F393264

General Info

Members Datasets Scaffolds Average Seq Length
296 217 592 73

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10003293|Ga0307508_1000329315
Length 72
Sequence LKRDIHPEYFETQVSCTCGASFTTRSTVSGNVRADICSECHPFYTGKQKILDTGGRVARFEARFGKNAGSKK

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
66 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
94 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
95 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
96 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
121 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
122 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
123 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
124 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
197 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
198 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
199 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
206 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
207 2643221641 Nocardioides sp. Root122 Isolate Unclassified
208 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
209 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
210 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
211 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
212 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
213 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
214 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
215 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
216 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
217 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.43
Metatranscriptomes 13.18
Isolates 4.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.12
Nodule 0
Rhizoplane 6.42
Rhizosphere 78.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10003293 3300031616 Bacteria 16460
2 JGI24746J21847_1045712 3300001977 Bacteria 612
3 JGI24737J22298_10153983 3300001990 Bacteria 678
4 JGI24751J29686_10121736 3300002459 Bacteria 549
5 Ga0006778J45830_1009446 3300003162 Bacteria 569
6 Ga0006759J45824_1005786 3300003163 Bacteria 600
7 JGI25406J46586_10008427 3300003203 Bacteria 4671
8 Ga0006777J48905_1019103 3300003308 Bacteria 690
9 JGI25160J50197_1029009 3300003354 Bacteria 1473
10 Ga0007429J51699_1008747 3300003579 Bacteria 1444
11 Ga0032354_1012264 3300003693 Bacteria 1057
12 Ga0058860_12178325 3300004801 Bacteria 539
13 Ga0070683_100440205 3300005329 Bacteria 1244
14 Ga0070683_100757020 3300005329 Bacteria 931
15 Ga0070682_100053449 3300005337 Bacteria 2531
16 Ga0068868_100460567 3300005338 Bacteria 1107
17 Ga0070689_100759052 3300005340 Bacteria 851
18 Ga0070687_100341967 3300005343 Bacteria 963
19 Ga0070668_100698013 3300005347 Bacteria 895
20 Ga0070659_100967616 3300005366 Bacteria 746
21 Ga0070714_101107274 3300005435 Bacteria 772
22 Ga0070663_101124113 3300005455 Bacteria 688
23 Ga0070685_11173272 3300005466 Bacteria 583
24 Ga0070706_100802086 3300005467 Bacteria 871
25 Ga0070707_100135645 3300005468 Bacteria 2394
26 Ga0070698_100298782 3300005471 Bacteria 1541
27 Ga0070684_100025778 3300005535 Bacteria 4945
28 Ga0070684_100070697 3300005535 Bacteria 3072
29 Ga0070665_101494131 3300005548 Bacteria 684
