteria 1233
283 Ga0495630_0001574 3300046517 Bacteria 15859
284 Ga0495630_0005881 3300046517 Bacteria 8676
285 Ga0495666_0276025 3300046526 Bacteria 762
286 Ga0495652_0058906 3300046529 Bacteria 3251
287 Ga0495665_0000077 3300046531 Bacteria 42404
288 Ga0495665_0009519 3300046531 Bacteria 5262
289 Ga0495586_0019454 3300046535 Bacteria 3615
290 Ga0495586_0072438 3300046535 Bacteria 1884
291 Ga0495586_0108407 3300046535 Bacteria 1545
292 Ga0495587_0016885 3300046536 Bacteria 4539
293 Ga0495587_0143439 3300046536 Bacteria 1362
294 Ga0495621_0003484 3300046539 Bacteria 4344
295 Ga0495621_0010403 3300046539 Bacteria 2845
296 Ga0495597_0008733 3300046542 Bacteria 5061
297 Ga0495645_0252713 3300046543 Bacteria 1171
298 Ga0495622_0000544 3300046557 Bacteria 22645
299 Ga0495667_0126414 3300046559 Bacteria 1650
300 Ga0495611_0074484 3300046648 Bacteria 1555
301 Ga0495625_0000146 3300046660 Bacteria 108123
302 Ga0495625_0004613 3300046660 Bacteria 12953
303 Ga0495661_0135767 3300046665 Bacteria 1343
304 Ga0495599_0000226 3300046678 Bacteria 35902
305 Ga0495599_0010350 3300046678 Bacteria 5703
306 Ga0495599_0022952 3300046678 Bacteria 3897
307 Ga0495658_0060800 3300046683 Bacteria 2167
308 Ga0495669_0098140 3300046684 Bacteria 1359
309 Ga0495613_0018317 3300046689 Bacteria 5222
310 Ga0495624_0012093 3300046690 Bacteria 5910
311 Ga0495649_0325779 3300046694 Bacteria 779
312 Ga0495600_0043320 3300046809 Bacteria 2935
313 Ga0495581_0113235 3300047315 Bacteria 1577
314 Ga0495674_0027440 3300047319 Bacteria 5204
315 Ga0495674_0187068 3300047319 Bacteria 1723
316 Ga0495674_0442196 3300047319 Bacteria 1045
317 Ga0495676_0128939 3300047321 Bacteria 1829
318 Ga0495683_0000642 3300047323 Bacteria 26000
319 Ga0495683_0060229 3300047323 Bacteria 1882
320 Ga0495687_018714 3300047443 Bacteria 3415
321 Ga0495687_049395 3300047443 Bacteria 1798
322 Ga0495679_019676 3300047446 Bacteria 2365
323 Ga0495679_045361 3300047446 Bacteria 1343
324 Ga0495602_0073146 3300048088 Bacteria 2919
325 Ga0495626_0086085 3300048091 Bacteria 1389
326 Ga0496100_0000078 3300048903 Bacteria 54410
327 Ga0496100_0005911 3300048903 Bacteria 6632
328 Ga0496101_0000205 3300048904 Bacteria 45101
329 Ga0496101_0000694 3300048904 Bacteria 20286
330 Ga0496102_0000165 3300048905 Bacteria 89141
331 Ga0496102_0001233 3300048905 Bacteria 23156
332 Ga0496102_0064503 3300048905 Bacteria 3354
333 Ga0496102_0152712 3300048905 Bacteria 2170
334 Ga0496102_0355612 3300048905 Bacteria 1379
335 Ga0496103_0000668 3300048906 Bacteria 25769
336 Ga0496103_0001056 3300048906 Bacteria 19218
337 Ga0496103_0006236 3300048906 Bacteria 7127
338 Ga0496103_0007741 3300048906 Bacteria 6387
339 Ga0496104_0008622 3300048907 Bacteria 9068
340 Ga0496104_0191190 3300048907 Bacteria 1958
341 Ga0496105_0079305 3300048908 Bacteria 2711
342 Ga0496105_0726330 3300048908 Bacteria 760
343 Ga0496108_0225199 3300048911 Bacteria 1630
344 Ga0496108_0283238 3300048911 Bacteria 1443
345 Ga0496111_0004800 3300048914 Bacteria 8573
346 Ga0496112_0002697 3300048915 Bacteria 14354
347 Ga0496113_0027885 3300048916 Bacteria 4054
348 Ga0496115_0304036 3300048918 Bacteria 1307
