F497234

General Info

Members Datasets Scaffolds Average Seq Length
3146 1040 2083 364

Family's Representative Sequence

Representative Sequence 3300042006|Ga0439432_004689|Ga0439432_004689_3216_4499
Length 427
Sequence MNHCGEGIYPRWAAKRPLQFYLKTPYSGFATASQPSGDKSPRHKVQVHRAFVLLNKKKGVVPMKMFGRTLLTLSLMGAMVMGAQANDKVLRVYNWSDYIAPDTVKKFEDETGIRVTYDVFDSNETLEARLLAGKSGYDIVVPSNSFLAKQIKAGVYQPLDKSKLPNWKNLNPVLLKNASASDPDNAHAFPYMWGSIGIGFNPAKVKEVLGANAPTNSWDLLFKPENAEKLKACGISFLDSPTEMLPAALHYLGYPVNDKDKAHIAEAEALFMKIRPYVAYFHSSKYISDLANGNICVAVGYSGDVLQAKARAVESGNNVVIDYSIPKEGAGSFYDMVAIPRDAANVDNAYLFMDFLMRPDIIAEVTNSIGYSNANAAATPLVDEAIRNEPGSYPSQAVMATLYAVPDQPIATQRIMTRGWTRVKLGK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
4 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
5 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
6 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
7 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
8 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
9 2511231004 Pseudomonas sp. GM102 Isolate Nodule
10 2511231006 Pseudomonas sp. GM17 Isolate Nodule
11 2511231007 Pseudomonas sp. GM18 Isolate Nodule
12 2511231008 Pseudomonas sp. GM21 Isolate Nodule
13 2511231010 Pseudomonas sp. GM25 Isolate Nodule
14 2511231011 Pseudomonas sp. GM30 Isolate Nodule
15 2511231012 Pseudomonas sp. GM33 Isolate Nodule
16 2511231014 Pseudomonas sp. GM48 Isolate Nodule
17 2511231015 Pseudomonas sp. GM49 Isolate Nodule
18 2511231016 Pseudomonas sp. GM50 Isolate Nodule
19 2511231017 Pseudomonas sp. GM55 Isolate Nodule
20 2511231018 Pseudomonas sp. GM60 Isolate Nodule
21 2511231019 Pseudomonas sp. GM67 Isolate Nodule
22 2511231020 Pseudomonas sp. GM74 Isolate Nodule
23 2511231021 Pseudomonas sp. GM78 Isolate Nodule
24 2511231022 Pseudomonas sp. GM79 Isolate Nodule
25 2511231023 Pseudomonas sp. GM80 Isolate Nodule
26 2511231024 Pseudomonas sp. GM84 Isolate Nodule
27 2511231031 Pseudomonas sp. GM16 Isolate Nodule
28 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
29 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
30 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
31 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
32 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
33 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
34 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
35 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
36 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
37 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
38 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
39 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
40 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
41 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
42 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
43 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
44 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
45 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
46 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
47 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
48 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
49 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
50 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
51 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
52 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
53 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
54 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
55 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
56 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
57 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
58 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
59 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
60 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
61 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
62 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
63 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
64 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
65 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
66 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
67 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
68 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
69 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
70 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
71 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
72 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
73 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
74 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
75 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
76 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
77 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
78 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
79 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
80 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
81 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
82 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
83 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
84 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
85 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
86 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
87 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
88 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
89 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
90 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
91 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
92 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
93 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
94 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
95 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
96 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
97 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
98 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
99 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
100 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
101 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
102 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
103 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
104 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
105 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
106 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
107 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
108 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
109 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
110 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
111 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
112 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
113 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
114 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
115 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
116 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
117 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
118 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
119 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
120 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
121 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
122 2643221569 Achromobacter sp. Root565 Isolate Unclassified
123 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
124 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
125 2643221594 Achromobacter sp. Root170 Isolate Unclassified
126 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
127 2643221621 Achromobacter sp. Root83 Isolate Unclassified
128 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
129 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
130 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
131 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
132 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
133 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
134 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
135 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
136 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
137 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
138 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
139 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
140 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
141 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
142 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
143 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
144 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
145 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
146 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
147 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
148 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
149 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
150 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
151 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
152 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
153 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
154 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
155 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
156 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
157 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
158 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
159 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
160 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
161 2765235841 Pseudomonas putida AA7 Isolate Unclassified
162 2773857670 Pseudomonas sp. 478 Isolate Unclassified
163 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
164 2773857673 Pseudomonas sp. 443 Isolate Unclassified
165 2784132063 Pseudomonas sp. 424 Isolate Unclassified
166 2784132072 Pseudomonas sp. 460 Isolate Unclassified
167 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
168 2791355199
169 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
170 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
171 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
172 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
173 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
174 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
175 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
176 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
177 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
178 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
179 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
180 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
181 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
182 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
183 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
184 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
185 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
186 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
187 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
188 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
189 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
190 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
191 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
192 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
193 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
194 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
195 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
196 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
197 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
198 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
199 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
200 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
201 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
202 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
203 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
204 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
205 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
206 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
207 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
208 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
209 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
210 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
211 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
212 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
213 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
214 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
215 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
216 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
217 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
218 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
219 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
220 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
221 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
222 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
223 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
224 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
225 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
226 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
227 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
228 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
229 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
230 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
231 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
232 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
233 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
234 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
235 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
236 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
237 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
238 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
239 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
240 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
241 2855730933 Achromobacter sp. HZ28 Isolate Nodule
242 2855767633 Achromobacter sp. HZ34 Isolate Nodule
243 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
244 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
245 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
246 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
247 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
248 2858950400 Achromobacter sp. K91 Isolate Unclassified
249 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
250 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
251 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
252 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
253 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
254 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
255 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
256 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
257 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
258 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
259 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
260 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
261 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
262 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
263 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
264 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
265 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
266 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
267 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
268 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
269 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
270 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
271 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
272 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
273 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
274 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
275 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
276 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
277 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
278 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
279 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
280 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
281 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
282 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
283 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
284 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
285 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
286 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
287 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
288 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
289 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
290 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
291 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
292 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
293 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
294 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
295 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
296 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
297 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
298 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
299 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
300 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
301 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
302 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
303 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
304 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
305 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
306 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
307 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
308 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
309 2922368715
310 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
311 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
312 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
313 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
314 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
315 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
316 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
317 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
318 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
319 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
320 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
321 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
322 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
323 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
324 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
325 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
326 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
327 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
328 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
329 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
330 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
331 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
332 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
333 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
334 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
335 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
336 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
337 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
338 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
339 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
340 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
341 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
342 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
343 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
344 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
345 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
346 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
347 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
348 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
349 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
350 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
351 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
352 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
353 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
354 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
355 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
356 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
357 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
358 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
359 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
360 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
361 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
362 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
363 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
364 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
365 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
366 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
367 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
368 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
369 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
370 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
371 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
372 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
373 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
374 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
375 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
376 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
377 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
378 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
379 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
380 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
381 2941479691
382 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
383 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
384 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
385 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
386 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
387 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
388 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
389 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
390 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
391 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
392 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
393 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
394 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
395 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
396 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
397 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
398 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
399 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
400 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
401 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
402 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
403 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
404 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
405 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
406 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
407 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
408 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
409 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
410 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
411 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
412 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
413 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
414 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
415 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
416 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
417 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
418 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
419 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
420 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
421 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
422 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
423 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
424 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
425 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
426 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
427 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
428 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
429 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
430 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
431 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
432 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
433 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
434 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
435 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
436 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
437 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
438 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
439 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
440 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
441 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
442 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
443 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
444 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
445 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
446 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
447 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
448 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
449 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
450 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
451 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
452 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
453 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
454 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
455 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
456 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
457 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
458 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
459 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
460 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
461 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
462 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
463 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
464 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
465 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
466 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
467 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
468 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
469 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
470 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
471 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
472 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
473 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
474 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
475 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
476 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
477 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
478 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
479 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
480 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
481 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
482 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
483 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
484 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
485 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
486 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
487 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
488 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
489 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
490 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
491 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
492 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
493 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
494 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
495 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
496 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
497 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
498 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
499 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
500 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
501 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
502 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
503 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
504 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
505 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
506 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
507 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
508 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
509 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
510 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
511 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
512 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
513 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
514 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
515 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
516 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
517 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
518 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
519 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
520 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
521 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
522 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
523 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
524 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
525 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
526 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
527 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
528 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
529 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
530 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
531 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
532 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
533 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
534 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
535 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
536 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
537 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
538 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
539 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
540 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
541 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
542 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
543 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
544 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
545 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
546 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
547 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
548 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
549 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
550 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
551 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
552 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
553 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
554 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
555 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
556 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
557 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
558 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
559 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
560 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
561 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
562 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
563 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
564 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
565 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
566 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
567 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
568 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
569 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
570 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
571 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
572 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
573 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
574 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
575 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
576 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
577 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
578 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