30 Ga0070664_100709089 3300005564 Bacteria 938
31 Ga0070664_100988616 3300005564 Bacteria 791
32 Ga0070664_101093560 3300005564 Bacteria 751
33 Ga0068857_100193268 3300005577 Bacteria 1854
34 Ga0068856_101526287 3300005614 Bacteria 682
35 Ga0070702_100585667 3300005615 Bacteria 834
36 Ga0068859_100613651 3300005617 Bacteria 1180
37 Ga0068861_101928148 3300005719 Bacteria 588
38 Ga0081539_10034690 3300005985 Bacteria 3045
39 Ga0075365_10928561 3300006038 Bacteria 613
40 Ga0075368_10082599 3300006042 Bacteria 1309
41 Ga0075363_100138768 3300006048 Bacteria 1367
42 Ga0075364_10316599 3300006051 Bacteria 1062
43 Ga0075364_10405374 3300006051 Bacteria 930
44 Ga0075362_10121013 3300006177 Bacteria 1239
45 Ga0075370_10015863 3300006353 Bacteria 4043
46 Ga0075370_10355419 3300006353 Bacteria 875
47 Ga0075428_100293160 3300006844 Bacteria 1750
48 Ga0075428_100345079 3300006844 Bacteria 1598
49 Ga0075434_100759013 3300006871 Bacteria 987
50 Ga0075429_100239730 3300006880 Bacteria 1588
51 Ga0097620_100613662 3300006931 Bacteria 1180
52 Ga0105245_10576949 3300009098 Bacteria 1149
53 Ga0114129_10156011 3300009147 Bacteria 3121
54 Ga0105243_10280569 3300009148 Bacteria 1500
55 Ga0105237_12546148 3300009545 Bacteria 522
56 Ga0105238_10770232 3300009551 Bacteria 977
57 Ga0105249_10391470 3300009553 Bacteria 1418
58 Ga0105239_11003159 3300010375 Bacteria 960
59 Ga0105246_10204619 3300011119 Bacteria 1537
60 Ga0157314_1033339 3300012500 Bacteria 590
61 Ga0157371_10548305 3300013102 Bacteria 857
62 Ga0157370_11272299 3300013104 Bacteria 663
63 Ga0157369_10669545 3300013105 Bacteria 1069
64 Ga0157375_11212826 3300013308 Bacteria 885
65 Ga0157375_12799994 3300013308 Bacteria 583
66 Ga0182008_10101197 3300014497 Bacteria 1424
67 Ga0157377_10107516 3300014745 Bacteria 1672
68 Ga0157379_11436631 3300014968 Bacteria 669
69 Ga0163161_10819201 3300017792 Bacteria 783
70 Ga0197907_10002146 3300020069 Bacteria 505
71 Ga0197907_11343455 3300020069 Bacteria 1418
72 Ga0197907_11383976 3300020069 Bacteria 1075
73 Ga0206356_10558516 3300020070 Bacteria 908
74 Ga0206356_10968120 3300020070 Bacteria 1389
75 Ga0206356_11296375 3300020070 Bacteria 1313
76 Ga0206349_1613634 3300020075 Bacteria 1093
77 Ga0206349_1807525 3300020075 Bacteria 1268
78 Ga0206355_1130621 3300020076 Bacteria 1822
79 Ga0206355_1502955 3300020076 Bacteria 673
80 Ga0206351_10556868 3300020077 Bacteria 1027
81 Ga0206350_10108509 3300020080 Bacteria 1231
82 Ga0206350_11321186 3300020080 Bacteria 952
83 Ga0206354_10432764 3300020081 Bacteria 3688
84 Ga0206354_10756231 3300020081 Bacteria 1267
85 Ga0206354_11460497 3300020081 Bacteria 800
86 Ga0206353_10140062 3300020082 Bacteria 596
87 Ga0206353_10543014 3300020082 Bacteria 1184
88 Ga0206353_10827258 3300020082 Bacteria 1283
89 Ga0206353_11359602 3300020082 Bacteria 3220
90 Ga0206353_11620169 3300020082 Bacteria 518
91 Ga0154015_1456046 3300020610 Bacteria 1153
92 Ga0224712_10000851 3300022467 Bacteria 6517
93 Ga0224712_10248146 3300022467 Bacteria 822
94 Ga0224712_10266616 3300022467 Bacteria 794
95 Ga0224712_10306001 3300022467 Bacteria 744
96 Ga0207426_1004031 3300025302 Bacteria 7441
97 Ga0207710_10624084 3300025900 Bacteria 564
98 Ga0207699_10544565 3300025906 Bacteria 841