349 Ga0496116_0031167 3300048919 Bacteria 3822
350 Ga0496116_0146352 3300048919 Bacteria 1320
351 Ga0496117_0000707 3300048920 Bacteria 52889
352 Ga0496117_0015289 3300048920 Bacteria 6553
353 Ga0496117_0053154 3300048920 Bacteria 2848
354 Ga0496118_0000283 3300048921 Bacteria 89206
355 Ga0496118_0002388 3300048921 Bacteria 25379
356 Ga0496118_0046400 3300048921 Bacteria 3380
357 Ga0496119_0149264 3300048922 Bacteria 1254
358 Ga0496121_0003158 3300048924 Bacteria 23745
359 Ga0496121_0076846 3300048924 Bacteria 2661
360 Ga0496122_0008812 3300048925 Bacteria 10779
361 Ga0496122_0155299 3300048925 Bacteria 1405
362 Ga0496123_0005833 3300048926 Bacteria 12212
363 Ga0496123_0064823 3300048926 Bacteria 2326
364 Ga0496124_0013497 3300048927 Bacteria 7972
365 Ga0496125_0014028 3300048928 Bacteria 7833
366 Ga0496125_0023533 3300048928 Bacteria 5684
367 Ga0496125_0261453 3300048928 Bacteria 1084
368 Ga0496126_0039442 3300048929 Bacteria 4382
369 Ga0496126_0046408 3300048929 Bacteria 3985
370 Ga0501318_038297 3300049534 Bacteria 677
371 Ga0501032_0322739 3300049569 Bacteria 996
372 Ga0501033_0003745 3300049570 Bacteria 12362
373 Ga0501033_0037476 3300049570 Bacteria 3629
374 Ga0501034_0000293 3300049571 Bacteria 88978
375 Ga0501034_0000874 3300049571 Bacteria 44331
376 Ga0501034_0001048 3300049571 Bacteria 39365
377 Ga0501034_0005695 3300049571 Bacteria 13543
378 Ga0501034_0380522 3300049571 Bacteria 1336
379 Ga0501038_0200717 3300049574 Bacteria 1601
380 Ga0501038_0414315 3300049574 Bacteria 1040
381 Ga0501039_0118985 3300049575 Bacteria 2069
382 Ga0501041_0017101 3300049577 Bacteria 4315
383 Ga0501043_0046207 3300049579 Bacteria 3424
384 Ga0501043_0231617 3300049579 Bacteria 1427
385 Ga0501047_0070134 3300049581 Bacteria 3374
386 Ga0501047_0152099 3300049581 Bacteria 2190
387 Ga0501047_0392940 3300049581 Bacteria 1220
388 Ga0501067_0049914 3300049583 Bacteria 2319
389 Ga0501069_0001386 3300049585 Bacteria 11897
390 Ga0501070_0730381 3300049586 Bacteria 781
391 Ga0501071_0052012 3300049587 Bacteria 2953
392 Ga0501072_0013175 3300049588 Bacteria 6331
393 Ga0501074_0249562 3300049590 Bacteria 1262
394 Ga0501076_0000922 3300049592 Bacteria 19182
395 Ga0501077_0041392 3300049593 Bacteria 2933
396 Ga0501079_0024619 3300049741 Bacteria 4619
397 Ga0501080_0103518 3300049742 Bacteria 2640
398 Ga0501081_0073088 3300049743 Bacteria 2392
399 Ga0501083_0053381 3300049744 Bacteria 2714
400 Ga0501035_0070688 3300049822 Bacteria 3091
401 Ga0501044_0024961 3300049823 Bacteria 6338
402 Ga0501045_0188791 3300049824 Bacteria 1536
403 nmdc:mga0k408_51309_c1 3300050493 Bacteria 2390
404 nmdc:mga09592_321782_c1 3300050508 Bacteria 1340
405 nmdc:mga09592_35337_c1 3300050508 Bacteria 4184
406 nmdc:mga09592_606152_c1 3300050508 Bacteria 938
407 nmdc:mga0qj67_107148_c1 3300050509 Bacteria 2254
408 nmdc:mga0qj67_306355_c1 3300050509 Bacteria 1287
409 nmdc:mga06r32_253526_c1 3300050510 Bacteria 1747
410 nmdc:mga06r32_510372_c1 3300050510 Bacteria 1179
411 Ga0500643_000017 3300053087 Bacteria 305781
412 Ga0500641_0061268 3300053096 Bacteria 1567
413 Ga0500658_0000012 3300053134 Bacteria 160010
414 Ga0500636_0210211 3300053177 Bacteria 1022