579 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
580 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
581 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
582 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
583 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
584 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
585 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
586 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
587 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
588 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
589 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
590 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
591 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
592 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
593 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
636 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
637 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
638 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
641 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
642 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
643 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
644 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
645 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
646 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
647 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
648 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
649 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
650 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
651 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
652 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
653 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
654 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
655 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
656 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
657 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
658 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
659 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
660 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
661 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
662 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
663 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
664 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
665 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
666 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
667 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
668 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
669 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
670 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
671 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
672 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
673 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
674 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
675 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
676 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
677 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
678 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
679 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
680 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
681 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
682 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
683 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
684 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
685 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
686 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
687 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
688 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
689 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
690 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
691 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
692 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
693 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
694 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
695 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
696 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
697 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
698 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
699 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
700 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
701 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
702 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
703 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
704 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
705 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
706 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
707 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
708 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
709 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
710 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
711 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
712 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
713 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
714 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
715 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
716 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
717 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
718 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
719 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
720 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
721 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
722 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
723 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
724 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
725 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
726 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
727 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
728 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
729 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
730 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
731 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
732 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
733 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
734 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
735 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
736 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
737 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
738 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
739 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
740 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
741 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
742 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
743 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
744 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
745 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
746 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
747 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
748 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
749 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
750 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
751 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
752 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
753 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
754 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
755 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
756 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
757 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
758 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
759 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
760 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
761 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
762 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
763 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
764 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
765 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
766 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
767 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
768 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
769 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
770 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
771 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
772 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
773 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
774 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
775 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
776 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
777 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
778 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
779 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
780 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
781 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
782 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
783 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
784 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
785 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
786 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
787 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
788 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
789 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
790 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
791 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
792 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
793 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
794 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
795 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
796 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
797 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
798 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
799 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
800 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
801 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
802 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
803 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
804 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
805 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
806 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
807 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
808 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
809 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
810 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
811 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
812 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
813 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
814 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
815 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
816 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
817 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
818 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
819 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
820 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
821 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
822 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
823 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
824 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
825 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
826 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
827 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
828 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
829 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
830 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
831 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
832 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
833 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
834 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
835 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
836 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
837 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
838 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
839 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
840 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
841 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
842 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
843 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
844 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
845 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
846 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
847 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
848 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
849 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
850 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
851 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
852 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
853 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
854 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
855 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
856 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
857 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
858 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
859 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
860 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
861 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
862 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
863 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
864 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
865 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
866 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
867 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
868 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
869 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
870 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
871 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
872 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
873 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
874 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
875 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
876 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
877 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
878 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
879 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
880 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
881 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
882 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
883 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
884 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
885 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
886 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
887 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
888 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
889 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
890 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
891 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
892 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
893 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
894 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
895 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
896 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
897 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
898 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
899 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
900 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
901 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
902 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
903 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
904 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
905 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
906 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
907 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
908 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
909 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
910 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
911 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
912 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
913 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
914 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
915 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
916 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
917 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
918 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
919 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
920 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
921 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
922 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
923 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
924 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
925 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
926 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
927 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
928 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
929 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
930 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
931 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
932 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
933 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
934 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
935 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
936 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
937 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
938 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
939 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
940 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
941 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
942 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
943 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
944 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
945 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
946 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
947 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
948 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
949 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
950 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
951 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
952 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
953 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
954 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
955 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
956 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
957 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
958 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
959 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
960 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
961 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
962 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
963 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
964 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
965 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
966 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
967 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
968 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
969 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
970 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
971 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
972 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
973 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
974 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
975 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
976 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
977 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
978 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
979 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
980 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
981 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
982 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
983 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
984 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
985 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
986 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
987 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
988 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
989 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
990 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
991 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
992 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
993 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
994 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
995 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
996 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
997 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
998 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
999 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1000 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1001 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1002 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1003 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1004 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1005 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1006 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1007 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1008 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1009 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1010 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
1011 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1012 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
1013 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
1014 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
1015 8052494512 Pseudomonas putida LD6 Isolate Unclassified
1016 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
1017 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
1018 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
1019 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
1020 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1021 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
1022 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
1023 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
1024 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
1025 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
1026 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1027 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
1028 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
1029 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
1030 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
1031 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1032 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
1033 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
1034 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
1035 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1036 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1037 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1038 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1039 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1040 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.81
Metatranscriptomes 0.06
Isolates 25.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.06
Bulb 0
Endosphere 9.19
Nodule 7.15
Rhizoplane 5.75
Rhizosphere 64.72
Stem 0
Stem Tuber 0
Unclassified 13.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_136 2124908027 Bacteria 16261
2 MRS2a_Contig_269 2124908027 Bacteria 3148
3 SwRhRL2b_contig_180730 2162886007 Bacteria 3385
4 SwRhRL2b_contig_326264 2162886007 Bacteria 2616
5 SwRhRL2b_contig_3395690 2162886007 Bacteria 2519
6 SwRhRL2b_contig_478269 2162886007 Bacteria 1321
7 JGI24741J21665_1003620 3300001915 Bacteria 3627
8 JGI24740J21852_10007980 3300001979 Bacteria 4258
9 JGI24739J22299_10034928 3300001989 Bacteria 1708
10 JGI24737J22298_10001022 3300001990 Bacteria 9909
11 JGI25162J39368_1000014 3300002737 Bacteria 328873
12 JGI25162J39368_1000505 3300002737 Bacteria 29260
13 JGI25162J39368_1000520 3300002737 Bacteria 28748
14 JGI25162J39368_1001867 3300002737 Bacteria 9721
15 JGI25154J39366_1002638 3300002738 Bacteria 4424
16 JGI25157J39369_1000038 3300002741 Bacteria 130270
17 JGI25163J39215_1000290 3300002771 Bacteria 17321
18 JGI25163J39215_1000623 3300002771 Bacteria 9721
19 JGI25163J39215_1002234 3300002771 Bacteria 2161
20 JGI25163J39215_1002499 3300002771 Bacteria 1860
21 JGI25164J39214_1000015 3300002772 Bacteria 217395
22 JGI25164J39214_1000130 3300002772 Bacteria 72405
23 JGI25164J39214_1000342 3300002772 Bacteria 29260
24 JGI25164J39214_1000350 3300002772 Bacteria 28748
25 JGI25164J39214_1002979 3300002772 Bacteria 2302
26 JGI25151J46595_10000195 3300003187 Bacteria 74795
27 JGI25406J46586_10000027 3300003203 Bacteria 70625
28 JGI25406J46586_10003146 3300003203 Bacteria 7760
29 JGI25165J46597_1000027 3300003214 Bacteria 328873
30 JGI25165J46597_1000629 3300003214 Bacteria 29260
31 JGI25165J46597_1000645 3300003214 Bacteria 28748
32 JGI25165J46597_1001729 3300003214 Bacteria 9721
33 JGI25165J46597_1007319 3300003214 Bacteria 1846
34 JGI25153J46596_10001910 3300003215 Bacteria 12359
35 JGI25153J46596_10002234 3300003215 Bacteria 11303
36 JGI25153J46596_10014841 3300003215 Bacteria 3213
37 JGI25153J46596_10038457 3300003215 Bacteria 1507
38 JGI25153J46596_10043410 3300003215 Bacteria 1362
39 rootH1_10026513 3300003316 Bacteria 2685
40 rootH1_10006273 3300003323 Bacteria 2973
41 rootH1_10006274 3300003323 Bacteria 1613
42 rootH1_10046746 3300003323 Bacteria 1416
43 JGI25160J50197_1003482 3300003354 Bacteria 7034
44 JGI25160J50197_1008036 3300003354 Bacteria 4056
45 Ga0006562J51391_1005136 3300003578 Bacteria 1874
46 Ga0006562J51391_1015265 3300003578 Bacteria 1712
47 Ga0055538_1000032 3300003751 Bacteria 199718
48 Ga0055539_1000043 3300003752 Bacteria 199718
49 Ga0055533_1000026 3300003756 Bacteria 323407
50 Ga0055533_1000052 3300003756 Bacteria 199718
51 Ga0055532_1000047 3300003758 Bacteria 179201
52 Ga0055525_1000062 3300003759 Bacteria 199718
53 Ga0055535_1004623 3300003761 Bacteria 3274
54 Ga0055542_1007018 3300003762 Bacteria 2337
55 Ga0055529_1001266 3300003763 Bacteria 9144
56 Ga0055536_1000050 3300003781 Bacteria 112647
57 Ga0055536_1000182 3300003781 Bacteria 52228
58 Ga0055536_1000894 3300003781 Bacteria 19371
59 Ga0055536_1001013 3300003781 Bacteria 17859
60 Ga0055536_1004708 3300003781 Bacteria 6871
61 Ga0055536_1004755 3300003781 Bacteria 6817
62 Ga0055536_1006955 3300003781 Bacteria 5151
63 Ga0055530_10000041 3300003791 Bacteria 112647
64 Ga0055530_10000150 3300003791 Bacteria 63051
65 Ga0055530_10000448 3300003791 Bacteria 36611
66 Ga0055530_10001395 3300003791 Bacteria 17859
67 Ga0055530_10004701 3300003791 Bacteria 6915
68 Ga0055530_10009077 3300003791 Bacteria 3872
69 Ga0055530_10014633 3300003791 Bacteria 2602
70 Ga0055540_1000122 3300003792 Bacteria 81293
71 Ga0055540_1000175 3300003792 Bacteria 63051
72 Ga0055540_1002862 3300003792 Bacteria 8769
73 Ga0055540_1003956 3300003792 Bacteria 6915
74 Ga0055540_1004783 3300003792 Bacteria 5959
75 Ga0055531_10000146 3300003794 Bacteria 81289
76 Ga0055531_10008572 3300003794 Bacteria 5367
77 Ga0055531_10016353 3300003794 Bacteria 3205
78 Ga0055531_10029303 3300003794 Bacteria 1877
79 Ga0055541_1000030 3300003841 Bacteria 199616
80 Ga0058692_1001311 3300003856 Bacteria 9374
81 Ga0058692_1005432 3300003856 Bacteria 3635
82 Ga0055543_1003863 3300004625 Bacteria 4243
83 Ga0065165_1001157 3300005262 Bacteria 30758
84 Ga0065165_1001250 3300005262 Bacteria 28850
85 Ga0065165_1006863 3300005262 Bacteria 5789
86 Ga0065714_10000590 3300005288 Bacteria 3600
87 Ga0065714_10000851 3300005288 Bacteria 2476
88 Ga0065714_10003458 3300005288 Bacteria 7061
89 Ga0065714_10006279 3300005288 Bacteria 4671
90 Ga0065714_10008011 3300005288 Bacteria 4309
91 Ga0065714_10008959 3300005288 Bacteria 2426
92 Ga0065714_10012751 3300005288 Bacteria 3303
93 Ga0065714_10013241 3300005288 Bacteria 2103
94 Ga0065714_10018895 3300005288 Bacteria 1366
95 Ga0065714_10027206 3300005288 Bacteria 1668
96 Ga0065714_10030759 3300005288 Bacteria 1942
97 Ga0065714_10068635 3300005288 Bacteria 4617
98 Ga0065714_10069870 3300005288 Bacteria 4053
99 Ga0065714_10070155 3300005288 Bacteria 3939
100 Ga0065714_10077781 3300005288 Bacteria 2652
101 Ga0065714_10090884 3300005288 Bacteria 1929
102 Ga0065714_10098173 3300005288 Bacteria 1716
103 Ga0065714_10098464 3300005288 Bacteria 1710
104 Ga0065714_10113211 3300005288 Bacteria 1442
105 Ga0065714_10122356 3300005288 Bacteria 1333
106 Ga0065714_10132432 3300005288 Bacteria 1233
107 Ga0065704_10006837 3300005289 Bacteria 4272
108 Ga0065704_10012302 3300005289 Bacteria 3699
109 Ga0065704_10071473 3300005289 Bacteria 11003
110 Ga0065704_10099092 3300005289 Bacteria 2309
111 Ga0065704_10102686 3300005289 Bacteria 2180
112 Ga0065704_10122222 3300005289 Bacteria 1753
113 Ga0065704_10138187 3300005289 Bacteria 1547
114 Ga0065704_10146024 3300005289 Bacteria 1454
115 Ga0065704_10150073 3300005289 Bacteria 1437
116 Ga0065704_10168464 3300005289 Bacteria 1305
117 Ga0065712_10000927 3300005290 Bacteria 7406
118 Ga0065712_10001010 3300005290 Bacteria 7130
119 Ga0065712_10069335 3300005290 Bacteria 7506
120 Ga0065712_10072290 3300005290 Bacteria 4824
121 Ga0065715_10002954 3300005293 Bacteria 7366
122 Ga0065707_10204688 3300005295 Bacteria 1294
123 Ga0070658_10034248 3300005327 Bacteria 4086
124 Ga0070658_10051402 3300005327 Bacteria 3340
125 Ga0070658_10074357 3300005327 Bacteria 2786
126 Ga0070676_10072245 3300005328 Bacteria 2074
127 Ga0070690_100010717 3300005330 Bacteria 5344
128 Ga0070670_100001953 3300005331 Bacteria 16902
129 Ga0068869_100041073 3300005334 Bacteria 3310
130 Ga0068869_100333149 3300005334 Bacteria 1233
131 Ga0070680_100088270 3300005336 Bacteria 2565
132 Ga0070682_100106857 3300005337 Bacteria 1858
133 Ga0068868_100010531 3300005338 Bacteria 6700
134 Ga0068868_100091713 3300005338 Bacteria 2448
135 Ga0070660_100002432 3300005339 Bacteria 12795
136 Ga0070660_100164783 3300005339 Bacteria 1787
137 Ga0070661_100001640 3300005344 Bacteria 15489
138 Ga0070661_100067766 3300005344 Bacteria 2623
139 Ga0070661_100095992 3300005344 Bacteria 2199
140 Ga0070668_100038230 3300005347 Bacteria 3667
141 Ga0070668_100140814 3300005347 Bacteria 1943
142 Ga0070668_100164082 3300005347 Bacteria 1804
143 Ga0070669_100002598 3300005353 Bacteria 13053
144 Ga0070669_100011283 3300005353 Bacteria 6344
145 Ga0070669_100216015 3300005353 Bacteria 1515
146 Ga0070671_100078909 3300005355 Bacteria 2751
147 Ga0070671_100178080 3300005355 Bacteria 1799
148 Ga0070674_100018306 3300005356 Bacteria 4426
149 Ga0070674_100278854 3300005356 Bacteria 1324
150 Ga0070709_10006118 3300005434 Bacteria 6547
151 Ga0070714_100382151 3300005435 Bacteria 1328
152 Ga0070713_100033148 3300005436 Bacteria 4134
153 Ga0070713_100090618 3300005436 Bacteria 2629
154 Ga0070710_10001287 3300005437 Bacteria 11902
155 Ga0070711_100004377 3300005439 Bacteria 8321
156 Ga0070711_100019147 3300005439 Bacteria 4386
157 Ga0070711_100027037 3300005439 Bacteria 3763
158 Ga0070711_100038035 3300005439 Bacteria 3232
159 Ga0070711_100107768 3300005439 Bacteria 2040
160 Ga0070708_100126635 3300005445 Bacteria 2361
161 Ga0070663_100025300 3300005455 Bacteria 4005
162 Ga0070663_100064241 3300005455 Bacteria 2653
163 Ga0070678_100084483 3300005456 Bacteria 2416
164 Ga0070662_100008312 3300005457 Bacteria 6763
165 Ga0070662_100065030 3300005457 Bacteria 2672
166 Ga0070662_100071722 3300005457 Bacteria 2555
167 Ga0070662_100127954 3300005457 Bacteria 1954
168 Ga0070662_100166156 3300005457 Bacteria 1729
169 Ga0070681_10009117 3300005458 Bacteria 9750
170 Ga0070681_10014556 3300005458 Bacteria 7827
171 Ga0070681_10020657 3300005458 Bacteria 6597
172 Ga0070698_100037322 3300005471 Bacteria 5010
173 Ga0070698_100175114 3300005471 Bacteria 2085
174 Ga0070698_100221832 3300005471 Bacteria 1824
175 Ga0070679_100020776 3300005530 Bacteria 6404
176 Ga0070679_100402024 3300005530 Bacteria 1315
177 Ga0070684_100231098 3300005535 Bacteria 1689
178 Ga0070697_100041824 3300005536 Bacteria 3710
179 Ga0068853_100000187 3300005539 Bacteria 43749
180 Ga0068853_100002462 3300005539 Bacteria 13860
181 Ga0068853_100067217 3300005539 Bacteria 3113
182 Ga0068853_100136819 3300005539 Bacteria 2197
183 Ga0070665_100021594 3300005548 Bacteria 6472
184 Ga0070665_100084700 3300005548 Bacteria 3175
185 Ga0070665_100095898 3300005548 Bacteria 2971
186 Ga0070665_100101819 3300005548 Bacteria 2876
187 Ga0070665_100111069 3300005548 Bacteria 2744
188 Ga0070665_100116829 3300005548 Bacteria 2670
189 Ga0070665_100247405 3300005548 Bacteria 1783