99 Ga0207684_10906540 3300025910 Bacteria 741
100 Ga0207693_10767619 3300025915 Bacteria 744
101 Ga0207663_11093621 3300025916 Bacteria 641
102 Ga0207662_10447861 3300025918 Bacteria 882
103 Ga0207687_10462438 3300025927 Bacteria 1054
104 Ga0207700_10401007 3300025928 Bacteria 1202
105 Ga0207664_10745054 3300025929 Bacteria 881
106 Ga0207669_10211279 3300025937 Bacteria 1417
107 Ga0207661_10112472 3300025944 Bacteria 2305
108 Ga0207661_10330080 3300025944 Bacteria 1373
109 Ga0207661_10843701 3300025944 Bacteria 843
110 Ga0207661_11183470 3300025944 Bacteria 703
111 Ga0207679_10600139 3300025945 Bacteria 992
112 Ga0207679_11738906 3300025945 Bacteria 570
113 Ga0207712_10421330 3300025961 Bacteria 1126
114 Ga0207668_11859767 3300025972 Bacteria 543
115 Ga0207640_11362301 3300025981 Bacteria 635
116 Ga0207678_10407490 3300026067 Bacteria 1178
117 Ga0207702_10223651 3300026078 Bacteria 1755
118 Ga0207702_11170154 3300026078 Bacteria 763
119 Ga0207674_10382337 3300026116 Bacteria 1361
120 Ga0209983_1154156 3300027665 Bacteria 527
121 Ga0209974_10031163 3300027876 Bacteria 1765
122 Ga0316179_1037089 3300030734 Bacteria 2196
123 Ga0316183_1090040 3300030742 Bacteria 1113
124 Ga0316181_1176788 3300030744 Bacteria 989
125 Ga0316181_1292971 3300030744 Bacteria 744
126 Ga0316182_1114849 3300030745 Bacteria 793
127 Ga0307405_10533454 3300031731 Bacteria 947
128 Ga0307405_12102903 3300031731 Bacteria 507
129 Ga0307413_11185945 3300031824 Bacteria 663
130 Ga0307410_10130782 3300031852 Bacteria 1844
131 Ga0307410_10549108 3300031852 Bacteria 957
132 Ga0307410_11987153 3300031852 Bacteria 519
133 Ga0326468_10038166 3300031889 Bacteria 673
134 Ga0307406_10302990 3300031901 Bacteria 1229
135 Ga0307407_10947598 3300031903 Bacteria 663
136 Ga0307409_100182589 3300031995 Bacteria 1859
137 Ga0307409_100275382 3300031995 Bacteria 1552
138 Ga0307416_101639802 3300032002 Bacteria 748
139 Ga0307416_103015600 3300032002 Bacteria 563
140 Ga0307411_12002443 3300032005 Bacteria 541
141 Ga0307411_12016758 3300032005 Bacteria 539
142 Ga0307415_100647380 3300032126 Bacteria 947
143 Ga0307415_100662251 3300032126 Bacteria 937
144 Ga0307415_101580444 3300032126 Bacteria 629
145 Ga0316593_10268462 3300032168 Bacteria 641
146 Ga0307507_10000001 3300033179 Bacteria 417520
147 Ga0373949_0176505 3300035090 Bacteria 631
148 Ga0373942_0031938 3300035207 Bacteria 1396
149 Ga0373961_0344002 3300035241 Bacteria 561
150 Ga0373931_0869508 3300035691 Bacteria 604
151 Ga0373937_1676395 3300036401 Bacteria 583
152 Ga0373925_0475475 3300037068 Bacteria 1025
153 Ga0395899_0534415 3300037312 Bacteria 756
154 Ga0395900_0010768 3300037418 Bacteria 9355
155 Ga0395900_0462579 3300037418 Bacteria 1223
156 Ga0395898_0041654 3300037466 Bacteria 4535
157 Ga0395898_0282559 3300037466 Bacteria 1583
158 Ga0436364_0789007 3300037853 Bacteria 1015
159 Ga0395901_0143970 3300038443 Bacteria 2505
160 Ga0395901_0337650 3300038443 Bacteria 1557
161 Ga0395901_1196009 3300038443 Bacteria 726
162 Ga0400488_23132 3300038741 Bacteria 14813
163 Ga0242420_019163 3300038996 Bacteria 1210
164 Ga0451797_0578273 3300041453 Bacteria 543
165 Ga0451800_0044868 3300041459 Bacteria 587
166 Ga0439458_0125511 3300042157 Bacteria 678