415 Ga0501084_0561330 3300054114 Bacteria 965
416 Ga0501082_0054698 3300060353 Bacteria 3440
417 Ga0466962_0012688 3300061719 Bacteria 4053
418 Ga0466962_0017508 3300061719 Bacteria 3449
419 Ga0466962_0194663 3300061719 Bacteria 989
420 Ga0530510_0000977 3300061734 Bacteria 18901
421 2501071635 2501025501 Bacteria 7768574
422 2501081175 2501025502 Bacteria 9641094
423 2501083019 2501025502 Bacteria 9641094
424 2510247052 2510065045 Bacteria 7761063
425 2511085950 2510917013 Bacteria 9951648
426 2511091004 2510917013 Bacteria 9951648
427 2511108044 2510917015 Bacteria 7950052
428 2511388133 2511231027 Bacteria 5013807
429 2512352016 2512047030 Bacteria 9031815
430 2512352449 2512047030 Bacteria 9031815
431 2512352616 2512047030 Bacteria 9031815
432 2513554200 2513237082 Bacteria 8640282
433 2515681176 2515154122 Bacteria 8609520
434 2515685909 2515154122 Bacteria 8609520
435 2516024324 2515154189 Bacteria 9629850
436 2527077549 2526164713 Bacteria 6780608
437 2587727658 2585428057 Bacteria 6737412
438 2587733034 2585428058 Bacteria 6853932
439 2588291331 2588253510 Bacteria 6901809
440 2600810876 2600255067 Bacteria 6795583
441 2643919749 2643221582 Bacteria 5804683
442 2715501373 2713897090 Bacteria 3353799
443 2719637927 2718217991 Bacteria 7829542
444 2735816734 2734482258 Unclassified 2930739
445 2738819046 2738541296 Bacteria 7285013
446 2738830798 2738541298 Bacteria 7286732
447 2738872324 2738541306 Bacteria 7284992
448 2739183955 2738543002 Bacteria 7284546
449 2739218925 2738543008 Bacteria 7282815
450 2746087124 2744054900 Bacteria 8399525
451 2746088228 2744054900 Bacteria 8399525
452 2746089534 2744054900 Bacteria 8399525
453 2746096878 2744054901 Bacteria 8397047
454 2746098393 2744054901 Bacteria 8397047
455 2753568241 2751185846 Bacteria 7242164
456 2778179875 2775507266 Bacteria 7392367
457 2778180181 2775507266 Bacteria 7392367
458 2792837842 2791355137 Bacteria 9654227
459 2792839220 2791355137 Bacteria 9654227
460 2834580546 2834578030 Bacteria 3530182
461 2840880694 2840878972 Bacteria 5483153
462 2842779021 2842775625 Bacteria 5587290
463 2854685294 2854681122 Bacteria 4548679
464 2855021453 2855020534 Bacteria 3204685
465 2857361058 2857357740 Bacteria 9937880
466 2857361333 2857357740 Bacteria 9937880
467 2857365627 2857357740 Bacteria 9937880
468 2883087860 2883087390 Bacteria 9532701
469 2885271636 2885270888 Bacteria 9831543
470 2889916899 2889914905 Bacteria 5702301
471 2894777555 2894772417 Bacteria 5305674
472 2898798160 2898795034 Bacteria 4294459
473 2899262031 2899259804 Bacteria 3320927
474 2899277375 2899275550 Bacteria 3958688
475 2900641510 2900634093 Bacteria 10263517
476 2902685397 2902682994 Bacteria 8951596
477 2902686378 2902682994 Bacteria 8951596
478 2902687379 2902682994 Bacteria 8951596
479 2923563034 2923556063 Bacteria 6793593
480 2928028185 2928027323 Bacteria 4382488
481 2929141677 2929138655 Bacteria 5810547
482 2945937728 2945934425 Bacteria 7444609
483 2984558525 2984555340 Bacteria 4247089
484 2984567068 2984564862 Bacteria 4339992
485 2990705554 2990703756 Bacteria 7715990
486 2993358157 2993356040 Bacteria 4247105