190 Ga0068855_100013031 3300005563 Bacteria 10029
191 Ga0068855_100062119 3300005563 Bacteria 4362
192 Ga0068855_100099110 3300005563 Bacteria 3356
193 Ga0068855_100490959 3300005563 Bacteria 1335
194 Ga0070664_100001886 3300005564 Bacteria 16837
195 Ga0070664_100090486 3300005564 Bacteria 2648
196 Ga0068857_100048859 3300005577 Bacteria 3754
197 Ga0068854_100003296 3300005578 Bacteria 10057
198 Ga0068854_100080142 3300005578 Bacteria 2409
199 Ga0068854_100095029 3300005578 Bacteria 2224
200 Ga0068854_100139182 3300005578 Bacteria 1861
201 Ga0068854_100175651 3300005578 Bacteria 1670
202 Ga0068854_100194598 3300005578 Bacteria 1591
203 Ga0068856_100001621 3300005614 Bacteria 23564
204 Ga0068852_100296110 3300005616 Bacteria 1565
205 Ga0068852_100345374 3300005616 Bacteria 1452
206 Ga0068864_100075582 3300005618 Bacteria 2941
207 Ga0068866_10171931 3300005718 Bacteria 1273
208 Ga0068861_100105855 3300005719 Bacteria 2246
209 Ga0068851_10000007 3300005834 Bacteria 244101
210 Ga0068863_100274461 3300005841 Bacteria 1632
211 Ga0068858_100273575 3300005842 Bacteria 1607
212 Ga0068860_100000213 3300005843 Bacteria 91105
213 Ga0068860_100071448 3300005843 Bacteria 3298
214 Ga0068862_100128001 3300005844 Bacteria 2243
215 Ga0081455_10006592 3300005937 Bacteria 12420
216 Ga0081455_10018614 3300005937 Bacteria 6603
217 Ga0081455_10024972 3300005937 Bacteria 5523
218 Ga0081540_1001168 3300005983 Bacteria 23063
219 Ga0081540_1001683 3300005983 Bacteria 18785
220 Ga0081540_1004236 3300005983 Bacteria 11018
221 Ga0081540_1038167 3300005983 Bacteria 2535
222 Ga0081540_1043861 3300005983 Bacteria 2289
223 Ga0081539_10000051 3300005985 Bacteria 268337
224 Ga0081539_10000148 3300005985 Bacteria 163442
225 Ga0081539_10017427 3300005985 Bacteria 5044
226 Ga0070717_10000905 3300006028 Bacteria 19709
227 Ga0070717_10003205 3300006028 Bacteria 11688
228 Ga0070717_10383905 3300006028 Bacteria 1260
229 Ga0075365_10023750 3300006038 Bacteria 3859
230 Ga0075365_10059255 3300006038 Bacteria 2551
231 Ga0075365_10094806 3300006038 Bacteria 2037
232 Ga0075365_10193611 3300006038 Bacteria 1423
233 Ga0075363_100007789 3300006048 Bacteria 4949
234 Ga0075364_10001161 3300006051 Bacteria 14099
235 Ga0075364_10015756 3300006051 Bacteria 4693
236 Ga0075364_10025590 3300006051 Bacteria 3757
237 Ga0075364_10027279 3300006051 Bacteria 3647
238 Ga0075364_10039123 3300006051 Bacteria 3073
239 Ga0075364_10099958 3300006051 Bacteria 1931
240 Ga0075364_10104267 3300006051 Bacteria 1889
241 Ga0075364_10126531 3300006051 Bacteria 1713
242 Ga0075364_10132834 3300006051 Bacteria 1671
243 Ga0075364_10194853 3300006051 Bacteria 1372
244 Ga0075432_10006756 3300006058 Bacteria 3908
245 Ga0075432_10007217 3300006058 Bacteria 3782
246 Ga0075432_10021117 3300006058 Bacteria 2227
247 Ga0075432_10034684 3300006058 Bacteria 1753
248 Ga0075432_10057374 3300006058 Bacteria 1381
249 Ga0070716_100020409 3300006173 Bacteria 3477
250 Ga0070712_100018569 3300006175 Bacteria 4520
251 Ga0070712_100020288 3300006175 Bacteria 4348
252 Ga0070712_100115135 3300006175 Bacteria 2014
253 Ga0070712_100128349 3300006175 Bacteria 1919
254 Ga0075367_10046606 3300006178 Bacteria 2547
255 Ga0075367_10068056 3300006178 Bacteria 2136
256 Ga0075367_10116510 3300006178 Bacteria 1643
257 Ga0075369_10014926 3300006186 Bacteria 3110
258 Ga0075369_10031582 3300006186 Bacteria 2237
259 Ga0075366_10029203 3300006195 Bacteria 3239
260 Ga0075366_10047179 3300006195 Bacteria 2553
261 Ga0075366_10060473 3300006195 Bacteria 2250
262 Ga0075366_10072326 3300006195 Bacteria 2054
263 Ga0075366_10162577 3300006195 Bacteria 1353
264 Ga0097621_100318574 3300006237 Bacteria 1377
265 Ga0075370_10040035 3300006353 Bacteria 2642
266 Ga0075370_10045881 3300006353 Bacteria 2472
267 Ga0075370_10046766 3300006353 Bacteria 2450
268 Ga0075370_10049899 3300006353 Bacteria 2373
269 Ga0075370_10066959 3300006353 Bacteria 2050
270 Ga0068871_100074485 3300006358 Bacteria 2801
271 Ga0068871_100273287 3300006358 Bacteria 1477
272 Ga0075433_10008589 3300006852 Bacteria 8149
273 Ga0075434_100000766 3300006871 Bacteria 25369
274 Ga0075434_100134872 3300006871 Bacteria 2488
275 Ga0075436_100058719 3300006914 Bacteria 2657
276 Ga0075436_100218350 3300006914 Bacteria 1352
277 Ga0099824_1018120 3300006942 Bacteria 5872
278 Ga0099823_1000043 3300006944 Bacteria 60786
279 Ga0099823_1043123 3300006944 Bacteria 3126
280 Ga0099823_1058735 3300006944 Bacteria 2070
281 Ga0079104_1000897 3300006946 Bacteria 24278
282 Ga0079104_1001103 3300006946 Bacteria 19997
283 Ga0079104_1003465 3300006946 Bacteria 7309
284 Ga0079104_1011286 3300006946 Bacteria 2880
285 Ga0099826_10004877 3300006948 Bacteria 9495
286 Ga0099794_10072809 3300007265 Bacteria 1685
287 Ga0099794_10111701 3300007265 Bacteria 1370
288 Ga0105251_10000024 3300009011 Bacteria 133058
289 Ga0105251_10004294 3300009011 Bacteria 9779
290 Ga0105251_10004985 3300009011 Bacteria 8827
291 Ga0105251_10017375 3300009011 Bacteria 3857
292 Ga0105251_10019600 3300009011 Bacteria 3569
293 Ga0105251_10022129 3300009011 Bacteria 3308
294 Ga0105251_10026448 3300009011 Bacteria 2955
295 Ga0105251_10035664 3300009011 Bacteria 2452
296 Ga0105251_10043856 3300009011 Bacteria 2164
297 Ga0105244_10002242 3300009036 Bacteria 14721
298 Ga0105244_10007755 3300009036 Bacteria 6793
299 Ga0105244_10013364 3300009036 Bacteria 4804
300 Ga0105244_10022572 3300009036 Bacteria 3463
301 Ga0105244_10035888 3300009036 Bacteria 2601
302 Ga0105244_10037094 3300009036 Bacteria 2549
303 Ga0105244_10041429 3300009036 Bacteria 2386
304 Ga0105244_10048939 3300009036 Bacteria 2162
305 Ga0105244_10056006 3300009036 Bacteria 1997
306 Ga0105244_10056448 3300009036 Bacteria 1988
307 Ga0105244_10058050 3300009036 Bacteria 1955
308 Ga0105244_10063820 3300009036 Bacteria 1849
309 Ga0105244_10068353 3300009036 Bacteria 1775
310 Ga0105244_10078852 3300009036 Bacteria 1633
311 Ga0105244_10085390 3300009036 Bacteria 1557
312 Ga0105244_10092244 3300009036 Bacteria 1488
313 Ga0105244_10098258 3300009036 Bacteria 1434
314 Ga0105244_10107817 3300009036 Bacteria 1358
315 Ga0105250_10001113 3300009092 Bacteria 15161
316 Ga0105250_10008783 3300009092 Bacteria 4280
317 Ga0105250_10009972 3300009092 Bacteria 3979
318 Ga0105250_10011073 3300009092 Bacteria 3748
319 Ga0105250_10028250 3300009092 Bacteria 2259
320 Ga0105250_10043081 3300009092 Bacteria 1809
321 Ga0105250_10060814 3300009092 Bacteria 1518
322 Ga0105250_10062884 3300009092 Bacteria 1494
323 Ga0105250_10071347 3300009092 Bacteria 1403
324 Ga0105250_10082103 3300009092 Bacteria 1307
325 Ga0105250_10086053 3300009092 Bacteria 1276
326 Ga0105240_10010458 3300009093 Bacteria 13040
327 Ga0105240_10019779 3300009093 Bacteria 8991
328 Ga0105240_10039056 3300009093 Bacteria 6082
329 Ga0105240_10069157 3300009093 Bacteria 4371
330 Ga0105240_10104268 3300009093 Bacteria 3444
331 Ga0111539_10084175 3300009094 Bacteria 3740
332 Ga0111539_10096711 3300009094 Bacteria 3468
333 Ga0111539_10521151 3300009094 Bacteria 1385
334 Ga0105245_10034443 3300009098 Bacteria 4491
335 Ga0105243_10000203 3300009148 Bacteria 69484
336 Ga0105243_10001069 3300009148 Bacteria 25056
337 Ga0105243_10001412 3300009148 Bacteria 21239
338 Ga0105243_10001572 3300009148 Bacteria 19964
339 Ga0105243_10001599 3300009148 Bacteria 19744
340 Ga0105243_10011620 3300009148 Bacteria 6660
341 Ga0105243_10016707 3300009148 Bacteria 5548
342 Ga0105243_10039470 3300009148 Bacteria 3680
343 Ga0105243_10052138 3300009148 Bacteria 3239
344 Ga0105243_10099939 3300009148 Bacteria 2406
345 Ga0105243_10144585 3300009148 Bacteria 2033
346 Ga0105243_10299789 3300009148 Bacteria 1456
347 Ga0105243_10321541 3300009148 Bacteria 1410
348 Ga0105243_10344050 3300009148 Bacteria 1367
349 Ga0105243_10347081 3300009148 Bacteria 1361
350 Ga0105243_10390432 3300009148 Bacteria 1290
351 Ga0105241_10100504 3300009174 Bacteria 2299
352 Ga0105242_10001499 3300009176 Bacteria 18352
353 Ga0105242_10027006 3300009176 Bacteria 4553
354 Ga0105242_10296188 3300009176 Bacteria 1475
355 Ga0105248_10007834 3300009177 Bacteria 11730
356 Ga0105248_10222294 3300009177 Bacteria 2126
357 Ga0105237_10010598 3300009545 Bacteria 9791
358 Ga0105237_10013465 3300009545 Bacteria 8575
359 Ga0105237_10018185 3300009545 Bacteria 7275
360 Ga0105237_10121683 3300009545 Bacteria 2604
361 Ga0105237_10140629 3300009545 Bacteria 2408
362 Ga0105237_10286056 3300009545 Bacteria 1651
363 Ga0105238_10005132 3300009551 Bacteria 12943
364 Ga0105249_10007064 3300009553 Bacteria 9797
365 Ga0105030_100135 3300009987 Bacteria 5867
366 Ga0099796_10008410 3300010159 Bacteria 2749
367 Ga0099796_10009635 3300010159 Bacteria 2621
368 Ga0099796_10014885 3300010159 Bacteria 2259
369 Ga0105239_10007603 3300010375 Bacteria 12418
370 Ga0105239_10021881 3300010375 Bacteria 7049
371 Ga0105239_10247080 3300010375 Bacteria 2004
372 Ga0105239_10315588 3300010375 Bacteria 1762
373 Ga0105246_10000088 3300011119 Bacteria 39136
374 Ga0105246_10002803 3300011119 Bacteria 10549
375 Ga0105246_10007983 3300011119 Bacteria 6497
376 Ga0105246_10009162 3300011119 Bacteria 6096
377 Ga0105246_10011130 3300011119 Bacteria 5575
378 Ga0105246_10115159 3300011119 Bacteria 1982
379 Ga0105246_10171484 3300011119 Bacteria 1662
380 Ga0157345_1000151 3300012498 Bacteria 12029
381 Ga0157345_1000628 3300012498 Bacteria 2978
382 Ga0157345_1001643 3300012498 Bacteria 1571
383 Ga0157347_1000415 3300012502 Bacteria 2736
384 Ga0157373_10000789 3300013100 Bacteria 24417
385 Ga0157373_10004409 3300013100 Bacteria 10600
386 Ga0157373_10007497 3300013100 Bacteria 8112
387 Ga0157373_10018008 3300013100 Bacteria 5144
388 Ga0157373_10043030 3300013100 Bacteria 3227
389 Ga0157373_10046973 3300013100 Bacteria 3080
390 Ga0157373_10115237 3300013100 Bacteria 1889
391 Ga0157373_10178305 3300013100 Bacteria 1496
392 Ga0157371_10000045 3300013102 Bacteria 189065
393 Ga0157371_10000162 3300013102 Bacteria 98237
394 Ga0157371_10002021 3300013102 Bacteria 20035
395 Ga0157371_10002180 3300013102 Bacteria 19014
396 Ga0157371_10007072 3300013102 Bacteria 9127
397 Ga0157371_10013168 3300013102 Bacteria 6296
398 Ga0157371_10013733 3300013102 Bacteria 6141
399 Ga0157371_10015420 3300013102 Bacteria 5733
400 Ga0157371_10043778 3300013102 Bacteria 3188
401 Ga0157371_10067806 3300013102 Bacteria 2525
402 Ga0157371_10159592 3300013102 Bacteria 1610
403 Ga0157371_10165556 3300013102 Bacteria 1579
404 Ga0157370_10003242 3300013104 Bacteria 19198
405 Ga0157370_10063716 3300013104 Bacteria 3491
406 Ga0157370_10077868 3300013104 Bacteria 3123
407 Ga0157370_10084448 3300013104 Bacteria 2984
408 Ga0157370_10088973 3300013104 Bacteria 2900
409 Ga0157370_10089404 3300013104 Bacteria 2893
410 Ga0157370_10112690 3300013104 Bacteria 2542
411 Ga0157370_10112745 3300013104 Bacteria 2542
412 Ga0157370_10122605 3300013104 Bacteria 2427
413 Ga0157370_10233505 3300013104 Bacteria 1702
414 Ga0157370_10270291 3300013104 Bacteria 1570
415 Ga0157370_10375385 3300013104 Bacteria 1310
416 Ga0157369_10002918 3300013105 Bacteria 20446
417 Ga0157369_10005049 3300013105 Bacteria 15450
418 Ga0157369_10009441 3300013105 Bacteria 11153
419 Ga0157369_10016741 3300013105 Bacteria 8241
420 Ga0157369_10030463 3300013105 Bacteria 5950
421 Ga0157369_10037854 3300013105 Bacteria 5278
422 Ga0157369_10055802 3300013105 Bacteria 4263
423 Ga0157369_10081171 3300013105 Bacteria 3471
424 Ga0157369_10179265 3300013105 Bacteria 2229
425 Ga0157369_10199135 3300013105 Bacteria 2103
426 Ga0157378_10026157 3300013297 Bacteria 5144
427 Ga0163162_10001285 3300013306 Bacteria 23460
428 Ga0163162_10001487 3300013306 Bacteria 21848
429 Ga0163162_10030569 3300013306 Bacteria 5337
430 Ga0163162_10231284 3300013306 Bacteria 1979
431 Ga0163162_10537436 3300013306 Bacteria 1298
432 Ga0157372_10007682 3300013307 Bacteria 11470
433 Ga0157372_10015782 3300013307 Bacteria 8102
434 Ga0157372_10067862 3300013307 Bacteria 4009
435 Ga0157372_10112469 3300013307 Bacteria 3120
436 Ga0157372_10229313 3300013307 Bacteria 2153
437 Ga0157375_10044677 3300013308 Bacteria 4306
438 Ga0157375_10197398 3300013308 Bacteria 2167
439 Ga0157375_10477150 3300013308 Bacteria 1412
440 Ga0163163_10074440 3300014325 Bacteria 3388
441 Ga0157380_10010381 3300014326 Bacteria 6699
442 Ga0182008_10001885 3300014497 Bacteria 13631
443 Ga0182008_10004078 3300014497 Bacteria 8617
444 Ga0182008_10005548 3300014497 Bacteria 7165
445 Ga0182008_10006484 3300014497 Bacteria 6535
446 Ga0182008_10007486 3300014497 Bacteria 6024
447 Ga0182008_10007506 3300014497 Bacteria 6016
448 Ga0182008_10021926 3300014497 Bacteria 3276
449 Ga0182008_10029815 3300014497 Bacteria 2754
450 Ga0182008_10032915 3300014497 Bacteria 2603
451 Ga0182008_10037407 3300014497 Bacteria 2428
452 Ga0182008_10038255 3300014497 Bacteria 2399
453 Ga0182008_10041095 3300014497 Bacteria 2307
454 Ga0182008_10055382 3300014497 Bacteria 1961
455 Ga0182008_10106983 3300014497 Bacteria 1384
456 Ga0182008_10134459 3300014497 Bacteria 1234
457 Ga0157377_10233704 3300014745 Bacteria 1183
458 Ga0157376_10054188 3300014969 Bacteria 3342
459 Ga0182006_1000385 3300015261 Bacteria 36409
460 Ga0182006_1003062 3300015261 Bacteria 8773
461 Ga0182006_1003888 3300015261 Bacteria 7486
462 Ga0182006_1008964 3300015261 Bacteria 4511
463 Ga0182006_1012007 3300015261 Bacteria 3794
464 Ga0182006_1016596 3300015261 Bacteria 3139
465 Ga0182006_1019954 3300015261 Bacteria 2814
466 Ga0182006_1023774 3300015261 Bacteria 2536
467 Ga0182006_1030586 3300015261 Bacteria 2175
468 Ga0182006_1035964 3300015261 Bacteria 1971
469 Ga0182006_1040160 3300015261 Bacteria 1843
470 Ga0182007_10000794 3300015262 Bacteria 17656
471 Ga0182007_10002733 3300015262 Bacteria 8624
472 Ga0182007_10044641 3300015262 Bacteria 1470
473 Ga0182005_1000681 3300015265 Bacteria 15884
474 Ga0182005_1002836 3300015265 Bacteria 6038
475 Ga0182005_1003074 3300015265 Bacteria 5757
476 Ga0182005_1003780 3300015265 Bacteria 5033
477 Ga0182005_1011009 3300015265 Bacteria 2589
478 Ga0163161_10001061 3300017792 Bacteria 20821
479 Ga0163161_10071145 3300017792 Bacteria 2545
480 Ga0163161_10102782 3300017792 Bacteria 2129
481 Ga0163161_10136874 3300017792 Bacteria 1852
482 Ga0163161_10137255 3300017792 Bacteria 1849
483 Ga0163161_10149651 3300017792 Bacteria 1773
484 Ga0163161_10237469 3300017792 Bacteria 1416
485 Ga0214544_1000002 3300021320 Bacteria 753857
486 Ga0214542_1000001 3300021321 Bacteria 1018696
487 Ga0214545_1000001 3300021324 Bacteria 1092817
488 Ga0214543_1000001 3300021327 Bacteria 776921
489 Ga0213872_10043153 3300021361 Bacteria 2055
490 Ga0213876_10080217 3300021384 Bacteria 1725
491 Ga0209435_100764 3300025206 Bacteria 5281
492 Ga0209760_100012 3300025207 Bacteria 185483
493 Ga0209760_100025 3300025207 Bacteria 156628
494 Ga0209760_100027 3300025207 Bacteria 153290
495 Ga0209760_100197 3300025207 Bacteria 29065
496 Ga0209784_100007 3300025224 Bacteria 747715
497 Ga0209566_100009 3300025225 Bacteria 554018
498 Ga0209674_100021 3300025226 Bacteria 629811
499 Ga0209674_100024 3300025226 Bacteria 535481
500 Ga0209147_100009 3300025229 Bacteria 747409
501 Ga0209563_100018 3300025230 Bacteria 747850
502 Ga0209563_100069 3300025230 Bacteria 253154
503 Ga0209563_101931 3300025230 Bacteria 5007
504 Ga0209563_102470 3300025230 Bacteria 4173
505 Ga0207427_100003 3300025231 Bacteria 1035004
506 Ga0207427_100005 3300025231 Bacteria 797999
507 Ga0207427_100006 3300025231 Bacteria 785415
508 Ga0207427_100303 3300025231 Bacteria 34361
509 Ga0209437_100002 3300025233 Bacteria 1574801
510 Ga0209437_100013 3300025233 Bacteria 785457
511 Ga0209437_100018 3300025233 Bacteria 694400
512 Ga0209437_101479 3300025233 Bacteria 5645
513 Ga0209258_100169 3300025242 Bacteria 145227
514 Ga0209258_100456 3300025242 Bacteria 44547
515 Ga0209646_1000012 3300025246 Bacteria 573300
516 Ga0209646_1000184 3300025246 Bacteria 78423
517 Ga0209026_1000004 3300025250 Bacteria 949012
518 Ga0209677_100012 3300025253 Bacteria 554018
519 Ga0209677_100048 3300025253 Bacteria 183563
520 Ga0209677_100232 3300025253 Bacteria 39525
521 Ga0209677_102534 3300025253 Bacteria 6765
522 Ga0209148_1000374 3300025254 Bacteria 54657
523 Ga0209759_1000003 3300025256 Bacteria 792130
524 Ga0209233_1000004 3300025261 Bacteria 1574798
525 Ga0209233_1000021 3300025261 Bacteria 798078
526 Ga0209233_1000022 3300025261 Bacteria 785415
527 Ga0209233_1003138 3300025261 Bacteria 5869
528 Ga0209233_1008338 3300025261 Bacteria 3214
529 Ga0209455_1000795 3300025272 Bacteria 17472
530 Ga0209455_1001411 3300025272 Bacteria 10891
531 Ga0209455_1002427 3300025272 Bacteria 7213
532 Ga0209675_1002171 3300025291 Bacteria 10329
533 Ga0209675_1015233 3300025291 Bacteria 2296
534 Ga0209676_1000015 3300025292 Bacteria 784458
535 Ga0209676_1000030 3300025292 Bacteria 506421
536 Ga0209676_1000041 3300025292 Bacteria 424583
537 Ga0209676_1000062 3300025292 Bacteria 332319
538 Ga0209676_1000065 3300025292 Bacteria 318605
539 Ga0209676_1000102 3300025292 Bacteria 227372
540 Ga0209676_1000154 3300025292 Bacteria 166013
541 Ga0209676_1001192 3300025292 Bacteria 27932
542 Ga0209676_1003691 3300025292 Bacteria 9150
543 Ga0209676_1004755 3300025292 Bacteria 7409
544 Ga0209676_1005922 3300025292 Bacteria 6193
545 Ga0209676_1007365 3300025292 Bacteria 5181
546 Ga0209025_1000040 3300025294 Bacteria 376228
547 Ga0209564_1004290 3300025295 Bacteria 8835
548 Ga0209564_1006740 3300025295 Bacteria 6097
549 Ga0209758_1000024 3300025297 Bacteria 591966
550 Ga0209758_1000068 3300025297 Bacteria 286488
551 Ga0209758_1001579 3300025297 Bacteria 26050
552 Ga0209758_1002091 3300025297 Bacteria 21224
553 Ga0209050_1000004 3300025298 Bacteria 1600040
554 Ga0209050_1000024 3300025298 Bacteria 533389
555 Ga0209050_1000030 3300025298 Bacteria 463381
556 Ga0209050_1000105 3300025298 Bacteria 227285
557 Ga0209050_1000518 3300025298 Bacteria 64332
558 Ga0209050_1000647 3300025298 Bacteria 54000
559 Ga0209050_1000684 3300025298 Bacteria 50962
560 Ga0209050_1005899 3300025298 Bacteria 7480
561 Ga0207426_1000387 3300025302 Bacteria 75536
562 Ga0207426_1000726 3300025302 Bacteria 37826
563 Ga0207426_1032069 3300025302 Bacteria 1708
564 Ga0207426_1046358 3300025302 Bacteria 1316
565 Ga0209051_1000012 3300025303 Bacteria 595474
566 Ga0209051_1000023 3300025303 Bacteria 437371
567 Ga0209051_1000066 3300025303 Bacteria 227369
568 Ga0209051_1000181 3300025303 Bacteria 113391
569 Ga0209051_1000881 3300025303 Bacteria 30220
570 Ga0209051_1007044 3300025303 Bacteria 6221
571 Ga0209051_1011455 3300025303 Bacteria 4376
572 Ga0209051_1017273 3300025303 Bacteria 3229
573 Ga0209257_1000069 3300025304 Bacteria 339826
574 Ga0209257_1000124 3300025304 Bacteria 218195
575 Ga0209257_1004927 3300025304 Bacteria 9810
576 Ga0209257_1004945 3300025304 Bacteria 9776
577 Ga0209257_1026696 3300025304 Bacteria 1939
578 Ga0207656_10000006 3300025321 Bacteria 395044
579 Ga0207696_1000002 3300025711 Bacteria 1098043
580 Ga0207696_1000031 3300025711 Bacteria 384169
581 Ga0207696_1000050 3300025711 Bacteria 276983
582 Ga0207696_1000105 3300025711 Bacteria 163421
583 Ga0207696_1000156 3300025711 Bacteria 112840
584 Ga0207696_1000541 3300025711 Bacteria 30663
585 Ga0207696_1000902 3300025711 Bacteria 18404
586 Ga0207696_1006588 3300025711 Bacteria 4659
587 Ga0207696_1008859 3300025711 Bacteria 3801
588 Ga0207696_1014635 3300025711 Bacteria 2684
589 Ga0207696_1018751 3300025711 Bacteria 2267
590 Ga0207696_1018949 3300025711 Bacteria 2251
591 Ga0207696_1021172 3300025711 Bacteria 2085
592 Ga0207655_1000014 3300025728 Bacteria 607124
593 Ga0207655_1000202 3300025728 Bacteria 103907
594 Ga0207655_1000388 3300025728 Bacteria 61513
595 Ga0207655_1001189 3300025728 Bacteria 25183
596 Ga0207655_1002158 3300025728 Bacteria 16393
597 Ga0207655_1002275 3300025728 Bacteria 15824
598 Ga0207655_1002393 3300025728 Bacteria 15296
599 Ga0207655_1002424 3300025728 Bacteria 15154
600 Ga0207655_1003208 3300025728 Bacteria 12295
601 Ga0207655_1005954 3300025728 Bacteria 8168
602 Ga0207655_1007793 3300025728 Bacteria 6900
603 Ga0207655_1009633 3300025728 Bacteria 5976
604 Ga0207655_1012780 3300025728 Bacteria 4869
605 Ga0207655_1013044 3300025728 Bacteria 4798
606 Ga0207655_1016142 3300025728 Bacteria 4104
607 Ga0207655_1017975 3300025728 Bacteria 3781
608 Ga0207655_1020188 3300025728 Bacteria 3437
609 Ga0207655_1024145 3300025728 Bacteria 2988
610 Ga0207655_1038420 3300025728 Bacteria 2093
611 Ga0207655_1044069 3300025728 Bacteria 1878
612 Ga0207655_1044223 3300025728 Bacteria 1874
613 Ga0207655_1047018 3300025728 Bacteria 1785
614 Ga0207655_1054524 3300025728 Bacteria 1589
615 Ga0207655_1055413 3300025728 Bacteria 1570
616 Ga0207655_1065501 3300025728 Bacteria 1379
617 Ga0207713_1000010 3300025735 Bacteria 528374
618 Ga0207713_1000077 3300025735 Bacteria 176517
619 Ga0207713_1001506 3300025735 Bacteria 18410
620 Ga0207713_1001707 3300025735 Bacteria 16947
621 Ga0207713_1001805 3300025735 Bacteria 16354
622 Ga0207713_1003359 3300025735 Bacteria 10976
623 Ga0207713_1003953 3300025735 Bacteria 9846
624 Ga0207713_1003958 3300025735 Bacteria 9829
625 Ga0207713_1004772 3300025735 Bacteria 8713
626 Ga0207713_1006013 3300025735 Bacteria 7481
627 Ga0207713_1006986 3300025735 Bacteria 6767
628 Ga0207713_1007874 3300025735 Bacteria 6211
629 Ga0207713_1009206 3300025735 Bacteria 5593
630 Ga0207713_1017229 3300025735 Bacteria 3634
631 Ga0207713_1025065 3300025735 Bacteria 2762
632 Ga0207713_1032621 3300025735 Bacteria 2284
633 Ga0207713_1033698 3300025735 Bacteria 2234
634 Ga0207713_1042048 3300025735 Bacteria 1901
635 Ga0207713_1045356 3300025735 Bacteria 1796
636 Ga0207713_1068035 3300025735 Bacteria 1326
637 Ga0207713_1068036 3300025735 Bacteria 1326
638 Ga0207692_10000175 3300025898 Bacteria 20519
639 Ga0207688_10091493 3300025901 Bacteria 1747
640 Ga0207647_10001739 3300025904 Bacteria 16681
641 Ga0207647_10005184 3300025904 Bacteria 9590
642 Ga0207647_10036284 3300025904 Bacteria 3134
643 Ga0207647_10083672 3300025904 Bacteria 1910
644 Ga0207685_10084217 3300025905 Bacteria 1323
645 Ga0207699_10001765 3300025906 Bacteria 10215
646 Ga0207643_10030984 3300025908 Bacteria 2980
647 Ga0207705_10049526 3300025909 Bacteria 3023
648 Ga0207705_10088342 3300025909 Bacteria 2267
649 Ga0207684_10002597 3300025910 Bacteria 18082
650 Ga0207654_10150616 3300025911 Bacteria 1493
651 Ga0207707_10069686 3300025912 Bacteria 3065
652 Ga0207695_10018901 3300025913 Bacteria 7951
653 Ga0207695_10019286 3300025913 Bacteria 7854
654 Ga0207695_10027028 3300025913 Bacteria 6393
655 Ga0207695_10383090 3300025913 Bacteria 1292
656 Ga0207671_10000131 3300025914 Bacteria 116866
657 Ga0207671_10046338 3300025914 Bacteria 3216
658 Ga0207671_10050917 3300025914 Bacteria 3067
659 Ga0207671_10055068 3300025914 Bacteria 2947
660 Ga0207693_10003312 3300025915 Bacteria 13783
661 Ga0207693_10018169 3300025915 Bacteria 5603
662 Ga0207693_10046264 3300025915 Bacteria 3418
663 Ga0207693_10105263 3300025915 Bacteria 2212
664 Ga0207663_10017815 3300025916 Bacteria 3966
665 Ga0207663_10110872 3300025916 Bacteria 1862
666 Ga0207660_10006978 3300025917 Bacteria 7314
667 Ga0207660_10047416 3300025917 Bacteria 3037
668 Ga0207657_10000658 3300025919 Bacteria 36762
669 Ga0207649_10000012 3300025920 Bacteria 265674
670 Ga0207649_10056828 3300025920 Bacteria 2445
671 Ga0207649_10268068 3300025920 Bacteria 1236
672 Ga0207649_10288436 3300025920 Bacteria 1196
673 Ga0207652_10003041 3300025921 Bacteria 13986
674 Ga0207652_10129327 3300025921 Bacteria 2251
675 Ga0207681_10000099 3300025923 Bacteria 73220
676 Ga0207681_10008578 3300025923 Bacteria 6242
677 Ga0207681_10188783 3300025923 Bacteria 1575
678 Ga0207694_10051021 3300025924 Bacteria 3206
679 Ga0207694_10092620 3300025924 Bacteria 2386
680 Ga0207650_10000157 3300025925 Bacteria 81959
681 Ga0207650_10000185 3300025925 Bacteria 72385
682 Ga0207687_10062693 3300025927 Bacteria 2630
683 Ga0207687_10063544 3300025927 Bacteria 2614
684 Ga0207687_10067519 3300025927 Bacteria 2544
685 Ga0207687_10357830 3300025927 Bacteria 1191
686 Ga0207700_10066796 3300025928 Bacteria 2750
687 Ga0207664_10028049 3300025929 Bacteria 4275
688 Ga0207706_10001069 3300025933 Bacteria 27808
689 Ga0207706_10044947 3300025933 Bacteria 3913
690 Ga0207706_10047830 3300025933 Bacteria 3784
691 Ga0207706_10144240 3300025933 Bacteria 2095
692 Ga0207706_10261683 3300025933 Bacteria 1510
693 Ga0207706_10325249 3300025933 Bacteria 1338
694 Ga0207686_10000319 3300025934 Bacteria 34615
695 Ga0207686_10048050 3300025934 Bacteria 2641
696 Ga0207686_10075823 3300025934 Bacteria 2178
697 Ga0207709_10000011 3300025935 Bacteria 552881
698 Ga0207709_10000071 3300025935 Bacteria 181156
699 Ga0207709_10000337 3300025935 Bacteria 49221
700 Ga0207709_10008269 3300025935 Bacteria 5761
701 Ga0207709_10010196 3300025935 Bacteria 5175
702 Ga0207709_10010923 3300025935 Bacteria 5004
703 Ga0207709_10012591 3300025935 Bacteria 4661
704 Ga0207709_10013313 3300025935 Bacteria 4538
705 Ga0207709_10173634 3300025935 Bacteria 1515
706 Ga0207709_10223251 3300025935 Bacteria 1360
707 Ga0207709_10250329 3300025935 Bacteria 1294
708 Ga0207669_10000863 3300025937 Bacteria 12890
709 Ga0207669_10035918 3300025937 Bacteria 2826
710 Ga0207669_10117280 3300025937 Bacteria 1799
711 Ga0207704_10032792 3300025938 Bacteria 2945
712 Ga0207665_10015055 3300025939 Bacteria 5079
713 Ga0207691_10253853 3300025940 Bacteria 1517
714 Ga0207711_10124145 3300025941 Bacteria 2308
715 Ga0207711_10258398 3300025941 Bacteria 1600
716 Ga0207689_10014103 3300025942 Bacteria 6802
717 Ga0207689_10017839 3300025942 Bacteria 5997
718 Ga0207661_10032316 3300025944 Bacteria 4053
719 Ga0207661_10126364 3300025944 Bacteria 2184
720 Ga0207679_10000015 3300025945 Bacteria 265674
721 Ga0207679_10074449 3300025945 Bacteria 2573
722 Ga0207679_10275352 3300025945 Bacteria 1441
723 Ga0207667_10011875 3300025949 Bacteria 10088
724 Ga0207667_10056026 3300025949 Bacteria 4142
725 Ga0207667_10103685 3300025949 Bacteria 2933
726 Ga0207667_10143474 3300025949 Bacteria 2458
727 Ga0207712_10004516 3300025961 Bacteria 8788
728 Ga0207712_10271080 3300025961 Bacteria 1381
729 Ga0207668_10076324 3300025972 Bacteria 2412
730 Ga0207668_10153152 3300025972 Bacteria 1787
731 Ga0207668_10199966 3300025972 Bacteria 1590
732 Ga0207640_10005343 3300025981 Bacteria 7002
733 Ga0207640_10010617 3300025981 Bacteria 5194
734 Ga0207640_10048787 3300025981 Bacteria 2739
735 Ga0207640_10086931 3300025981 Bacteria 2154
736 Ga0207677_10023672 3300026023 Bacteria 3798
737 Ga0207639_10000775 3300026041 Bacteria 21763
738 Ga0207639_10087607 3300026041 Bacteria 2482
739 Ga0207678_10021335 3300026067 Bacteria 5680
740 Ga0207678_10046708 3300026067 Bacteria 3745
741 Ga0207678_10065131 3300026067 Bacteria 3130
742 Ga0207678_10094558 3300026067 Bacteria 2554
743 Ga0207678_10114319 3300026067 Bacteria 2303
744 Ga0207678_10141824 3300026067 Bacteria 2051
745 Ga0207708_10135100 3300026075 Bacteria 1931
746 Ga0207702_10000253 3300026078 Bacteria 62073
747 Ga0207702_10028663 3300026078 Bacteria 4628
748 Ga0207641_10056434 3300026088 Bacteria 3338
749 Ga0207648_10025754 3300026089 Bacteria 5236
750 Ga0207674_10109869 3300026116 Bacteria 2733
751 Ga0207674_10118327 3300026116 Bacteria 2619
752 Ga0207674_10180564 3300026116 Bacteria 2062
753 Ga0207675_100068172 3300026118 Bacteria 3326
754 Ga0207675_100094940 3300026118 Bacteria 2805
755 Ga0207675_100320191 3300026118 Bacteria 1514
756 Ga0207683_10021857 3300026121 Bacteria 5486
757 Ga0207683_10058663 3300026121 Bacteria 3380
758 Ga0207683_10088966 3300026121 Bacteria 2748
759 Ga0207698_10126516 3300026142 Bacteria 2174
760 Ga0209281_1000016 3300027111 Bacteria 588107
761 Ga0209281_1000019 3300027111 Bacteria 576164
762 Ga0209281_1000924 3300027111 Bacteria 24292
763 Ga0209281_1001944 3300027111 Bacteria 9656
764 Ga0209281_1003285 3300027111 Bacteria 5475
765 Ga0209281_1016497 3300027111 Bacteria 1517
766 Ga0209281_1016715 3300027111 Bacteria 1503
767 Ga0209389_1000017 3300027296 Bacteria 180543
768 Ga0209389_1000100 3300027296 Bacteria 79023
769 Ga0209389_1000107 3300027296 Bacteria 74129
770 Ga0209371_1000151 3300027312 Bacteria 109594
771 Ga0209371_1000245 3300027312 Bacteria 67465
772 Ga0209371_1013286 3300027312 Bacteria 2324
773 Ga0209589_1000092 3300027357 Bacteria 89530
774 Ga0209969_1002270 3300027360 Bacteria 2649
775 Ga0209489_100006 3300027361 Bacteria 475698
776 Ga0209489_107740 3300027361 Bacteria 15589
777 Ga0209700_100005 3300027363 Bacteria 573969
778 Ga0209996_1002678 3300027395 Bacteria 2213
779 Ga0209995_1004381 3300027471 Bacteria 2256
780 Ga0209968_1003426 3300027526 Bacteria 2383
781 Ga0209983_1001634 3300027665 Bacteria 4962
782 Ga0209971_1000237 3300027682 Bacteria 15655
783 Ga0209998_10006573 3300027717 Bacteria 2416
784 Ga0209974_10003263 3300027876 Bacteria 5865
785 Ga0209974_10005244 3300027876 Bacteria 4573
786 Ga0209974_10011959 3300027876 Bacteria 2907
787 Ga0207428_10019373 3300027907 Bacteria 5803
788 Ga0207428_10027106 3300027907 Bacteria 4772
789 Ga0207428_10094936 3300027907 Bacteria 2311
790 Ga0207428_10115673 3300027907 Bacteria 2060
791 Ga0207428_10153492 3300027907 Bacteria 1752
792 Ga0207428_10172427 3300027907 Bacteria 1638
793 Ga0207428_10214373 3300027907 Bacteria 1446
794 Ga0268266_10019676 3300028379 Bacteria 5752
795 Ga0268266_10060264 3300028379 Bacteria 3271
796 Ga0268266_10085810 3300028379 Bacteria 2751
797 Ga0268266_10092832 3300028379 Bacteria 2649
798 Ga0268266_10156704 3300028379 Bacteria 2057
799 Ga0268266_10258037 3300028379 Bacteria 1614
800 Ga0268265_10168625 3300028380 Bacteria 1868
801 Ga0268264_10000065 3300028381 Bacteria 298403
802 Ga0268264_10158441 3300028381 Bacteria 2037
803 Ga0265334_10039460 3300028573 Bacteria 1853
804 Ga0265338_10203576 3300028800 Bacteria 1491
805 Ga0268256_1000050 3300030500 Bacteria 300675
806 Ga0268256_1000163 3300030500 Bacteria 83483
807 Ga0268256_1000201 3300030500 Bacteria 67997
808 Ga0268256_1014589 3300030500 Bacteria 2324
809 Ga0307511_10066924 3300030521 Bacteria 2672
810 Ga0314311_1099326 3300030733 Bacteria 5378
811 Ga0316179_1035710 3300030734 Bacteria 1472
812 Ga0316178_1008333 3300030735 Bacteria 44288
813 Ga0316178_1149028 3300030735 Bacteria 12196
814 Ga0316183_1030411 3300030742 Bacteria 2806
815 Ga0316181_1037347 3300030744 Bacteria 2724
816 Ga0265330_10022831 3300031235 Bacteria 2845
817 Ga0265328_10002795 3300031239 Bacteria 7811
818 Ga0265325_10009474 3300031241 Bacteria 5682
819 Ga0265340_10000523 3300031247 Bacteria 21161
820 Ga0265339_10058741 3300031249 Bacteria 2076
821 Ga0265327_10000315 3300031251 Bacteria 92454
822 Ga0265327_10003967 3300031251 Bacteria 13510
823 Ga0265316_10110520 3300031344 Bacteria 2081
824 Ga0307513_10193326 3300031456 Bacteria 1884
825 Ga0307509_10010951 3300031507 Bacteria 11053
826 Ga0307509_10079255 3300031507 Bacteria 3401
827 Ga0307408_100000002 3300031548 Bacteria 827227
828 Ga0307408_100022947 3300031548 Bacteria 4246
829 Ga0307408_100027281 3300031548 Bacteria 3933
830 Ga0307408_100031929 3300031548 Bacteria 3669
831 Ga0307408_100070276 3300031548 Bacteria 2584
832 Ga0307408_100094932 3300031548 Bacteria 2259
833 Ga0307408_100171761 3300031548 Bacteria 1731
834 Ga0307408_100188518 3300031548 Bacteria 1660
835 Ga0307508_10000018 3300031616 Bacteria 202701
836 Ga0307508_10044258 3300031616 Bacteria 3984
837 Ga0307508_10241022 3300031616 Bacteria 1405
838 Ga0307514_10001020 3300031649 Bacteria 40660
839 Ga0307516_10026957 3300031730 Bacteria 5831
840 Ga0307516_10048898 3300031730 Bacteria 4160
841 Ga0307516_10068537 3300031730 Bacteria 3416
842 Ga0307516_10178855 3300031730 Bacteria 1856
843 Ga0307516_10208602 3300031730 Bacteria 1669
844 Ga0307516_10227251 3300031730 Bacteria 1572
845 Ga0307405_10014846 3300031731 Bacteria 4201
846 Ga0307405_10024462 3300031731 Bacteria 3450
847 Ga0307405_10037461 3300031731 Bacteria 2914
848 Ga0307405_10092485 3300031731 Bacteria 2006
849 Ga0307405_10128733 3300031731 Bacteria 1745
850 Ga0307413_10014552 3300031824 Bacteria 4001
851 Ga0307413_10023143 3300031824 Bacteria 3362
852 Ga0307413_10031975 3300031824 Bacteria 2976
853 Ga0307413_10070878 3300031824 Bacteria 2193
854 Ga0307406_10034564 3300031901 Bacteria 3101
855 Ga0307406_10067092 3300031901 Bacteria 2337
856 Ga0307406_10096106 3300031901 Bacteria 2006
857 Ga0307406_10176535 3300031901 Bacteria 1551
858 Ga0307407_10021661 3300031903 Bacteria 3320
859 Ga0307407_10141511 3300031903 Bacteria 1552
860 Ga0307412_10000918 3300031911 Bacteria 16854
861 Ga0307412_10016127 3300031911 Bacteria 4442
862 Ga0307412_10039128 3300031911 Bacteria 3059
863 Ga0307409_100066784 3300031995 Bacteria 2837
864 Ga0307409_100093784 3300031995 Bacteria 2468
865 Ga0307409_100160375 3300031995 Bacteria 1966
866 Ga0307409_100164006 3300031995 Bacteria 1947
867 Ga0307416_100003094 3300032002 Bacteria 9732
868 Ga0307416_100268530 3300032002 Bacteria 1673
869 Ga0307414_10016650 3300032004 Bacteria 4475
870 Ga0307411_10033211 3300032005 Bacteria 3198
871 Ga0307411_10048225 3300032005 Bacteria 2760
872 Ga0307411_10110950 3300032005 Bacteria 1962
873 Ga0307411_10216930 3300032005 Bacteria 1481
874 Ga0307415_100001180 3300032126 Bacteria 12227
875 Ga0307415_100033511 3300032126 Bacteria 3335
876 Ga0307510_10002229 3300033180 Bacteria 21900
877 Ga0307510_10174285 3300033180 Bacteria 1724
878 Ga0307510_10226640 3300033180 Bacteria 1375
879 Ga0373934_0019123 3300035086 Bacteria 2626
880 Ga0373952_0026456 3300035092 Bacteria 1261
881 Ga0373923_0012445 3300035111 Bacteria 3145
882 Ga0373953_0004837 3300035117 Bacteria 4326
883 Ga0373953_0011650 3300035117 Bacteria 3093
884 Ga0373954_0022928 3300035118 Bacteria 2835
885 Ga0373956_0008939 3300035119 Bacteria 4060
886 Ga0373956_0015922 3300035119 Bacteria 3154
887 Ga0373957_0002127 3300035120 Bacteria 5574
888 Ga0373957_0004425 3300035120 Bacteria 4276
889 Ga0373955_0001054 3300035172 Bacteria 11740
890 Ga0373955_0005969 3300035172 Bacteria 5520