167 Ga0466972_0032299 3300044658 Bacteria 2571
168 Ga0466965_0010700 3300044683 Bacteria 4287
169 Ga0466965_0013886 3300044683 Bacteria 3806
170 Ga0466961_0291802 3300044693 Bacteria 997
171 Ga0466961_0843174 3300044693 Bacteria 546
172 Ga0466964_0881760 3300044706 Bacteria 511
173 Ga0466971_0060988 3300044719 Bacteria 1705
174 Ga0466971_0213625 3300044719 Bacteria 913
175 Ga0466968_0074536 3300044735 Bacteria 1482
176 Ga0466970_0019503 3300044765 Bacteria 3516
177 Ga0466970_0024596 3300044765 Bacteria 3150
178 Ga0466970_0844213 3300044765 Bacteria 537
179 Ga0466957_0001681 3300044842 Bacteria 11626
180 Ga0466957_0053651 3300044842 Bacteria 2458
181 Ga0466957_0142579 3300044842 Bacteria 1544
182 Ga0466960_0278462 3300044901 Bacteria 937
183 Ga0466960_0615916 3300044901 Bacteria 645
184 Ga0466959_0059006 3300045049 Bacteria 2795
185 Ga0466958_0024794 3300045836 Bacteria 3530
186 Ga0466967_0005579 3300045976 Bacteria 8745
187 Ga0466967_0239544 3300045976 Bacteria 1730
188 Ga0466967_1185349 3300045976 Bacteria 761
189 Ga0466967_2098548 3300045976 Bacteria 561
190 Ga0495630_0880907 3300046517 Bacteria 682
191 Ga0495676_0392003 3300047321 Bacteria 923
192 Ga0495602_0985592 3300048088 Bacteria 557
193 Ga0496100_0083745 3300048903 Bacteria 2160
194 Ga0496100_0835359 3300048903 Bacteria 722
195 Ga0496101_0084697 3300048904 Bacteria 2348
196 Ga0496102_0138922 3300048905 Bacteria 2277
197 Ga0496103_0113589 3300048906 Bacteria 1721
198 Ga0496105_0486448 3300048908 Bacteria 970
199 Ga0496106_0018995 3300048909 Bacteria 5094
200 Ga0496107_0090810 3300048910 Bacteria 2231
201 Ga0496107_0381001 3300048910 Bacteria 1049
202 Ga0496108_0343404 3300048911 Bacteria 1302
203 Ga0496109_0232484 3300048912 Bacteria 1734
204 Ga0496110_0061112 3300048913 Bacteria 3324
205 Ga0496111_0083126 3300048914 Bacteria 2339
206 Ga0496112_0322877 3300048915 Bacteria 1488
207 Ga0496113_1261922 3300048916 Bacteria 575
208 Ga0496114_0210975 3300048917 Bacteria 1703
209 Ga0496115_0717017 3300048918 Bacteria 785
210 Ga0496118_0028903 3300048921 Bacteria 4660
211 Ga0496119_0142917 3300048922 Bacteria 1290
212 Ga0496122_0000649 3300048925 Bacteria 70427
213 Ga0496123_0001992 3300048926 Bacteria 26411
214 Ga0496124_0000985 3300048927 Bacteria 45202
215 Ga0496125_0001181 3300048928 Bacteria 39507
216 Ga0501310_000002 3300049130 Bacteria 24441
217 Ga0501317_011236 3300049533 Bacteria 1085
218 Ga0501324_041104 3300049540 Bacteria 528
219 Ga0501031_0097498 3300049568 Bacteria 1919
220 Ga0501032_0155152 3300049569 Bacteria 1504
221 Ga0501032_0376623 3300049569 Bacteria 913
222 Ga0501033_0009940 3300049570 Bacteria 7304
223 Ga0501034_0116064 3300049571 Bacteria 2665
224 Ga0501034_0348638 3300049571 Bacteria 1409
225 Ga0501034_0895170 3300049571 Bacteria 776
226 Ga0501036_0031492 3300049572 Bacteria 4482
227 Ga0501036_0825614 3300049572 Bacteria 763
228 Ga0501040_0730231 3300049576 Bacteria 716
229 Ga0501043_0245382 3300049579 Bacteria 1380
230 Ga0501043_0469765 3300049579 Bacteria 943
231 Ga0501043_1241836 3300049579 Bacteria 522
232 Ga0501046_0003930 3300049580 Bacteria 13592
233 Ga0501046_0203639 3300049580 Bacteria 1472
234 Ga0501046_0913018 3300049580 Bacteria 612
235 Ga0501047_0000031 3300049581 Bacteria 215903