487 2995393690 2995392953 Bacteria 4539380
488 2995396404 2995392953 Bacteria 4539380
489 3000019244 3000017691 Bacteria 3772574
490 3000019367 3000017691 Bacteria 3772574
491 3000406589 3000405567 Bacteria 3779330
492 8001846995 8001845381 Bacteria 5804942
493 8019563522 8019555841 Bacteria 9642137
494 8019573597 8019565922 Bacteria 9639779
495 8055271527 8055266321 Bacteria 7999742
496 8055272850 8055266321 Bacteria 7999742
497 8057134437 8057132660 Bacteria 4061191
498 8057134476 8057132660 Bacteria 4061191
499 Ga0400483_071358
500 JGI24740J21852_10000321
501 JGI24739J22299_10003749
502 JGI24735J21928_10000185
503 JGI24735J21928_10000536
504 JGI24738J21930_10008608
505 JGI25406J46586_10000707
506 Ga0007409J51694_1022478
507 Ga0007409J51694_1033728
508 Ga0055525_1001632
509 Ga0055540_1013687
510 Ga0065714_10068786
511 Ga0070658_10009845
512 Ga0070658_10018549
513 Ga0070658_10309121
514 Ga0070658_10459200
515 Ga0070690_100196601
516 Ga0070680_100025975
517 Ga0070675_100142125
518 Ga0070673_100348371
519 Ga0070659_100139129
520 Ga0070705_100021147
521 Ga0070663_100057164
522 Ga0070663_100119645
523 Ga0070679_100022584
524 Ga0068853_100603228
525 Ga0070665_100018494
526 Ga0070665_100587718
527 Ga0070704_100055363
528 Ga0068855_100004807
529 Ga0068855_100277965
530 Ga0068855_100458709
531 Ga0068855_100510115
532 Ga0068857_100293752
533 Ga0068856_100228370
534 Ga0068856_100259230
535 Ga0068856_100942907
536 Ga0068852_100388627
537 Ga0068859_100023328
538 Ga0068862_100025030
539 Ga0068862_100081412
540 Ga0081539_10000054
541 Ga0075428_100173706
542 Ga0075430_100059073
543 Ga0075429_100148146
544 Ga0068865_100101216
545 Ga0097620_100023328
546 Ga0105251_10000789
547 Ga0105251_10021755
548 Ga0105240_10000528
549 Ga0105240_10009265
550 Ga0105240_10167754
551 Ga0105240_10205516
552 Ga0105240_10213170
553 Ga0105240_10238803
554 Ga0105241_10073576
555 Ga0105241_10154617
556 Ga0105241_10196389
557 Ga0105241_10233552
558 Ga0105237_10032573
559 Ga0105237_10056325
560 Ga0105238_10126502
561 Ga0105238_10162234
562 Ga0105238_10250654
563 Ga0105239_10099382
564 Ga0105239_10102953
565 Ga0105239_10106923
566 Ga0105239_10191626
567 Ga0105239_10297698
568 Ga0157373_10249457
569 Ga0157371_10008332
570 Ga0157370_10023816
571 Ga0157370_10028282
572 Ga0157370_10075991
573 Ga0157370_10126782
574 Ga0157369_10000126
575 Ga0157369_10007456
576 Ga0157369_10167853
577 Ga0157372_10115275
578 Ga0157380_10137776
579 Ga0182008_10050262
580 Ga0182006_1044595
581 Ga0183363_1005
582 Ga0183361_10002
583 Ga0183361_10039
584 Ga0163161_10049491
585 Ga0163161_10226702
586 Ga0197907_10533598
587 Ga0206349_1389287
588 Ga0206350_10498766
589 Ga0206354_11162103
590 Ga0213872_10043710
591 Ga0213875_10019792
592 Ga0224712_10016383
593 Ga0209233_1029195
594 Ga0207713_1001874
595 Ga0207705_10000909
596 Ga0207705_10008134
597 Ga0207705_10409579
598 Ga0207654_10025279
599 Ga0207654_10040815
600 Ga0207654_10079946
601 Ga0207695_10001649
602 Ga0207695_10057015
603 Ga0207695_10092956
604 Ga0207695_10096687
605 Ga0207695_10098468
606 Ga0207695_10243967
607 Ga0207695_10426145
608 Ga0207671_10162637
609 Ga0207671_10187577