891 Ga0373955_0011701 3300035172 Bacteria 4193
892 Ga0373931_0024948 3300035691 Bacteria 3035
893 Ga0373931_0030359 3300035691 Bacteria 2782
894 Ga0373931_0126172 3300035691 Bacteria 1468
895 Ga0373935_0035794 3300035692 Bacteria 3099
896 Ga0373927_0004346 3300035695 Bacteria 9940
897 Ga0373927_0015919 3300035695 Bacteria 4963
898 Ga0373927_0020940 3300035695 Bacteria 4287
899 Ga0373927_0128631 3300035695 Bacteria 1654
900 Ga0373933_0000199 3300035724 Bacteria 39593
901 Ga0373947_0001007 3300035725 Bacteria 17183
902 Ga0373947_0023591 3300035725 Bacteria 3581
903 Ga0373937_0086454 3300036401 Bacteria 2901
904 Ga0373937_0258052 3300036401 Bacteria 1643
905 Ga0373925_0033053 3300037068 Bacteria 3811
906 Ga0373925_0144023 3300037068 Bacteria 1867
907 Ga0395899_0101302 3300037312 Bacteria 2079
908 Ga0395900_0000820 3300037418 Bacteria 41179
909 Ga0395900_0013685 3300037418 Bacteria 8283
910 Ga0395900_0053459 3300037418 Bacteria 4157
911 Ga0395900_0206035 3300037418 Bacteria 1988
912 Ga0395898_0012692 3300037466 Bacteria 8703
913 Ga0395898_0013589 3300037466 Bacteria 8379
914 Ga0395898_0026506 3300037466 Bacteria 5830
915 Ga0395898_0034063 3300037466 Bacteria 5079
916 Ga0395898_0112834 3300037466 Bacteria 2605
917 Ga0395898_0150848 3300037466 Bacteria 2224
918 Ga0395898_0234984 3300037466 Bacteria 1748
919 Ga0395898_0286713 3300037466 Bacteria 1571
920 Ga0395905_0000427 3300037471 Bacteria 58785
921 Ga0395905_0006498 3300037471 Bacteria 11758
922 Ga0395905_0027144 3300037471 Bacteria 5400
923 Ga0395905_0208735 3300037471 Bacteria 1830
924 Ga0436364_0105078 3300037853 Bacteria 3266
925 Ga0395901_0003090 3300038443 Bacteria 16741
926 Ga0395901_0066455 3300038443 Bacteria 3756
927 Ga0237819_01098 3300038705 Bacteria 7931
928 Ga0237819_02359 3300038705 Bacteria 3852
929 Ga0436365_0377156 3300039437 Bacteria 4468
930 Ga0436365_0760706 3300039437 Bacteria 1998
931 Ga0436365_1119744 3300039437 Bacteria 3600
932 Ga0436360_0105255 3300039438 Bacteria 5973
933 Ga0436361_0243524 3300039447 Bacteria 4792
934 Ga0436361_0328064 3300039447 Bacteria 5863
935 Ga0436361_0432976 3300039447 Bacteria 11064
936 Ga0436361_0463027 3300039447 Bacteria 3087
937 Ga0436363_0172435 3300039450 Bacteria 1291
938 Ga0436363_0600222 3300039450 Bacteria 4562
939 Ga0436363_1354384 3300039450 Bacteria 3755
940 Ga0439436_0000361 3300041404 Bacteria 11255
941 Ga0439438_000615 3300041405 Bacteria 16046
942 Ga0439438_001002 3300041405 Bacteria 12640
943 Ga0439438_003869 3300041405 Bacteria 5904
944 Ga0439438_004560 3300041405 Bacteria 5275
945 Ga0439438_004878 3300041405 Bacteria 5035
946 Ga0439438_006392 3300041405 Bacteria 4166
947 Ga0439438_007237 3300041405 Bacteria 3813
948 Ga0439438_007901 3300041405 Bacteria 3587
949 Ga0439438_009786 3300041405 Bacteria 3081
950 Ga0439438_017683 3300041405 Bacteria 2045
951 Ga0439438_018507 3300041405 Bacteria 1982
952 Ga0439438_024015 3300041405 Bacteria 1673
953 Ga0439447_000445 3300041407 Bacteria 15381
954 Ga0439447_001182 3300041407 Bacteria 9512
955 Ga0439447_001332 3300041407 Bacteria 9002
956 Ga0439447_001366 3300041407 Bacteria 8914
957 Ga0439447_003423 3300041407 Bacteria 5642
958 Ga0439447_003817 3300041407 Bacteria 5289
959 Ga0439447_004221 3300041407 Bacteria 4983
960 Ga0439447_008152 3300041407 Bacteria 3264
961 Ga0439447_017232 3300041407 Bacteria 1968
962 Ga0439447_018163 3300041407 Bacteria 1901
963 Ga0439447_021098 3300041407 Bacteria 1719
964 Ga0439466_0000466 3300041411 Bacteria 15422
965 Ga0439466_0000587 3300041411 Bacteria 13635
966 Ga0439466_0000965 3300041411 Bacteria 11052
967 Ga0439466_0001135 3300041411 Bacteria 10378
968 Ga0439466_0002245 3300041411 Bacteria 7567
969 Ga0439466_0003958 3300041411 Bacteria 5714
970 Ga0439466_0006786 3300041411 Bacteria 4343
971 Ga0439466_0009861 3300041411 Bacteria 3558
972 Ga0439466_0013317 3300041411 Bacteria 3011
973 Ga0439466_0015682 3300041411 Bacteria 2751
974 Ga0439466_0036674 3300041411 Bacteria 1654
975 Ga0439466_0042605 3300041411 Bacteria 1510
976 Ga0439466_0047845 3300041411 Bacteria 1408
977 Ga0439431_0010407 3300041997 Bacteria 2111
978 Ga0439431_0014036 3300041997 Bacteria 1853
979 Ga0439437_000505 3300042000 Bacteria 3872
980 Ga0439432_001382 3300042006 Bacteria 9197
981 Ga0439432_001621 3300042006 Bacteria 8420
982 Ga0439432_002018 3300042006 Bacteria 7686
983 Ga0439432_003032 3300042006 Bacteria 6254
984 Ga0439432_004689 3300042006 Bacteria 4982
985 Ga0439432_013930 3300042006 Bacteria 2726
986 Ga0439432_021256 3300042006 Bacteria 2153
987 Ga0439432_024336 3300042006 Bacteria 1990
988 Ga0439432_037495 3300042006 Bacteria 1546
989 Ga0439451_001456 3300042009 Bacteria 4677
990 Ga0439451_001929 3300042009 Bacteria 4143
991 Ga0439451_003084 3300042009 Bacteria 3387
992 Ga0439451_007294 3300042009 Bacteria 2256
993 Ga0439451_020102 3300042009 Bacteria 1345
994 Ga0439452_000566 3300042010 Bacteria 19317
995 Ga0439452_000592 3300042010 Bacteria 18631
996 Ga0439452_001275 3300042010 Bacteria 10700
997 Ga0439452_003753 3300042010 Bacteria 5231
998 Ga0439452_004104 3300042010 Bacteria 4951
999 Ga0439452_004757 3300042010 Bacteria 4487
1000 Ga0439452_006994 3300042010 Bacteria 3487
1001 Ga0439452_007409 3300042010 Bacteria 3363
1002 Ga0439452_011662 3300042010 Bacteria 2518
1003 Ga0439452_012826 3300042010 Bacteria 2370
1004 Ga0439452_016282 3300042010 Bacteria 2021
1005 Ga0439452_016780 3300042010 Bacteria 1981
1006 Ga0439452_029753 3300042010 Bacteria 1352
1007 Ga0439456_000058 3300042013 Bacteria 39602
1008 Ga0439456_001721 3300042013 Bacteria 4416
1009 Ga0439456_006645 3300042013 Bacteria 2366
1010 Ga0439456_013403 3300042013 Bacteria 1705
1011 Ga0439456_015616 3300042013 Bacteria 1586
1012 Ga0439456_026385 3300042013 Bacteria 1235
1013 Ga0439463_002333 3300042016 Bacteria 4842
1014 Ga0439463_002378 3300042016 Bacteria 4793
1015 Ga0439463_002471 3300042016 Bacteria 4693
1016 Ga0439463_014864 3300042016 Bacteria 1922
1017 Ga0450911_000304 3300042115 Bacteria 17754
1018 Ga0450911_002622 3300042115 Bacteria 3457
1019 Ga0450911_003135 3300042115 Bacteria 2995
1020 Ga0450919_001027 3300042121 Bacteria 3610
1021 Ga0450923_015542 3300042125 Bacteria 1425
1022 Ga0450890_000509 3300042127 Bacteria 5716
1023 Ga0450896_000896 3300042133 Bacteria 3426
1024 Ga0450900_003575 3300042136 Bacteria 1733
1025 Ga0450902_003775 3300042137 Bacteria 2234
1026 Ga0450903_002311 3300042138 Bacteria 3400
1027 Ga0450903_004485 3300042138 Bacteria 2379
1028 Ga0450904_004837 3300042139 Bacteria 1384
1029 Ga0450906_000672 3300042145 Bacteria 7317
1030 Ga0450906_001379 3300042145 Bacteria 5297
1031 Ga0450906_009937 3300042145 Bacteria 1806
1032 Ga0450907_001254 3300042146 Bacteria 5697
1033 Ga0450907_001751 3300042146 Bacteria 4494
1034 Ga0450907_003353 3300042146 Bacteria 2870
1035 Ga0450907_004826 3300042146 Bacteria 2303
1036 Ga0450910_004099 3300042147 Bacteria 1961
1037 Ga0439446_0001826 3300042156 Bacteria 4980
1038 Ga0439446_0002288 3300042156 Bacteria 4573
1039 Ga0439446_0006254 3300042156 Bacteria 3098
1040 Ga0450908_001960 3300042184 Bacteria 4033
1041 Ga0450908_003021 3300042184 Bacteria 3283
1042 Ga0450908_003622 3300042184 Bacteria 3003
1043 Ga0450909_001991 3300042185 Bacteria 2881
1044 Ga0439434_0000153 3300042435 Bacteria 18390
1045 Ga0439434_0003416 3300042435 Bacteria 4641
1046 Ga0439434_0004552 3300042435 Bacteria 4056
1047 Ga0439435_0001752 3300042436 Bacteria 4121
1048 Ga0439444_0003265 3300042437 Bacteria 2281
1049 Ga0439464_0001520 3300042439 Bacteria 5489
1050 Ga0439464_0002231 3300042439 Bacteria 4739
1051 Ga0439464_0060035 3300042439 Bacteria 1112
1052 Ga0439460_0000875 3300042461 Bacteria 6881
1053 Ga0439460_0005509 3300042461 Bacteria 3109
1054 Ga0439460_0006176 3300042461 Bacteria 2962
1055 Ga0450918_004797 3300042531 Bacteria 2447
1056 Ga0451577_0096507 3300042876 Bacteria 2639
1057 Ga0439440_0006226 3300042993 Bacteria 2396
1058 Ga0439440_0008256 3300042993 Bacteria 2133
1059 Ga0439440_0011398 3300042993 Bacteria 1873
1060 Ga0439440_0018048 3300042993 Bacteria 1559
1061 Ga0466969_0000830 3300044656 Bacteria 16802
1062 Ga0466969_0008238 3300044656 Bacteria 5530
1063 Ga0466969_0016791 3300044656 Bacteria 3827
1064 Ga0466972_0000846 3300044658 Bacteria 14671
1065 Ga0466972_0003419 3300044658 Bacteria 7876
1066 Ga0466965_0000692 3300044683 Bacteria 12482
1067 Ga0466965_0001897 3300044683 Bacteria 8716
1068 Ga0466965_0008515 3300044683 Bacteria 4744
1069 Ga0466966_0012649 3300044684 Bacteria 5593
1070 Ga0466966_0025143 3300044684 Bacteria 3891
1071 Ga0466966_0025890 3300044684 Bacteria 3832
1072 Ga0466961_0000519 3300044693 Bacteria 24528
1073 Ga0466961_0008582 3300044693 Bacteria 6510
1074 Ga0466961_0019605 3300044693 Bacteria 4351
1075 Ga0466963_0134214 3300044694 Bacteria 1712
1076 Ga0466964_0006744 3300044706 Bacteria 4282
1077 Ga0466968_0045894 3300044735 Bacteria 1855
1078 Ga0466968_0070883 3300044735 Bacteria 1517
1079 Ga0466970_0053441 3300044765 Bacteria 2157
1080 Ga0466957_0002678 3300044842 Bacteria 9618
1081 Ga0466957_0021128 3300044842 Bacteria 3833
1082 Ga0466960_0019222 3300044901 Bacteria 3007
1083 Ga0466960_0049535 3300044901 Bacteria 2022
1084 Ga0466959_0003326 3300045049 Bacteria 10501
1085 Ga0466959_0052408 3300045049 Bacteria 2988
1086 Ga0466959_0085574 3300045049 Bacteria 2268
1087 Ga0466958_0155860 3300045836 Bacteria 1441
1088 Ga0466967_0058693 3300045976 Bacteria 3402
1089 Ga0466967_0134031 3300045976 Bacteria 2302
1090 Ga0466967_0352232 3300045976 Bacteria 1425
1091 Ga0495617_003398 3300046452 Bacteria 5999
1092 Ga0495617_014034 3300046452 Bacteria 2722
1093 Ga0495617_024452 3300046452 Bacteria 2038
1094 Ga0495617_027869 3300046452 Bacteria 1899
1095 Ga0495617_046184 3300046452 Bacteria 1451
1096 Ga0495617_047126 3300046452 Bacteria 1435
1097 Ga0495627_000102 3300046453 Bacteria 104889
1098 Ga0495627_000415 3300046453 Bacteria 37684
1099 Ga0495627_004313 3300046453 Bacteria 5977
1100 Ga0495627_014046 3300046453 Bacteria 2806
1101 Ga0495627_022656 3300046453 Bacteria 2064
1102 Ga0495592_0034429 3300046454 Bacteria 3817
1103 Ga0495592_0137254 3300046454 Bacteria 1704
1104 Ga0495603_0001705 3300046455 Bacteria 12940
1105 Ga0495603_0004420 3300046455 Bacteria 8380
1106 Ga0495603_0010552 3300046455 Bacteria 5595
1107 Ga0495603_0011469 3300046455 Bacteria 5365
1108 Ga0495603_0035234 3300046455 Bacteria 3006
1109 Ga0495603_0035626 3300046455 Bacteria 2989
1110 Ga0495603_0052036 3300046455 Bacteria 2432
1111 Ga0495603_0153418 3300046455 Bacteria 1337
1112 Ga0495590_0004917 3300046457 Bacteria 5339
1113 Ga0495590_0025192 3300046457 Bacteria 2092
1114 Ga0495590_0056214 3300046457 Bacteria 1375
1115 Ga0495591_000009 3300046458 Bacteria 331626
1116 Ga0495591_000021 3300046458 Bacteria 203554
1117 Ga0495591_000105 3300046458 Bacteria 97199
1118 Ga0495591_000975 3300046458 Bacteria 19539
1119 Ga0495591_003166 3300046458 Bacteria 8682
1120 Ga0495591_004959 3300046458 Bacteria 6303
1121 Ga0495591_006424 3300046458 Bacteria 5196
1122 Ga0495591_008144 3300046458 Bacteria 4326
1123 Ga0495591_015032 3300046458 Bacteria 2751
1124 Ga0495591_019551 3300046458 Bacteria 2262
1125 Ga0495591_022014 3300046458 Bacteria 2068
1126 Ga0495591_024804 3300046458 Bacteria 1892
1127 Ga0495591_035759 3300046458 Bacteria 1450
1128 Ga0495629_0000606 3300046459 Bacteria 29232
1129 Ga0495629_0002560 3300046459 Bacteria 13946
1130 Ga0495629_0005229 3300046459 Bacteria 9706
1131 Ga0495629_0086057 3300046459 Bacteria 2193
1132 Ga0495629_0164015 3300046459 Bacteria 1543
1133 Ga0495638_0023142 3300046460 Bacteria 4068
1134 Ga0495638_0037952 3300046460 Bacteria 3063
1135 Ga0495638_0040974 3300046460 Bacteria 2932
1136 Ga0495638_0044398 3300046460 Bacteria 2799
1137 Ga0495638_0056158 3300046460 Bacteria 2443
1138 Ga0495638_0081891 3300046460 Bacteria 1958
1139 Ga0495638_0094163 3300046460 Bacteria 1800
1140 Ga0495638_0117552 3300046460 Bacteria 1573
1141 Ga0495641_0016685 3300046461 Bacteria 3858
1142 Ga0495651_0093750 3300046462 Bacteria 2247
1143 Ga0495653_0010997 3300046463 Bacteria 7405
1144 Ga0495653_0022923 3300046463 Bacteria 5049
1145 Ga0495653_0032449 3300046463 Bacteria 4145
1146 Ga0495653_0043147 3300046463 Bacteria 3508
1147 Ga0495653_0048713 3300046463 Bacteria 3269
1148 Ga0495653_0050907 3300046463 Bacteria 3183
1149 Ga0495653_0067297 3300046463 Bacteria 2690
1150 Ga0495653_0111731 3300046463 Bacteria 1962
1151 Ga0495650_0000578 3300046471 Bacteria 51315
1152 Ga0495650_0005356 3300046471 Bacteria 8369
1153 Ga0495650_0015211 3300046471 Bacteria 3956
1154 Ga0495650_0026268 3300046471 Bacteria 2711
1155 Ga0495650_0040949 3300046471 Bacteria 1984
1156 Ga0495650_0041090 3300046471 Bacteria 1980
1157 Ga0495650_0044530 3300046471 Bacteria 1874
1158 Ga0495650_0074066 3300046471 Bacteria 1328
1159 Ga0495580_0001160 3300046472 Bacteria 23154
1160 Ga0495580_0002907 3300046472 Bacteria 14718
1161 Ga0495582_0000174 3300046473 Bacteria 34996
1162 Ga0495582_0035013 3300046473 Bacteria 2760
1163 Ga0495582_0174550 3300046473 Bacteria 1224
1164 Ga0495605_0000391 3300046474 Bacteria 40370
1165 Ga0495605_0000625 3300046474 Bacteria 27283
1166 Ga0495605_0001226 3300046474 Bacteria 17066
1167 Ga0495605_0001398 3300046474 Bacteria 15876
1168 Ga0495605_0008521 3300046474 Bacteria 5794
1169 Ga0495605_0010112 3300046474 Bacteria 5284
1170 Ga0495605_0014816 3300046474 Bacteria 4255
1171 Ga0495605_0019111 3300046474 Bacteria 3666
1172 Ga0495605_0019400 3300046474 Bacteria 3630
1173 Ga0495605_0027479 3300046474 Bacteria 2947
1174 Ga0495605_0027696 3300046474 Bacteria 2934
1175 Ga0495605_0055637 3300046474 Bacteria 1910
1176 Ga0495605_0056061 3300046474 Bacteria 1901
1177 Ga0495605_0056996 3300046474 Bacteria 1882
1178 Ga0495605_0072234 3300046474 Bacteria 1627
1179 Ga0495605_0090222 3300046474 Bacteria 1421
1180 Ga0495605_0095699 3300046474 Bacteria 1370
1181 Ga0495639_0000037 3300046475 Bacteria 58725
1182 Ga0495639_0000136 3300046475 Bacteria 37792
1183 Ga0495639_0003111 3300046475 Bacteria 7214
1184 Ga0495639_0015202 3300046475 Bacteria 3335
1185 Ga0495662_0000723 3300046476 Bacteria 15781
1186 Ga0495664_0015166 3300046477 Bacteria 4379
1187 Ga0495584_0009566 3300046491 Bacteria 4993
1188 Ga0495584_0011363 3300046491 Bacteria 4560
1189 Ga0495584_0012700 3300046491 Bacteria 4298
1190 Ga0495584_0015742 3300046491 Bacteria 3856
1191 Ga0495584_0019702 3300046491 Bacteria 3427
1192 Ga0495584_0020473 3300046491 Bacteria 3360
1193 Ga0495584_0020644 3300046491 Bacteria 3345
1194 Ga0495584_0029229 3300046491 Bacteria 2793
1195 Ga0495584_0031836 3300046491 Bacteria 2669
1196 Ga0495584_0041164 3300046491 Bacteria 2332
1197 Ga0495584_0044159 3300046491 Bacteria 2249
1198 Ga0495584_0054801 3300046491 Bacteria 2006
1199 Ga0495584_0107262 3300046491 Bacteria 1412
1200 Ga0495585_0000811 3300046492 Bacteria 27233
1201 Ga0495585_0005628 3300046492 Bacteria 7869
1202 Ga0495585_0007063 3300046492 Bacteria 6904
1203 Ga0495585_0010687 3300046492 Bacteria 5452
1204 Ga0495585_0025626 3300046492 Bacteria 3375
1205 Ga0495585_0028569 3300046492 Bacteria 3180
1206 Ga0495585_0032083 3300046492 Bacteria 2977
1207 Ga0495585_0041729 3300046492 Bacteria 2572
1208 Ga0495585_0044397 3300046492 Bacteria 2483
1209 Ga0495585_0094590 3300046492 Bacteria 1605
1210 Ga0495585_0100931 3300046492 Bacteria 1543
1211 Ga0495594_0002231 3300046499 Bacteria 10081
1212 Ga0495594_0015297 3300046499 Bacteria 4028
1213 Ga0495594_0021768 3300046499 Bacteria 3423
1214 Ga0495594_0052184 3300046499 Bacteria 2251
1215 Ga0495594_0086633 3300046499 Bacteria 1752
1216 Ga0495594_0177146 3300046499 Bacteria 1213
1217 Ga0495596_0000128 3300046500 Bacteria 52409
1218 Ga0495596_0004395 3300046500 Bacteria 6880
1219 Ga0495607_0000637 3300046501 Bacteria 34042
1220 Ga0495607_0001133 3300046501 Bacteria 24182
1221 Ga0495607_0001191 3300046501 Bacteria 23475
1222 Ga0495607_0001249 3300046501 Bacteria 22783
1223 Ga0495607_0001267 3300046501 Bacteria 22574
1224 Ga0495607_0004588 3300046501 Bacteria 10120
1225 Ga0495607_0005049 3300046501 Bacteria 9572
1226 Ga0495607_0006036 3300046501 Bacteria 8581
1227 Ga0495607_0008940 3300046501 Bacteria 6818
1228 Ga0495607_0013525 3300046501 Bacteria 5346
1229 Ga0495607_0024248 3300046501 Bacteria 3784
1230 Ga0495607_0025959 3300046501 Bacteria 3638
1231 Ga0495607_0031220 3300046501 Bacteria 3262
1232 Ga0495607_0037662 3300046501 Bacteria 2903
1233 Ga0495607_0045134 3300046501 Bacteria 2594
1234 Ga0495607_0052194 3300046501 Bacteria 2369
1235 Ga0495607_0064247 3300046501 Bacteria 2073
1236 Ga0495607_0072460 3300046501 Bacteria 1917
1237 Ga0495607_0078102 3300046501 Bacteria 1827
1238 Ga0495607_0086628 3300046501 Bacteria 1707
1239 Ga0495607_0101501 3300046501 Bacteria 1540
1240 Ga0495607_0137948 3300046501 Bacteria 1261
1241 Ga0495583_0000015 3300046506 Bacteria 316392
1242 Ga0495583_0000018 3300046506 Bacteria 306541
1243 Ga0495583_0002642 3300046506 Bacteria 14945
1244 Ga0495583_0004981 3300046506 Bacteria 9213
1245 Ga0495583_0013180 3300046506 Bacteria 4627
1246 Ga0495583_0022237 3300046506 Bacteria 3240
1247 Ga0495583_0026524 3300046506 Bacteria 2870
1248 Ga0495583_0058088 3300046506 Bacteria 1737
1249 Ga0495606_0000083 3300046507 Bacteria 159263
1250 Ga0495606_0000870 3300046507 Bacteria 45205
1251 Ga0495606_0003754 3300046507 Bacteria 15805
1252 Ga0495606_0004670 3300046507 Bacteria 13535
1253 Ga0495606_0005953 3300046507 Bacteria 11444
1254 Ga0495606_0008185 3300046507 Bacteria 9147
1255 Ga0495606_0015235 3300046507 Bacteria 5936
1256 Ga0495606_0015967 3300046507 Bacteria 5752
1257 Ga0495606_0018166 3300046507 Bacteria 5285
1258 Ga0495606_0027999 3300046507 Bacteria 3983
1259 Ga0495606_0043525 3300046507 Bacteria 2993
1260 Ga0495606_0047295 3300046507 Bacteria 2836
1261 Ga0495606_0053925 3300046507 Bacteria 2606
1262 Ga0495606_0059263 3300046507 Bacteria 2456
1263 Ga0495606_0065212 3300046507 Bacteria 2314
1264 Ga0495606_0093753 3300046507 Bacteria 1841
1265 Ga0495606_0160229 3300046507 Bacteria 1313
1266 Ga0495608_0028145 3300046511 Bacteria 3820
1267 Ga0495610_0009929 3300046512 Bacteria 5954
1268 Ga0495610_0011079 3300046512 Bacteria 5538
1269 Ga0495610_0023829 3300046512 Bacteria 3318
1270 Ga0495610_0029404 3300046512 Bacteria 2893
1271 Ga0495610_0029705 3300046512 Bacteria 2874
1272 Ga0495610_0038049 3300046512 Bacteria 2443
1273 Ga0495610_0040034 3300046512 Bacteria 2365
1274 Ga0495610_0056657 3300046512 Bacteria 1883
1275 Ga0495610_0064906 3300046512 Bacteria 1724
1276 Ga0495610_0065149 3300046512 Bacteria 1720
1277 Ga0495616_0000853 3300046513 Bacteria 22214
1278 Ga0495616_0014537 3300046513 Bacteria 4403
1279 Ga0495616_0030952 3300046513 Bacteria 2807
1280 Ga0495616_0031789 3300046513 Bacteria 2761
1281 Ga0495616_0032179 3300046513 Bacteria 2742
1282 Ga0495616_0041414 3300046513 Bacteria 2349
1283 Ga0495616_0047880 3300046513 Bacteria 2150
1284 Ga0495616_0054876 3300046513 Bacteria 1975
1285 Ga0495616_0057796 3300046513 Bacteria 1912
1286 Ga0495616_0079499 3300046513 Bacteria 1571
1287 Ga0495618_0095258 3300046514 Bacteria 1904
1288 Ga0495618_0115837 3300046514 Bacteria 1716
1289 Ga0495620_0000171 3300046515 Bacteria 51260
1290 Ga0495620_0000229 3300046515 Bacteria 41859
1291 Ga0495620_0000231 3300046515 Bacteria 41704
1292 Ga0495620_0005486 3300046515 Bacteria 7069
1293 Ga0495620_0005705 3300046515 Bacteria 6930
1294 Ga0495620_0013289 3300046515 Bacteria 4221
1295 Ga0495620_0014267 3300046515 Bacteria 4042
1296 Ga0495620_0021445 3300046515 Bacteria 3137
1297 Ga0495620_0021774 3300046515 Bacteria 3105
1298 Ga0495620_0042846 3300046515 Bacteria 1974
1299 Ga0495628_0042406 3300046516 Bacteria 3629
1300 Ga0495628_0057728 3300046516 Bacteria 3053
1301 Ga0495628_0125305 3300046516 Bacteria 1968
1302 Ga0495630_0002539 3300046517 Bacteria 12659
1303 Ga0495631_0000018 3300046518 Bacteria 95764
1304 Ga0495631_0004242 3300046518 Bacteria 7670
1305 Ga0495631_0023548 3300046518 Bacteria 2853
1306 Ga0495631_0030185 3300046518 Bacteria 2460
1307 Ga0495631_0107052 3300046518 Bacteria 1202
1308 Ga0495632_0003754 3300046519 Bacteria 10623
1309 Ga0495632_0003848 3300046519 Bacteria 10444
1310 Ga0495632_0008782 3300046519 Bacteria 6156
1311 Ga0495632_0015328 3300046519 Bacteria 4303
1312 Ga0495632_0016111 3300046519 Bacteria 4167
1313 Ga0495632_0016447 3300046519 Bacteria 4115
1314 Ga0495632_0018908 3300046519 Bacteria 3765
1315 Ga0495632_0022095 3300046519 Bacteria 3416
1316 Ga0495632_0023753 3300046519 Bacteria 3268
1317 Ga0495632_0043632 3300046519 Bacteria 2240
1318 Ga0495632_0057379 3300046519 Bacteria 1900
1319 Ga0495632_0078600 3300046519 Bacteria 1576
1320 Ga0495632_0081149 3300046519 Bacteria 1546
1321 Ga0495637_0000271 3300046520 Bacteria 40891
1322 Ga0495637_0001100 3300046520 Bacteria 16650
1323 Ga0495637_0001227 3300046520 Bacteria 15550
1324 Ga0495637_0001301 3300046520 Bacteria 14990
1325 Ga0495637_0001531 3300046520 Bacteria 13511
1326 Ga0495637_0002729 3300046520 Bacteria 9620
1327 Ga0495637_0005947 3300046520 Bacteria 6169
1328 Ga0495637_0008829 3300046520 Bacteria 4934
1329 Ga0495637_0015531 3300046520 Bacteria 3571
1330 Ga0495637_0018657 3300046520 Bacteria 3214
1331 Ga0495637_0023917 3300046520 Bacteria 2766
1332 Ga0495637_0024971 3300046520 Bacteria 2699
1333 Ga0495637_0026881 3300046520 Bacteria 2578
1334 Ga0495637_0033102 3300046520 Bacteria 2273
1335 Ga0495637_0034975 3300046520 Bacteria 2196
1336 Ga0495637_0039184 3300046520 Bacteria 2046
1337 Ga0495637_0046376 3300046520 Bacteria 1838
1338 Ga0495643_0002030 3300046522 Bacteria 16840
1339 Ga0495643_0007948 3300046522 Bacteria 6763
1340 Ga0495643_0011277 3300046522 Bacteria 5453
1341 Ga0495643_0012620 3300046522 Bacteria 5089
1342 Ga0495643_0017811 3300046522 Bacteria 4143
1343 Ga0495643_0022708 3300046522 Bacteria 3574
1344 Ga0495643_0024343 3300046522 Bacteria 3435
1345 Ga0495643_0033048 3300046522 Bacteria 2865
1346 Ga0495643_0035776 3300046522 Bacteria 2732
1347 Ga0495643_0040043 3300046522 Bacteria 2560
1348 Ga0495643_0074639 3300046522 Bacteria 1775
1349 Ga0495644_0005075 3300046523 Bacteria 5152
1350 Ga0495644_0011302 3300046523 Bacteria 3437
1351 Ga0495644_0013763 3300046523 Bacteria 3101
1352 Ga0495644_0023365 3300046523 Bacteria 2354
1353 Ga0495644_0023779 3300046523 Bacteria 2331
1354 Ga0495644_0029586 3300046523 Bacteria 2069
1355 Ga0495644_0046782 3300046523 Bacteria 1626
1356 Ga0495648_0005418 3300046524 Bacteria 10604
1357 Ga0495648_0013922 3300046524 Bacteria 5922
1358 Ga0495648_0022735 3300046524 Bacteria 4308
1359 Ga0495648_0029830 3300046524 Bacteria 3614
1360 Ga0495648_0030147 3300046524 Bacteria 3591
1361 Ga0495648_0030158 3300046524 Bacteria 3590
1362 Ga0495648_0037236 3300046524 Bacteria 3128
1363 Ga0495648_0038267 3300046524 Bacteria 3070
1364 Ga0495648_0049635 3300046524 Bacteria 2570
1365 Ga0495648_0056277 3300046524 Bacteria 2366
1366 Ga0495648_0065283 3300046524 Bacteria 2140
1367 Ga0495648_0076749 3300046524 Bacteria 1917
1368 Ga0495648_0084817 3300046524 Bacteria 1791
1369 Ga0495648_0089855 3300046524 Bacteria 1722
1370 Ga0495648_0092480 3300046524 Bacteria 1689
1371 Ga0495648_0109489 3300046524 Bacteria 1506
1372 Ga0495648_0115655 3300046524 Bacteria 1450
1373 Ga0495648_0125110 3300046524 Bacteria 1375
1374 Ga0495648_0138248 3300046524 Bacteria 1285
1375 Ga0495666_0016976 3300046526 Bacteria 3623
1376 Ga0495666_0046651 3300046526 Bacteria 2088
1377 Ga0495666_0051646 3300046526 Bacteria 1974
1378 Ga0495642_0000209 3300046528 Bacteria 34265
1379 Ga0495642_0000631 3300046528 Bacteria 17653
1380 Ga0495642_0008604 3300046528 Bacteria 3903
1381 Ga0495642_0009876 3300046528 Bacteria 3657
1382 Ga0495642_0012032 3300046528 Bacteria 3333
1383 Ga0495652_0028480 3300046529 Bacteria 4914
1384 Ga0495652_0056391 3300046529 Bacteria 3336
1385 Ga0495654_0000253 3300046530 Bacteria 48877
1386 Ga0495654_0001197 3300046530 Bacteria 18448
1387 Ga0495654_0005941 3300046530 Bacteria 7014
1388 Ga0495654_0006795 3300046530 Bacteria 6459
1389 Ga0495654_0015100 3300046530 Bacteria 4104
1390 Ga0495654_0015523 3300046530 Bacteria 4042
1391 Ga0495654_0015833 3300046530 Bacteria 3998
1392 Ga0495654_0016359 3300046530 Bacteria 3924
1393 Ga0495654_0019163 3300046530 Bacteria 3579
1394 Ga0495654_0019167 3300046530 Bacteria 3579
1395 Ga0495654_0021575 3300046530 Bacteria 3349
1396 Ga0495654_0031574 3300046530 Bacteria 2688
1397 Ga0495654_0042724 3300046530 Bacteria 2248
1398 Ga0495654_0043164 3300046530 Bacteria 2236
1399 Ga0495654_0070144 3300046530 Bacteria 1662
1400 Ga0495654_0073453 3300046530 Bacteria 1617
1401 Ga0495654_0073951 3300046530 Bacteria 1610
1402 Ga0495654_0076462 3300046530 Bacteria 1577
1403 Ga0495654_0109268 3300046530 Bacteria 1263
1404 Ga0495665_0000026 3300046531 Bacteria 56855
1405 Ga0495640_0005169 3300046533 Bacteria 10379
1406 Ga0495640_0027293 3300046533 Bacteria 4119
1407 Ga0495640_0040414 3300046533 Bacteria 3266
1408 Ga0495586_0030142 3300046535 Bacteria 2903
1409 Ga0495587_0007618 3300046536 Bacteria 7008
1410 Ga0495587_0057032 3300046536 Bacteria 2297
1411 Ga0495598_0024381 3300046537 Bacteria 1640
1412 Ga0495609_0000458 3300046538 Bacteria 33250
1413 Ga0495609_0000759 3300046538 Bacteria 24242
1414 Ga0495609_0001158 3300046538 Bacteria 18191
1415 Ga0495609_0003174 3300046538 Bacteria 9560
1416 Ga0495609_0005475 3300046538 Bacteria 6655
1417 Ga0495609_0009928 3300046538 Bacteria 4586
1418 Ga0495609_0042360 3300046538 Bacteria 2044
1419 Ga0495609_0064848 3300046538 Bacteria 1610
1420 Ga0495621_0037192 3300046539 Bacteria 1692
1421 Ga0495597_0000221 3300046542 Bacteria 52360
1422 Ga0495597_0005155 3300046542 Bacteria 6962
1423 Ga0495597_0006213 3300046542 Bacteria 6196
1424 Ga0495597_0012962 3300046542 Bacteria 4003
1425 Ga0495597_0039743 3300046542 Bacteria 2104
1426 Ga0495597_0057264 3300046542 Bacteria 1705
1427 Ga0495597_0093887 3300046542 Bacteria 1270
1428 Ga0495597_0095516 3300046542 Bacteria 1257
1429 Ga0495597_0101449 3300046542 Bacteria 1213
1430 Ga0495645_0016528 3300046543 Bacteria 5271
1431 Ga0495645_0072329 3300046543 Bacteria 2485
1432 Ga0495622_0000202 3300046557 Bacteria 47328
1433 Ga0495622_0000446 3300046557 Bacteria 26677
1434 Ga0495622_0002873 3300046557 Bacteria 8224
1435 Ga0495622_0021988 3300046557 Bacteria 2971
1436 Ga0495622_0027108 3300046557 Bacteria 2673
1437 Ga0495633_0000115 3300046558 Bacteria 108676
1438 Ga0495633_0002236 3300046558 Bacteria 13846
1439 Ga0495633_0021030 3300046558 Bacteria 3269
1440 Ga0495633_0100729 3300046558 Bacteria 1341
1441 Ga0495633_0113237 3300046558 Bacteria 1258
1442 Ga0495667_0011698 3300046559 Bacteria 5942
1443 Ga0495667_0013735 3300046559 Bacteria 5472
1444 Ga0495667_0023096 3300046559 Bacteria 4190
1445 Ga0495667_0151761 3300046559 Bacteria 1492
1446 Ga0495656_0003150 3300046615 Bacteria 5551
1447 Ga0495656_0008181 3300046615 Bacteria 3724
1448 Ga0495668_0007092 3300046616 Bacteria 7214
1449 Ga0495668_0009606 3300046616 Bacteria 5919
1450 Ga0495668_0017608 3300046616 Bacteria 4140
1451 Ga0495668_0018591 3300046616 Bacteria 4015
1452 Ga0495634_0000634 3300046642 Bacteria 34163
1453 Ga0495634_0019357 3300046642 Bacteria 4838
1454 Ga0495634_0030773 3300046642 Bacteria 3703
1455 Ga0495611_0003126 3300046648 Bacteria 7342
1456 Ga0495611_0026380 3300046648 Bacteria 2535
1457 Ga0495625_0000187 3300046660 Bacteria 97797
1458 Ga0495625_0003633 3300046660 Bacteria 15129
1459 Ga0495625_0003893 3300046660 Bacteria 14383
1460 Ga0495625_0023162 3300046660 Bacteria 4746
1461 Ga0495625_0055159 3300046660 Bacteria 2835
1462 Ga0495625_0067465 3300046660 Bacteria 2517
1463 Ga0495625_0076637 3300046660 Bacteria 2337
1464 Ga0495625_0084434 3300046660 Bacteria 2205
1465 Ga0495625_0084474 3300046660 Bacteria 2204
1466 Ga0495625_0102481 3300046660 Bacteria 1964
1467 Ga0495625_0120157 3300046660 Bacteria 1789
1468 Ga0495625_0120513 3300046660 Bacteria 1785
1469 Ga0495625_0124201 3300046660 Bacteria 1753
1470 Ga0495625_0143060 3300046660 Bacteria 1612
1471 Ga0495625_0212910 3300046660 Bacteria 1269
1472 Ga0495635_0001841 3300046663 Bacteria 14351
1473 Ga0495635_0003370 3300046663 Bacteria 11036
1474 Ga0495635_0004062 3300046663 Bacteria 10158
1475 Ga0495635_0020678 3300046663 Bacteria 4584
1476 Ga0495635_0025341 3300046663 Bacteria 4130
1477 Ga0495635_0040672 3300046663 Bacteria 3213
1478 Ga0495659_0000061 3300046664 Bacteria 48142
1479 Ga0495659_0003345 3300046664 Bacteria 5140
1480 Ga0495659_0009058 3300046664 Bacteria 3173
1481 Ga0495659_0013842 3300046664 Bacteria 2632
1482 Ga0495659_0019089 3300046664 Bacteria 2291
1483 Ga0495659_0028157 3300046664 Bacteria 1943
1484 Ga0495661_0000061 3300046665 Bacteria 130811
1485 Ga0495661_0000865 3300046665 Bacteria 28200
1486 Ga0495661_0002054 3300046665 Bacteria 15804
1487 Ga0495661_0002403 3300046665 Bacteria 14449
1488 Ga0495661_0019070 3300046665 Bacteria 4499
1489 Ga0495661_0022475 3300046665 Bacteria 4103
1490 Ga0495661_0023890 3300046665 Bacteria 3962
1491 Ga0495661_0046668 3300046665 Bacteria 2643
1492 Ga0495661_0050682 3300046665 Bacteria 2511
1493 Ga0495661_0081050 3300046665 Bacteria 1871
1494 Ga0495661_0100345 3300046665 Bacteria 1630
1495 Ga0495661_0140792 3300046665 Bacteria 1312
1496 Ga0495588_0022122 3300046674 Bacteria 3140
1497 Ga0495588_0026025 3300046674 Bacteria 2919
1498 Ga0495588_0033296 3300046674 Bacteria 2602
1499 Ga0495588_0040130 3300046674 Bacteria 2386
1500 Ga0495657_0006252 3300046675 Bacteria 9334
1501 Ga0495657_0028324 3300046675 Bacteria 3942
1502 Ga0495599_0029627 3300046678 Bacteria 3431
1503 Ga0495623_0002847 3300046679 Bacteria 11412
1504 Ga0495623_0022811 3300046679 Bacteria 4041
1505 Ga0495623_0042377 3300046679 Bacteria 2899
1506 Ga0495623_0083846 3300046679 Bacteria 1968
1507 Ga0495623_0092799 3300046679 Bacteria 1849
1508 Ga0495646_0005522 3300046680 Bacteria 7996
1509 Ga0495646_0023046 3300046680 Bacteria 3921
1510 Ga0495646_0027791 3300046680 Bacteria 3546
1511 Ga0495646_0050695 3300046680 Bacteria 2515
1512 Ga0495646_0086790 3300046680 Bacteria 1814
1513 Ga0495646_0092638 3300046680 Bacteria 1742
1514 Ga0495646_0126693 3300046680 Bacteria 1440
1515 Ga0495647_0000987 3300046681 Bacteria 8648
1516 Ga0495647_0051544 3300046681 Bacteria 1600
1517 Ga0495658_0002317 3300046683 Bacteria 9607
1518 Ga0495658_0052747 3300046683 Bacteria 2308
1519 Ga0495658_0072018 3300046683 Bacteria 2009
1520 Ga0495669_0001652 3300046684 Bacteria 9165
1521 Ga0495669_0022338 3300046684 Bacteria 2748
1522 Ga0495669_0048523 3300046684 Bacteria 1899
1523 Ga0495613_0011021 3300046689 Bacteria 6713
1524 Ga0495613_0054909 3300046689 Bacteria 2928
1525 Ga0495613_0141974 3300046689 Bacteria 1715
1526 Ga0495613_0170065 3300046689 Bacteria 1547
1527 Ga0495624_0004274 3300046690 Bacteria 10493
1528 Ga0495624_0006291 3300046690 Bacteria 8445
1529 Ga0495624_0053079 3300046690 Bacteria 2560
1530 Ga0495624_0078701 3300046690 Bacteria 2044
1531 Ga0495670_0000963 3300046691 Bacteria 13946
1532 Ga0495670_0004412 3300046691 Bacteria 6902
1533 Ga0495670_0019432 3300046691 Bacteria 3348
1534 Ga0495670_0021556 3300046691 Bacteria 3178
1535 Ga0495670_0052903 3300046691 Bacteria 2033
1536 Ga0495671_0000061 3300046692 Bacteria 107050
1537 Ga0495671_0001595 3300046692 Bacteria 14974
1538 Ga0495671_0005463 3300046692 Bacteria 7438
1539 Ga0495671_0014734 3300046692 Bacteria 4202
1540 Ga0495671_0018334 3300046692 Bacteria 3716
1541 Ga0495671_0020983 3300046692 Bacteria 3436
1542 Ga0495671_0022432 3300046692 Bacteria 3308
1543 Ga0495671_0027626 3300046692 Bacteria 2928
1544 Ga0495671_0049292 3300046692 Bacteria 2099
1545 Ga0495671_0049844 3300046692 Bacteria 2086
1546 Ga0495671_0061656 3300046692 Bacteria 1849
1547 Ga0495671_0082163 3300046692 Bacteria 1578
1548 Ga0495671_0101986 3300046692 Bacteria 1402
1549 Ga0495671_0157634 3300046692 Bacteria 1104
1550 Ga0495649_0000086 3300046694 Bacteria 80528
1551 Ga0495649_0000107 3300046694 Bacteria 74394
1552 Ga0495649_0002324 3300046694 Bacteria 13463
1553 Ga0495649_0008513 3300046694 Bacteria 6166
1554 Ga0495649_0009795 3300046694 Bacteria 5673
1555 Ga0495649_0021520 3300046694 Bacteria 3611
1556 Ga0495649_0023432 3300046694 Bacteria 3449
1557 Ga0495649_0023466 3300046694 Bacteria 3446
1558 Ga0495649_0031252 3300046694 Bacteria 2937
1559 Ga0495649_0032872 3300046694 Bacteria 2856
1560 Ga0495649_0038135 3300046694 Bacteria 2637
1561 Ga0495649_0049014 3300046694 Bacteria 2294
1562 Ga0495649_0053969 3300046694 Bacteria 2174
1563 Ga0495649_0072728 3300046694 Bacteria 1842
1564 Ga0495589_0000636 3300046794 Bacteria 23067
1565 Ga0495589_0000678 3300046794 Bacteria 22253
1566 Ga0495589_0008703 3300046794 Bacteria 5286
1567 Ga0495589_0010021 3300046794 Bacteria 4923
1568 Ga0495589_0011274 3300046794 Bacteria 4640
1569 Ga0495589_0013533 3300046794 Bacteria 4207
1570 Ga0495589_0024440 3300046794 Bacteria 3071
1571 Ga0495589_0026631 3300046794 Bacteria 2928
1572 Ga0495589_0036686 3300046794 Bacteria 2456
1573 Ga0495589_0040523 3300046794 Bacteria 2325
1574 Ga0495600_0003343 3300046809 Bacteria 9426
1575 Ga0495600_0028920 3300046809 Bacteria 3586
1576 Ga0495600_0030502 3300046809 Bacteria 3492
1577 Ga0495600_0084270 3300046809 Bacteria 2074
1578 Ga0495600_0092764 3300046809 Bacteria 1969
1579 Ga0495660_0000831 3300046810 Bacteria 22952
1580 Ga0495660_0001838 3300046810 Bacteria 13929
1581 Ga0495660_0016712 3300046810 Bacteria 4228
1582 Ga0495660_0022720 3300046810 Bacteria 3579
1583 Ga0495660_0036242 3300046810 Bacteria 2751
1584 Ga0495660_0039445 3300046810 Bacteria 2622
1585 Ga0495660_0052711 3300046810 Bacteria 2209
1586 Ga0495660_0060930 3300046810 Bacteria 2025
1587 Ga0495660_0061413 3300046810 Bacteria 2016
1588 Ga0495660_0067162 3300046810 Bacteria 1910
1589 Ga0495660_0073031 3300046810 Bacteria 1815
1590 Ga0495660_0079343 3300046810 Bacteria 1724
1591 Ga0495660_0097158 3300046810 Bacteria 1521
1592 Ga0495660_0111576 3300046810 Bacteria 1394
1593 Ga0495581_0001078 3300047315 Bacteria 14830
1594 Ga0495581_0025764 3300047315 Bacteria 3410