236 Ga0501067_0272298 3300049583 Bacteria 943
237 Ga0501067_0353165 3300049583 Bacteria 820
238 Ga0501067_0580071 3300049583 Bacteria 628
239 Ga0501068_0836758 3300049584 Bacteria 604
240 Ga0501069_0235185 3300049585 Bacteria 1067
241 Ga0501069_0883353 3300049585 Bacteria 543
242 Ga0501070_0168961 3300049586 Bacteria 1802
243 Ga0501074_0451983 3300049590 Bacteria 911
244 Ga0501075_0123483 3300049591 Bacteria 1971
245 Ga0501076_0607851 3300049592 Bacteria 902
246 Ga0501081_0570686 3300049743 Bacteria 846
247 Ga0501081_0739733 3300049743 Bacteria 739
248 Ga0501081_0815450 3300049743 Bacteria 703
249 Ga0501035_0053743 3300049822 Bacteria 3601
250 Ga0501035_0119434 3300049822 Bacteria 2305
251 Ga0501035_0312002 3300049822 Bacteria 1323
252 Ga0501035_0861633 3300049822 Bacteria 720
253 Ga0501044_0010470 3300049823 Bacteria 10063
254 Ga0501044_0311053 3300049823 Bacteria 1502
255 nmdc:mga03683_163867_c1 3300050489 Bacteria 1008
256 nmdc:mga00v17_218085_c2 3300050491 Bacteria 892
257 nmdc:mga00v17_400625_c1 3300050491 Bacteria 892
258 nmdc:mga00v17_509464_c1 3300050491 Bacteria 780
259 nmdc:mga00v17_539505_c1 3300050491 Bacteria 755
260 nmdc:mga0yw44_224798_c1 3300050492 Bacteria 1245
261 nmdc:mga0yw44_838240_c1 3300050492 Bacteria 624
262 nmdc:mga06z11_674291_c1 3300050494 Bacteria 630
263 nmdc:mga07m45_30877_c1 3300050496 Bacteria 2969
264 nmdc:mga06r32_459480_c1 3300050510 Bacteria 1252
265 nmdc:mga08y16_1398314_c1 3300050511 Bacteria 663
266 nmdc:mga08y16_1548051_c1 3300050511 Bacteria 622
267 nmdc:mga0n895_1075702_c1 3300050512 Bacteria 782
268 Ga0495595_0423432 3300053084 Bacteria 676
269 Ga0500566_0203357 3300053094 Bacteria 998
270 Ga0500556_0000284 3300053104 Bacteria 39641
271 Ga0500593_002613 3300053117 Bacteria 6648
272 Ga0500568_0006111 3300053139 Bacteria 6103
273 Ga0500568_0116505 3300053139 Bacteria 997
274 Ga0500620_142710 3300053155 Bacteria 836
275 Ga0500624_051229 3300053157 Bacteria 768
276 Ga0500637_0114841 3300053178 Bacteria 1562
277 Ga0587088_068184 3300059508 Bacteria 736
278 Ga0587090_173726 3300059510 Bacteria 501
279 Ga0587079_102929 3300059647 Bacteria 684
280 Ga0501082_1701464 3300060353 Bacteria 550
281 Ga0466962_0060447 3300061719 Bacteria 1809
282 Ga0466962_0409514 3300061719 Bacteria 679
283 Ga0530510_0093551 3300061734 Bacteria 2195
284 2643850935 2643221567 Bacteria 4163945
285 2644134675 2643221624 Bacteria 4384879
286 2644230721 2643221641 Bacteria 4490190
287 2768643045 2767802112 Bacteria 6465194
288 2812478779 2811994917 Bacteria 7761064
289 2855390674 2855386786 Bacteria 4752232
290 2862512703 2862507626 Bacteria 9425308
291 2912717640 2912715099 Bacteria 9460473
292 2912762723 2912757875 Bacteria 7940295
293 8008577193 8008574985 Bacteria 7815457
294 8025480765 8025478263 Bacteria 8209203
295 8025531342 8025530807 Bacteria 8495698
296 8056832174 8056829672 Bacteria 9045328
297 Ga0307508_10003293
298 JGI24746J21847_1045712
299 JGI24737J22298_10153983
300 JGI24751J29686_10121736
301 Ga0006778J45830_1009446
302 Ga0006759J45824_1005786
303 JGI25406J46586_10008427
304 Ga0006777J48905_1019103
305 JGI25160J50197_1029009
306 Ga0007429J51699_1008747
307 Ga0032354_1012264
308 Ga0058860_12178325
309 Ga0070683_100440205
310 Ga0070683_100757020