610 Ga0207660_10047341
611 Ga0207657_10237941
612 Ga0207649_10179012
613 Ga0207652_10008279
614 Ga0207694_10075189
615 Ga0207659_10091733
616 Ga0207690_10058112
617 Ga0207709_10224066
618 Ga0207670_10348293
619 Ga0207669_10046192
620 Ga0207711_10191826
621 Ga0207667_10005385
622 Ga0207667_10183027
623 Ga0207667_10270906
624 Ga0207667_10305436
625 Ga0207667_10727265
626 Ga0207651_10260339
627 Ga0207639_10032334
628 Ga0207678_10077300
629 Ga0207678_10217882
630 Ga0207678_10234215
631 Ga0207702_10453034
632 Ga0207648_10091050
633 Ga0207674_10063707
634 Ga0209983_1016437
635 Ga0209966_1010685
636 Ga0209966_1014767
637 Ga0209974_10039044
638 Ga0268266_10055699
639 Ga0268265_10041130
640 Ga0268265_10622831
641 Ga0265323_10004666
642 Ga0265324_10008485
643 Ga0265324_10012600
644 Ga0237817_11579
645 Ga0265330_10002470
646 Ga0265340_10000353
647 Ga0265340_10001830
648 Ga0265340_10178668
649 Ga0265339_10015108
650 Ga0265339_10130288
651 Ga0265331_10022694
652 Ga0265331_10039047
653 Ga0265316_10022994
654 Ga0265316_10032425
655 Ga0265316_10106641
656 Ga0265316_10117251
657 Ga0265316_10180089
658 Ga0307513_10116644
659 Ga0307509_10103946
660 Ga0307408_100288238
661 Ga0265313_10005546
662 Ga0265314_10040683
663 Ga0265314_10077461
664 Ga0265314_10102259
665 Ga0265342_10014194
666 Ga0316576_10008183
667 Ga0307405_10344407
668 Ga0307416_100129991
669 Ga0316593_10046868
670 Ga0373934_0184746
671 Ga0373931_0040154
672 Ga0373925_0017082
673 Ga0373925_0515301
674 Ga0395899_0000005
675 Ga0395899_0000041
676 Ga0395899_0005775
677 Ga0395900_0000077
678 Ga0395900_0000090
679 Ga0395900_0000097
680 Ga0395900_0058918
681 Ga0395900_0205411
682 Ga0395900_0903915
683 Ga0395898_0000003
684 Ga0395898_0000220
685 Ga0395898_0142502
686 Ga0395898_0545405
687 Ga0395905_0053858
688 Ga0395905_0466454
689 Ga0436364_0107567
690 Ga0436364_0210663
691 Ga0436364_0836559
692 Ga0395901_0000096
693 Ga0395901_0001807
694 Ga0395901_0032893
695 Ga0400483_038604
696 Ga0400483_074493
697 Ga0400483_167249
698 Ga0400483_213659
699 Ga0400483_264211
700 Ga0436361_0178339
701 Ga0436363_0732576
702 Ga0439453_0024531
703 Ga0451841_0799575
704 Ga0439441_005529
705 Ga0439435_0005347
706 Ga0439444_0007101
707 Ga0451577_0000186
708 Ga0451577_0007642
709 Ga0451577_0016740
710 Ga0451577_0040155
711 Ga0466969_0011145
712 Ga0466969_0017288
713 Ga0466969_0026644
714 Ga0466969_0054663
715 Ga0466972_0026427
716 Ga0466973_0015470
717 Ga0466977_0000158
718 Ga0466978_0213382
719 Ga0453683_0137708
720 Ga0466965_0000245
721 Ga0466965_0018157
722 Ga0466966_0000002
723 Ga0466966_0000033
724 Ga0466966_0049025
725 Ga0466966_0128542
726 Ga0466961_0000061
727 Ga0466961_0001363
728 Ga0466961_0034112
729 Ga0466961_0302725
730 Ga0466963_0003013
731 Ga0466963_0067160
732 Ga0466964_0002043
733 Ga0466964_0030792
734 Ga0453684_0000121
735 Ga0453684_0026586
736 Ga0466971_0038874
737 Ga0466971_0298253
738 Ga0466968_0046064
739 Ga0466970_0001731
740 Ga0466970_0111582
741 Ga0466970_0178515
742 Ga0466957_0002815
743 Ga0466957_0008605
744 Ga0466957_0034095
745 Ga0466957_0217358
746 Ga0466959_0003607
747 Ga0466959_0039385
748 Ga0466959_0140168
749 Ga0451576_0005812