1595 Ga0495581_0040729 3300047315 Bacteria 2687
1596 Ga0495604_0008991 3300047317 Bacteria 7901
1597 Ga0495604_0036302 3300047317 Bacteria 3885
1598 Ga0495604_0050010 3300047317 Bacteria 3247
1599 Ga0495604_0073834 3300047317 Bacteria 2572
1600 Ga0495604_0127862 3300047317 Bacteria 1829
1601 Ga0495636_0010451 3300047318 Bacteria 3666
1602 Ga0495636_0014868 3300047318 Bacteria 3097
1603 Ga0495636_0029976 3300047318 Bacteria 2222
1604 Ga0495636_0040808 3300047318 Bacteria 1924
1605 Ga0495674_0005676 3300047319 Bacteria 11951
1606 Ga0495674_0118139 3300047319 Bacteria 2242
1607 Ga0495672_0001126 3300047320 Bacteria 27097
1608 Ga0495672_0010611 3300047320 Bacteria 6546
1609 Ga0495672_0012072 3300047320 Bacteria 6048
1610 Ga0495672_0021245 3300047320 Bacteria 4236
1611 Ga0495672_0021737 3300047320 Bacteria 4180
1612 Ga0495672_0027088 3300047320 Bacteria 3647
1613 Ga0495672_0028318 3300047320 Bacteria 3546
1614 Ga0495672_0032400 3300047320 Bacteria 3251
1615 Ga0495672_0032463 3300047320 Bacteria 3248
1616 Ga0495672_0039727 3300047320 Bacteria 2859
1617 Ga0495672_0044741 3300047320 Bacteria 2653
1618 Ga0495672_0059609 3300047320 Bacteria 2207
1619 Ga0495672_0065055 3300047320 Bacteria 2085
1620 Ga0495672_0091900 3300047320 Bacteria 1665
1621 Ga0495672_0096138 3300047320 Bacteria 1615
1622 Ga0495676_0000011 3300047321 Bacteria 242612
1623 Ga0495676_0005828 3300047321 Bacteria 11307
1624 Ga0495676_0010463 3300047321 Bacteria 8412
1625 Ga0495676_0025513 3300047321 Bacteria 5102
1626 Ga0495676_0035807 3300047321 Bacteria 4149
1627 Ga0495676_0040008 3300047321 Bacteria 3874
1628 Ga0495676_0112090 3300047321 Bacteria 1999
1629 Ga0495676_0190525 3300047321 Bacteria 1430
1630 Ga0495680_0014977 3300047322 Bacteria 6697
1631 Ga0495680_0048211 3300047322 Bacteria 3346
1632 Ga0495680_0057176 3300047322 Bacteria 3017
1633 Ga0495680_0075591 3300047322 Bacteria 2555
1634 Ga0495680_0109475 3300047322 Bacteria 2048
1635 Ga0495680_0224225 3300047322 Bacteria 1340
1636 Ga0495683_0000106 3300047323 Bacteria 86579
1637 Ga0495683_0000156 3300047323 Bacteria 67301
1638 Ga0495683_0000207 3300047323 Bacteria 55998
1639 Ga0495683_0000337 3300047323 Bacteria 38955
1640 Ga0495683_0001584 3300047323 Bacteria 14666
1641 Ga0495683_0007048 3300047323 Bacteria 6100
1642 Ga0495683_0008997 3300047323 Bacteria 5328
1643 Ga0495683_0019156 3300047323 Bacteria 3532
1644 Ga0495683_0021909 3300047323 Bacteria 3290
1645 Ga0495683_0028046 3300047323 Bacteria 2877
1646 Ga0495683_0028666 3300047323 Bacteria 2846
1647 Ga0495683_0072814 3300047323 Bacteria 1685
1648 Ga0495683_0103389 3300047323 Bacteria 1367
1649 Ga0495687_001073 3300047443 Bacteria 26922
1650 Ga0495687_004107 3300047443 Bacteria 10067
1651 Ga0495687_007653 3300047443 Bacteria 6321
1652 Ga0495687_026449 3300047443 Bacteria 2730
1653 Ga0495687_028062 3300047443 Bacteria 2622
1654 Ga0495687_037907 3300047443 Bacteria 2143
1655 Ga0495675_0002568 3300047444 Bacteria 10878
1656 Ga0495675_0009055 3300047444 Bacteria 6189
1657 Ga0495675_0033888 3300047444 Bacteria 3259
1658 Ga0495675_0042527 3300047444 Bacteria 2894
1659 Ga0495675_0148493 3300047444 Bacteria 1449
1660 Ga0495677_0028517 3300047445 Bacteria 2027
1661 Ga0495677_0033436 3300047445 Bacteria 1874
1662 Ga0495679_000274 3300047446 Bacteria 43056
1663 Ga0495679_000482 3300047446 Bacteria 28817
1664 Ga0495679_000704 3300047446 Bacteria 21744
1665 Ga0495685_033973 3300047447 Bacteria 1752
1666 Ga0495685_039526 3300047447 Bacteria 1615
1667 Ga0495685_049081 3300047447 Bacteria 1434
1668 Ga0495673_0001341 3300047469 Bacteria 19995
1669 Ga0495673_0001682 3300047469 Bacteria 16994
1670 Ga0495673_0003114 3300047469 Bacteria 11110
1671 Ga0495673_0005616 3300047469 Bacteria 7542
1672 Ga0495673_0007829 3300047469 Bacteria 6080
1673 Ga0495673_0009096 3300047469 Bacteria 5519
1674 Ga0495673_0009718 3300047469 Bacteria 5296
1675 Ga0495673_0010604 3300047469 Bacteria 5001
1676 Ga0495673_0012008 3300047469 Bacteria 4621
1677 Ga0495673_0014010 3300047469 Bacteria 4185
1678 Ga0495673_0015631 3300047469 Bacteria 3904
1679 Ga0495673_0021205 3300047469 Bacteria 3214
1680 Ga0495673_0026141 3300047469 Bacteria 2794
1681 Ga0495673_0029934 3300047469 Bacteria 2564
1682 Ga0495673_0033541 3300047469 Bacteria 2381
1683 Ga0495673_0038250 3300047469 Bacteria 2184
1684 Ga0495673_0070722 3300047469 Bacteria 1468
1685 Ga0495673_0075739 3300047469 Bacteria 1404
1686 Ga0495673_0076183 3300047469 Bacteria 1399
1687 Ga0495673_0102147 3300047469 Bacteria 1157
1688 Ga0495681_0000262 3300047470 Bacteria 42740
1689 Ga0495681_0000399 3300047470 Bacteria 33808
1690 Ga0495681_0001634 3300047470 Bacteria 16640
1691 Ga0495681_0002529 3300047470 Bacteria 13024
1692 Ga0495681_0012867 3300047470 Bacteria 4892
1693 Ga0495681_0014112 3300047470 Bacteria 4601
1694 Ga0495681_0018926 3300047470 Bacteria 3777
1695 Ga0495681_0022189 3300047470 Bacteria 3403
1696 Ga0495681_0022796 3300047470 Bacteria 3341
1697 Ga0495681_0028260 3300047470 Bacteria 2889
1698 Ga0495681_0037106 3300047470 Bacteria 2404
1699 Ga0495681_0055627 3300047470 Bacteria 1844
1700 Ga0495681_0060820 3300047470 Bacteria 1741
1701 Ga0495684_0007045 3300047471 Bacteria 8731
1702 Ga0495684_0008772 3300047471 Bacteria 7818
1703 Ga0495684_0011084 3300047471 Bacteria 6969
1704 Ga0495684_0060720 3300047471 Bacteria 2877
1705 Ga0495684_0234970 3300047471 Bacteria 1339
1706 Ga0495686_0012888 3300047472 Bacteria 5829
1707 Ga0495686_0034862 3300047472 Bacteria 3237
1708 Ga0495686_0049563 3300047472 Bacteria 2641
1709 Ga0495686_0089654 3300047472 Bacteria 1868
1710 Ga0495686_0138510 3300047472 Bacteria 1437
1711 Ga0495593_0001096 3300047673 Bacteria 15805
1712 Ga0495593_0007705 3300047673 Bacteria 6284
1713 Ga0495593_0014851 3300047673 Bacteria 4423
1714 Ga0495593_0041936 3300047673 Bacteria 2458
1715 Ga0495593_0064136 3300047673 Bacteria 1917
1716 Ga0495593_0065094 3300047673 Bacteria 1901
1717 Ga0495593_0112358 3300047673 Bacteria 1390
1718 Ga0495602_0116943 3300048088 Bacteria 2153
1719 Ga0495602_0157704 3300048088 Bacteria 1775
1720 Ga0495626_0000068 3300048091 Bacteria 139126
1721 Ga0495626_0000079 3300048091 Bacteria 129922
1722 Ga0495626_0000345 3300048091 Bacteria 48769
1723 Ga0495626_0001545 3300048091 Bacteria 18082
1724 Ga0495626_0003093 3300048091 Bacteria 10911
1725 Ga0495626_0005680 3300048091 Bacteria 7222
1726 Ga0495626_0007093 3300048091 Bacteria 6278
1727 Ga0495626_0008893 3300048091 Bacteria 5455
1728 Ga0495626_0012046 3300048091 Bacteria 4550
1729 Ga0495626_0018553 3300048091 Bacteria 3491
1730 Ga0495626_0022681 3300048091 Bacteria 3098
1731 Ga0495626_0024603 3300048091 Bacteria 2950
1732 Ga0495626_0031751 3300048091 Bacteria 2539
1733 Ga0495626_0035027 3300048091 Bacteria 2398
1734 Ga0495626_0059123 3300048091 Bacteria 1750
1735 Ga0495626_0061484 3300048091 Bacteria 1707
1736 Ga0495626_0063518 3300048091 Bacteria 1674
1737 Ga0496100_0073096 3300048903 Bacteria 2294
1738 Ga0496101_0059381 3300048904 Bacteria 2772
1739 Ga0496101_0166385 3300048904 Bacteria 1693
1740 Ga0496102_0000815 3300048905 Bacteria 30310
1741 Ga0496102_0011407 3300048905 Bacteria 7659
1742 Ga0496102_0026312 3300048905 Bacteria 5188
1743 Ga0496102_0145282 3300048905 Bacteria 2226
1744 Ga0496103_0026858 3300048906 Bacteria 3484
1745 Ga0496104_0065597 3300048907 Bacteria 3445
1746 Ga0496104_0140469 3300048907 Bacteria 2320
1747 Ga0496104_0164768 3300048907 Bacteria 2125
1748 Ga0496105_0000527 3300048908 Bacteria 25240
1749 Ga0496105_0012981 3300048908 Bacteria 6599
1750 Ga0496106_0002824 3300048909 Bacteria 12877
1751 Ga0496106_0025243 3300048909 Bacteria 4421
1752 Ga0496106_0105257 3300048909 Bacteria 2192
1753 Ga0496106_0218296 3300048909 Bacteria 1520
1754 Ga0496106_0288858 3300048909 Bacteria 1315
1755 Ga0496107_0117439 3300048910 Bacteria 1959
1756 Ga0496108_0118228 3300048911 Bacteria 2272
1757 Ga0496109_0055493 3300048912 Bacteria 3614
1758 Ga0496110_0064373 3300048913 Bacteria 3240
1759 Ga0496110_0079448 3300048913 Bacteria 2921
1760 Ga0496110_0261537 3300048913 Bacteria 1575
1761 Ga0496110_0342683 3300048913 Bacteria 1361
1762 Ga0496111_0088190 3300048914 Bacteria 2272
1763 Ga0496111_0100862 3300048914 Bacteria 2121
1764 Ga0496112_0000004 3300048915 Bacteria 553294
1765 Ga0496112_0126454 3300048915 Bacteria 2527
1766 Ga0496114_0029802 3300048917 Bacteria 4486
1767 Ga0496114_0058276 3300048917 Bacteria 3225
1768 Ga0496114_0231185 3300048917 Bacteria 1625
1769 Ga0496114_0481643 3300048917 Bacteria 1098
1770 Ga0496115_0017945 3300048918 Bacteria 5421
1771 Ga0496115_0244338 3300048918 Bacteria 1479
1772 Ga0496115_0345548 3300048918 Bacteria 1214
1773 Ga0496116_0000046 3300048919 Bacteria 323643
1774 Ga0496116_0000220 3300048919 Bacteria 107152
1775 Ga0496116_0001963 3300048919 Bacteria 22172
1776 Ga0496116_0008830 3300048919 Bacteria 8682
1777 Ga0496116_0018439 3300048919 Bacteria 5381
1778 Ga0496116_0018636 3300048919 Bacteria 5341
1779 Ga0496116_0021869 3300048919 Bacteria 4811
1780 Ga0496116_0035344 3300048919 Bacteria 3510
1781 Ga0496116_0044478 3300048919 Bacteria 3015
1782 Ga0496116_0094032 3300048919 Bacteria 1813
1783 Ga0496116_0096804 3300048919 Bacteria 1776
1784 Ga0496117_0001438 3300048920 Bacteria 34331
1785 Ga0496117_0009752 3300048920 Bacteria 8860
1786 Ga0496117_0018385 3300048920 Bacteria 5789
1787 Ga0496117_0025481 3300048920 Bacteria 4649
1788 Ga0496117_0038087 3300048920 Bacteria 3572
1789 Ga0496117_0039315 3300048920 Bacteria 3493
1790 Ga0496117_0050271 3300048920 Bacteria 2957
1791 Ga0496117_0074888 3300048920 Bacteria 2251
1792 Ga0496117_0084420 3300048920 Bacteria 2072
1793 Ga0496117_0092326 3300048920 Bacteria 1945
1794 Ga0496117_0113845 3300048920 Bacteria 1678
1795 Ga0496117_0115773 3300048920 Bacteria 1658
1796 Ga0496117_0150264 3300048920 Bacteria 1379
1797 Ga0496118_0004964 3300048921 Bacteria 15387
1798 Ga0496118_0013461 3300048921 Bacteria 7733
1799 Ga0496118_0014197 3300048921 Bacteria 7469
1800 Ga0496118_0016655 3300048921 Bacteria 6735
1801 Ga0496118_0020225 3300048921 Bacteria 5911
1802 Ga0496118_0089431 3300048921 Bacteria 2126
1803 Ga0496118_0089826 3300048921 Bacteria 2119
1804 Ga0496118_0092267 3300048921 Bacteria 2079
1805 Ga0496118_0095347 3300048921 Bacteria 2031
1806 Ga0496118_0104783 3300048921 Bacteria 1897
1807 Ga0496118_0105960 3300048921 Bacteria 1882
1808 Ga0496118_0123442 3300048921 Bacteria 1682
1809 Ga0496118_0156864 3300048921 Bacteria 1414
1810 Ga0496118_0164338 3300048921 Bacteria 1367
1811 Ga0496119_0002124 3300048922 Bacteria 22306
1812 Ga0496119_0004034 3300048922 Bacteria 14828
1813 Ga0496119_0005169 3300048922 Bacteria 12629
1814 Ga0496119_0018826 3300048922 Bacteria 5116
1815 Ga0496119_0115253 3300048922 Bacteria 1485
1816 Ga0496119_0122633 3300048922 Bacteria 1426
1817 Ga0496119_0140593 3300048922 Bacteria 1304
1818 Ga0496119_0169704 3300048922 Bacteria 1153
1819 Ga0496120_0003119 3300048923 Bacteria 15545
1820 Ga0496120_0004180 3300048923 Bacteria 12366
1821 Ga0496121_0000093 3300048924 Bacteria 212965
1822 Ga0496121_0000229 3300048924 Bacteria 120626
1823 Ga0496121_0000594 3300048924 Bacteria 67953
1824 Ga0496121_0002820 3300048924 Bacteria 25702
1825 Ga0496121_0004468 3300048924 Bacteria 18789
1826 Ga0496121_0004887 3300048924 Bacteria 17596
1827 Ga0496121_0011294 3300048924 Bacteria 9945
1828 Ga0496121_0013055 3300048924 Bacteria 8970
1829 Ga0496121_0016565 3300048924 Bacteria 7601
1830 Ga0496121_0020706 3300048924 Bacteria 6490
1831 Ga0496121_0026659 3300048924 Bacteria 5435
1832 Ga0496121_0032696 3300048924 Bacteria 4723
1833 Ga0496121_0044950 3300048924 Bacteria 3802
1834 Ga0496121_0061861 3300048924 Bacteria 3069
1835 Ga0496121_0083015 3300048924 Bacteria 2531
1836 Ga0496121_0083957 3300048924 Bacteria 2512
1837 Ga0496121_0096390 3300048924 Bacteria 2295
1838 Ga0496121_0103123 3300048924 Bacteria 2195
1839 Ga0496121_0114881 3300048924 Bacteria 2045
1840 Ga0496121_0125167 3300048924 Bacteria 1933
1841 Ga0496121_0134066 3300048924 Bacteria 1848
1842 Ga0496121_0142522 3300048924 Bacteria 1775
1843 Ga0496121_0213203 3300048924 Bacteria 1366
1844 Ga0496122_0001103 3300048925 Bacteria 46670
1845 Ga0496122_0001381 3300048925 Bacteria 39387
1846 Ga0496122_0001707 3300048925 Bacteria 34056
1847 Ga0496122_0002086 3300048925 Bacteria 29621
1848 Ga0496122_0006443 3300048925 Bacteria 13471
1849 Ga0496122_0010358 3300048925 Bacteria 9633
1850 Ga0496122_0019987 3300048925 Bacteria 6087
1851 Ga0496122_0062136 3300048925 Bacteria 2736
1852 Ga0496122_0076285 3300048925 Bacteria 2359
1853 Ga0496122_0097889 3300048925 Bacteria 1972
1854 Ga0496122_0117185 3300048925 Bacteria 1729
1855 Ga0496123_0000178 3300048926 Bacteria 128587
1856 Ga0496123_0000411 3300048926 Bacteria 78453
1857 Ga0496123_0000607 3300048926 Bacteria 60365
1858 Ga0496123_0004139 3300048926 Bacteria 15519
1859 Ga0496123_0024819 3300048926 Bacteria 4540
1860 Ga0496123_0082890 3300048926 Bacteria 1941
1861 Ga0496123_0088936 3300048926 Bacteria 1841
1862 Ga0496123_0089595 3300048926 Bacteria 1832
1863 Ga0496124_0000073 3300048927 Bacteria 219306
1864 Ga0496124_0000123 3300048927 Bacteria 161106
1865 Ga0496124_0002651 3300048927 Bacteria 22984
1866 Ga0496124_0019279 3300048927 Bacteria 6356
1867 Ga0496124_0022258 3300048927 Bacteria 5817
1868 Ga0496124_0027093 3300048927 Bacteria 5154
1869 Ga0496124_0033513 3300048927 Bacteria 4518
1870 Ga0496124_0043552 3300048927 Bacteria 3858
1871 Ga0496124_0050734 3300048927 Bacteria 3533
1872 Ga0496124_0067679 3300048927 Bacteria 2971
1873 Ga0496124_0120638 3300048927 Bacteria 2095
1874 Ga0496124_0128685 3300048927 Bacteria 2014
1875 Ga0496124_0147253 3300048927 Bacteria 1852
1876 Ga0496124_0189871 3300048927 Bacteria 1573
1877 Ga0496124_0217305 3300048927 Bacteria 1440
1878 Ga0496124_0238222 3300048927 Bacteria 1355
1879 Ga0496125_0000011 3300048928 Bacteria 655895
1880 Ga0496125_0008852 3300048928 Bacteria 10461
1881 Ga0496125_0012388 3300048928 Bacteria 8469
1882 Ga0496125_0025916 3300048928 Bacteria 5357
1883 Ga0496125_0039046 3300048928 Bacteria 4096
1884 Ga0496125_0040602 3300048928 Bacteria 3989
1885 Ga0496125_0051779 3300048928 Bacteria 3382
1886 Ga0496125_0056938 3300048928 Bacteria 3170
1887 Ga0496125_0064355 3300048928 Bacteria 2914
1888 Ga0496125_0079776 3300048928 Bacteria 2508
1889 Ga0496125_0130265 3300048928 Bacteria 1772
1890 Ga0496125_0130919 3300048928 Bacteria 1766
1891 Ga0496126_0010997 3300048929 Bacteria 9416
1892 Ga0496126_0014996 3300048929 Bacteria 7812
1893 Ga0496126_0031625 3300048929 Bacteria 4995
1894 Ga0496126_0038090 3300048929 Bacteria 4476
1895 Ga0496126_0039798 3300048929 Bacteria 4359
1896 Ga0496126_0052595 3300048929 Bacteria 3700
1897 Ga0496126_0095848 3300048929 Bacteria 2602
1898 Ga0496126_0110833 3300048929 Bacteria 2390
1899 Ga0496126_0125183 3300048929 Bacteria 2225
1900 Ga0496126_0134533 3300048929 Bacteria 2133
1901 Ga0496126_0239859 3300048929 Bacteria 1515
1902 Ga0495678_000017 3300049459 Bacteria 282592
1903 Ga0495678_000404 3300049459 Bacteria 43644
1904 Ga0495678_000437 3300049459 Bacteria 41568
1905 Ga0495678_002139 3300049459 Bacteria 13965
1906 Ga0495678_006385 3300049459 Bacteria 6285
1907 Ga0495678_018021 3300049459 Bacteria 3184
1908 Ga0495678_018168 3300049459 Bacteria 3167
1909 Ga0495678_029671 3300049459 Bacteria 2294
1910 Ga0495678_031421 3300049459 Bacteria 2214
1911 Ga0495678_039419 3300049459 Bacteria 1905
1912 Ga0495678_041091 3300049459 Bacteria 1853
1913 Ga0495678_042169 3300049459 Bacteria 1820
1914 Ga0495678_046530 3300049459 Bacteria 1704
1915 Ga0495678_047054 3300049459 Bacteria 1691
1916 Ga0495678_077413 3300049459 Bacteria 1203
1917 Ga0495682_0000124 3300049460 Bacteria 67600
1918 Ga0495682_0000150 3300049460 Bacteria 59591
1919 Ga0495682_0006507 3300049460 Bacteria 4719
1920 Ga0495682_0007005 3300049460 Bacteria 4518
1921 Ga0495682_0015357 3300049460 Bacteria 2901
1922 Ga0495682_0017968 3300049460 Bacteria 2663
1923 Ga0495682_0024581 3300049460 Bacteria 2245
1924 Ga0495682_0055348 3300049460 Bacteria 1438
1925 Ga0495682_0077650 3300049460 Bacteria 1194
1926 Ga0501031_0000232 3300049568 Bacteria 31820
1927 Ga0501031_0064268 3300049568 Bacteria 2390
1928 Ga0501031_0111772 3300049568 Bacteria 1784
1929 Ga0501032_0019278 3300049569 Bacteria 4773
1930 Ga0501032_0034847 3300049569 Bacteria 3443
1931 Ga0501032_0062528 3300049569 Bacteria 2494
1932 Ga0501033_0000599 3300049570 Bacteria 33415
1933 Ga0501033_0005271 3300049570 Bacteria 10262
1934 Ga0501033_0045457 3300049570 Bacteria 3268
1935 Ga0501033_0186663 3300049570 Bacteria 1485
1936 Ga0501034_0000143 3300049571 Bacteria 133317
1937 Ga0501034_0006374 3300049571 Bacteria 12707
1938 Ga0501034_0026665 3300049571 Bacteria 5880
1939 Ga0501034_0042197 3300049571 Bacteria 4618
1940 Ga0501034_0070282 3300049571 Bacteria 3512
1941 Ga0501034_0101892 3300049571 Bacteria 2865
1942 Ga0501036_0000300 3300049572 Bacteria 34234
1943 Ga0501036_0032497 3300049572 Bacteria 4409
1944 Ga0501036_0164435 3300049572 Bacteria 1871
1945 Ga0501037_0001751 3300049573 Bacteria 15767
1946 Ga0501037_0090688 3300049573 Bacteria 2210
1947 Ga0501037_0234545 3300049573 Bacteria 1288
1948 Ga0501039_0004768 3300049575 Bacteria 10273
1949 Ga0501039_0032810 3300049575 Bacteria 4005
1950 Ga0501040_0014406 3300049576 Bacteria 5210
1951 Ga0501042_0013981 3300049578 Bacteria 5470
1952 Ga0501042_0276848 3300049578 Bacteria 1212
1953 Ga0501043_0010432 3300049579 Bacteria 7278
1954 Ga0501043_0187229 3300049579 Bacteria 1611
1955 Ga0501046_0008979 3300049580 Bacteria 8679
1956 Ga0501046_0045764 3300049580 Bacteria 3475
1957 Ga0501046_0193971 3300049580 Bacteria 1514
1958 Ga0501047_0000477 3300049581 Bacteria 43621
1959 Ga0501047_0007358 3300049581 Bacteria 10352
1960 Ga0501047_0011016 3300049581 Bacteria 8556
1961 Ga0501047_0125227 3300049581 Bacteria 2450
1962 Ga0501067_0015248 3300049583 Bacteria 4255
1963 Ga0501070_0003226 3300049586 Bacteria 14186
1964 Ga0501071_0013254 3300049587 Bacteria 5617
1965 Ga0501073_0009857 3300049589 Bacteria 7028
1966 Ga0501074_0044503 3300049590 Bacteria 3213
1967 Ga0501076_0020718 3300049592 Bacteria 5034
1968 Ga0501222_005457 3300049662 Bacteria 1714
1969 Ga0501227_021756 3300049665 Bacteria 1479
1970 Ga0501080_0002465 3300049742 Bacteria 16197
1971 Ga0501080_0045308 3300049742 Bacteria 4094
1972 Ga0501081_0004633 3300049743 Bacteria 8835
1973 Ga0501083_0039608 3300049744 Bacteria 3200
1974 Ga0501269_007525 3300049766 Bacteria 1317
1975 Ga0501035_0004829 3300049822 Bacteria 12783
1976 Ga0501035_0011026 3300049822 Bacteria 8367
1977 Ga0501035_0023345 3300049822 Bacteria 5673
1978 Ga0501035_0025090 3300049822 Bacteria 5465
1979 Ga0501035_0185630 3300049822 Bacteria 1790
1980 Ga0501035_0237213 3300049822 Bacteria 1552
1981 Ga0501044_0000396 3300049823 Bacteria 54058
1982 Ga0501044_0000987 3300049823 Bacteria 34197
1983 Ga0501044_0010449 3300049823 Bacteria 10075
1984 Ga0501044_0039138 3300049823 Bacteria 4948
1985 Ga0501044_0063709 3300049823 Bacteria 3765
1986 Ga0501044_0114906 3300049823 Bacteria 2697
1987 Ga0501044_0474966 3300049823 Bacteria 1154
1988 Ga0501226_000002 3300049853 Bacteria 426935
1989 nmdc:mga03683_65384_c1 3300050489 Bacteria 1544
1990 nmdc:mga03n38_428_c1 3300050490 Bacteria 10457
1991 nmdc:mga00v17_133592_c1 3300050491 Bacteria 1587
1992 nmdc:mga00v17_33080_c1 3300050491 Bacteria 3061
1993 nmdc:mga00v17_5311_c1 3300050491 Bacteria 6787
1994 nmdc:mga00v17_558_c1 3300050491 Bacteria 20849
1995 nmdc:mga00v17_71659_c1 3300050491 Bacteria 2148
1996 nmdc:mga00v17_81575_c1 3300050491 Bacteria 2020
1997 nmdc:mga0yw44_103586_c1 3300050492 Bacteria 1815
1998 nmdc:mga0yw44_149282_c1 3300050492 Bacteria 1524
1999 nmdc:mga0yw44_179343_c1 3300050492 Bacteria 1394
2000 nmdc:mga0yw44_88128_c1 3300050492 Bacteria 1957
2001 nmdc:mga0yw44_9310_c1 3300050492 Bacteria 3581
2002 nmdc:mga0k408_127804_c1 3300050493 Bacteria 1508
2003 nmdc:mga0k408_42800_c1 3300050493 Bacteria 2608
2004 nmdc:mga0k408_80381_c1 3300050493 Bacteria 1908
2005 nmdc:mga06z11_158342_c1 3300050494 Bacteria 1293
2006 nmdc:mga06z11_5877_c1 3300050494 Bacteria 4956
2007 nmdc:mga05p37_115892_c1 3300050507 Bacteria 3293
2008 nmdc:mga0n895_22023_c1 3300050512 Bacteria 5971
2009 nmdc:mga0rr50_196553_c1 3300050513 Bacteria 1655
2010 nmdc:mga0a205_461_c1 3300050515 Bacteria 31578
2011 nmdc:mga0sz30_23091_c1 3300050516 Bacteria 1935
2012 nmdc:mga0sz30_29734_c1 3300050516 Bacteria 2254
2013 nmdc:mga0sz30_8004_c1 3300050516 Bacteria 3979
2014 Ga0495601_0008732 3300053077 Bacteria 5980
2015 Ga0495601_0033943 3300053077 Bacteria 3180
2016 Ga0495595_0003654 3300053084 Bacteria 6113
2017 Ga0495619_0010334 3300053085 Bacteria 5873
2018 Ga0500643_000007 3300053087 Bacteria 462836
2019 Ga0500643_016083 3300053087 Bacteria 2548
2020 Ga0500644_0009647 3300053088 Bacteria 2589
2021 Ga0500581_016413 3300053089 Bacteria 3707
2022 Ga0500646_0031568 3300053090 Bacteria 1458
2023 Ga0500647_0105885 3300053091 Bacteria 1340
2024 Ga0500583_0022622 3300053092 Bacteria 2636
2025 Ga0500651_0034507 3300053093 Bacteria 3190
2026 Ga0500651_0052395 3300053093 Bacteria 2559
2027 Ga0500651_0139549 3300053093 Bacteria 1462
2028 Ga0500566_0000204 3300053094 Bacteria 31169
2029 Ga0500566_0003695 3300053094 Bacteria 9139
2030 Ga0500566_0004932 3300053094 Bacteria 7951
2031 Ga0500566_0007897 3300053094 Bacteria 6300
2032 Ga0500641_0010248 3300053096 Bacteria 3382
2033 Ga0500641_0089982 3300053096 Bacteria 1309
2034 Ga0500650_0001956 3300053098 Bacteria 6549
2035 Ga0500555_007056 3300053103 Bacteria 3194
2036 Ga0500556_0000002 3300053104 Bacteria 773626
2037 Ga0500556_0034985 3300053104 Bacteria 1732
2038 Ga0500562_021179 3300053108 Bacteria 1690
2039 Ga0500562_021318 3300053108 Bacteria 1685
2040 Ga0500562_039247 3300053108 Bacteria 1258
2041 Ga0500569_023292 3300053109 Bacteria 1662
2042 Ga0500572_000995 3300053111 Bacteria 8595
2043 Ga0500592_009787 3300053116 Bacteria 1525
2044 Ga0500595_002911 3300053119 Bacteria 8191
2045 Ga0500595_036527 3300053119 Bacteria 1608
2046 Ga0500607_033439 3300053121 Bacteria 2817
2047 Ga0500608_004606 3300053122 Bacteria 5366
2048 Ga0500614_000876 3300053123 Bacteria 7604
2049 Ga0500618_012475 3300053125 Bacteria 2225
2050 Ga0500642_0000016 3300053130 Bacteria 176560
2051 Ga0500642_0012732 3300053130 Bacteria 3064
2052 Ga0500652_002511 3300053131 Bacteria 5523
2053 Ga0500658_0028516 3300053134 Bacteria 2166
2054 Ga0500659_0019210 3300053135 Bacteria 3723
2055 Ga0500559_0000066 3300053136 Bacteria 84664
2056 Ga0500559_0001636 3300053136 Bacteria 12414
2057 Ga0500559_0036176 3300053136 Bacteria 2134
2058 Ga0500564_063243 3300053138 Bacteria 1676
2059 Ga0500568_0024804 3300053139 Bacteria 2536
2060 Ga0500586_001313 3300053145 Bacteria 5224
2061 Ga0500590_070024 3300053148 Bacteria 1745
2062 Ga0500604_0003380 3300053151 Bacteria 4291
2063 Ga0500604_0011205 3300053151 Bacteria 2405
2064 Ga0500616_0000061 3300053153 Bacteria 249158
2065 Ga0500616_0040062 3300053153 Bacteria 2522
2066 Ga0500622_0000518 3300053156 Bacteria 35866
2067 Ga0500622_0008171 3300053156 Bacteria 5878
2068 Ga0500630_000027 3300053159 Bacteria 42085
2069 Ga0500638_094639 3300053162 Bacteria 1401
2070 Ga0500639_000020 3300053163 Bacteria 102959
2071 Ga0500636_0000042 3300053177 Bacteria 69412
2072 Ga0500636_0002158 3300053177 Bacteria 10858
2073 Ga0500636_0069343 3300053177 Bacteria 2046
2074 Ga0500636_0123862 3300053177 Bacteria 1447
2075 Ga0500637_0000132 3300053178 Bacteria 27236
2076 Ga0500637_0185693 3300053178 Bacteria 1189
2077 Ga0500596_000114 3300053735 Bacteria 11327
2078 Ga0500601_000228 3300053737 Bacteria 11112
2079 Ga0501084_0105072 3300054114 Bacteria 2372
2080 Ga0500661_004960 3300055283 Bacteria 2494
2081 Ga0501082_0006434 3300060353 Bacteria 10192
2082 Ga0501082_0022979 3300060353 Bacteria 5376
2083 Ga0466962_0001425 3300061719 Bacteria 11134

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10347081 Ga0105243_103470811 299
2 3300025935 Ga0207709_10173634 Ga0207709_101736342 299
3 iso_pu_bacteria 2895511927 2895516538 315
4 iso_pu_bacteria 8016575299 8016576923 316
5 3300042439 Ga0439464_0060035 Ga0439464_0060035_44_1015 323
6 3300025915 Ga0207693_10105263 Ga0207693_101052632 327
7 3300044683 Ga0466965_0000692 Ga0466965_0000692_5310_6455 328
8 3300044684 Ga0466966_0012649 Ga0466966_0012649_4398_5543 328
9 3300044765 Ga0466970_0053441 Ga0466970_0053441_939_2084 328
10 3300044842 Ga0466957_0002678 Ga0466957_0002678_6111_7256 328
11 3300046473 Ga0495582_0174550 Ga0495582_0174550_23_1012 328
12 3300046516 Ga0495628_0042406 Ga0495628_0042406_2600_3589 328
13 3300046537 Ga0495598_0024381 Ga0495598_0024381_41_1030 328
14 3300046692 Ga0495671_0157634 Ga0495671_0157634_75_1064 328
15 3300048913 Ga0496110_0342683 Ga0496110_0342683_56_1045 328
16 3300048917 Ga0496114_0481643 Ga0496114_0481643_78_1067 328
17 3300049578 Ga0501042_0276848 Ga0501042_0276848_213_1202 328
18 3300053116 Ga0500592_009787 Ga0500592_009787_22_1023 328
19 3300061719 Ga0466962_0001425 Ga0466962_0001425_4317_5462 328
20 3300006195 Ga0075366_10162577 Ga0075366_101625771 330
21 3300046452 Ga0495617_003398 Ga0495617_003398_2815_3909 330
22 3300046457 Ga0495590_0004917 Ga0495590_0004917_3222_4316 330
23 3300046463 Ga0495653_0032449 Ga0495653_0032449_2143_3237 330
24 3300046473 Ga0495582_0035013 Ga0495582_0035013_850_1944 330
25 3300046475 Ga0495639_0015202 Ga0495639_0015202_1351_2445 330
26 3300046491 Ga0495584_0019702 Ga0495584_0019702_1430_2524 330
27 3300046501 Ga0495607_0013525 Ga0495607_0013525_2822_3916 330
28 3300046513 Ga0495616_0014537 Ga0495616_0014537_898_1992 330
29 3300046519 Ga0495632_0016447 Ga0495632_0016447_2027_3121 330
30 3300046526 Ga0495666_0016976 Ga0495666_0016976_1144_2238 330
31 3300046528 Ga0495642_0009876 Ga0495642_0009876_47_1141 330
32 3300046538 Ga0495609_0003174 Ga0495609_0003174_6136_7230 330
33 3300046648 Ga0495611_0026380 Ga0495611_0026380_595_1689 330
34 3300046663 Ga0495635_0040672 Ga0495635_0040672_1254_2348 330
35 3300046680 Ga0495646_0023046 Ga0495646_0023046_986_2080 330
36 3300046794 Ga0495589_0008703 Ga0495589_0008703_1377_2471 330
37 3300046809 Ga0495600_0003343 Ga0495600_0003343_2824_3918 330
38 3300047318 Ga0495636_0010451 Ga0495636_0010451_229_1323 330
39 3300047322 Ga0495680_0014977 Ga0495680_0014977_2948_4042 330
40 3300047444 Ga0495675_0009055 Ga0495675_0009055_497_1591 330
41 3300047447 Ga0495685_033973 Ga0495685_033973_140_1234 330
42 3300048091 Ga0495626_0018553 Ga0495626_0018553_968_2062 330
43 3300049459 Ga0495678_006385 Ga0495678_006385_3762_4856 330
44 3300049460 Ga0495682_0077650 Ga0495682_0077650_54_1148 330
45 3300003578 Ga0006562J51391_1005136 Ga0006562J51391_10051362 333
46 3300005288 Ga0065714_10008011 Ga0065714_100080111 333
47 3300014497 Ga0182008_10007506 Ga0182008_100075063 333
48 3300015261 Ga0182006_1008964 Ga0182006_10089642 333
49 3300015262 Ga0182007_10002733 Ga0182007_100027335 333
50 3300015265 Ga0182005_1002836 Ga0182005_10028363 333
51 3300025728 Ga0207655_1001189 Ga0207655_10011893 333
52 3300027907 Ga0207428_10027106 Ga0207428_100271063 333
53 3300046460 Ga0495638_0081891 Ga0495638_0081891_104_1213 333
54 3300046474 Ga0495605_0010112 Ga0495605_0010112_139_1248 333
55 3300046474 Ga0495605_0056996 Ga0495605_0056996_139_1248 333
56 3300046475 Ga0495639_0003111 Ga0495639_0003111_2797_3906 333
57 3300046499 Ga0495594_0021768 Ga0495594_0021768_245_1354 333
58 3300046522 Ga0495643_0017811 Ga0495643_0017811_2095_3204 333
59 3300046526 Ga0495666_0046651 Ga0495666_0046651_567_1676 333
60 3300046530 Ga0495654_0005941 Ga0495654_0005941_2014_3123 333
61 3300046530 Ga0495654_0019167 Ga0495654_0019167_763_1872 333
62 3300046535 Ga0495586_0030142 Ga0495586_0030142_832_1941 333
63 3300046542 Ga0495597_0012962 Ga0495597_0012962_2057_3166 333
64 3300046557 Ga0495622_0002873 Ga0495622_0002873_3310_4419 333
65 3300046664 Ga0495659_0003345 Ga0495659_0003345_721_1830 333
66 3300046794 Ga0495589_0010021 Ga0495589_0010021_1654_2763 333
67 3300047315 Ga0495581_0025764 Ga0495581_0025764_822_1931 333
68 3300047320 Ga0495672_0012072 Ga0495672_0012072_2824_3933 333
69 3300047443 Ga0495687_007653 Ga0495687_007653_2563_3672 333
70 3300047443 Ga0495687_037907 Ga0495687_037907_86_1195 333
71 3300047470 Ga0495681_0055627 Ga0495681_0055627_687_1688 333
72 3300048091 Ga0495626_0005680 Ga0495626_0005680_2808_3917 333
73 3300048909 Ga0496106_0218296 Ga0496106_0218296_292_1401 333
74 3300048919 Ga0496116_0018439 Ga0496116_0018439_1593_2678 333
75 3300048919 Ga0496116_0021869 Ga0496116_0021869_2819_3928 333
76 3300048920 Ga0496117_0050271 Ga0496117_0050271_1036_2121 333
77 3300048921 Ga0496118_0095347 Ga0496118_0095347_392_1501 333
78 3300048922 Ga0496119_0002124 Ga0496119_0002124_8237_9322 333
79 3300048923 Ga0496120_0004180 Ga0496120_0004180_1146_2231 333
80 3300048924 Ga0496121_0004468 Ga0496121_0004468_7116_8201 333
81 3300048924 Ga0496121_0083957 Ga0496121_0083957_643_1752 333
82 3300048925 Ga0496122_0019987 Ga0496122_0019987_2188_3297 333
83 3300048925 Ga0496122_0097889 Ga0496122_0097889_62_1147 333
84 3300048927 Ga0496124_0027093 Ga0496124_0027093_3459_4544 333
85 3300048928 Ga0496125_0000011 Ga0496125_0000011_608445_609530 333
86 3300002737 JGI25162J39368_1000520 JGI25162J39368_10005204 334
87 3300002771 JGI25163J39215_1002234 JGI25163J39215_10022342 334
88 3300002772 JGI25164J39214_1000350 JGI25164J39214_10003504 334
89 3300003214 JGI25165J46597_1000645 JGI25165J46597_10006454 334
90 3300003781 Ga0055536_1006955 Ga0055536_10069555 334
91 3300025207 Ga0209760_100027 Ga0209760_100027120 334
92 3300025231 Ga0207427_100006 Ga0207427_100006452 334
93 3300025233 Ga0209437_100013 Ga0209437_100013452 334
94 3300025261 Ga0209233_1000022 Ga0209233_1000022452 334
95 3300025292 Ga0209676_1000065 Ga0209676_1000065289 334
96 3300046471 Ga0495650_0074066 Ga0495650_0074066_40_1137 334
97 3300046501 Ga0495607_0005049 Ga0495607_0005049_3831_4928 334
98 3300046501 Ga0495607_0008940 Ga0495607_0008940_4952_6049 334
99 3300046506 Ga0495583_0002642 Ga0495583_0002642_13697_14794 334
100 3300046515 Ga0495620_0005486 Ga0495620_0005486_4274_5371 334
101 3300046519 Ga0495632_0018908 Ga0495632_0018908_952_2049 334
102 3300046665 Ga0495661_0002054 Ga0495661_0002054_4228_5325 334
103 3300047469 Ga0495673_0001682 Ga0495673_0001682_2691_3788 334
104 3300045976 Ga0466967_0058693 Ga0466967_0058693_173_1309 335
105 3300048920 Ga0496117_0009752 Ga0496117_0009752_3217_4302 335
106 3300048922 Ga0496119_0018826 Ga0496119_0018826_145_1230 335
107 3300006051 Ga0075364_10015756 Ga0075364_100157562 336
108 3300009036 Ga0105244_10068353 Ga0105244_100683532 336
109 3300031911 Ga0307412_10000918 Ga0307412_1000091813 336
110 3300048925 Ga0496122_0001381 Ga0496122_0001381_7883_8986 336
111 3300048926 Ga0496123_0000411 Ga0496123_0000411_8387_9490 336
112 3300048928 Ga0496125_0025916 Ga0496125_0025916_357_1460 336
113 3300050491 nmdc:mga00v17_5311_c1 nmdc:mga00v17_5311_c1_2382_3485 336
114 iso_pu_bacteria 2856349417 2856352198 336
115 3300003187 JGI25151J46595_10000195 JGI25151J46595_1000019523 337
116 3300025294 Ga0209025_1000040 Ga0209025_1000040283 337
117 3300046499 Ga0495594_0177146 Ga0495594_0177146_182_1195 337
118 3300006051 Ga0075364_10001161 Ga0075364_100011613 338
119 3300006051 Ga0075364_10025590 Ga0075364_100255904 338
120 3300037466 Ga0395898_0150848 Ga0395898_0150848_32_1126 338
121 3300005471 Ga0070698_100175114 Ga0070698_1001751142 339
122 3300006051 Ga0075364_10099958 Ga0075364_100999582 339
123 3300006051 Ga0075364_10104267 Ga0075364_101042672 339
124 3300025924 Ga0207694_10092620 Ga0207694_100926202 339
125 3300050493 nmdc:mga0k408_127804_c1 nmdc:mga0k408_127804_c1_67_1248 339
126 3300037418 Ga0395900_0053459 Ga0395900_0053459_819_1925 340
127 3300049570 Ga0501033_0005271 Ga0501033_0005271_7689_8792 340
128 3300049571 Ga0501034_0026665 Ga0501034_0026665_3750_4853 340
129 3300049573 Ga0501037_0234545 Ga0501037_0234545_168_1271 340
130 3300049581 Ga0501047_0000477 Ga0501047_0000477_36760_37863 340
131 3300049822 Ga0501035_0004829 Ga0501035_0004829_8076_9179 340
132 3300049823 Ga0501044_0000987 Ga0501044_0000987_16417_17520 340
133 3300045049 Ga0466959_0052408 Ga0466959_0052408_1937_2971 341
134 3300050491 nmdc:mga00v17_71659_c1 nmdc:mga00v17_71659_c1_488_1639 341
135 3300006195 Ga0075366_10047179 Ga0075366_100471793 342
136 3300025910 Ga0207684_10002597 Ga0207684_100025978 342
137 3300041407 Ga0439447_017232 Ga0439447_017232_273_1400 342
138 3300041997 Ga0439431_0014036 Ga0439431_0014036_442_1569 342
139 3300048924 Ga0496121_0026659 Ga0496121_0026659_4124_5227 342
140 3300003316 rootH1_10026513 rootH1_100265132 343
141 3300003794 Ga0055531_10029303 Ga0055531_100293032 343
142 3300006178 Ga0075367_10068056 Ga0075367_100680561 343
143 3300042876 Ga0451577_0096507 Ga0451577_0096507_466_1638 343
144 3300048929 Ga0496126_0239859 Ga0496126_0239859_441_1496 343
145 3300050491 nmdc:mga00v17_558_c1 nmdc:mga00v17_558_c1_13124_14359 343
146 iso_pu_bacteria 8019538911 8019545274 343
147 iso_pu_bacteria 8019608314 8019618202 343
148 3300009094 Ga0111539_10084175 Ga0111539_100841753 344
149 3300044656 Ga0466969_0016791 Ga0466969_0016791_2441_3691 344
150 3300044683 Ga0466965_0001897 Ga0466965_0001897_2903_4153 344
151 3300044684 Ga0466966_0025143 Ga0466966_0025143_2010_3260 344
152 3300044693 Ga0466961_0019605 Ga0466961_0019605_445_1695 344
153 3300044706 Ga0466964_0006744 Ga0466964_0006744_1848_3098 344
154 3300044735 Ga0466968_0070883 Ga0466968_0070883_288_1430 344
155 3300044842 Ga0466957_0021128 Ga0466957_0021128_264_1514 344
156 3300045049 Ga0466959_0003326 Ga0466959_0003326_5543_6793 344
157 3300045836 Ga0466958_0155860 Ga0466958_0155860_54_1196 344
158 3300003215 JGI25153J46596_10043410 JGI25153J46596_100434101 345
159 3300005435 Ga0070714_100382151 Ga0070714_1003821512 345
160 3300005439 Ga0070711_100107768 Ga0070711_1001077682 345
161 3300006914 Ga0075436_100058719 Ga0075436_1000587192 345
162 3300031239 Ga0265328_10002795 Ga0265328_100027955 345