311 Ga0070682_100053449
312 Ga0068868_100460567
313 Ga0070689_100759052
314 Ga0070687_100341967
315 Ga0070668_100698013
316 Ga0070659_100967616
317 Ga0070714_101107274
318 Ga0070663_101124113
319 Ga0070685_11173272
320 Ga0070706_100802086
321 Ga0070707_100135645
322 Ga0070698_100298782
323 Ga0070684_100025778
324 Ga0070684_100070697
325 Ga0070665_101494131
326 Ga0070664_100709089
327 Ga0070664_100988616
328 Ga0070664_101093560
329 Ga0068857_100193268
330 Ga0068856_101526287
331 Ga0070702_100585667
332 Ga0068859_100613651
333 Ga0068861_101928148
334 Ga0081539_10034690
335 Ga0075365_10928561
336 Ga0075368_10082599
337 Ga0075363_100138768
338 Ga0075364_10316599
339 Ga0075364_10405374
340 Ga0075362_10121013
341 Ga0075370_10015863
342 Ga0075370_10355419
343 Ga0075428_100293160
344 Ga0075428_100345079
345 Ga0075434_100759013
346 Ga0075429_100239730
347 Ga0097620_100613662
348 Ga0105245_10576949
349 Ga0114129_10156011
350 Ga0105243_10280569
351 Ga0105237_12546148
352 Ga0105238_10770232
353 Ga0105249_10391470
354 Ga0105239_11003159
355 Ga0105246_10204619
356 Ga0157314_1033339
357 Ga0157371_10548305
358 Ga0157370_11272299
359 Ga0157369_10669545
360 Ga0157375_11212826
361 Ga0157375_12799994
362 Ga0182008_10101197
363 Ga0157377_10107516
364 Ga0157379_11436631
365 Ga0163161_10819201
366 Ga0197907_10002146
367 Ga0197907_11343455
368 Ga0197907_11383976
369 Ga0206356_10558516
370 Ga0206356_10968120
371 Ga0206356_11296375
372 Ga0206349_1613634
373 Ga0206349_1807525
374 Ga0206355_1130621
375 Ga0206355_1502955
376 Ga0206351_10556868
377 Ga0206350_10108509
378 Ga0206350_11321186
379 Ga0206354_10432764
380 Ga0206354_10756231
381 Ga0206354_11460497
382 Ga0206353_10140062
383 Ga0206353_10543014
384 Ga0206353_10827258
385 Ga0206353_11359602
386 Ga0206353_11620169
387 Ga0154015_1456046
388 Ga0224712_10000851
389 Ga0224712_10248146
390 Ga0224712_10266616
391 Ga0224712_10306001
392 Ga0207426_1004031
393 Ga0207710_10624084
394 Ga0207699_10544565
395 Ga0207684_10906540
396 Ga0207693_10767619
397 Ga0207663_11093621
398 Ga0207662_10447861
399 Ga0207687_10462438
400 Ga0207700_10401007
401 Ga0207664_10745054
402 Ga0207669_10211279
403 Ga0207661_10112472
404 Ga0207661_10330080
405 Ga0207661_10843701
406 Ga0207661_11183470
407 Ga0207679_10600139
408 Ga0207679_11738906
409 Ga0207712_10421330
410 Ga0207668_11859767
411 Ga0207640_11362301
412 Ga0207678_10407490
413 Ga0207702_10223651
414 Ga0207702_11170154
415 Ga0207674_10382337
416 Ga0209983_1154156
417 Ga0209974_10031163
418 Ga0316179_1037089
419 Ga0316183_1090040
420 Ga0316181_1176788
421 Ga0316181_1292971
422 Ga0316182_1114849
423 Ga0307405_10533454
424 Ga0307405_12102903
425 Ga0307413_11185945
426 Ga0307410_10130782
427 Ga0307410_10549108
428 Ga0307410_11987153
429 Ga0326468_10038166
430 Ga0307406_10302990
431 Ga0307407_10947598
432 Ga0307409_100182589
433 Ga0307409_100275382
434 Ga0307416_101639802
435 Ga0307416_103015600
436 Ga0307411_12002443
437 Ga0307411_12016758
438 Ga0307415_100647380
439 Ga0307415_100662251
440 Ga0307415_101580444
441 Ga0316593_10268462
442 Ga0307507_10000001
443 Ga0373949_0176505
444 Ga0373942_0031938
445 Ga0373961_0344002
446 Ga0373931_0869508
447 Ga0373937_1676395
448 Ga0373925_0475475
449 Ga0395899_0534415
450 Ga0395900_0010768