750 Ga0451576_0373609
751 Ga0466958_0003344
752 Ga0466958_0004230
753 Ga0466958_0006705
754 Ga0466958_0010621
755 Ga0466958_0137250
756 Ga0466967_0920450
757 Ga0495603_0077869
758 Ga0495603_0098484
759 Ga0495590_0008310
760 Ga0495591_002588
761 Ga0495629_0222597
762 Ga0495653_0056724
763 Ga0495580_0000758
764 Ga0495580_0001122
765 Ga0495580_0143763
766 Ga0495580_0461836
767 Ga0495582_0033474
768 Ga0495582_0036064
769 Ga0495662_0077267
770 Ga0495664_0058951
771 Ga0495584_0000990
772 Ga0495585_0021023
773 Ga0495596_0026911
774 Ga0495596_0072614
775 Ga0495607_0025653
776 Ga0495606_0025424
777 Ga0495606_0222100
778 Ga0495608_0045574
779 Ga0495620_0016698
780 Ga0495628_0282080
781 Ga0495630_0001574
782 Ga0495630_0005881
783 Ga0495666_0276025
784 Ga0495652_0058906
785 Ga0495665_0000077
786 Ga0495665_0009519
787 Ga0495586_0019454
788 Ga0495586_0072438
789 Ga0495586_0108407
790 Ga0495587_0016885
791 Ga0495587_0143439
792 Ga0495621_0003484
793 Ga0495621_0010403
794 Ga0495597_0008733
795 Ga0495645_0252713
796 Ga0495622_0000544
797 Ga0495667_0126414
798 Ga0495611_0074484
799 Ga0495625_0000146
800 Ga0495625_0004613
801 Ga0495661_0135767
802 Ga0495599_0000226
803 Ga0495599_0010350
804 Ga0495599_0022952
805 Ga0495658_0060800
806 Ga0495669_0098140
807 Ga0495613_0018317
808 Ga0495624_0012093
809 Ga0495649_0325779
810 Ga0495600_0043320
811 Ga0495581_0113235
812 Ga0495674_0027440
813 Ga0495674_0187068
814 Ga0495674_0442196
815 Ga0495676_0128939
816 Ga0495683_0000642
817 Ga0495683_0060229
818 Ga0495687_018714
819 Ga0495687_049395
820 Ga0495679_019676
821 Ga0495679_045361
822 Ga0495602_0073146
823 Ga0495626_0086085
824 Ga0496100_0000078
825 Ga0496100_0005911
826 Ga0496101_0000205
827 Ga0496101_0000694
828 Ga0496102_0000165
829 Ga0496102_0001233
830 Ga0496102_0064503
831 Ga0496102_0152712
832 Ga0496102_0355612
833 Ga0496103_0000668
834 Ga0496103_0001056
835 Ga0496103_0006236
836 Ga0496103_0007741
837 Ga0496104_0008622
838 Ga0496104_0191190
839 Ga0496105_0079305
840 Ga0496105_0726330
841 Ga0496108_0225199
842 Ga0496108_0283238
843 Ga0496111_0004800
844 Ga0496112_0002697
845 Ga0496113_0027885
846 Ga0496115_0304036
847 Ga0496116_0031167
848 Ga0496116_0146352
849 Ga0496117_0000707
850 Ga0496117_0015289
851 Ga0496117_0053154
852 Ga0496118_0000283
853 Ga0496118_0002388
854 Ga0496118_0046400
855 Ga0496119_0149264
856 Ga0496121_0003158
857 Ga0496121_0076846
858 Ga0496122_0008812
859 Ga0496122_0155299
860 Ga0496123_0005833
861 Ga0496123_0064823
862 Ga0496124_0013497
863 Ga0496125_0014028
864 Ga0496125_0023533
865 Ga0496125_0261453
866 Ga0496126_0039442
867 Ga0496126_0046408
868 Ga0501318_038297
869 Ga0501032_0322739
870 Ga0501033_0003745
871 Ga0501033_0037476
872 Ga0501034_0000293
873 Ga0501034_0000874
874 Ga0501034_0001048
875 Ga0501034_0005695
876 Ga0501034_0380522
877 Ga0501038_0200717
878 Ga0501038_0414315
879 Ga0501039_0118985
880 Ga0501041_0017101
881 Ga0501043_0046207
882 Ga0501043_0231617
883 Ga0501047_0070134
884 Ga0501047_0152099
885 Ga0501047_0392940
886 Ga0501067_0049914
887 Ga0501069_0001386
888 Ga0501070_0730381
889 Ga0501071_0052012
890 Ga0501072_0013175
891 Ga0501074_0249562
892 Ga0501076_0000922