163 3300031251 Ga0265327_10000315 Ga0265327_1000031536 345
164 3300031649 Ga0307514_10001020 Ga0307514_1000102026 345
165 3300031731 Ga0307405_10024462 Ga0307405_100244623 345
166 3300046530 Ga0495654_0070144 Ga0495654_0070144_596_1651 345
167 3300053108 Ga0500562_039247 Ga0500562_039247_188_1243 345
168 3300005937 Ga0081455_10006592 Ga0081455_100065926 346
169 3300005985 Ga0081539_10017427 Ga0081539_100174272 346
170 3300006028 Ga0070717_10003205 Ga0070717_100032057 346
171 3300009148 Ga0105243_10001412 Ga0105243_100014124 346
172 3300046455 Ga0495603_0011469 Ga0495603_0011469_3317_4366 346
173 3300046474 Ga0495605_0019111 Ga0495605_0019111_707_1756 346
174 3300046690 Ga0495624_0053079 Ga0495624_0053079_696_1817 346
175 3300049460 Ga0495682_0017968 Ga0495682_0017968_567_1616 346
176 3300049823 Ga0501044_0474966 Ga0501044_0474966_84_1136 346
177 iso_pu_bacteria 2857509624 2857515930 346
178 3300005577 Ga0068857_100048859 Ga0068857_1000488594 347
179 3300035172 Ga0373955_0011701 Ga0373955_0011701_3101_4159 347
180 3300039450 Ga0436363_0600222 Ga0436363_0600222_1578_2636 347
181 3300048929 Ga0496126_0095848 Ga0496126_0095848_43_1155 347
182 3300003791 Ga0055530_10000150 Ga0055530_100001504 348
183 3300003792 Ga0055540_1000175 Ga0055540_10001754 348
184 3300009987 Ga0105030_100135 Ga0105030_1001353 348
185 3300015261 Ga0182006_1040160 Ga0182006_10401602 348
186 3300015262 Ga0182007_10044641 Ga0182007_100446411 348
187 3300025292 Ga0209676_1005922 Ga0209676_10059223 348
188 3300025298 Ga0209050_1000024 Ga0209050_1000024183 348
189 3300025303 Ga0209051_1000023 Ga0209051_100002399 348
190 3300025304 Ga0209257_1004945 Ga0209257_10049453 348
191 3300031548 Ga0307408_100188518 Ga0307408_1001885182 348
192 3300031901 Ga0307406_10176535 Ga0307406_101765351 348
193 3300046524 Ga0495648_0005418 Ga0495648_0005418_1813_2874 348
194 3300049583 Ga0501067_0015248 Ga0501067_0015248_189_1310 348
195 3300049589 Ga0501073_0009857 Ga0501073_0009857_158_1279 348
196 3300049742 Ga0501080_0002465 Ga0501080_0002465_12462_13583 348
197 3300049744 Ga0501083_0039608 Ga0501083_0039608_1071_2192 348
198 3300060353 Ga0501082_0006434 Ga0501082_0006434_7419_8540 348
199 3300009092 Ga0105250_10011073 Ga0105250_100110734 349
200 3300009094 Ga0111539_10521151 Ga0111539_105211511 349
201 3300012498 Ga0157345_1000151 Ga0157345_10001512 349
202 3300013100 Ga0157373_10000789 Ga0157373_100007893 349
203 3300013102 Ga0157371_10002021 Ga0157371_1000202117 349
204 3300013102 Ga0157371_10015420 Ga0157371_100154205 349
205 3300013105 Ga0157369_10002918 Ga0157369_100029182 349
206 3300013105 Ga0157369_10037854 Ga0157369_100378544 349
207 3300013105 Ga0157369_10081171 Ga0157369_100811713 349
208 3300013306 Ga0163162_10001285 Ga0163162_100012852 349
209 3300013306 Ga0163162_10231284 Ga0163162_102312842 349
210 3300014497 Ga0182008_10007486 Ga0182008_100074862 349
211 3300025253 Ga0209677_102534 Ga0209677_1025347 349
212 3300025933 Ga0207706_10144240 Ga0207706_101442402 349
213 3300026067 Ga0207678_10141824 Ga0207678_101418243 349
214 3300041405 Ga0439438_000615 Ga0439438_000615_67_1125 349
215 3300041407 Ga0439447_021098 Ga0439447_021098_244_1302 349
216 3300041411 Ga0439466_0000965 Ga0439466_0000965_8907_9965 349
217 3300042010 Ga0439452_000566 Ga0439452_000566_17188_18246 349
218 3300042013 Ga0439456_001721 Ga0439456_001721_1134_2192 349
219 3300042115 Ga0450911_000304 Ga0450911_000304_15805_16863 349
220 3300042136 Ga0450900_003575 Ga0450900_003575_123_1181 349
221 3300044684 Ga0466966_0025890 Ga0466966_0025890_2740_3810 349
222 3300046453 Ga0495627_000415 Ga0495627_000415_35520_36578 349
223 3300046458 Ga0495591_000975 Ga0495591_000975_870_1928 349
224 3300046501 Ga0495607_0052194 Ga0495607_0052194_1138_2196 349
225 3300046506 Ga0495583_0022237 Ga0495583_0022237_915_1973 349
226 3300046507 Ga0495606_0059263 Ga0495606_0059263_603_1661 349
227 3300046515 Ga0495620_0000231 Ga0495620_0000231_39750_40808 349
228 3300046518 Ga0495631_0023548 Ga0495631_0023548_737_1795 349
229 3300046520 Ga0495637_0002729 Ga0495637_0002729_7590_8648 349
230 3300046523 Ga0495644_0023779 Ga0495644_0023779_13_1071 349
231 3300046530 Ga0495654_0001197 Ga0495654_0001197_17140_18198 349
232 3300046538 Ga0495609_0001158 Ga0495609_0001158_15813_16871 349
233 3300046558 Ga0495633_0002236 Ga0495633_0002236_648_1706 349
234 3300046690 Ga0495624_0006291 Ga0495624_0006291_6467_7525 349
235 3300046692 Ga0495671_0049844 Ga0495671_0049844_840_1898 349
236 3300046694 Ga0495649_0032872 Ga0495649_0032872_1672_2730 349
237 3300046794 Ga0495589_0000678 Ga0495589_0000678_888_1946 349
238 3300047320 Ga0495672_0032400 Ga0495672_0032400_1310_2368 349
239 3300047322 Ga0495680_0075591 Ga0495680_0075591_1146_2204 349
240 3300047469 Ga0495673_0009718 Ga0495673_0009718_904_1962 349
241 3300048919 Ga0496116_0000046 Ga0496116_0000046_198558_199616 349
242 3300048919 Ga0496116_0001963 Ga0496116_0001963_979_2037 349
243 3300048924 Ga0496121_0000093 Ga0496121_0000093_14286_15344 349
244 3300048924 Ga0496121_0004887 Ga0496121_0004887_894_1952 349
245 3300049459 Ga0495678_002139 Ga0495678_002139_11960_13018 349
246 3300049460 Ga0495682_0006507 Ga0495682_0006507_1004_2062 349
247 3300049572 Ga0501036_0032497 Ga0501036_0032497_1930_3039 349
248 3300053136 Ga0500559_0036176 Ga0500559_0036176_379_1491 349
249 3300060353 Ga0501082_0022979 Ga0501082_0022979_3336_4445 349
250 iso_pu_bacteria 2885366525 2885370519 349
251 3300003215 JGI25153J46596_10001910 JGI25153J46596_100019107 350
252 3300003794 Ga0055531_10016353 Ga0055531_100163532 350
253 3300005563 Ga0068855_100490959 Ga0068855_1004909591 350
254 3300025297 Ga0209758_1000024 Ga0209758_1000024106 350
255 3300025304 Ga0209257_1004927 Ga0209257_10049274 350
256 3300046462 Ga0495651_0093750 Ga0495651_0093750_495_1565 350
257 3300046559 Ga0495667_0011698 Ga0495667_0011698_4492_5562 350
258 3300046642 Ga0495634_0030773 Ga0495634_0030773_2546_3616 350
259 3300046675 Ga0495657_0028324 Ga0495657_0028324_545_1615 350
260 3300046680 Ga0495646_0126693 Ga0495646_0126693_162_1232 350
261 3300047322 Ga0495680_0224225 Ga0495680_0224225_263_1330 350
262 3300047471 Ga0495684_0008772 Ga0495684_0008772_204_1274 350
263 3300047472 Ga0495686_0138510 Ga0495686_0138510_231_1355 350
264 3300049575 Ga0501039_0032810 Ga0501039_0032810_1103_2188 350
265 iso_pu_bacteria 2806310737 2807406025 350
266 iso_pu_bacteria 2806310745 2807454377 350
267 3300002737 JGI25162J39368_1001867 JGI25162J39368_10018676 351
268 3300002771 JGI25163J39215_1000623 JGI25163J39215_10006236 351
269 3300002772 JGI25164J39214_1000130 JGI25164J39214_100013068 351
270 3300003214 JGI25165J46597_1001729 JGI25165J46597_10017296 351
271 3300014497 Ga0182008_10001885 Ga0182008_100018859 351
272 3300025207 Ga0209760_100025 Ga0209760_100025133 351
273 3300025231 Ga0207427_100003 Ga0207427_100003458 351
274 3300025233 Ga0209437_100002 Ga0209437_100002555 351
275 3300025261 Ga0209233_1000004 Ga0209233_1000004870 351
276 3300025302 Ga0207426_1046358 Ga0207426_10463581 351
277 3300025929 Ga0207664_10028049 Ga0207664_100280492 351
278 3300035691 Ga0373931_0024948 Ga0373931_0024948_1426_2538 351
279 3300037312 Ga0395899_0101302 Ga0395899_0101302_929_2020 351
280 3300037466 Ga0395898_0112834 Ga0395898_0112834_469_1560 351
281 3300038443 Ga0395901_0003090 Ga0395901_0003090_5814_6905 351
282 3300039447 Ga0436361_0432976 Ga0436361_0432976_4224_5300 351
283 3300046559 Ga0495667_0013735 Ga0495667_0013735_4368_5438 351
284 3300048915 Ga0496112_0000004 Ga0496112_0000004_378458_379528 351
285 3300048919 Ga0496116_0000220 Ga0496116_0000220_84515_85636 351
286 3300048920 Ga0496117_0001438 Ga0496117_0001438_21386_22507 351
287 3300048924 Ga0496121_0000229 Ga0496121_0000229_19281_20402 351
288 3300048925 Ga0496122_0010358 Ga0496122_0010358_2052_3173 351
289 3300048926 Ga0496123_0004139 Ga0496123_0004139_12220_13341 351
290 3300048928 Ga0496125_0039046 Ga0496125_0039046_774_1895 351
291 3300049822 Ga0501035_0025090 Ga0501035_0025090_654_1757 351
292 iso_pu_bacteria 2511231006 2511266853 351
293 iso_pu_bacteria 2512047018 2512329505 351
294 iso_pu_bacteria 2582580891 2583795737 351
295 iso_pu_bacteria 2597489887 2597860867 351
296 iso_pu_bacteria 2597489888 2597866617 351
297 iso_pu_bacteria 2599185160 2599355973 351
298 iso_pu_bacteria 2599185161 2599362625 351
299 iso_pu_bacteria 2599185162 2599369069 351
300 iso_pu_bacteria 2599185163 2599375734 351
301 iso_pu_bacteria 2599185164 2599381079 351
302 iso_pu_bacteria 2599185165 2599387405 351
303 iso_pu_bacteria 2599185166 2599394592 351
304 iso_pu_bacteria 2599185167 2599400552 351
305 iso_pu_bacteria 2599185168 2599406357 351
306 iso_pu_bacteria 2599185179 2599449876 351
307 iso_pu_bacteria 2599185181 2599462807 351
308 iso_pu_bacteria 2599185182 2599467770 351
309 iso_pu_bacteria 2599185185 2599485897 351
310 iso_pu_bacteria 2599185186 2599491824 351
311 iso_pu_bacteria 2599185189 2599505739 351
312 iso_pu_bacteria 2599185190 2599511950 351
313 iso_pu_bacteria 2599185191 2599516934 351
314 iso_pu_bacteria 2599185257 2599804679 351
315 iso_pu_bacteria 2599185290 2599892688 351
316 iso_pu_bacteria 2599185356 2600215433 351
317 iso_pu_bacteria 2600254931 2600363561 351
318 iso_pu_bacteria 2600255296 2601693458 351
319 iso_pu_bacteria 2600255313 2601775599 351
320 iso_pu_bacteria 2643221571 2643872251 351
321 iso_pu_bacteria 2643221713 2644620154 351
322 iso_pu_bacteria 2667528171 2671099265 351
323 iso_pu_bacteria 2671180172 2671771686 351
324 iso_pu_bacteria 2721755607 2723251353 351
325 iso_pu_bacteria 2740892503 2743740409 351
326 iso_pu_bacteria 2818991464 2819704387 351
327 3300003203 JGI25406J46586_10003146 JGI25406J46586_100031465 352
328 3300005288 Ga0065714_10077781 Ga0065714_100777811 352
329 3300005327 Ga0070658_10074357 Ga0070658_100743572 352
330 3300005439 Ga0070711_100038035 Ga0070711_1000380352 352
331 3300005530 Ga0070679_100402024 Ga0070679_1004020241 352
332 3300005937 Ga0081455_10024972 Ga0081455_100249723 352
333 3300005983 Ga0081540_1043861 Ga0081540_10438611 352
334 3300005985 Ga0081539_10000148 Ga0081539_10000148116 352
335 3300006852 Ga0075433_10008589 Ga0075433_100085895 352
336 3300006871 Ga0075434_100000766 Ga0075434_1000007665 352
337 3300013104 Ga0157370_10375385 Ga0157370_103753851 352
338 3300014326 Ga0157380_10010381 Ga0157380_100103812 352
339 3300017792 Ga0163161_10136874 Ga0163161_101368742 352
340 3300025909 Ga0207705_10088342 Ga0207705_100883422 352
341 3300025916 Ga0207663_10110872 Ga0207663_101108722 352
342 3300027907 Ga0207428_10153492 Ga0207428_101534922 352
343 3300035117 Ga0373953_0004837 Ga0373953_0004837_1123_2238 352
344 3300035119 Ga0373956_0015922 Ga0373956_0015922_908_2023 352
345 3300035120 Ga0373957_0004425 Ga0373957_0004425_2079_3194 352
346 3300035691 Ga0373931_0126172 Ga0373931_0126172_179_1270 352
347 3300046463 Ga0495653_0043147 Ga0495653_0043147_2114_3229 352
348 3300046477 Ga0495664_0015166 Ga0495664_0015166_1505_2620 352
349 3300046512 Ga0495610_0029705 Ga0495610_0029705_1460_2572 352
350 3300046529 Ga0495652_0028480 Ga0495652_0028480_1478_2593 352
351 3300046533 Ga0495640_0040414 Ga0495640_0040414_789_1904 352
352 3300046543 Ga0495645_0016528 Ga0495645_0016528_1547_2662 352
353 3300046663 Ga0495635_0025341 Ga0495635_0025341_2503_3618 352
354 3300046679 Ga0495623_0002847 Ga0495623_0002847_8247_9362 352
355 3300046681 Ga0495647_0051544 Ga0495647_0051544_248_1363 352
356 3300046809 Ga0495600_0084270 Ga0495600_0084270_801_1916 352
357 3300047317 Ga0495604_0008991 Ga0495604_0008991_982_2097 352
358 3300047322 Ga0495680_0057176 Ga0495680_0057176_1531_2646 352
359 3300049569 Ga0501032_0019278 Ga0501032_0019278_354_1475 352
360 3300049570 Ga0501033_0186663 Ga0501033_0186663_203_1324 352
361 3300049575 Ga0501039_0004768 Ga0501039_0004768_4679_5800 352
362 3300049576 Ga0501040_0014406 Ga0501040_0014406_923_2044 352
363 3300049578 Ga0501042_0013981 Ga0501042_0013981_1656_2777 352
364 3300049579 Ga0501043_0187229 Ga0501043_0187229_377_1498 352
365 3300049580 Ga0501046_0193971 Ga0501046_0193971_187_1308 352
366 3300049587 Ga0501071_0013254 Ga0501071_0013254_1000_2121 352
367 3300049592 Ga0501076_0020718 Ga0501076_0020718_568_1689 352
368 3300049743 Ga0501081_0004633 Ga0501081_0004633_7042_8163 352
369 3300049822 Ga0501035_0023345 Ga0501035_0023345_3750_4871 352
370 3300049823 Ga0501044_0114906 Ga0501044_0114906_1540_2661 352
371 3300050512 nmdc:mga0n895_22023_c1 nmdc:mga0n895_22023_c1_2618_3736 352
372 3300050515 nmdc:mga0a205_461_c1 nmdc:mga0a205_461_c1_29627_30745 352
373 3300053094 Ga0500566_0007897 Ga0500566_0007897_773_1849 352
374 3300053119 Ga0500595_002911 Ga0500595_002911_6232_7308 352
375 3300053178 Ga0500637_0000132 Ga0500637_0000132_4490_5566 352
376 3300054114 Ga0501084_0105072 Ga0501084_0105072_1028_2149 352
377 3300055283 Ga0500661_004960 Ga0500661_004960_1162_2238 352
378 iso_pu_bacteria 2857537821 2857540860 352
379 iso_pu_bacteria 2858950400 2858956418 352
380 iso_pu_bacteria 2876392853 2876393862 352
381 iso_pu_bacteria 2881155292 2881158175 352
382 iso_pu_bacteria 2881853255 2881856042 352
383 iso_pu_bacteria 2881927736 2881929323 352
384 iso_pu_bacteria 2885350715 2885354577 352
385 iso_pu_bacteria 2904659560 2904660898 352
386 iso_pu_bacteria 2961114664 2961116057 352
387 iso_pu_bacteria 2968110612 2968112042 352
388 3300025937 Ga0207669_10117280 Ga0207669_101172801 353
389 3300027876 Ga0209974_10011959 Ga0209974_100119592 353
390 3300028800 Ga0265338_10203576 Ga0265338_102035761 353
391 3300031730 Ga0307516_10048898 Ga0307516_100488982 353
392 3300031731 Ga0307405_10014846 Ga0307405_100148464 353
393 3300031824 Ga0307413_10031975 Ga0307413_100319753 353
394 3300031901 Ga0307406_10034564 Ga0307406_100345642 353
395 3300032002 Ga0307416_100003094 Ga0307416_1000030942 353
396 3300032005 Ga0307411_10048225 Ga0307411_100482252 353
397 3300032126 Ga0307415_100001180 Ga0307415_1000011808 353
398 3300037418 Ga0395900_0013685 Ga0395900_0013685_6181_7287 353
399 3300039438 Ga0436360_0105255 Ga0436360_0105255_968_2050 353
400 3300039447 Ga0436361_0328064 Ga0436361_0328064_218_1321 353
401 3300042133 Ga0450896_000896 Ga0450896_000896_333_1454 353
402 3300042184 Ga0450908_003021 Ga0450908_003021_1635_2756 353
403 3300042436 Ga0439435_0001752 Ga0439435_0001752_2784_3905 353
404 3300042437 Ga0439444_0003265 Ga0439444_0003265_457_1578 353
405 3300045976 Ga0466967_0134031 Ga0466967_0134031_350_1471 353
406 3300046455 Ga0495603_0010552 Ga0495603_0010552_549_1643 353
407 3300049570 Ga0501033_0045457 Ga0501033_0045457_1477_2583 353
408 3300049571 Ga0501034_0042197 Ga0501034_0042197_1946_3052 353
409 3300049572 Ga0501036_0164435 Ga0501036_0164435_213_1319 353
410 3300049581 Ga0501047_0125227 Ga0501047_0125227_778_1884 353
411 3300049823 Ga0501044_0063709 Ga0501044_0063709_2195_3301 353
412 iso_pu_bacteria 2515154123 2515691725 353
413 iso_pu_bacteria 2602042107 2603856794 353
414 iso_pu_bacteria 2739367655 2739611030 353
415 iso_pu_bacteria 2881665667 2881672512 353
416 iso_pu_bacteria 2887375801 2887380375 353
417 iso_pu_bacteria 3007315729 3007318773 353
418 3300003203 JGI25406J46586_10000027 JGI25406J46586_1000002732 354
419 3300005336 Ga0070680_100088270 Ga0070680_1000882702 354
420 3300005457 Ga0070662_100071722 Ga0070662_1000717221 354
421 3300005458 Ga0070681_10009117 Ga0070681_100091172 354
422 3300005458 Ga0070681_10014556 Ga0070681_100145562 354
423 3300005530 Ga0070679_100020776 Ga0070679_1000207762 354
424 3300005563 Ga0068855_100062119 Ga0068855_1000621193 354
425 3300005985 Ga0081539_10000051 Ga0081539_1000005132 354
426 3300009093 Ga0105240_10069157 Ga0105240_100691574 354
427 3300013102 Ga0157371_10002180 Ga0157371_1000218016 354
428 3300013104 Ga0157370_10112690 Ga0157370_101126902 354
429 3300013307 Ga0157372_10015782 Ga0157372_100157823 354
430 3300021361 Ga0213872_10043153 Ga0213872_100431532 354
431 3300025711 Ga0207696_1014635 Ga0207696_10146352 354
432 3300025735 Ga0207713_1004772 Ga0207713_10047723 354
433 3300025912 Ga0207707_10069686 Ga0207707_100696863 354
434 3300025917 Ga0207660_10047416 Ga0207660_100474162 354
435 3300025921 Ga0207652_10129327 Ga0207652_101293272 354
436 3300025935 Ga0207709_10010196 Ga0207709_100101963 354
437 3300025949 Ga0207667_10143474 Ga0207667_101434742 354
438 3300027312 Ga0209371_1000151 Ga0209371_100015166 354
439 3300030500 Ga0268256_1000163 Ga0268256_100016344 354
440 3300031616 Ga0307508_10000018 Ga0307508_10000018177 354
441 3300031995 Ga0307409_100164006 Ga0307409_1001640062 354
442 3300037068 Ga0373925_0144023 Ga0373925_0144023_236_1339 354
443 3300037466 Ga0395898_0286713 Ga0395898_0286713_38_1132 354
444 3300037471 Ga0395905_0027144 Ga0395905_0027144_2585_3673 354
445 3300041405 Ga0439438_003869 Ga0439438_003869_1617_2702 354
446 3300041407 Ga0439447_001332 Ga0439447_001332_78_1163 354
447 3300041411 Ga0439466_0006786 Ga0439466_0006786_1821_2906 354
448 3300042006 Ga0439432_002018 Ga0439432_002018_4652_5737 354
449 3300044901 Ga0466960_0019222 Ga0466960_0019222_1863_2981 354
450 3300046455 Ga0495603_0035626 Ga0495603_0035626_1310_2413 354
451 3300046507 Ga0495606_0003754 Ga0495606_0003754_5617_6714 354
452 3300046515 Ga0495620_0000229 Ga0495620_0000229_38817_39881 354
453 3300046519 Ga0495632_0008782 Ga0495632_0008782_1857_2921 354
454 3300046522 Ga0495643_0002030 Ga0495643_0002030_12607_13671 354
455 3300046524 Ga0495648_0013922 Ga0495648_0013922_1791_2855 354
456 3300048091 Ga0495626_0035027 Ga0495626_0035027_1127_2221 354
457 3300048919 Ga0496116_0094032 Ga0496116_0094032_452_1516 354
458 3300048921 Ga0496118_0016655 Ga0496118_0016655_5253_6317 354
459 3300048923 Ga0496120_0003119 Ga0496120_0003119_9605_10669 354
460 3300048924 Ga0496121_0044950 Ga0496121_0044950_2455_3519 354
461 3300048927 Ga0496124_0050734 Ga0496124_0050734_224_1288 354
462 3300048928 Ga0496125_0012388 Ga0496125_0012388_4880_5944 354
463 3300053145 Ga0500586_001313 Ga0500586_001313_2050_3144 354
464 iso_pu_bacteria 2507262055 2507508205 354
465 iso_pu_bacteria 2508501009 2508542271 354
466 iso_pu_bacteria 2508501042 2508691965 354
467 iso_pu_bacteria 2510065053 2510284094 354
468 iso_pu_bacteria 2510065055 2510293230 354
469 iso_pu_bacteria 2510065058 2510312724 354
470 iso_pu_bacteria 2513237098 2513676604 354
471 iso_pu_bacteria 2513237101 2513692915 354
472 iso_pu_bacteria 2515154112 2515627288 354
473 iso_pu_bacteria 2524023210 2524470382 354
474 iso_pu_bacteria 2599185292 2599906109 354
475 iso_pu_bacteria 2643221569 2643861893 354
476 iso_pu_bacteria 2643221594 2643979943 354
477 iso_pu_bacteria 2643221621 2644122538 354
478 iso_pu_bacteria 2643221654 2644305243 354
479 iso_pu_bacteria 2721755755 2723846542 354
480 iso_pu_bacteria 2773857672 2774130482 354
481 iso_pu_bacteria 2791355196 2793062577 354
482 iso_pu_bacteria 2791355199 2793080610 354
483 iso_pu_bacteria 2808606395 2809031610 354
484 iso_pu_bacteria 2855730933 2855736361 354
485 iso_pu_bacteria 2855767633 2855773298 354
486 iso_pu_bacteria 2857542790 2857547272 354
487 iso_pu_bacteria 2874604998 2874605563 354
488 iso_pu_bacteria 2874628541 2874632292 354
489 iso_pu_bacteria 2876808645 2876816692 354
490 iso_pu_bacteria 2879110137 2879115877 354
491 iso_pu_bacteria 2881364244 2881368447 354
492 iso_pu_bacteria 2881412998 2881418750 354
493 iso_pu_bacteria 2885383462 2885387859 354
494 iso_pu_bacteria 2889033259 2889039392 354
495 iso_pu_bacteria 2893066018 2893068705 354
496 iso_pu_bacteria 2903768456 2903771879 354
497 iso_pu_bacteria 2922361189 2922365748 354
498 iso_pu_bacteria 2935608549 2935609312 354
499 iso_pu_bacteria 2935648319 2935650897 354
500 iso_pu_bacteria 2935656913 2935659078 354
501 iso_pu_bacteria 2935819856 2935822472 354
502 iso_pu_bacteria 2935847175 2935848055 354
503 iso_pu_bacteria 2935908558 2935908722 354
504 iso_pu_bacteria 2935916978 2935917868 354
505 iso_pu_bacteria 2935926038 2935926704 354
506 iso_pu_bacteria 2935934488 2935935154 354
507 iso_pu_bacteria 2935942939 2935943604 354
508 iso_pu_bacteria 2935951376 2935952042 354
509 iso_pu_bacteria 2935967501 2935968167 354
510 iso_pu_bacteria 2935975950 2935978782 354
511 iso_pu_bacteria 2935984226 2935987347 354
512 iso_pu_bacteria 2936011229 2936013493 354
513 iso_pu_bacteria 2936019824 2936022380 354
514 iso_pu_bacteria 2936028420 2936030826 354
515 iso_pu_bacteria 2936046547 2936048639 354
516 iso_pu_bacteria 2936055302 2936058853 354
517 iso_pu_bacteria 2941479691 2941485818 354
518 iso_pu_bacteria 2941531003 2941533205 354
519 iso_pu_bacteria 2974298342 2974301469 354
520 iso_pu_bacteria 2984499530 2984503949 354
521 iso_pu_bacteria 3005506211 3005510689 354
522 iso_pu_bacteria 8006964411 8006969663 354
523 iso_pu_bacteria 8006984368 8006987875 354
524 iso_pu_bacteria 8006994254 8006995649 354
525 iso_pu_bacteria 8016630954 8016639921 354
526 iso_pu_bacteria 8019629233 8019634045 354
527 iso_pu_bacteria 8019638758 8019645685 354
528 iso_pu_bacteria 8019659431 8019661925 354
529 iso_pu_bacteria 8019687851 8019690482 354
530 iso_pu_bacteria 8048746797 8048748867 354
531 iso_pu_bacteria 8056673599 8056676940 354
532 3300001915 JGI24741J21665_1003620 JGI24741J21665_10036203 355
533 3300001989 JGI24739J22299_10034928 JGI24739J22299_100349282 355
534 3300001990 JGI24737J22298_10001022 JGI24737J22298_100010226 355
535 3300002737 JGI25162J39368_1000505 JGI25162J39368_100050524 355
536 3300002737 JGI25162J39368_1000520 JGI25162J39368_10005205 355
537 3300002772 JGI25164J39214_1000342 JGI25164J39214_10003425 355
538 3300002772 JGI25164J39214_1000350 JGI25164J39214_10003505 355
539 3300003214 JGI25165J46597_1000629 JGI25165J46597_10006295 355
540 3300003214 JGI25165J46597_1000645 JGI25165J46597_10006455 355
541 3300003215 JGI25153J46596_10038457 JGI25153J46596_100384572 355
542 3300003763 Ga0055529_1001266 Ga0055529_10012663 355
543 3300005288 Ga0065714_10068635 Ga0065714_100686353 355
544 3300005288 Ga0065714_10069870 Ga0065714_100698703 355
545 3300005288 Ga0065714_10070155 Ga0065714_100701553 355
546 3300005288 Ga0065714_10077781 Ga0065714_100777812 355
547 3300005288 Ga0065714_10132432 Ga0065714_101324321 355
548 3300005290 Ga0065712_10072290 Ga0065712_100722902 355
549 3300005331 Ga0070670_100001953 Ga0070670_1000019534 355
550 3300005344 Ga0070661_100095992 Ga0070661_1000959922 355
551 3300005353 Ga0070669_100002598 Ga0070669_1000025984 355
552 3300005455 Ga0070663_100064241 Ga0070663_1000642413 355
553 3300005457 Ga0070662_100008312 Ga0070662_1000083125 355
554 3300005457 Ga0070662_100127954 Ga0070662_1001279542 355
555 3300005539 Ga0068853_100000187 Ga0068853_10000018723 355
556 3300005548 Ga0070665_100095898 Ga0070665_1000958982 355
557 3300005578 Ga0068854_100003296 Ga0068854_1000032967 355
558 3300005578 Ga0068854_100095029 Ga0068854_1000950292 355
559 3300005843 Ga0068860_100000213 Ga0068860_10000021369 355
560 3300006038 Ga0075365_10023750 Ga0075365_100237503 355
561 3300006038 Ga0075365_10094806 Ga0075365_100948062 355
562 3300006051 Ga0075364_10194853 Ga0075364_101948532 355
563 3300006058 Ga0075432_10034684 Ga0075432_100346843 355
564 3300006058 Ga0075432_10057374 Ga0075432_100573741 355
565 3300006186 Ga0075369_10014926 Ga0075369_100149262 355
566 3300006353 Ga0075370_10066959 Ga0075370_100669592 355
567 3300006914 Ga0075436_100218350 Ga0075436_1002183502 355
568 3300006942 Ga0099824_1018120 Ga0099824_10181202 355
569 3300006946 Ga0079104_1001103 Ga0079104_10011036 355
570 3300009011 Ga0105251_10017375 Ga0105251_100173752 355
571 3300009092 Ga0105250_10028250 Ga0105250_100282502 355
572 3300009093 Ga0105240_10104268 Ga0105240_101042682 355
573 3300009148 Ga0105243_10001599 Ga0105243_1000159915 355
574 3300009148 Ga0105243_10144585 Ga0105243_101445852 355
575 3300009148 Ga0105243_10390432 Ga0105243_103904322 355
576 3300009177 Ga0105248_10007834 Ga0105248_100078347 355
577 3300009545 Ga0105237_10121683 Ga0105237_101216832 355
578 3300009545 Ga0105237_10286056 Ga0105237_102860562 355
579 3300009553 Ga0105249_10007064 Ga0105249_100070646 355
580 3300010159 Ga0099796_10014885 Ga0099796_100148852 355
581 3300010375 Ga0105239_10021881 Ga0105239_100218814 355
582 3300013102 Ga0157371_10013168 Ga0157371_100131683 355
583 3300013102 Ga0157371_10067806 Ga0157371_100678062 355
584 3300013104 Ga0157370_10077868 Ga0157370_100778683 355
585 3300013105 Ga0157369_10179265 Ga0157369_101792652 355
586 3300014497 Ga0182008_10006484 Ga0182008_100064844 355
587 3300014497 Ga0182008_10106983 Ga0182008_101069831 355
588 3300014497 Ga0182008_10134459 Ga0182008_101344591 355
589 3300015261 Ga0182006_1030586 Ga0182006_10305862 355
590 3300017792 Ga0163161_10149651 Ga0163161_101496512 355
591 3300017792 Ga0163161_10237469 Ga0163161_102374691 355
592 3300025207 Ga0209760_100197 Ga0209760_1001975 355
593 3300025231 Ga0207427_100005 Ga0207427_100005318 355
594 3300025233 Ga0209437_100018 Ga0209437_100018228 355
595 3300025261 Ga0209233_1000021 Ga0209233_1000021318 355
596 3300025272 Ga0209455_1000795 Ga0209455_10007953 355
597 3300025297 Ga0209758_1002091 Ga0209758_100209120 355
598 3300025303 Ga0209051_1011455 Ga0209051_10114553 355
599 3300025711 Ga0207696_1021172 Ga0207696_10211722 355
600 3300025728 Ga0207655_1038420 Ga0207655_10384202 355
601 3300025728 Ga0207655_1044069 Ga0207655_10440692 355
602 3300025735 Ga0207713_1001707 Ga0207713_10017073 355
603 3300025735 Ga0207713_1006013 Ga0207713_10060133 355
604 3300025735 Ga0207713_1007874 Ga0207713_10078742 355
605 3300025904 Ga0207647_10001739 Ga0207647_1000173914 355
606 3300025913 Ga0207695_10383090 Ga0207695_103830901 355
607 3300025920 Ga0207649_10288436 Ga0207649_102884361 355
608 3300025924 Ga0207694_10051021 Ga0207694_100510212 355
609 3300025925 Ga0207650_10000157 Ga0207650_1000015776 355
610 3300025933 Ga0207706_10001069 Ga0207706_100010694 355
611 3300025933 Ga0207706_10044947 Ga0207706_100449472 355
612 3300025935 Ga0207709_10013313 Ga0207709_100133132 355
613 3300025941 Ga0207711_10124145 Ga0207711_101241452 355
614 3300025949 Ga0207667_10056026 Ga0207667_100560264 355
615 3300025961 Ga0207712_10004516 Ga0207712_100045164 355
616 3300025981 Ga0207640_10010617 Ga0207640_100106172 355
617 3300025981 Ga0207640_10048787 Ga0207640_100487872 355
618 3300026078 Ga0207702_10028663 Ga0207702_100286632 355
619 3300027296 Ga0209389_1000100 Ga0209389_10001005 355
620 3300027312 Ga0209371_1000245 Ga0209371_100024516 355
621 3300027357 Ga0209589_1000092 Ga0209589_100009216 355
622 3300027361 Ga0209489_100006 Ga0209489_100006473 355
623 3300027907 Ga0207428_10172427 Ga0207428_101724272 355
624 3300027907 Ga0207428_10214373 Ga0207428_102143731 355
625 3300028381 Ga0268264_10000065 Ga0268264_10000065162 355
626 3300030500 Ga0268256_1000201 Ga0268256_100020116 355
627 3300031456 Ga0307513_10193326 Ga0307513_101933262 355
628 3300031616 Ga0307508_10241022 Ga0307508_102410221 355
629 3300031730 Ga0307516_10227251 Ga0307516_102272512 355
630 3300035086 Ga0373934_0019123 Ga0373934_0019123_790_1893 355
631 3300035092 Ga0373952_0026456 Ga0373952_0026456_50_1147 355
632 3300035111 Ga0373923_0012445 Ga0373923_0012445_1850_2953 355
633 3300035117 Ga0373953_0011650 Ga0373953_0011650_20_1123 355
634 3300035119 Ga0373956_0008939 Ga0373956_0008939_855_1958 355
635 3300035172 Ga0373955_0001054 Ga0373955_0001054_1280_2383 355
636 3300035692 Ga0373935_0035794 Ga0373935_0035794_1225_2328 355
637 3300036401 Ga0373937_0086454 Ga0373937_0086454_647_1750 355
638 3300039437 Ga0436365_0760706 Ga0436365_0760706_343_1431 355
639 3300039447 Ga0436361_0463027 Ga0436361_0463027_1420_2517 355
640 3300041405 Ga0439438_001002 Ga0439438_001002_625_1716 355
641 3300041405 Ga0439438_017683 Ga0439438_017683_633_1700 355
642 3300041407 Ga0439447_001366 Ga0439447_001366_7336_8427 355
643 3300041411 Ga0439466_0015682 Ga0439466_0015682_625_1716 355
644 3300042006 Ga0439432_013930 Ga0439432_013930_1077_2144 355
645 3300042006 Ga0439432_021256 Ga0439432_021256_346_1413 355
646 3300042009 Ga0439451_001929 Ga0439451_001929_12_1103 355
647 3300042009 Ga0439451_007294 Ga0439451_007294_1095_2162 355
648 3300042010 Ga0439452_016282 Ga0439452_016282_779_1870 355
649 3300042145 Ga0450906_000672 Ga0450906_000672_4898_5989 355
650 3300042147 Ga0450910_004099 Ga0450910_004099_483_1574 355
651 3300042184 Ga0450908_001960 Ga0450908_001960_542_1633 355
652 3300044658 Ga0466972_0000846 Ga0466972_0000846_6750_7856 355
653 3300046454 Ga0495592_0034429 Ga0495592_0034429_1435_2538 355
654 3300046458 Ga0495591_000021 Ga0495591_000021_198158_199249 355
655 3300046458 Ga0495591_035759 Ga0495591_035759_186_1253 355
656 3300046459 Ga0495629_0005229 Ga0495629_0005229_1110_2213 355
657 3300046471 Ga0495650_0026268 Ga0495650_0026268_907_1998 355
658 3300046474 Ga0495605_0000391 Ga0495605_0000391_38207_39298 355
659 3300046474 Ga0495605_0014816 Ga0495605_0014816_3017_4108 355
660 3300046474 Ga0495605_0056061 Ga0495605_0056061_504_1571 355
661 3300046491 Ga0495584_0009566 Ga0495584_0009566_689_1756 355
662 3300046491 Ga0495584_0031836 Ga0495584_0031836_1209_2300 355
663 3300046491 Ga0495584_0044159 Ga0495584_0044159_717_1784 355
664 3300046499 Ga0495594_0052184 Ga0495594_0052184_167_1258 355
665 3300046500 Ga0495596_0000128 Ga0495596_0000128_21407_22498 355
666 3300046500 Ga0495596_0004395 Ga0495596_0004395_761_1828 355
667 3300046501 Ga0495607_0001249 Ga0495607_0001249_1082_2173 355
668 3300046501 Ga0495607_0025959 Ga0495607_0025959_2094_3161 355
669 3300046506 Ga0495583_0000015 Ga0495583_0000015_38988_40079 355
670 3300046507 Ga0495606_0018166 Ga0495606_0018166_988_2055 355
671 3300046507 Ga0495606_0093753 Ga0495606_0093753_662_1768 355
672 3300046511 Ga0495608_0028145 Ga0495608_0028145_495_1598 355
673 3300046512 Ga0495610_0029404 Ga0495610_0029404_1010_2077 355
674 3300046512 Ga0495610_0056657 Ga0495610_0056657_697_1764 355
675 3300046513 Ga0495616_0047880 Ga0495616_0047880_409_1500 355
676 3300046516 Ga0495628_0057728 Ga0495628_0057728_758_1861 355
677 3300046518 Ga0495631_0004242 Ga0495631_0004242_4997_6064 355
678 3300046519 Ga0495632_0003754 Ga0495632_0003754_1048_2139 355
679 3300046519 Ga0495632_0023753 Ga0495632_0023753_783_1874 355
680 3300046520 Ga0495637_0001100 Ga0495637_0001100_13767_14858 355
681 3300046520 Ga0495637_0001301 Ga0495637_0001301_12791_13882 355
682 3300046520 Ga0495637_0005947 Ga0495637_0005947_737_1804 355
683 3300046520 Ga0495637_0026881 Ga0495637_0026881_107_1174 355
684 3300046520 Ga0495637_0034975 Ga0495637_0034975_358_1425 355
685 3300046522 Ga0495643_0040043 Ga0495643_0040043_1050_2141 355
686 3300046523 Ga0495644_0011302 Ga0495644_0011302_101_1168 355
687 3300046524 Ga0495648_0056277 Ga0495648_0056277_505_1572 355
688 3300046524 Ga0495648_0065283 Ga0495648_0065283_42_1133 355
689 3300046524 Ga0495648_0092480 Ga0495648_0092480_493_1560 355
690 3300046528 Ga0495642_0008604 Ga0495642_0008604_2156_3247 355
691 3300046529 Ga0495652_0056391 Ga0495652_0056391_1173_2276 355
692 3300046530 Ga0495654_0006795 Ga0495654_0006795_4117_5208 355
693 3300046530 Ga0495654_0031574 Ga0495654_0031574_969_2036 355
694 3300046530 Ga0495654_0073453 Ga0495654_0073453_115_1182 355
695 3300046533 Ga0495640_0027293 Ga0495640_0027293_2994_4097 355
696 3300046542 Ga0495597_0006213 Ga0495597_0006213_1659_2750 355
697 3300046542 Ga0495597_0057264 Ga0495597_0057264_459_1526 355
698 3300046542 Ga0495597_0093887 Ga0495597_0093887_169_1236 355
699 3300046542 Ga0495597_0095516 Ga0495597_0095516_179_1246 355
700 3300046542 Ga0495597_0101449 Ga0495597_0101449_34_1125 355
701 3300046543 Ga0495645_0072329 Ga0495645_0072329_558_1661 355
702 3300046558 Ga0495633_0113237 Ga0495633_0113237_109_1176 355
703 3300046559 Ga0495667_0023096 Ga0495667_0023096_1850_2953 355
704 3300046616 Ga0495668_0007092 Ga0495668_0007092_2142_3233 355
705 3300046616 Ga0495668_0017608 Ga0495668_0017608_2307_3374 355
706 3300046648 Ga0495611_0003126 Ga0495611_0003126_2129_3220 355
707 3300046660 Ga0495625_0003893 Ga0495625_0003893_12586_13677 355
708 3300046660 Ga0495625_0076637 Ga0495625_0076637_492_1559 355
709 3300046663 Ga0495635_0004062 Ga0495635_0004062_2508_3611 355
710 3300046665 Ga0495661_0002403 Ga0495661_0002403_4123_5214 355
711 3300046665 Ga0495661_0022475 Ga0495661_0022475_2190_3296 355
712 3300046665 Ga0495661_0100345 Ga0495661_0100345_55_1122 355
713 3300046665 Ga0495661_0140792 Ga0495661_0140792_58_1125 355
714 3300046675 Ga0495657_0006252 Ga0495657_0006252_7299_8402 355
715 3300046678 Ga0495599_0029627 Ga0495599_0029627_1219_2322 355
716 3300046679 Ga0495623_0092799 Ga0495623_0092799_312_1415 355
717 3300046680 Ga0495646_0005522 Ga0495646_0005522_394_1497 355
718 3300046680 Ga0495646_0027791 Ga0495646_0027791_2432_3523 355
719 3300046684 Ga0495669_0001652 Ga0495669_0001652_6884_7975 355
720 3300046689 Ga0495613_0054909 Ga0495613_0054909_766_1869 355
721 3300046691 Ga0495670_0004412 Ga0495670_0004412_4409_5500 355
722 3300046691 Ga0495670_0019432 Ga0495670_0019432_2101_3168 355
723 3300046692 Ga0495671_0022432 Ga0495671_0022432_84_1151 355
724 3300046692 Ga0495671_0061656 Ga0495671_0061656_21_1112 355
725 3300046692 Ga0495671_0082163 Ga0495671_0082163_181_1248 355
726 3300046694 Ga0495649_0038135 Ga0495649_0038135_445_1536 355
727 3300046694 Ga0495649_0072728 Ga0495649_0072728_749_1816 355
728 3300046794 Ga0495589_0026631 Ga0495589_0026631_153_1220 355
729 3300046794 Ga0495589_0036686 Ga0495589_0036686_1132_2223 355
730 3300046794 Ga0495589_0040523 Ga0495589_0040523_765_1832 355
731 3300046809 Ga0495600_0030502 Ga0495600_0030502_1280_2383 355
732 3300046810 Ga0495660_0022720 Ga0495660_0022720_453_1544 355
733 3300046810 Ga0495660_0060930 Ga0495660_0060930_194_1261 355
734 3300047317 Ga0495604_0036302 Ga0495604_0036302_933_2036 355
735 3300047320 Ga0495672_0027088 Ga0495672_0027088_1963_3030 355
736 3300047323 Ga0495683_0007048 Ga0495683_0007048_4988_6055 355
737 3300047323 Ga0495683_0072814 Ga0495683_0072814_126_1193 355