451 Ga0395900_0462579
452 Ga0395898_0041654
453 Ga0395898_0282559
454 Ga0436364_0789007
455 Ga0395901_0143970
456 Ga0395901_0337650
457 Ga0395901_1196009
458 Ga0400488_23132
459 Ga0242420_019163
460 Ga0451797_0578273
461 Ga0451800_0044868
462 Ga0439458_0125511
463 Ga0466972_0032299
464 Ga0466965_0010700
465 Ga0466965_0013886
466 Ga0466961_0291802
467 Ga0466961_0843174
468 Ga0466964_0881760
469 Ga0466971_0060988
470 Ga0466971_0213625
471 Ga0466968_0074536
472 Ga0466970_0019503
473 Ga0466970_0024596
474 Ga0466970_0844213
475 Ga0466957_0001681
476 Ga0466957_0053651
477 Ga0466957_0142579
478 Ga0466960_0278462
479 Ga0466960_0615916
480 Ga0466959_0059006
481 Ga0466958_0024794
482 Ga0466967_0005579
483 Ga0466967_0239544
484 Ga0466967_1185349
485 Ga0466967_2098548
486 Ga0495630_0880907
487 Ga0495676_0392003
488 Ga0495602_0985592
489 Ga0496100_0083745
490 Ga0496100_0835359
491 Ga0496101_0084697
492 Ga0496102_0138922
493 Ga0496103_0113589
494 Ga0496105_0486448
495 Ga0496106_0018995
496 Ga0496107_0090810
497 Ga0496107_0381001
498 Ga0496108_0343404
499 Ga0496109_0232484
500 Ga0496110_0061112
501 Ga0496111_0083126
502 Ga0496112_0322877
503 Ga0496113_1261922
504 Ga0496114_0210975
505 Ga0496115_0717017
506 Ga0496118_0028903
507 Ga0496119_0142917
508 Ga0496122_0000649
509 Ga0496123_0001992
510 Ga0496124_0000985
511 Ga0496125_0001181
512 Ga0501310_000002
513 Ga0501317_011236
514 Ga0501324_041104
515 Ga0501031_0097498
516 Ga0501032_0155152
517 Ga0501032_0376623
518 Ga0501033_0009940
519 Ga0501034_0116064
520 Ga0501034_0348638
521 Ga0501034_0895170
522 Ga0501036_0031492
523 Ga0501036_0825614
524 Ga0501040_0730231
525 Ga0501043_0245382
526 Ga0501043_0469765
527 Ga0501043_1241836
528 Ga0501046_0003930
529 Ga0501046_0203639
530 Ga0501046_0913018
531 Ga0501047_0000031
532 Ga0501067_0272298
533 Ga0501067_0353165
534 Ga0501067_0580071
535 Ga0501068_0836758
536 Ga0501069_0235185
537 Ga0501069_0883353
538 Ga0501070_0168961
539 Ga0501074_0451983
540 Ga0501075_0123483
541 Ga0501076_0607851
542 Ga0501081_0570686
543 Ga0501081_0739733
544 Ga0501081_0815450
545 Ga0501035_0053743
546 Ga0501035_0119434
547 Ga0501035_0312002
548 Ga0501035_0861633
549 Ga0501044_0010470
550 Ga0501044_0311053
551 nmdc:mga03683_163867_c1
552 nmdc:mga00v17_218085_c2
553 nmdc:mga00v17_400625_c1
554 nmdc:mga00v17_509464_c1
555 nmdc:mga00v17_539505_c1
556 nmdc:mga0yw44_224798_c1
557 nmdc:mga0yw44_838240_c1
558 nmdc:mga06z11_674291_c1
559 nmdc:mga07m45_30877_c1
560 nmdc:mga06r32_459480_c1
561 nmdc:mga08y16_1398314_c1
562 nmdc:mga08y16_1548051_c1
563 nmdc:mga0n895_1075702_c1
564 Ga0495595_0423432
565 Ga0500566_0203357
566 Ga0500556_0000284
567 Ga0500593_002613
568 Ga0500568_0006111
569 Ga0500568_0116505
570 Ga0500620_142710
571 Ga0500624_051229
572 Ga0500637_0114841
573 Ga0587088_068184
574 Ga0587090_173726
575 Ga0587079_102929
576 Ga0501082_1701464
577 Ga0466962_0060447
578 Ga0466962_0409514
579 Ga0530510_0093551
580 2643850935
581 2644134675
582 2644230721
583 2768643045
584 2812478779
585 2855390674
586 2862512703
587 2912717640
588 2912762723
589 8008577193
590 8025480765
591 8025531342
592 8056832174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01197

Ribosomal_L31

Ribosomal protein L31

1

65

0.98

Map