893 Ga0501077_0041392
894 Ga0501079_0024619
895 Ga0501080_0103518
896 Ga0501081_0073088
897 Ga0501083_0053381
898 Ga0501035_0070688
899 Ga0501044_0024961
900 Ga0501045_0188791
901 nmdc:mga0k408_51309_c1
902 nmdc:mga09592_321782_c1
903 nmdc:mga09592_35337_c1
904 nmdc:mga09592_606152_c1
905 nmdc:mga0qj67_107148_c1
906 nmdc:mga0qj67_306355_c1
907 nmdc:mga06r32_253526_c1
908 nmdc:mga06r32_510372_c1
909 Ga0500643_000017
910 Ga0500641_0061268
911 Ga0500658_0000012
912 Ga0500636_0210211
913 Ga0501084_0561330
914 Ga0501082_0054698
915 Ga0466962_0012688
916 Ga0466962_0017508
917 Ga0466962_0194663
918 Ga0530510_0000977
919 2501071635
920 2501081175
921 2501083019
922 2510247052
923 2511085950
924 2511091004
925 2511108044
926 2511388133
927 2512352016
928 2512352449
929 2512352616
930 2513554200
931 2515681176
932 2515685909
933 2516024324
934 2527077549
935 2587727658
936 2587733034
937 2588291331
938 2600810876
939 2643919749
940 2715501373
941 2719637927
942 2735816734
943 2738819046
944 2738830798
945 2738872324
946 2739183955
947 2739218925
948 2746087124
949 2746088228
950 2746089534
951 2746096878
952 2746098393
953 2753568241
954 2778179875
955 2778180181
956 2792837842
957 2792839220
958 2834580546
959 2840880694
960 2842779021
961 2854685294
962 2855021453
963 2857361058
964 2857361333
965 2857365627
966 2883087860
967 2885271636
968 2889916899
969 2894777555
970 2898798160
971 2899262031
972 2899277375
973 2900641510
974 2902685397
975 2902686378
976 2902687379
977 2923563034
978 2928028185
979 2929141677
980 2945937728
981 2984558525
982 2984567068
983 2990705554
984 2993358157
985 2995393690
986 2995396404
987 3000019244
988 3000019367
989 3000406589
990 8001846995
991 8019563522
992 8019573597
993 8055271527
994 8055272850
995 8057134437
996 8057134476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

50

236

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9723 1 224
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9514 1 224
2a1u-assembly1.cif.gz_B crystal structure of the human etf e165betaa mutant 0.9247 1 248
1efp-assembly2.cif.gz_D electron transfer flavoprotein (etf) from paracoccus denitrificans 0.9234 1 242
1efv-assembly1.cif.gz_B three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution 0.9216 1 248
ID Description Score Start End Superfamily
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9723 1 224 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9514 1 224 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9325 2 248 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9217 2 248 3.40.50.620
af_A4I154_9_258_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9169 1 249 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2T0QHW5-F1-model_v4 Electron transfer flavoprotein beta subunit 1.001 1 86 GO:0009055
AF-A0A3D5N4G0-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9994 1 100 GO:0009055
AF-A0A1H2PLR8-F1-model_v4 Electron transfer flavoprotein beta subunit 0.9979 1 113 GO:0009055
AF-A0A4S8F3U0-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9976 2 116 GO:0009055
AF-A0A7W6YVC3-F1-model_v4 deleted 0.9959 1 86

Map