738 3300047443 Ga0495687_001073 Ga0495687_001073_24679_25770 355
739 3300047444 Ga0495675_0033888 Ga0495675_0033888_255_1346 355
740 3300047444 Ga0495675_0042527 Ga0495675_0042527_1061_2164 355
741 3300047446 Ga0495679_000704 Ga0495679_000704_18243_19334 355
742 3300047469 Ga0495673_0012008 Ga0495673_0012008_2279_3370 355
743 3300047470 Ga0495681_0000262 Ga0495681_0000262_1330_2421 355
744 3300047470 Ga0495681_0000399 Ga0495681_0000399_991_2082 355
745 3300047470 Ga0495681_0002529 Ga0495681_0002529_2115_3206 355
746 3300047470 Ga0495681_0022189 Ga0495681_0022189_40_1107 355
747 3300047470 Ga0495681_0060820 Ga0495681_0060820_179_1246 355
748 3300047471 Ga0495684_0007045 Ga0495684_0007045_6982_8085 355
749 3300047472 Ga0495686_0012888 Ga0495686_0012888_1796_2902 355
750 3300047472 Ga0495686_0034862 Ga0495686_0034862_2000_3067 355
751 3300047472 Ga0495686_0049563 Ga0495686_0049563_586_1677 355
752 3300047673 Ga0495593_0007705 Ga0495593_0007705_2662_3765 355
753 3300048088 Ga0495602_0116943 Ga0495602_0116943_320_1423 355
754 3300048091 Ga0495626_0001545 Ga0495626_0001545_13726_14817 355
755 3300048091 Ga0495626_0012046 Ga0495626_0012046_1103_2194 355
756 3300048091 Ga0495626_0022681 Ga0495626_0022681_1526_2617 355
757 3300048091 Ga0495626_0031751 Ga0495626_0031751_896_1963 355
758 3300048905 Ga0496102_0000815 Ga0496102_0000815_1112_2203 355
759 3300048917 Ga0496114_0058276 Ga0496114_0058276_837_1925 355
760 3300048919 Ga0496116_0008830 Ga0496116_0008830_2201_3268 355
761 3300048920 Ga0496117_0025481 Ga0496117_0025481_772_1839 355
762 3300048920 Ga0496117_0038087 Ga0496117_0038087_2050_3138 355
763 3300048920 Ga0496117_0084420 Ga0496117_0084420_171_1238 355
764 3300048921 Ga0496118_0013461 Ga0496118_0013461_6357_7466 355
765 3300048921 Ga0496118_0014197 Ga0496118_0014197_3574_4662 355
766 3300048921 Ga0496118_0020225 Ga0496118_0020225_1576_2694 355
767 3300048921 Ga0496118_0156864 Ga0496118_0156864_130_1197 355
768 3300048924 Ga0496121_0016565 Ga0496121_0016565_4352_5470 355
769 3300048924 Ga0496121_0020706 Ga0496121_0020706_3529_4596 355
770 3300048924 Ga0496121_0213203 Ga0496121_0213203_210_1316 355
771 3300048925 Ga0496122_0002086 Ga0496122_0002086_28278_29366 355
772 3300048925 Ga0496122_0062136 Ga0496122_0062136_466_1572 355
773 3300048925 Ga0496122_0076285 Ga0496122_0076285_656_1723 355
774 3300048926 Ga0496123_0000178 Ga0496123_0000178_4115_5203 355
775 3300048926 Ga0496123_0024819 Ga0496123_0024819_2017_3123 355
776 3300048926 Ga0496123_0082890 Ga0496123_0082890_158_1225 355
777 3300048927 Ga0496124_0019279 Ga0496124_0019279_3230_4318 355
778 3300048927 Ga0496124_0217305 Ga0496124_0217305_133_1200 355
779 3300048928 Ga0496125_0064355 Ga0496125_0064355_490_1578 355
780 3300048928 Ga0496125_0079776 Ga0496125_0079776_1068_2177 355
781 3300049568 Ga0501031_0000232 Ga0501031_0000232_800_1897 355
782 3300049568 Ga0501031_0111772 Ga0501031_0111772_327_1424 355
783 3300049569 Ga0501032_0034847 Ga0501032_0034847_2166_3263 355
784 3300049570 Ga0501033_0000599 Ga0501033_0000599_27482_28579 355
785 3300049571 Ga0501034_0000143 Ga0501034_0000143_128777_129865 355
786 3300049571 Ga0501034_0006374 Ga0501034_0006374_6774_7871 355
787 3300049572 Ga0501036_0000300 Ga0501036_0000300_5210_6307 355
788 3300049573 Ga0501037_0001751 Ga0501037_0001751_8713_9810 355
789 3300049573 Ga0501037_0090688 Ga0501037_0090688_353_1450 355
790 3300049579 Ga0501043_0010432 Ga0501043_0010432_642_1739 355
791 3300049580 Ga0501046_0008979 Ga0501046_0008979_450_1547 355
792 3300049581 Ga0501047_0011016 Ga0501047_0011016_2751_3848 355
793 3300049822 Ga0501035_0011026 Ga0501035_0011026_1380_2477 355
794 3300049822 Ga0501035_0237213 Ga0501035_0237213_330_1433 355
795 3300049823 Ga0501044_0000396 Ga0501044_0000396_48385_49488 355
796 3300049823 Ga0501044_0010449 Ga0501044_0010449_7162_8259 355
797 3300050492 nmdc:mga0yw44_9310_c1 nmdc:mga0yw44_9310_c1_1838_2944 355
798 3300050516 nmdc:mga0sz30_8004_c1 nmdc:mga0sz30_8004_c1_2756_3865 355
799 3300053077 Ga0495601_0008732 Ga0495601_0008732_4202_5305 355
800 3300053084 Ga0495595_0003654 Ga0495595_0003654_2677_3780 355
801 3300053085 Ga0495619_0010334 Ga0495619_0010334_2300_3403 355
802 3300053087 Ga0500643_016083 Ga0500643_016083_916_2013 355
803 3300053090 Ga0500646_0031568 Ga0500646_0031568_228_1334 355
804 3300053093 Ga0500651_0034507 Ga0500651_0034507_1071_2177 355
805 3300053093 Ga0500651_0052395 Ga0500651_0052395_446_1546 355
806 3300053094 Ga0500566_0004932 Ga0500566_0004932_5875_6975 355
807 3300053096 Ga0500641_0010248 Ga0500641_0010248_260_1366 355
808 3300053104 Ga0500556_0034985 Ga0500556_0034985_89_1195 355
809 3300053130 Ga0500642_0000016 Ga0500642_0000016_57911_59029 355
810 3300053135 Ga0500659_0019210 Ga0500659_0019210_545_1633 355
811 3300053136 Ga0500559_0000066 Ga0500559_0000066_67222_68322 355
812 3300053153 Ga0500616_0000061 Ga0500616_0000061_169655_170773 355
813 3300053177 Ga0500636_0002158 Ga0500636_0002158_8112_9212 355
814 3300053178 Ga0500637_0185693 Ga0500637_0185693_48_1151 355
815 iso_pu_bacteria 2511231004 2511253161 355
816 iso_pu_bacteria 2511231007 2511272143 355
817 iso_pu_bacteria 2511231008 2511278287 355
818 iso_pu_bacteria 2511231010 2511291367 355
819 iso_pu_bacteria 2511231011 2511294459 355
820 iso_pu_bacteria 2511231012 2511302091 355
821 iso_pu_bacteria 2511231014 2511313754 355
822 iso_pu_bacteria 2511231015 2511321138 355
823 iso_pu_bacteria 2511231016 2511327565 355
824 iso_pu_bacteria 2511231018 2511337467 355
825 iso_pu_bacteria 2511231019 2511343770 355
826 iso_pu_bacteria 2511231020 2511350137 355
827 iso_pu_bacteria 2511231021 2511358738 355
828 iso_pu_bacteria 2511231022 2511361017 355
829 iso_pu_bacteria 2511231023 2511371771 355
830 iso_pu_bacteria 2511231024 2511377394 355
831 iso_pu_bacteria 2511231031 2511415969 355
832 iso_pu_bacteria 2512047018 2512327176 355
833 iso_pu_bacteria 2513237092 2513622333 355
834 iso_pu_bacteria 2513237094 2513640508 355
835 iso_pu_bacteria 2513237104 2513718369 355
836 iso_pu_bacteria 2513237139 2513873157 355
837 iso_pu_bacteria 2513237161 2514016498 355
838 iso_pu_bacteria 2517093001 2517102599 355
839 iso_pu_bacteria 2524023205 2524437756 355
840 iso_pu_bacteria 2528768022 2528848726 355
841 iso_pu_bacteria 2554235231 2555247264 355
842 iso_pu_bacteria 2554235341 2555669345 355
843 iso_pu_bacteria 2582580891 2583791567 355
844 iso_pu_bacteria 2597489887 2597857407 355
845 iso_pu_bacteria 2599185155 2599331155 355
846 iso_pu_bacteria 2599185160 2599353658 355
847 iso_pu_bacteria 2599185161 2599364068 355
848 iso_pu_bacteria 2599185162 2599370388 355
849 iso_pu_bacteria 2599185163 2599372695 355
850 iso_pu_bacteria 2599185164 2599378766 355
851 iso_pu_bacteria 2599185165 2599383857 355
852 iso_pu_bacteria 2599185166 2599391554 355
853 iso_pu_bacteria 2599185168 2599407800 355
854 iso_pu_bacteria 2599185181 2599460492 355
855 iso_pu_bacteria 2599185182 2599470896 355
856 iso_pu_bacteria 2599185185 2599484659 355
857 iso_pu_bacteria 2599185186 2599489513 355
858 iso_pu_bacteria 2599185257 2599802076 355
859 iso_pu_bacteria 2599185307 2599972216 355
860 iso_pu_bacteria 2599185356 2600213103 355
861 iso_pu_bacteria 2600254931 2600368342 355
862 iso_pu_bacteria 2600254954 2600444086 355
863 iso_pu_bacteria 2600254954 2600444087 355
864 iso_pu_bacteria 2600255283 2601627299 355
865 iso_pu_bacteria 2600255313 2601773271 355
866 iso_pu_bacteria 2600255318 2601796048 355
867 iso_pu_bacteria 2600255389 2602008428 355
868 iso_pu_bacteria 2600255389 2602008429 355
869 iso_pu_bacteria 2603880185 2606075100 355
870 iso_pu_bacteria 2603880199 2606127963 355
871 iso_pu_bacteria 2617270735 2617346976 355
872 iso_pu_bacteria 2617270741 2617375394 355
873 iso_pu_bacteria 2623620443 2624480094 355
874 iso_pu_bacteria 2623620446 2624492807 355
875 iso_pu_bacteria 2643221565 2643842269 355
876 iso_pu_bacteria 2643221589 2643957086 355
877 iso_pu_bacteria 2643221602 2644025010 355
878 iso_pu_bacteria 2643221633 2644189380 355
879 iso_pu_bacteria 2667528171 2671094763 355
880 iso_pu_bacteria 2671180172 2671769024 355
881 iso_pu_bacteria 2713897148 2715753578 355
882 iso_pu_bacteria 2713897149 2715758514 355
883 iso_pu_bacteria 2718217725 2718634613 355
884 iso_pu_bacteria 2728369097 2729147869 355
885 iso_pu_bacteria 2738541271 2738691947 355
886 iso_pu_bacteria 2738543004 2739197770 355
887 iso_pu_bacteria 2738543015 2739262252 355
888 iso_pu_bacteria 2738543016 2739263303 355
889 iso_pu_bacteria 2738543020 2739289618 355
890 iso_pu_bacteria 2738543021 2739294930 355
891 iso_pu_bacteria 2738543025 2739316215 355
892 iso_pu_bacteria 2744054633 2745074832 355
893 iso_pu_bacteria 2765235841 2765581402 355
894 iso_pu_bacteria 2773857670 2774118668 355
895 iso_pu_bacteria 2773857673 2774134352 355
896 iso_pu_bacteria 2784132063 2784263852 355
897 iso_pu_bacteria 2784132072 2784312305 355
898 iso_pu_bacteria 2802429603 2805914944 355
899 iso_pu_bacteria 2806310737 2807406024 355
900 iso_pu_bacteria 2806310745 2807454376 355
901 iso_pu_bacteria 2808606373 2808905734 355
902 iso_pu_bacteria 2808606377 2808930161 355
903 iso_pu_bacteria 2808606379 2808942155 355
904 iso_pu_bacteria 2808606381 2808952274 355
905 iso_pu_bacteria 2808606382 2808958012 355
906 iso_pu_bacteria 2808606445 2809215380 355
907 iso_pu_bacteria 2811994881 2812369486 355
908 iso_pu_bacteria 2818991456 2819656657 355
909 iso_pu_bacteria 2818991464 2819705884 355
910 iso_pu_bacteria 2823421272 2823425715 355
911 iso_pu_bacteria 2824600985 2824602339 355
912 iso_pu_bacteria 2824609381 2824610567 355
913 iso_pu_bacteria 2824653114 2824654306 355
914 iso_pu_bacteria 2824661429 2824661614 355
915 iso_pu_bacteria 2824671348 2824672059 355
916 iso_pu_bacteria 2824679649 2824679888 355
917 iso_pu_bacteria 2824687955 2824688658 355
918 iso_pu_bacteria 2824696289 2824697104 355
919 iso_pu_bacteria 2824704595 2824712274 355
920 iso_pu_bacteria 2824732956 2824734584 355
921 iso_pu_bacteria 2824746037 2824749876 355
922 iso_pu_bacteria 2824753945 2824754396 355
923 iso_pu_bacteria 2824763712 2824769183 355
924 iso_pu_bacteria 2824773399 2824780372 355
925 iso_pu_bacteria 2826581358 2826581928 355
926 iso_pu_bacteria 2838122688 2838123328 355
927 iso_pu_bacteria 2841941048 2841946621 355
928 iso_pu_bacteria 2841949485 2841954147 355
929 iso_pu_bacteria 2841957949 2841961000 355
930 iso_pu_bacteria 2841966195 2841969523 355
931 iso_pu_bacteria 2841974524 2841974592 355
932 iso_pu_bacteria 2841983080 2841983847 355
933 iso_pu_bacteria 2842038055 2842040202 355
934 iso_pu_bacteria 2842045827 2842046853 355
935 iso_pu_bacteria 2842805378 2842807778 355
936 iso_pu_bacteria 2842815866 2842816817 355
937 iso_pu_bacteria 2842832357 2842836214 355
938 iso_pu_bacteria 2842843487 2842844203 355
939 iso_pu_bacteria 2842849001 2842853968 355
940 iso_pu_bacteria 2847930680 2847936599 355
941 iso_pu_bacteria 2847939898 2847946948 355
942 iso_pu_bacteria 2849076700 2849078941 355
943 iso_pu_bacteria 2852657418 2852658056 355
944 iso_pu_bacteria 2857524615 2857528272 355
945 iso_pu_bacteria 2860339153 2860342157 355
946 iso_pu_bacteria 2874612657 2874619353 355
947 iso_pu_bacteria 2874620515 2874626427 355
948 iso_pu_bacteria 2878029506 2878032001 355
949 iso_pu_bacteria 2879083081 2879088057 355
950 iso_pu_bacteria 2879099564 2879108369 355
951 iso_pu_bacteria 2880230671 2880234087 355
952 iso_pu_bacteria 2885409591 2885417695 355
953 iso_pu_bacteria 2888388044 2888393411 355
954 iso_pu_bacteria 2888419890 2888424942 355
955 iso_pu_bacteria 2903727486 2903734370 355
956 iso_pu_bacteria 2904518522 2904522753 355
957 iso_pu_bacteria 2904550169 2904555878 355
958 iso_pu_bacteria 2904666416 2904671766 355
959 iso_pu_bacteria 2904690495 2904694890 355
960 iso_pu_bacteria 2904711408 2904715119 355
961 iso_pu_bacteria 2906626472 2906627144 355
962 iso_pu_bacteria 2906643746 2906646176 355
963 iso_pu_bacteria 2908756301 2908759969 355
964 iso_pu_bacteria 2908775508 2908780548 355
965 iso_pu_bacteria 2912963787 2912968884 355
966 iso_pu_bacteria 2917070673 2917073151 355
967 iso_pu_bacteria 2917832318 2917836165 355
968 iso_pu_bacteria 2919063839 2919068475 355
969 iso_pu_bacteria 2919073203 2919075696 355
970 iso_pu_bacteria 2919125081 2919128316 355
971 iso_pu_bacteria 2919155634 2919155904 355
972 iso_pu_bacteria 2919385768 2919387517 355
973 iso_pu_bacteria 2919456309 2919456392 355
974 iso_pu_bacteria 2919487758 2919490345 355
975 iso_pu_bacteria 2919493220 2919494799 355
976 iso_pu_bacteria 2919501602 2919502461 355
977 iso_pu_bacteria 2919501602 2919502462 355
978 iso_pu_bacteria 2919543075 2919546755 355
979 iso_pu_bacteria 2919697872 2919703465 355
980 iso_pu_bacteria 2922368715 2922374915 355
981 iso_pu_bacteria 2922393267 2922394549 355
982 iso_pu_bacteria 2923519811 2923523572 355
983 iso_pu_bacteria 2923525760 2923526222 355
984 iso_pu_bacteria 2926063275 2926064134 355
985 iso_pu_bacteria 2926063275 2926064135 355
986 iso_pu_bacteria 2929615660 2929621955 355
987 iso_pu_bacteria 2929624759 2929629738 355
988 iso_pu_bacteria 2931396565 2931401091 355
989 iso_pu_bacteria 2932784394 2932788821 355
990 iso_pu_bacteria 2932794094 2932797977 355
991 iso_pu_bacteria 2932801729 2932807180 355
992 iso_pu_bacteria 2932809354 2932812797 355
993 iso_pu_bacteria 2932818245 2932819111 355
994 iso_pu_bacteria 2932828146 2932830487 355
995 iso_pu_bacteria 2933577622 2933583770 355
996 iso_pu_bacteria 2935353572 2935357852 355
997 iso_pu_bacteria 2935616580 2935616782 355
998 iso_pu_bacteria 2935638405 2935641888 355
999 iso_pu_bacteria 2935665750 2935673019 355
1000 iso_pu_bacteria 2935675223 2935675824 355
1001 iso_pu_bacteria 2935684952 2935685813 355
1002 iso_pu_bacteria 2935694250 2935697933 355
1003 iso_pu_bacteria 2935703347 2935705661 355
1004 iso_pu_bacteria 2935713505 2935714365 355
1005 iso_pu_bacteria 2935722832 2935724984 355
1006 iso_pu_bacteria 2935732158 2935732657 355
1007 iso_pu_bacteria 2935741537 2935742036 355
1008 iso_pu_bacteria 2935750917 2935751778 355
1009 iso_pu_bacteria 2935760218 2935765042 355
1010 iso_pu_bacteria 2935769743 2935771661 355
1011 iso_pu_bacteria 2935785616 2935791155 355
1012 iso_pu_bacteria 2935793552 2935795516 355
1013 iso_pu_bacteria 2935801545 2935802639 355
1014 iso_pu_bacteria 2935810662 2935813531 355
1015 iso_pu_bacteria 2935827899 2935830055 355
1016 iso_pu_bacteria 2935837841 2935837973 355
1017 iso_pu_bacteria 2935855204 2935855406 355
1018 iso_pu_bacteria 2935864058 2935867350 355
1019 iso_pu_bacteria 2935873716 2935875831 355
1020 iso_pu_bacteria 2935883170 2935885828 355
1021 iso_pu_bacteria 2935959822 2935960821 355
1022 iso_pu_bacteria 2935992306 2935996495 355
1023 iso_pu_bacteria 2936002035 2936003775 355
1024 iso_pu_bacteria 2936037263 2936042480 355
1025 iso_pu_bacteria 2939636861 2939639971 355
1026 iso_pu_bacteria 2939651529 2939654225 355
1027 iso_pu_bacteria 2940556831 2940557419 355
1028 iso_pu_bacteria 2941538514 2941539361 355
1029 iso_pu_bacteria 2969304461 2969308079 355
1030 iso_pu_bacteria 2974289157 2974290413 355
1031 iso_pu_bacteria 2984504281 2984507466 355
1032 iso_pu_bacteria 2998139840 2998143438 355
1033 iso_pu_bacteria 3005474847 3005480567 355
1034 iso_pu_bacteria 3005594810 3005599643 355
1035 iso_pu_bacteria 3005718088 3005722668 355
1036 iso_pu_bacteria 3007252601 3007255271 355
1037 iso_pu_bacteria 3007315729 3007315927 355
1038 iso_pu_bacteria 3007511990 3007514807 355
1039 iso_pu_bacteria 3007614139 3007619125 355
1040 iso_pu_bacteria 3007619802 3007620641 355
1041 iso_pu_bacteria 3007718800 3007722348 355
1042 iso_pu_bacteria 3007803356 3007807480 355
1043 iso_pu_bacteria 3007855910 3007857941 355
1044 iso_pu_bacteria 3007861166 3007862592 355
1045 iso_pu_bacteria 3007872151 3007876464 355
1046 iso_pu_bacteria 637000220 637319675 355
1047 iso_pu_bacteria 640427133 640486023 355
1048 iso_pu_bacteria 651053060 651173937 355
1049 iso_pu_bacteria 8002392321 8002393466 355
1050 iso_pu_bacteria 8006926726 8006930489 355
1051 iso_pu_bacteria 8011350971 8011351785 355
1052 iso_pu_bacteria 8016511872 8016521804 355
1053 iso_pu_bacteria 8016583857 8016593296 355
1054 iso_pu_bacteria 8016622563 8016626141 355
1055 iso_pu_bacteria 8016728285 8016730417 355
1056 iso_pu_bacteria 8017057580 8017063847 355
1057 iso_pu_bacteria 8019547302 8019553236 355
1058 iso_pu_bacteria 8019586578 8019591004 355
1059 iso_pu_bacteria 8019597564 8019600341 355
1060 iso_pu_bacteria 8019648815 8019658956 355
1061 iso_pu_bacteria 8019769354 8019772477 355
1062 iso_pu_bacteria 8019775933 8019781806 355
1063 iso_pu_bacteria 8029995093 8029997381 355
1064 iso_pu_bacteria 8034962539 8034963655 355
1065 iso_pu_bacteria 8034962539 8034963656 355
1066 iso_pu_bacteria 8052494512 8052494846 355
1067 iso_pu_bacteria 8054929484 8054930494 355
1068 iso_pu_bacteria 8055742211 8055745880 355
1069 iso_pu_bacteria 8055878733 8055881161 355
1070 iso_pu_bacteria 8056115690 8056116096 355
1071 iso_pu_bacteria 8056120720 8056120955 355
1072 iso_pu_bacteria 8056125926 8056129449 355
1073 iso_pu_bacteria 8056137416 8056137623 355
1074 iso_pu_bacteria 8056155041 8056157447 355
1075 iso_pu_bacteria 8056166840 8056167773 355
1076 iso_pu_bacteria 8056172158 8056174930 355
1077 iso_pu_bacteria 8056177738 8056178616 355
1078 iso_pu_bacteria 8056569372 8056570979 355
1079 iso_pu_bacteria 8056689827 8056692233 355
1080 iso_pu_bacteria 8056967851 8056968419 355
1081 iso_pu_bacteria 8057798959 8057800830 355
1082 3300003215 JGI25153J46596_10014841 JGI25153J46596_100148413 356
1083 3300003354 JGI25160J50197_1008036 JGI25160J50197_10080362 356
1084 3300004625 Ga0055543_1003863 Ga0055543_10038632 356
1085 3300005262 Ga0065165_1001250 Ga0065165_10012507 356
1086 3300005262 Ga0065165_1006863 Ga0065165_10068632 356
1087 3300005295 Ga0065707_10204688 Ga0065707_102046881 356
1088 3300005328 Ga0070676_10072245 Ga0070676_100722451 356
1089 3300005334 Ga0068869_100333149 Ga0068869_1003331491 356
1090 3300005337 Ga0070682_100106857 Ga0070682_1001068571 356
1091 3300005338 Ga0068868_100010531 Ga0068868_1000105313 356
1092 3300005338 Ga0068868_100091713 Ga0068868_1000917132 356
1093 3300005339 Ga0070660_100164783 Ga0070660_1001647832 356
1094 3300005344 Ga0070661_100067766 Ga0070661_1000677662 356
1095 3300005347 Ga0070668_100038230 Ga0070668_1000382303 356
1096 3300005347 Ga0070668_100140814 Ga0070668_1001408142 356
1097 3300005347 Ga0070668_100164082 Ga0070668_1001640823 356
1098 3300005355 Ga0070671_100078909 Ga0070671_1000789092 356
1099 3300005355 Ga0070671_100178080 Ga0070671_1001780802 356
1100 3300005356 Ga0070674_100018306 Ga0070674_1000183065 356
1101 3300005356 Ga0070674_100278854 Ga0070674_1002788541 356
1102 3300005436 Ga0070713_100090618 Ga0070713_1000906182 356
1103 3300005439 Ga0070711_100019147 Ga0070711_1000191474 356
1104 3300005439 Ga0070711_100027037 Ga0070711_1000270371 356
1105 3300005455 Ga0070663_100025300 Ga0070663_1000253003 356
1106 3300005456 Ga0070678_100084483 Ga0070678_1000844831 356
1107 3300005457 Ga0070662_100065030 Ga0070662_1000650301 356
1108 3300005458 Ga0070681_10020657 Ga0070681_100206573 356
1109 3300005471 Ga0070698_100037322 Ga0070698_1000373222 356
1110 3300005539 Ga0068853_100067217 Ga0068853_1000672173 356
1111 3300005539 Ga0068853_100136819 Ga0068853_1001368191 356
1112 3300005548 Ga0070665_100021594 Ga0070665_1000215942 356
1113 3300005548 Ga0070665_100084700 Ga0070665_1000847004 356
1114 3300005548 Ga0070665_100101819 Ga0070665_1001018193 356
1115 3300005548 Ga0070665_100111069 Ga0070665_1001110693 356
1116 3300005548 Ga0070665_100247405 Ga0070665_1002474053 356
1117 3300005563 Ga0068855_100099110 Ga0068855_1000991102 356
1118 3300005578 Ga0068854_100139182 Ga0068854_1001391823 356
1119 3300005578 Ga0068854_100194598 Ga0068854_1001945982 356
1120 3300005616 Ga0068852_100296110 Ga0068852_1002961101 356
1121 3300005616 Ga0068852_100345374 Ga0068852_1003453742 356
1122 3300005618 Ga0068864_100075582 Ga0068864_1000755823 356
1123 3300005718 Ga0068866_10171931 Ga0068866_101719311 356
1124 3300005719 Ga0068861_100105855 Ga0068861_1001058552 356
1125 3300005841 Ga0068863_100274461 Ga0068863_1002744611 356
1126 3300005842 Ga0068858_100273575 Ga0068858_1002735752 356
1127 3300005843 Ga0068860_100071448 Ga0068860_1000714484 356
1128 3300005844 Ga0068862_100128001 Ga0068862_1001280012 356
1129 3300005937 Ga0081455_10018614 Ga0081455_100186142 356
1130 3300005983 Ga0081540_1001168 Ga0081540_100116825 356
1131 3300005983 Ga0081540_1001683 Ga0081540_100168316 356
1132 3300005983 Ga0081540_1038167 Ga0081540_10381672 356
1133 3300006028 Ga0070717_10000905 Ga0070717_1000090517 356
1134 3300006048 Ga0075363_100007789 Ga0075363_1000077893 356
1135 3300006051 Ga0075364_10027279 Ga0075364_100272792 356
1136 3300006051 Ga0075364_10039123 Ga0075364_100391234 356
1137 3300006175 Ga0070712_100020288 Ga0070712_1000202882 356
1138 3300006175 Ga0070712_100128349 Ga0070712_1001283492 356
1139 3300006178 Ga0075367_10046606 Ga0075367_100466063 356
1140 3300006178 Ga0075367_10116510 Ga0075367_101165101 356
1141 3300006195 Ga0075366_10060473 Ga0075366_100604733 356
1142 3300006353 Ga0075370_10045881 Ga0075370_100458813 356
1143 3300006353 Ga0075370_10046766 Ga0075370_100467661 356
1144 3300006358 Ga0068871_100074485 Ga0068871_1000744852 356
1145 3300006358 Ga0068871_100273287 Ga0068871_1002732871 356
1146 3300006871 Ga0075434_100134872 Ga0075434_1001348722 356
1147 3300009011 Ga0105251_10019600 Ga0105251_100196002 356
1148 3300009093 Ga0105240_10019779 Ga0105240_1001977910 356
1149 3300009098 Ga0105245_10034443 Ga0105245_100344432 356
1150 3300009148 Ga0105243_10039470 Ga0105243_100394701 356
1151 3300009148 Ga0105243_10321541 Ga0105243_103215412 356
1152 3300009174 Ga0105241_10100504 Ga0105241_101005042 356
1153 3300009176 Ga0105242_10296188 Ga0105242_102961882 356
1154 3300009177 Ga0105248_10222294 Ga0105248_102222942 356
1155 3300009545 Ga0105237_10013465 Ga0105237_100134652 356
1156 3300010375 Ga0105239_10315588 Ga0105239_103155882 356
1157 3300013100 Ga0157373_10046973 Ga0157373_100469732 356
1158 3300013104 Ga0157370_10088973 Ga0157370_100889733 356
1159 3300013105 Ga0157369_10009441 Ga0157369_100094415 356
1160 3300013105 Ga0157369_10016741 Ga0157369_100167414 356
1161 3300013307 Ga0157372_10112469 Ga0157372_101124693 356
1162 3300013308 Ga0157375_10044677 Ga0157375_100446773 356
1163 3300013308 Ga0157375_10197398 Ga0157375_101973982 356
1164 3300014325 Ga0163163_10074440 Ga0163163_100744404 356
1165 3300014745 Ga0157377_10233704 Ga0157377_102337041 356
1166 3300014969 Ga0157376_10054188 Ga0157376_100541883 356
1167 3300021320 Ga0214544_1000002 Ga0214544_100000272 356
1168 3300021321 Ga0214542_1000001 Ga0214542_1000001422 356
1169 3300021324 Ga0214545_1000001 Ga0214545_1000001488 356
1170 3300021327 Ga0214543_1000001 Ga0214543_1000001708 356
1171 3300021384 Ga0213876_10080217 Ga0213876_100802172 356
1172 3300025261 Ga0209233_1008338 Ga0209233_10083384 356
1173 3300025295 Ga0209564_1004290 Ga0209564_10042905 356
1174 3300025295 Ga0209564_1006740 Ga0209564_10067405 356
1175 3300025297 Ga0209758_1001579 Ga0209758_100157912 356
1176 3300025302 Ga0207426_1000387 Ga0207426_100038769 356
1177 3300025302 Ga0207426_1032069 Ga0207426_10320692 356
1178 3300025728 Ga0207655_1044223 Ga0207655_10442232 356
1179 3300025901 Ga0207688_10091493 Ga0207688_100914931 356
1180 3300025904 Ga0207647_10083672 Ga0207647_100836722 356
1181 3300025905 Ga0207685_10084217 Ga0207685_100842172 356
1182 3300025908 Ga0207643_10030984 Ga0207643_100309842 356
1183 3300025911 Ga0207654_10150616 Ga0207654_101506162 356
1184 3300025914 Ga0207671_10046338 Ga0207671_100463383 356
1185 3300025915 Ga0207693_10003312 Ga0207693_1000331214 356
1186 3300025915 Ga0207693_10046264 Ga0207693_100462642 356
1187 3300025916 Ga0207663_10017815 Ga0207663_100178152 356
1188 3300025920 Ga0207649_10056828 Ga0207649_100568282 356
1189 3300025927 Ga0207687_10062693 Ga0207687_100626932 356
1190 3300025927 Ga0207687_10063544 Ga0207687_100635442 356
1191 3300025927 Ga0207687_10067519 Ga0207687_100675192 356
1192 3300025928 Ga0207700_10066796 Ga0207700_100667962 356
1193 3300025937 Ga0207669_10000863 Ga0207669_100008638 356
1194 3300025937 Ga0207669_10035918 Ga0207669_100359182 356
1195 3300025938 Ga0207704_10032792 Ga0207704_100327923 356
1196 3300025940 Ga0207691_10253853 Ga0207691_102538532 356
1197 3300025941 Ga0207711_10258398 Ga0207711_102583982 356
1198 3300025942 Ga0207689_10014103 Ga0207689_100141037 356
1199 3300025944 Ga0207661_10032316 Ga0207661_100323163 356
1200 3300025945 Ga0207679_10275352 Ga0207679_102753522 356
1201 3300025961 Ga0207712_10271080 Ga0207712_102710801 356
1202 3300025972 Ga0207668_10076324 Ga0207668_100763243 356
1203 3300025972 Ga0207668_10153152 Ga0207668_101531522 356
1204 3300025972 Ga0207668_10199966 Ga0207668_101999661 356
1205 3300025981 Ga0207640_10086931 Ga0207640_100869312 356
1206 3300026023 Ga0207677_10023672 Ga0207677_100236722 356
1207 3300026041 Ga0207639_10087607 Ga0207639_100876072 356
1208 3300026067 Ga0207678_10021335 Ga0207678_100213352 356
1209 3300026067 Ga0207678_10046708 Ga0207678_100467083 356
1210 3300026067 Ga0207678_10065131 Ga0207678_100651311 356
1211 3300026067 Ga0207678_10094558 Ga0207678_100945582 356
1212 3300026075 Ga0207708_10135100 Ga0207708_101351002 356
1213 3300026088 Ga0207641_10056434 Ga0207641_100564343 356
1214 3300026089 Ga0207648_10025754 Ga0207648_100257544 356
1215 3300026118 Ga0207675_100068172 Ga0207675_1000681722 356
1216 3300026118 Ga0207675_100094940 Ga0207675_1000949403 356
1217 3300026118 Ga0207675_100320191 Ga0207675_1003201911 356
1218 3300026121 Ga0207683_10021857 Ga0207683_100218573 356
1219 3300026121 Ga0207683_10058663 Ga0207683_100586632 356
1220 3300026121 Ga0207683_10088966 Ga0207683_100889662 356
1221 3300026142 Ga0207698_10126516 Ga0207698_101265162 356
1222 3300028379 Ga0268266_10019676 Ga0268266_100196765 356
1223 3300028379 Ga0268266_10092832 Ga0268266_100928323 356
1224 3300028379 Ga0268266_10258037 Ga0268266_102580372 356
1225 3300028380 Ga0268265_10168625 Ga0268265_101686251 356
1226 3300028381 Ga0268264_10158441 Ga0268264_101584412 356
1227 3300031507 Ga0307509_10010951 Ga0307509_100109516 356
1228 3300031730 Ga0307516_10208602 Ga0307516_102086022 356
1229 3300032002 Ga0307416_100268530 Ga0307416_1002685301 356
1230 3300032126 Ga0307415_100033511 Ga0307415_1000335113 356
1231 3300033180 Ga0307510_10226640 Ga0307510_102266402 356
1232 3300035695 Ga0373927_0015919 Ga0373927_0015919_714_1820 356
1233 3300035695 Ga0373927_0128631 Ga0373927_0128631_25_1131 356
1234 3300037466 Ga0395898_0012692 Ga0395898_0012692_6517_7626 356
1235 3300037466 Ga0395898_0026506 Ga0395898_0026506_1147_2256 356
1236 3300037466 Ga0395898_0234984 Ga0395898_0234984_376_1485 356
1237 3300037471 Ga0395905_0006498 Ga0395905_0006498_1947_3053 356
1238 3300037471 Ga0395905_0208735 Ga0395905_0208735_262_1371 356
1239 3300037853 Ga0436364_0105078 Ga0436364_0105078_1160_2269 356
1240 3300039437 Ga0436365_0377156 Ga0436365_0377156_2884_3996 356
1241 3300039450 Ga0436363_0172435 Ga0436363_0172435_43_1140 356
1242 3300039450 Ga0436363_1354384 Ga0436363_1354384_495_1607 356
1243 3300044656 Ga0466969_0000830 Ga0466969_0000830_12753_13856 356
1244 3300044656 Ga0466969_0008238 Ga0466969_0008238_4201_5301 356
1245 3300044658 Ga0466972_0003419 Ga0466972_0003419_2000_3109 356
1246 3300044683 Ga0466965_0008515 Ga0466965_0008515_1937_3037 356
1247 3300044693 Ga0466961_0000519 Ga0466961_0000519_22814_23914 356
1248 3300044693 Ga0466961_0008582 Ga0466961_0008582_3820_4923 356
1249 3300044735 Ga0466968_0045894 Ga0466968_0045894_455_1564 356
1250 3300044901 Ga0466960_0049535 Ga0466960_0049535_633_1742 356
1251 3300045049 Ga0466959_0085574 Ga0466959_0085574_419_1519 356
1252 3300045976 Ga0466967_0352232 Ga0466967_0352232_82_1179 356
1253 3300046453 Ga0495627_004313 Ga0495627_004313_1761_2855 356
1254 3300046455 Ga0495603_0052036 Ga0495603_0052036_300_1406 356
1255 3300046458 Ga0495591_003166 Ga0495591_003166_3070_4164 356
1256 3300046459 Ga0495629_0164015 Ga0495629_0164015_42_1148 356
1257 3300046460 Ga0495638_0040974 Ga0495638_0040974_1076_2182 356
1258 3300046474 Ga0495605_0000625 Ga0495605_0000625_4124_5218 356
1259 3300046492 Ga0495585_0044397 Ga0495585_0044397_1148_2254 356
1260 3300046499 Ga0495594_0015297 Ga0495594_0015297_815_1909 356
1261 3300046507 Ga0495606_0160229 Ga0495606_0160229_50_1156 356
1262 3300046512 Ga0495610_0011079 Ga0495610_0011079_3468_4562 356
1263 3300046515 Ga0495620_0000171 Ga0495620_0000171_46049_47143 356
1264 3300046518 Ga0495631_0030185 Ga0495631_0030185_478_1584 356
1265 3300046518 Ga0495631_0107052 Ga0495631_0107052_59_1165 356
1266 3300046519 Ga0495632_0078600 Ga0495632_0078600_173_1279 356
1267 3300046520 Ga0495637_0033102 Ga0495637_0033102_20_1114 356
1268 3300046523 Ga0495644_0023365 Ga0495644_0023365_353_1459 356
1269 3300046523 Ga0495644_0046782 Ga0495644_0046782_160_1266 356
1270 3300046524 Ga0495648_0125110 Ga0495648_0125110_170_1270 356
1271 3300046538 Ga0495609_0000458 Ga0495609_0000458_28043_29137 356
1272 3300046539 Ga0495621_0037192 Ga0495621_0037192_419_1525 356
1273 3300046542 Ga0495597_0005155 Ga0495597_0005155_4123_5217 356
1274 3300046558 Ga0495633_0000115 Ga0495633_0000115_103459_104553 356
1275 3300046558 Ga0495633_0100729 Ga0495633_0100729_107_1213 356
1276 3300046559 Ga0495667_0151761 Ga0495667_0151761_315_1421 356
1277 3300046615 Ga0495656_0008181 Ga0495656_0008181_181_1287 356
1278 3300046660 Ga0495625_0055159 Ga0495625_0055159_556_1668 356
1279 3300046660 Ga0495625_0120157 Ga0495625_0120157_49_1155 356
1280 3300046660 Ga0495625_0143060 Ga0495625_0143060_352_1458 356
1281 3300046664 Ga0495659_0013842 Ga0495659_0013842_550_1656 356
1282 3300046679 Ga0495623_0083846 Ga0495623_0083846_782_1888 356
1283 3300046683 Ga0495658_0052747 Ga0495658_0052747_659_1765 356
1284 3300046691 Ga0495670_0000963 Ga0495670_0000963_2195_3307 356
1285 3300046692 Ga0495671_0005463 Ga0495671_0005463_4345_5439 356
1286 3300046794 Ga0495589_0011274 Ga0495589_0011274_2961_4055 356
1287 3300047321 Ga0495676_0035807 Ga0495676_0035807_2901_4007 356
1288 3300047323 Ga0495683_0000106 Ga0495683_0000106_46021_47115 356
1289 3300047447 Ga0495685_039526 Ga0495685_039526_458_1564 356
1290 3300047469 Ga0495673_0010604 Ga0495673_0010604_1026_2120 356
1291 3300048903 Ga0496100_0073096 Ga0496100_0073096_588_1694 356
1292 3300048904 Ga0496101_0059381 Ga0496101_0059381_754_1860 356
1293 3300048904 Ga0496101_0166385 Ga0496101_0166385_568_1674 356
1294 3300048905 Ga0496102_0011407 Ga0496102_0011407_1083_2189 356
1295 3300048905 Ga0496102_0145282 Ga0496102_0145282_177_1283 356
1296 3300048907 Ga0496104_0164768 Ga0496104_0164768_236_1342 356
1297 3300048908 Ga0496105_0012981 Ga0496105_0012981_2080_3186 356
1298 3300048909 Ga0496106_0002824 Ga0496106_0002824_7590_8699 356
1299 3300048909 Ga0496106_0025243 Ga0496106_0025243_708_1814 356
1300 3300048910 Ga0496107_0117439 Ga0496107_0117439_127_1233 356
1301 3300048911 Ga0496108_0118228 Ga0496108_0118228_104_1210 356
1302 3300048912 Ga0496109_0055493 Ga0496109_0055493_1111_2217 356
1303 3300048913 Ga0496110_0064373 Ga0496110_0064373_272_1378 356
1304 3300048914 Ga0496111_0088190 Ga0496111_0088190_566_1672 356
1305 3300048917 Ga0496114_0029802 Ga0496114_0029802_666_1772 356
1306 3300048918 Ga0496115_0345548 Ga0496115_0345548_27_1136 356
1307 3300048921 Ga0496118_0004964 Ga0496118_0004964_388_1497 356
1308 3300048921 Ga0496118_0123442 Ga0496118_0123442_321_1427 356
1309 3300048922 Ga0496119_0140593 Ga0496119_0140593_47_1159 356
1310 3300048924 Ga0496121_0002820 Ga0496121_0002820_10650_11759 356
1311 3300048924 Ga0496121_0020706 Ga0496121_0020706_2044_3312 356
1312 3300048924 Ga0496121_0114881 Ga0496121_0114881_144_1250 356
1313 3300048924 Ga0496121_0134066 Ga0496121_0134066_719_1825 356
1314 3300048925 Ga0496122_0006443 Ga0496122_0006443_4086_5180 356
1315 3300048927 Ga0496124_0002651 Ga0496124_0002651_14791_15900 356
1316 3300048927 Ga0496124_0238222 Ga0496124_0238222_159_1265 356
1317 3300048928 Ga0496125_0008852 Ga0496125_0008852_8527_9639 356
1318 3300048929 Ga0496126_0014996 Ga0496126_0014996_2176_3285 356
1319 3300048929 Ga0496126_0031625 Ga0496126_0031625_703_1809 356
1320 3300048929 Ga0496126_0038090 Ga0496126_0038090_950_2062 356
1321 3300048929 Ga0496126_0052595 Ga0496126_0052595_300_1412 356
1322 3300049459 Ga0495678_000017 Ga0495678_000017_4124_5218 356
1323 3300049580 Ga0501046_0045764 Ga0501046_0045764_909_2006 356
1324 3300049581 Ga0501047_0007358 Ga0501047_0007358_3090_4187 356
1325 3300049586 Ga0501070_0003226 Ga0501070_0003226_9691_10788 356
1326 3300049590 Ga0501074_0044503 Ga0501074_0044503_1174_2271 356
1327 3300049742 Ga0501080_0045308 Ga0501080_0045308_940_2037 356
1328 3300049823 Ga0501044_0039138 Ga0501044_0039138_2159_3256 356
1329 3300050490 nmdc:mga03n38_428_c1 nmdc:mga03n38_428_c1_5550_6656 356
1330 3300050491 nmdc:mga00v17_33080_c1 nmdc:mga00v17_33080_c1_1335_2435 356
1331 3300050491 nmdc:mga00v17_81575_c1 nmdc:mga00v17_81575_c1_558_1664 356
1332 3300050492 nmdc:mga0yw44_149282_c1 nmdc:mga0yw44_149282_c1_119_1225 356
1333 3300050494 nmdc:mga06z11_5877_c1 nmdc:mga06z11_5877_c1_2416_3522 356
1334 3300050507 nmdc:mga05p37_115892_c1 nmdc:mga05p37_115892_c1_627_1733 356
1335 3300050513 nmdc:mga0rr50_196553_c1 nmdc:mga0rr50_196553_c1_479_1585 356
1336 3300053088 Ga0500644_0009647 Ga0500644_0009647_239_1363 356
1337 3300053089 Ga0500581_016413 Ga0500581_016413_469_1581 356
1338 3300053096 Ga0500641_0089982 Ga0500641_0089982_48_1154 356
1339 3300053098 Ga0500650_0001956 Ga0500650_0001956_3945_5057 356
1340 3300053104 Ga0500556_0000002 Ga0500556_0000002_366240_367364 356
1341 3300053108 Ga0500562_021179 Ga0500562_021179_89_1195 356
1342 3300053108 Ga0500562_021318 Ga0500562_021318_194_1306 356
1343 3300053121 Ga0500607_033439 Ga0500607_033439_944_2053 356
1344 3300053131 Ga0500652_002511 Ga0500652_002511_2954_4066 356
1345 3300053134 Ga0500658_0028516 Ga0500658_0028516_444_1556 356
1346 3300053148 Ga0500590_070024 Ga0500590_070024_89_1195 356
1347 3300053151 Ga0500604_0003380 Ga0500604_0003380_1151_2263 356
1348 3300053156 Ga0500622_0000518 Ga0500622_0000518_13919_15031 356
1349 3300053177 Ga0500636_0000042 Ga0500636_0000042_22423_23532 356
1350 iso_pu_bacteria 2513237102 2513701735 356
1351 iso_pu_bacteria 2513237141 2513890000 356
1352 iso_pu_bacteria 2554235132 2554812659 356
1353 iso_pu_bacteria 2599185161 2599362626 356
1354 iso_pu_bacteria 2599185162 2599369068 356
1355 iso_pu_bacteria 2599185163 2599375735 356
1356 iso_pu_bacteria 2599185166 2599394593 356
1357 iso_pu_bacteria 2599185168 2599406358 356
1358 iso_pu_bacteria 2606217733 2608383129 356
1359 iso_pu_bacteria 2824617872 2824618130 356
1360 iso_pu_bacteria 2824626560 2824626798 356
1361 iso_pu_bacteria 2824635225 2824640103 356
1362 iso_pu_bacteria 2824644064 2824647377 356
1363 iso_pu_bacteria 2824714736 2824717846 356
1364 iso_pu_bacteria 2824723954 2824728043 356
1365 iso_pu_bacteria 2931396565 2931400708 356
1366 iso_pu_bacteria 3005483717 3005484680 356
1367 iso_pu_bacteria 3005587118 3005587672 356
1368 iso_pu_bacteria 3005710791 3005715292 356
1369 2162886007 SwRhRL2b_contig_326264 SwRhRL2b_0353.00000290 357
1370 2162886007 SwRhRL2b_contig_3395690 SwRhRL2b_0025.00002420 357
1371 3300002737 JGI25162J39368_1000014 JGI25162J39368_100001413 357
1372 3300002771 JGI25163J39215_1000290 JGI25163J39215_100029011 357
1373 3300002772 JGI25164J39214_1000015 JGI25164J39214_1000015199 357
1374 3300003214 JGI25165J46597_1000027 JGI25165J46597_1000027305 357
1375 3300003214 JGI25165J46597_1007319 JGI25165J46597_10073191 357
1376 3300003323 rootH1_10046746 rootH1_100467461 357
1377 3300003354 JGI25160J50197_1003482 JGI25160J50197_10034828 357
1378 3300003762 Ga0055542_1007018 Ga0055542_10070182 357
1379 3300003781 Ga0055536_1000050 Ga0055536_100005020 357
1380 3300003781 Ga0055536_1000182 Ga0055536_10001823 357
1381 3300003781 Ga0055536_1000894 Ga0055536_10008943 357
1382 3300003791 Ga0055530_10000041 Ga0055530_1000004197 357
1383 3300003791 Ga0055530_10000448 Ga0055530_100004484 357
1384 3300003791 Ga0055530_10014633 Ga0055530_100146332 357
1385 3300003792 Ga0055540_1000122 Ga0055540_10001224 357
1386 3300003792 Ga0055540_1004783 Ga0055540_10047832 357
1387 3300003794 Ga0055531_10000146 Ga0055531_1000014678 357
1388 3300003856 Ga0058692_1001311 Ga0058692_10013113 357
1389 3300005262 Ga0065165_1001157 Ga0065165_100115715 357
1390 3300005288 Ga0065714_10000851 Ga0065714_100008511 357
1391 3300005288 Ga0065714_10006279 Ga0065714_100062792 357
1392 3300005288 Ga0065714_10012751 Ga0065714_100127513 357
1393 3300005288 Ga0065714_10013241 Ga0065714_100132412 357
1394 3300005288 Ga0065714_10027206 Ga0065714_100272061 357
1395 3300005288 Ga0065714_10030759 Ga0065714_100307591 357
1396 3300005288 Ga0065714_10113211 Ga0065714_101132112 357
1397 3300005289 Ga0065704_10122222 Ga0065704_101222222 357
1398 3300005289 Ga0065704_10138187 Ga0065704_101381872 357
1399 3300005289 Ga0065704_10150073 Ga0065704_101500731 357
1400 3300005290 Ga0065712_10001010 Ga0065712_100010109 357
1401 3300005290 Ga0065712_10069335 Ga0065712_100693353 357
1402 3300005353 Ga0070669_100216015 Ga0070669_1002160152 357
1403 3300005445 Ga0070708_100126635 Ga0070708_1001266352 357
1404 3300005471 Ga0070698_100221832 Ga0070698_1002218322 357
1405 3300005548 Ga0070665_100116829 Ga0070665_1001168292 357
1406 3300005578 Ga0068854_100080142 Ga0068854_1000801422 357
1407 3300006028 Ga0070717_10383905 Ga0070717_103839051 357
1408 3300006038 Ga0075365_10059255 Ga0075365_100592552 357
1409 3300006038 Ga0075365_10193611 Ga0075365_101936112 357
1410 3300006058 Ga0075432_10006756 Ga0075432_100067565 357
1411 3300006175 Ga0070712_100115135 Ga0070712_1001151352 357
1412 3300006195 Ga0075366_10029203 Ga0075366_100292033 357
1413 3300006353 Ga0075370_10040035 Ga0075370_100400353 357
1414 3300006944 Ga0099823_1000043 Ga0099823_100004334 357
1415 3300006944 Ga0099823_1043123 Ga0099823_10431232 357
1416 3300006944 Ga0099823_1058735 Ga0099823_10587351 357
1417 3300006946 Ga0079104_1000897 Ga0079104_100089724 357
1418 3300006946 Ga0079104_1011286 Ga0079104_10112861 357
1419 3300009011 Ga0105251_10000024 Ga0105251_100000245 357
1420 3300009011 Ga0105251_10004294 Ga0105251_100042945 357
1421 3300009011 Ga0105251_10004985 Ga0105251_100049854 357
1422 3300009011 Ga0105251_10026448 Ga0105251_100264482 357
1423 3300009011 Ga0105251_10035664 Ga0105251_100356641 357
1424 3300009036 Ga0105244_10002242 Ga0105244_100022423 357
1425 3300009036 Ga0105244_10007755 Ga0105244_100077553 357
1426 3300009036 Ga0105244_10013364 Ga0105244_100133647 357
1427 3300009036 Ga0105244_10022572 Ga0105244_100225722 357
1428 3300009036 Ga0105244_10035888 Ga0105244_100358882 357
1429 3300009036 Ga0105244_10085390 Ga0105244_100853901 357
1430 3300009036 Ga0105244_10107817 Ga0105244_101078171 357
1431 3300009092 Ga0105250_10001113 Ga0105250_100011133 357
1432 3300009092 Ga0105250_10071347 Ga0105250_100713471 357
1433 3300009094 Ga0111539_10096711 Ga0111539_100967112 357
1434 3300009148 Ga0105243_10000203 Ga0105243_100002034 357
1435 3300009148 Ga0105243_10016707 Ga0105243_100167072 357
1436 3300009148 Ga0105243_10052138 Ga0105243_100521383 357
1437 3300009148 Ga0105243_10299789 Ga0105243_102997891 357
1438 3300009148 Ga0105243_10344050 Ga0105243_103440502 357
1439 3300009545 Ga0105237_10140629 Ga0105237_101406292 357
1440 3300011119 Ga0105246_10000088 Ga0105246_100000883 357
1441 3300011119 Ga0105246_10011130 Ga0105246_100111303 357
1442 3300013100 Ga0157373_10004409 Ga0157373_1000440910 357
1443 3300013100 Ga0157373_10007497 Ga0157373_100074972 357
1444 3300013100 Ga0157373_10018008 Ga0157373_100180082 357
1445 3300013102 Ga0157371_10000045 Ga0157371_1000004585 357
1446 3300013102 Ga0157371_10007072 Ga0157371_1000707213 357
1447 3300013102 Ga0157371_10013733 Ga0157371_100137334 357
1448 3300013104 Ga0157370_10003242 Ga0157370_1000324214 357
1449 3300013104 Ga0157370_10084448 Ga0157370_100844482 357
1450 3300013104 Ga0157370_10089404 Ga0157370_100894042 357
1451 3300013104 Ga0157370_10270291 Ga0157370_102702911 357
1452 3300013105 Ga0157369_10199135 Ga0157369_101991352 357
1453 3300013297 Ga0157378_10026157 Ga0157378_100261574 357
1454 3300013306 Ga0163162_10001487 Ga0163162_1000148724 357
1455 3300013307 Ga0157372_10007682 Ga0157372_100076822 357
1456 3300013307 Ga0157372_10015782 Ga0157372_100157824 357
1457 3300013307 Ga0157372_10229313 Ga0157372_102293132 357
1458 3300014497 Ga0182008_10004078 Ga0182008_1000407810 357
1459 3300014497 Ga0182008_10005548 Ga0182008_100055485 357
1460 3300014497 Ga0182008_10021926 Ga0182008_100219263 357
1461 3300014497 Ga0182008_10038255 Ga0182008_100382552 357
1462 3300015261 Ga0182006_1000385 Ga0182006_10003852 357
1463 3300015261 Ga0182006_1003062 Ga0182006_10030623 357
1464 3300015261 Ga0182006_1003888 Ga0182006_10038885 357
1465 3300015262 Ga0182007_10000794 Ga0182007_1000079418 357
1466 3300015265 Ga0182005_1000681 Ga0182005_10006814 357
1467 3300015265 Ga0182005_1003780 Ga0182005_10037802 357
1468 3300017792 Ga0163161_10001061 Ga0163161_100010612 357
1469 3300025207 Ga0209760_100012 Ga0209760_10001232 357
1470 3300025230 Ga0209563_102470 Ga0209563_1024705 357
1471 3300025231 Ga0207427_100003 Ga0207427_100003784 357
1472 3300025233 Ga0209437_100002 Ga0209437_100002229 357
1473 3300025254 Ga0209148_1000374 Ga0209148_100037412 357
1474 3300025261 Ga0209233_1000004 Ga0209233_10000041196 357
1475 3300025261 Ga0209233_1003138 Ga0209233_10031385 357
1476 3300025272 Ga0209455_1001411 Ga0209455_100141113 357
1477 3300025272 Ga0209455_1002427 Ga0209455_10024274 357
1478 3300025291 Ga0209675_1002171 Ga0209675_100217112 357
1479 3300025292 Ga0209676_1000062 Ga0209676_1000062143 357
1480 3300025292 Ga0209676_1000102 Ga0209676_1000102111 357
1481 3300025292 Ga0209676_1000154 Ga0209676_1000154102 357
1482 3300025292 Ga0209676_1001192 Ga0209676_10011923 357
1483 3300025292 Ga0209676_1003691 Ga0209676_10036918 357
1484 3300025292 Ga0209676_1004755 Ga0209676_10047553 357
1485 3300025298 Ga0209050_1000004 Ga0209050_10000041444 357
1486 3300025298 Ga0209050_1000105 Ga0209050_1000105111 357
1487 3300025298 Ga0209050_1000684 Ga0209050_100068426 357
1488 3300025298 Ga0209050_1005899 Ga0209050_10058995 357
1489 3300025302 Ga0207426_1000726 Ga0207426_100072615 357
1490 3300025303 Ga0209051_1000066 Ga0209051_1000066111 357
1491 3300025303 Ga0209051_1000181 Ga0209051_100018119 357
1492 3300025303 Ga0209051_1007044 Ga0209051_10070442 357
1493 3300025303 Ga0209051_1017273 Ga0209051_10172732 357
1494 3300025304 Ga0209257_1000124 Ga0209257_100012479 357
1495 3300025711 Ga0207696_1000002 Ga0207696_1000002179 357
1496 3300025711 Ga0207696_1000050 Ga0207696_1000050101 357
1497 3300025711 Ga0207696_1000156 Ga0207696_1000156107 357
1498 3300025711 Ga0207696_1018751 Ga0207696_10187511 357
1499 3300025728 Ga0207655_1002158 Ga0207655_100215816 357
1500 3300025728 Ga0207655_1002275 Ga0207655_10022753 357
1501 3300025728 Ga0207655_1002393 Ga0207655_10023934 357
1502 3300025728 Ga0207655_1002424 Ga0207655_10024243 357
1503 3300025728 Ga0207655_1003208 Ga0207655_10032082 357
1504 3300025728 Ga0207655_1005954 Ga0207655_10059546 357
1505 3300025728 Ga0207655_1007793 Ga0207655_10077934 357
1506 3300025728 Ga0207655_1012780 Ga0207655_10127804 357
1507 3300025728 Ga0207655_1020188 Ga0207655_10201883 357
1508 3300025728 Ga0207655_1054524 Ga0207655_10545241 357
1509 3300025728 Ga0207655_1055413 Ga0207655_10554132 357
1510 3300025728 Ga0207655_1065501 Ga0207655_10655011 357
1511 3300025735 Ga0207713_1000010 Ga0207713_1000010300 357
1512 3300025735 Ga0207713_1000077 Ga0207713_100007741 357
1513 3300025735 Ga0207713_1001805 Ga0207713_10018054 357
1514 3300025735 Ga0207713_1003953 Ga0207713_10039534 357
1515 3300025735 Ga0207713_1003958 Ga0207713_10039581 357
1516 3300025735 Ga0207713_1004772 Ga0207713_10047724 357
1517 3300025735 Ga0207713_1006986 Ga0207713_10069867 357
1518 3300025735 Ga0207713_1009206 Ga0207713_10092064 357
1519 3300025735 Ga0207713_1025065 Ga0207713_10250653 357
1520 3300025735 Ga0207713_1032621 Ga0207713_10326212 357
1521 3300025735 Ga0207713_1033698 Ga0207713_10336982 357
1522 3300025735 Ga0207713_1045356 Ga0207713_10453562 357
1523 3300025904 Ga0207647_10005184 Ga0207647_100051841 357
1524 3300025904 Ga0207647_10036284 Ga0207647_100362842 357
1525 3300025923 Ga0207681_10188783 Ga0207681_101887831 357
1526 3300025933 Ga0207706_10261683 Ga0207706_102616831 357
1527 3300025933 Ga0207706_10325249 Ga0207706_103252491 357
1528 3300025935 Ga0207709_10000011 Ga0207709_10000011170 357
1529 3300025935 Ga0207709_10008269 Ga0207709_100082694 357
1530 3300025935 Ga0207709_10010196 Ga0207709_100101964 357
1531 3300025935 Ga0207709_10012591 Ga0207709_100125912 357
1532 3300025935 Ga0207709_10223251 Ga0207709_102232511 357
1533 3300025944 Ga0207661_10126364 Ga0207661_101263642 357
1534 3300026116 Ga0207674_10109869 Ga0207674_101098692 357
1535 3300026116 Ga0207674_10180564 Ga0207674_101805642 357
1536 3300027111 Ga0209281_1000924 Ga0209281_100092423 357
1537 3300027111 Ga0209281_1003285 Ga0209281_10032851 357
1538 3300027111 Ga0209281_1016497 Ga0209281_10164971 357
1539 3300027111 Ga0209281_1016715 Ga0209281_10167151 357
1540 3300027296 Ga0209389_1000017 Ga0209389_100001756 357
1541 3300027296 Ga0209389_1000107 Ga0209389_100010742 357
1542 3300027312 Ga0209371_1000151 Ga0209371_100015167 357
1543 3300027312 Ga0209371_1013286 Ga0209371_10132862 357
1544 3300027360 Ga0209969_1002270 Ga0209969_10022701 357
1545 3300027361 Ga0209489_107740 Ga0209489_1077404 357
1546 3300027363 Ga0209700_100005 Ga0209700_100005337 357
1547 3300027395 Ga0209996_1002678 Ga0209996_10026782 357
1548 3300027665 Ga0209983_1001634 Ga0209983_10016345 357
1549 3300027682 Ga0209971_1000237 Ga0209971_100023710 357
1550 3300027876 Ga0209974_10005244 Ga0209974_100052442 357
1551 3300027907 Ga0207428_10019373 Ga0207428_100193732 357
1552 3300027907 Ga0207428_10094936 Ga0207428_100949362 357
1553 3300028379 Ga0268266_10085810 Ga0268266_100858102 357
1554 3300028573 Ga0265334_10039460 Ga0265334_100394602 357
1555 3300030500 Ga0268256_1000163 Ga0268256_100016345 357
1556 3300030500 Ga0268256_1014589 Ga0268256_10145892 357
1557 3300030735 Ga0316178_1149028 Ga0316178_11490286 357
1558 3300031235 Ga0265330_10022831 Ga0265330_100228312 357
1559 3300031241 Ga0265325_10009474 Ga0265325_100094747 357
1560 3300031247 Ga0265340_10000523 Ga0265340_1000052312 357
1561 3300031249 Ga0265339_10058741 Ga0265339_100587411 357
1562 3300031344 Ga0265316_10110520 Ga0265316_101105202 357
1563 3300031548 Ga0307408_100000002 Ga0307408_100000002401 357
1564 3300031548 Ga0307408_100171761 Ga0307408_1001717611 357
1565 3300031616 Ga0307508_10044258 Ga0307508_100442585 357
1566 3300031730 Ga0307516_10026957 Ga0307516_100269575 357
1567 3300031824 Ga0307413_10014552 Ga0307413_100145523 357
1568 3300031995 Ga0307409_100093784 Ga0307409_1000937841 357
1569 3300033180 Ga0307510_10002229 Ga0307510_100022292 357
1570 3300035120 Ga0373957_0002127 Ga0373957_0002127_2323_3441 357
1571 3300035724 Ga0373933_0000199 Ga0373933_0000199_27456_28571 357
1572 3300036401 Ga0373937_0258052 Ga0373937_0258052_236_1354 357
1573 3300037418 Ga0395900_0000820 Ga0395900_0000820_5782_6891 357
1574 3300037418 Ga0395900_0206035 Ga0395900_0206035_611_1726 357
1575 3300037466 Ga0395898_0013589 Ga0395898_0013589_67_1176 357
1576 3300037466 Ga0395898_0034063 Ga0395898_0034063_3905_5020 357
1577 3300038443 Ga0395901_0066455 Ga0395901_0066455_1452_2561 357
1578 3300038705 Ga0237819_02359 Ga0237819_02359_1570_2667 357
1579 3300041404 Ga0439436_0000361 Ga0439436_0000361_5040_6140 357
1580 3300041405 Ga0439438_004560 Ga0439438_004560_3660_4760 357
1581 3300041405 Ga0439438_007237 Ga0439438_007237_1017_2114 357
1582 3300041405 Ga0439438_007901 Ga0439438_007901_183_1280 357
1583 3300041407 Ga0439447_000445 Ga0439447_000445_1146_2243 357
1584 3300041407 Ga0439447_001182 Ga0439447_001182_295_1395 357
1585 3300041407 Ga0439447_018163 Ga0439447_018163_485_1582 357
1586 3300041411 Ga0439466_0000587 Ga0439466_0000587_7412_8512 357
1587 3300041411 Ga0439466_0009861 Ga0439466_0009861_1599_2693 357
1588 3300041411 Ga0439466_0036674 Ga0439466_0036674_366_1463 357
1589 3300041997 Ga0439431_0010407 Ga0439431_0010407_381_1481 357
1590 3300042006 Ga0439432_001382 Ga0439432_001382_387_1484 357
1591 3300042006 Ga0439432_003032 Ga0439432_003032_1668_2768 357
1592 3300042010 Ga0439452_001275 Ga0439452_001275_9334_10431 357
1593 3300042010 Ga0439452_006994 Ga0439452_006994_603_1703 357
1594 3300042010 Ga0439452_016780 Ga0439452_016780_756_1853 357
1595 3300042013 Ga0439456_000058 Ga0439456_000058_3466_4563 357
1596 3300042013 Ga0439456_026385 Ga0439456_026385_77_1174 357
1597 3300042016 Ga0439463_002333 Ga0439463_002333_1464_2558 357
1598 3300042016 Ga0439463_002471 Ga0439463_002471_2067_3164 357
1599 3300042138 Ga0450903_002311 Ga0450903_002311_866_1963 357
1600 3300042139 Ga0450904_004837 Ga0450904_004837_252_1349 357
1601 3300042146 Ga0450907_003353 Ga0450907_003353_628_1725 357
1602 3300042156 Ga0439446_0002288 Ga0439446_0002288_1877_2977 357
1603 3300042185 Ga0450909_001991 Ga0450909_001991_1245_2342 357
1604 3300042435 Ga0439434_0000153 Ga0439434_0000153_486_1583 357
1605 3300042435 Ga0439434_0004552 Ga0439434_0004552_294_1394 357
1606 3300042439 Ga0439464_0001520 Ga0439464_0001520_2901_4001 357
1607 3300042439 Ga0439464_0002231 Ga0439464_0002231_1942_3039 357
1608 3300042993 Ga0439440_0006226 Ga0439440_0006226_595_1692 357
1609 3300042993 Ga0439440_0011398 Ga0439440_0011398_144_1241 357
1610 3300046453 Ga0495627_000102 Ga0495627_000102_85977_87074 357
1611 3300046455 Ga0495603_0004420 Ga0495603_0004420_1230_2327 357
1612 3300046458 Ga0495591_000105 Ga0495591_000105_26200_27297 357
1613 3300046458 Ga0495591_006424 Ga0495591_006424_2639_3736 357
1614 3300046458 Ga0495591_008144 Ga0495591_008144_637_1734 357
1615 3300046458 Ga0495591_024804 Ga0495591_024804_99_1196 357
1616 3300046459 Ga0495629_0002560 Ga0495629_0002560_10298_11410 357
1617 3300046459 Ga0495629_0086057 Ga0495629_0086057_266_1363 357
1618 3300046460 Ga0495638_0023142 Ga0495638_0023142_133_1245 357
1619 3300046460 Ga0495638_0056158 Ga0495638_0056158_340_1437 357
1620 3300046463 Ga0495653_0010997 Ga0495653_0010997_1749_2846 357
1621 3300046463 Ga0495653_0050907 Ga0495653_0050907_985_2082 357
1622 3300046471 Ga0495650_0000578 Ga0495650_0000578_39924_41021 357
1623 3300046471 Ga0495650_0005356 Ga0495650_0005356_997_2094 357
1624 3300046474 Ga0495605_0001226 Ga0495605_0001226_13954_15051 357
1625 3300046474 Ga0495605_0001398 Ga0495605_0001398_12418_13515 357
1626 3300046474 Ga0495605_0008521 Ga0495605_0008521_4111_5208 357
1627 3300046474 Ga0495605_0072234 Ga0495605_0072234_107_1204 357
1628 3300046475 Ga0495639_0000037 Ga0495639_0000037_1296_2393 357
1629 3300046491 Ga0495584_0011363 Ga0495584_0011363_3140_4237 357
1630 3300046491 Ga0495584_0020644 Ga0495584_0020644_983_2080 357
1631 3300046491 Ga0495584_0041164 Ga0495584_0041164_834_1931 357
1632 3300046492 Ga0495585_0000811 Ga0495585_0000811_25099_26196 357
1633 3300046492 Ga0495585_0007063 Ga0495585_0007063_3951_5048 357
1634 3300046492 Ga0495585_0041729 Ga0495585_0041729_577_1674 357
1635 3300046501 Ga0495607_0000637 Ga0495607_0000637_30473_31570 357
1636 3300046501 Ga0495607_0001133 Ga0495607_0001133_18849_19946 357
1637 3300046501 Ga0495607_0001191 Ga0495607_0001191_965_2062 357
1638 3300046501 Ga0495607_0001267 Ga0495607_0001267_4246_5343 357
1639 3300046501 Ga0495607_0004588 Ga0495607_0004588_3419_4516 357
1640 3300046501 Ga0495607_0006036 Ga0495607_0006036_2049_3146 357
1641 3300046501 Ga0495607_0031220 Ga0495607_0031220_1497_2597 357
1642 3300046501 Ga0495607_0086628 Ga0495607_0086628_448_1545 357
1643 3300046501 Ga0495607_0137948 Ga0495607_0137948_48_1145 357
1644 3300046506 Ga0495583_0004981 Ga0495583_0004981_4332_5429 357
1645 3300046506 Ga0495583_0026524 Ga0495583_0026524_1421_2518 357
1646 3300046507 Ga0495606_0000083 Ga0495606_0000083_137850_138947 357
1647 3300046507 Ga0495606_0004670 Ga0495606_0004670_10331_11428 357
1648 3300046507 Ga0495606_0005953 Ga0495606_0005953_995_2107 357
1649 3300046507 Ga0495606_0008185 Ga0495606_0008185_3833_4930 357
1650 3300046507 Ga0495606_0015235 Ga0495606_0015235_2202_3299 357
1651 3300046507 Ga0495606_0015967 Ga0495606_0015967_3236_4333 357
1652 3300046507 Ga0495606_0065212 Ga0495606_0065212_636_1733 357
1653 3300046512 Ga0495610_0009929 Ga0495610_0009929_1926_3023 357
1654 3300046512 Ga0495610_0023829 Ga0495610_0023829_223_1320 357
1655 3300046513 Ga0495616_0000853 Ga0495616_0000853_20066_21163 357
1656 3300046513 Ga0495616_0031789 Ga0495616_0031789_1151_2248 357
1657 3300046514 Ga0495618_0095258 Ga0495618_0095258_251_1363 357
1658 3300046515 Ga0495620_0000229 Ga0495620_0000229_37530_38627 357
1659 3300046515 Ga0495620_0005705 Ga0495620_0005705_1209_2306 357
1660 3300046515 Ga0495620_0013289 Ga0495620_0013289_1178_2275 357
1661 3300046515 Ga0495620_0042846 Ga0495620_0042846_349_1446 357
1662 3300046518 Ga0495631_0000018 Ga0495631_0000018_93535_94632 357
1663 3300046519 Ga0495632_0003848 Ga0495632_0003848_1116_2213 357
1664 3300046519 Ga0495632_0008782 Ga0495632_0008782_3111_4208 357
1665 3300046519 Ga0495632_0015328 Ga0495632_0015328_937_2034 357
1666 3300046519 Ga0495632_0016111 Ga0495632_0016111_146_1243 357
1667 3300046520 Ga0495637_0000271 Ga0495637_0000271_21538_22635 357
1668 3300046520 Ga0495637_0001227 Ga0495637_0001227_1010_2107 357
1669 3300046520 Ga0495637_0001531 Ga0495637_0001531_99_1196 357
1670 3300046520 Ga0495637_0008829 Ga0495637_0008829_1980_3080 357
1671 3300046520 Ga0495637_0018657 Ga0495637_0018657_754_1851 357
1672 3300046522 Ga0495643_0002030 Ga0495643_0002030_13861_14958 357
1673 3300046522 Ga0495643_0007948 Ga0495643_0007948_1559_2656 357
1674 3300046522 Ga0495643_0011277 Ga0495643_0011277_2557_3654 357
1675 3300046522 Ga0495643_0012620 Ga0495643_0012620_484_1581 357
1676 3300046522 Ga0495643_0024343 Ga0495643_0024343_2080_3192 357
1677 3300046522 Ga0495643_0035776 Ga0495643_0035776_74_1171 357
1678 3300046522 Ga0495643_0074639 Ga0495643_0074639_572_1669 357
1679 3300046523 Ga0495644_0005075 Ga0495644_0005075_1670_2767 357
1680 3300046524 Ga0495648_0013922 Ga0495648_0013922_3045_4142 357
1681 3300046524 Ga0495648_0030147 Ga0495648_0030147_99_1196 357
1682 3300046524 Ga0495648_0076749 Ga0495648_0076749_119_1216 357
1683 3300046524 Ga0495648_0138248 Ga0495648_0138248_99_1196 357
1684 3300046526 Ga0495666_0051646 Ga0495666_0051646_800_1897 357
1685 3300046528 Ga0495642_0000209 Ga0495642_0000209_32003_33100 357
1686 3300046530 Ga0495654_0000253 Ga0495654_0000253_46867_47964 357
1687 3300046530 Ga0495654_0015100 Ga0495654_0015100_2108_3205 357
1688 3300046530 Ga0495654_0016359 Ga0495654_0016359_788_1885 357
1689 3300046530 Ga0495654_0019163 Ga0495654_0019163_99_1196 357
1690 3300046530 Ga0495654_0042724 Ga0495654_0042724_518_1615 357
1691 3300046538 Ga0495609_0000759 Ga0495609_0000759_18968_20065 357
1692 3300046538 Ga0495609_0005475 Ga0495609_0005475_691_1788 357
1693 3300046538 Ga0495609_0009928 Ga0495609_0009928_647_1744 357
1694 3300046542 Ga0495597_0000221 Ga0495597_0000221_47002_48099 357
1695 3300046557 Ga0495622_0000202 Ga0495622_0000202_44920_46017 357
1696 3300046557 Ga0495622_0000446 Ga0495622_0000446_1295_2392 357
1697 3300046616 Ga0495668_0009606 Ga0495668_0009606_1850_2947 357
1698 3300046616 Ga0495668_0018591 Ga0495668_0018591_2222_3319 357
1699 3300046660 Ga0495625_0000187 Ga0495625_0000187_44710_45807 357
1700 3300046660 Ga0495625_0003633 Ga0495625_0003633_545_1642 357
1701 3300046660 Ga0495625_0084434 Ga0495625_0084434_891_1988 357
1702 3300046660 Ga0495625_0102481 Ga0495625_0102481_601_1698 357
1703 3300046663 Ga0495635_0003370 Ga0495635_0003370_982_2079 357
1704 3300046664 Ga0495659_0000061 Ga0495659_0000061_46035_47132 357
1705 3300046664 Ga0495659_0009058 Ga0495659_0009058_2003_3100 357
1706 3300046665 Ga0495661_0000061 Ga0495661_0000061_68148_69245 357
1707 3300046665 Ga0495661_0000865 Ga0495661_0000865_22926_24023 357
1708 3300046665 Ga0495661_0023890 Ga0495661_0023890_1618_2715 357
1709 3300046665 Ga0495661_0046668 Ga0495661_0046668_1031_2128 357
1710 3300046674 Ga0495588_0040130 Ga0495588_0040130_116_1213 357
1711 3300046680 Ga0495646_0086790 Ga0495646_0086790_479_1576 357
1712 3300046689 Ga0495613_0011021 Ga0495613_0011021_974_2071 357
1713 3300046692 Ga0495671_0000061 Ga0495671_0000061_865_1962 357
1714 3300046692 Ga0495671_0001595 Ga0495671_0001595_1143_2240 357
1715 3300046692 Ga0495671_0020983 Ga0495671_0020983_665_1762 357
1716 3300046694 Ga0495649_0000086 Ga0495649_0000086_2005_3102 357
1717 3300046694 Ga0495649_0002324 Ga0495649_0002324_8473_9573 357
1718 3300046694 Ga0495649_0008513 Ga0495649_0008513_2208_3305 357
1719 3300046694 Ga0495649_0009795 Ga0495649_0009795_2774_3871 357
1720 3300046694 Ga0495649_0023466 Ga0495649_0023466_792_1889 357
1721 3300046694 Ga0495649_0031252 Ga0495649_0031252_558_1670 357
1722 3300046794 Ga0495589_0000636 Ga0495589_0000636_19844_20941 357
1723 3300046794 Ga0495589_0013533 Ga0495589_0013533_500_1597 357
1724 3300046809 Ga0495600_0028920 Ga0495600_0028920_987_2084 357
1725 3300046810 Ga0495660_0000831 Ga0495660_0000831_2912_4009 357
1726 3300046810 Ga0495660_0001838 Ga0495660_0001838_12010_13107 357
1727 3300046810 Ga0495660_0016712 Ga0495660_0016712_1262_2359 357
1728 3300046810 Ga0495660_0052711 Ga0495660_0052711_435_1532 357
1729 3300046810 Ga0495660_0073031 Ga0495660_0073031_461_1558 357
1730 3300047315 Ga0495581_0040729 Ga0495581_0040729_1093_2190 357
1731 3300047318 Ga0495636_0029976 Ga0495636_0029976_452_1549 357
1732 3300047320 Ga0495672_0001126 Ga0495672_0001126_4454_5551 357
1733 3300047320 Ga0495672_0010611 Ga0495672_0010611_2755_3864 357
1734 3300047320 Ga0495672_0021737 Ga0495672_0021737_2087_3184 357
1735 3300047320 Ga0495672_0059609 Ga0495672_0059609_342_1439 357
1736 3300047320 Ga0495672_0091900 Ga0495672_0091900_190_1287 357
1737 3300047321 Ga0495676_0000011 Ga0495676_0000011_222454_223551 357
1738 3300047321 Ga0495676_0005828 Ga0495676_0005828_6665_7777 357
1739 3300047321 Ga0495676_0010463 Ga0495676_0010463_7025_8125 357
1740 3300047322 Ga0495680_0109475 Ga0495680_0109475_610_1707 357
1741 3300047323 Ga0495683_0000156 Ga0495683_0000156_1892_2989 357
1742 3300047323 Ga0495683_0000207 Ga0495683_0000207_38670_39770 357
1743 3300047323 Ga0495683_0000337 Ga0495683_0000337_36730_37827 357
1744 3300047323 Ga0495683_0001584 Ga0495683_0001584_368_1465 357
1745 3300047323 Ga0495683_0019156 Ga0495683_0019156_168_1265 357
1746 3300047323 Ga0495683_0028046 Ga0495683_0028046_1526_2623 357
1747 3300047323 Ga0495683_0028666 Ga0495683_0028666_1374_2486 357
1748 3300047443 Ga0495687_004107 Ga0495687_004107_7968_9065 357
1749 3300047443 Ga0495687_026449 Ga0495687_026449_583_1680 357
1750 3300047444 Ga0495675_0002568 Ga0495675_0002568_973_2070 357
1751 3300047446 Ga0495679_000274 Ga0495679_000274_25312_26409 357
1752 3300047469 Ga0495673_0001341 Ga0495673_0001341_17460_18557 357
1753 3300047469 Ga0495673_0003114 Ga0495673_0003114_1110_2207 357
1754 3300047469 Ga0495673_0005616 Ga0495673_0005616_56_1153 357
1755 3300047469 Ga0495673_0014010 Ga0495673_0014010_484_1581 357
1756 3300047469 Ga0495673_0033541 Ga0495673_0033541_765_1862 357
1757 3300047470 Ga0495681_0001634 Ga0495681_0001634_14626_15723 357
1758 3300047470 Ga0495681_0012867 Ga0495681_0012867_1490_2749 357
1759 3300047470 Ga0495681_0014112 Ga0495681_0014112_1350_2447 357
1760 3300048091 Ga0495626_0000068 Ga0495626_0000068_130001_131098 357
1761 3300048091 Ga0495626_0000079 Ga0495626_0000079_2013_3110 357
1762 3300048091 Ga0495626_0000345 Ga0495626_0000345_46475_47572 357
1763 3300048091 Ga0495626_0003093 Ga0495626_0003093_913_2010 357
1764 3300048907 Ga0496104_0065597 Ga0496104_0065597_1906_3018 357
1765 3300048907 Ga0496104_0140469 Ga0496104_0140469_1152_2264 357
1766 3300048908 Ga0496105_0000527 Ga0496105_0000527_10771_11883 357
1767 3300048909 Ga0496106_0105257 Ga0496106_0105257_766_1878 357
1768 3300048913 Ga0496110_0261537 Ga0496110_0261537_290_1402 357
1769 3300048914 Ga0496111_0100862 Ga0496111_0100862_43_1155 357
1770 3300048915 Ga0496112_0126454 Ga0496112_0126454_1051_2163 357
1771 3300048918 Ga0496115_0017945 Ga0496115_0017945_66_1178 357
1772 3300048918 Ga0496115_0244338 Ga0496115_0244338_186_1301 357
1773 3300048919 Ga0496116_0035344 Ga0496116_0035344_1263_2360 357
1774 3300048920 Ga0496117_0018385 Ga0496117_0018385_1099_2196 357
1775 3300048920 Ga0496117_0039315 Ga0496117_0039315_551_1648 357
1776 3300048920 Ga0496117_0092326 Ga0496117_0092326_637_1734 357
1777 3300048921 Ga0496118_0016655 Ga0496118_0016655_3966_5063 357
1778 3300048921 Ga0496118_0092267 Ga0496118_0092267_956_2053 357
1779 3300048921 Ga0496118_0164338 Ga0496118_0164338_126_1223 357
1780 3300048922 Ga0496119_0004034 Ga0496119_0004034_12851_13948 357
1781 3300048922 Ga0496119_0005169 Ga0496119_0005169_2831_3943 357
1782 3300048922 Ga0496119_0115253 Ga0496119_0115253_101_1213 357
1783 3300048923 Ga0496120_0003119 Ga0496120_0003119_10858_11955 357
1784 3300048924 Ga0496121_0011294 Ga0496121_0011294_4208_5305 357
1785 3300048924 Ga0496121_0013055 Ga0496121_0013055_3653_4750 357
1786 3300048924 Ga0496121_0032696 Ga0496121_0032696_1933_3045 357
1787 3300048924 Ga0496121_0044950 Ga0496121_0044950_1168_2265 357
1788 3300048924 Ga0496121_0061861 Ga0496121_0061861_255_1352 357
1789 3300048924 Ga0496121_0096390 Ga0496121_0096390_1173_2285 357
1790 3300048924 Ga0496121_0125167 Ga0496121_0125167_482_1585 357
1791 3300048925 Ga0496122_0001103 Ga0496122_0001103_594_1691 357
1792 3300048925 Ga0496122_0001707 Ga0496122_0001707_29061_30158 357
1793 3300048926 Ga0496123_0000607 Ga0496123_0000607_30314_31411 357
1794 3300048927 Ga0496124_0000073 Ga0496124_0000073_11328_12425 357
1795 3300048927 Ga0496124_0000123 Ga0496124_0000123_34044_35147 357
1796 3300048927 Ga0496124_0022258 Ga0496124_0022258_3566_4663 357
1797 3300048927 Ga0496124_0033513 Ga0496124_0033513_1914_3011 357
1798 3300048927 Ga0496124_0050734 Ga0496124_0050734_1478_2575 357
1799 3300048927 Ga0496124_0147253 Ga0496124_0147253_637_1734 357
1800 3300048928 Ga0496125_0012388 Ga0496125_0012388_3593_4690 357
1801 3300048929 Ga0496126_0010997 Ga0496126_0010997_2096_3208 357
1802 3300048929 Ga0496126_0039798 Ga0496126_0039798_2829_3926 357
1803 3300048929 Ga0496126_0125183 Ga0496126_0125183_628_1734 357
1804 3300048929 Ga0496126_0134533 Ga0496126_0134533_293_1405 357
1805 3300049459 Ga0495678_000404 Ga0495678_000404_9859_10956 357
1806 3300049459 Ga0495678_000437 Ga0495678_000437_1183_2280 357
1807 3300049459 Ga0495678_029671 Ga0495678_029671_1099_2196 357
1808 3300049459 Ga0495678_077413 Ga0495678_077413_24_1136 357
1809 3300049460 Ga0495682_0000124 Ga0495682_0000124_4480_5577 357
1810 3300049460 Ga0495682_0007005 Ga0495682_0007005_1634_2731 357
1811 3300049568 Ga0501031_0064268 Ga0501031_0064268_750_1850 357
1812 3300049571 Ga0501034_0070282 Ga0501034_0070282_1405_2505 357
1813 3300049571 Ga0501034_0101892 Ga0501034_0101892_1488_2588 357
1814 3300049822 Ga0501035_0185630 Ga0501035_0185630_258_1358 357
1815 3300050489 nmdc:mga03683_65384_c1 nmdc:mga03683_65384_c1_418_1515 357
1816 3300050491 nmdc:mga00v17_133592_c1 nmdc:mga00v17_133592_c1_437_1540 357
1817 3300050492 nmdc:mga0yw44_179343_c1 nmdc:mga0yw44_179343_c1_235_1347 357
1818 3300050492 nmdc:mga0yw44_88128_c1 nmdc:mga0yw44_88128_c1_363_1475 357
1819 3300050493 nmdc:mga0k408_42800_c1 nmdc:mga0k408_42800_c1_543_1655 357
1820 3300050494 nmdc:mga06z11_158342_c1 nmdc:mga06z11_158342_c1_48_1160 357
1821 3300050516 nmdc:mga0sz30_23091_c1 nmdc:mga0sz30_23091_c1_48_1160 357
1822 3300050516 nmdc:mga0sz30_29734_c1 nmdc:mga0sz30_29734_c1_1095_2207 357
1823 3300053077 Ga0495601_0033943 Ga0495601_0033943_1732_2850 357
1824 3300053087 Ga0500643_000007 Ga0500643_000007_24046_25170 357
1825 3300053092 Ga0500583_0022622 Ga0500583_0022622_1217_2341 357
1826 3300053094 Ga0500566_0003695 Ga0500566_0003695_3569_4681 357
1827 3300053103 Ga0500555_007056 Ga0500555_007056_199_1323 357
1828 3300053109 Ga0500569_023292 Ga0500569_023292_132_1244 357
1829 3300053119 Ga0500595_036527 Ga0500595_036527_198_1310 357
1830 3300053125 Ga0500618_012475 Ga0500618_012475_430_1530 357
1831 3300053130 Ga0500642_0012732 Ga0500642_0012732_1064_2188 357
1832 3300053139 Ga0500568_0024804 Ga0500568_0024804_1274_2398 357
1833 3300053151 Ga0500604_0011205 Ga0500604_0011205_1157_2281 357
1834 3300053153 Ga0500616_0040062 Ga0500616_0040062_724_1836 357
1835 3300053156 Ga0500622_0008171 Ga0500622_0008171_4611_5723 357
1836 3300053737 Ga0500601_000228 Ga0500601_000228_548_1654 357
1837 iso_pu_bacteria 2511231004 2511254010 357
1838 iso_pu_bacteria 2511231006 2511266852 357
1839 iso_pu_bacteria 2511231006 2511269114 357
1840 iso_pu_bacteria 2511231007 2511272444 357
1841 iso_pu_bacteria 2511231008 2511275103 357
1842 iso_pu_bacteria 2511231010 2511289393 357
1843 iso_pu_bacteria 2511231011 2511297763 357
1844 iso_pu_bacteria 2511231012 2511302827 357
1845 iso_pu_bacteria 2511231014 2511314421 357
1846 iso_pu_bacteria 2511231015 2511317221 357
1847 iso_pu_bacteria 2511231016 2511328021 357
1848 iso_pu_bacteria 2511231017 2511329658 357
1849 iso_pu_bacteria 2511231018 2511336845 357
1850 iso_pu_bacteria 2511231019 2511344808 357
1851 iso_pu_bacteria 2511231020 2511349571 357
1852 iso_pu_bacteria 2511231021 2511359299 357
1853 iso_pu_bacteria 2511231022 2511360909 357
1854 iso_pu_bacteria 2511231023 2511370983 357
1855 iso_pu_bacteria 2511231031 2511413477 357
1856 iso_pu_bacteria 2511231156 2511827623 357
1857 iso_pu_bacteria 2512047018 2512329504 357
1858 iso_pu_bacteria 2554235341 2555669666 357
1859 iso_pu_bacteria 2554235341 2555672824 357
1860 iso_pu_bacteria 2582580891 2583795736 357
1861 iso_pu_bacteria 2597489888 2597866618 357
1862 iso_pu_bacteria 2597489889 2597872474 357
1863 iso_pu_bacteria 2599185160 2599353337 357
1864 iso_pu_bacteria 2599185160 2599355972 357
1865 iso_pu_bacteria 2599185161 2599363732 357
1866 iso_pu_bacteria 2599185162 2599370052 357
1867 iso_pu_bacteria 2599185163 2599372359 357
1868 iso_pu_bacteria 2599185164 2599378445 357
1869 iso_pu_bacteria 2599185164 2599381078 357
1870 iso_pu_bacteria 2599185165 2599384178 357
1871 iso_pu_bacteria 2599185165 2599387406 357
1872 iso_pu_bacteria 2599185166 2599391218 357
1873 iso_pu_bacteria 2599185167 2599400551 357
1874 iso_pu_bacteria 2599185168 2599407463 357
1875 iso_pu_bacteria 2599185179 2599449875 357
1876 iso_pu_bacteria 2599185181 2599460171 357
1877 iso_pu_bacteria 2599185181 2599462806 357
1878 iso_pu_bacteria 2599185182 2599467771 357
1879 iso_pu_bacteria 2599185182 2599470565 357
1880 iso_pu_bacteria 2599185185 2599485896 357
1881 iso_pu_bacteria 2599185186 2599489192 357
1882 iso_pu_bacteria 2599185186 2599491823 357
1883 iso_pu_bacteria 2599185189 2599505740 357
1884 iso_pu_bacteria 2599185190 2599511949 357
1885 iso_pu_bacteria 2599185191 2599516933 357
1886 iso_pu_bacteria 2599185212 2599614418 357
1887 iso_pu_bacteria 2599185257 2599804678 357
1888 iso_pu_bacteria 2599185288 2599879025 357
1889 iso_pu_bacteria 2599185290 2599892689 357
1890 iso_pu_bacteria 2599185303 2599951439 357
1891 iso_pu_bacteria 2599185304 2599954227 357
1892 iso_pu_bacteria 2599185309 2599982930 357
1893 iso_pu_bacteria 2599185310 2599988320 357
1894 iso_pu_bacteria 2599185311 2599993979 357
1895 iso_pu_bacteria 2599185312 2599999114 357
1896 iso_pu_bacteria 2599185316 2600026351 357
1897 iso_pu_bacteria 2599185317 2600032101 357
1898 iso_pu_bacteria 2599185318 2600035962 357
1899 iso_pu_bacteria 2599185319 2600042326 357
1900 iso_pu_bacteria 2599185320 2600046645 357
1901 iso_pu_bacteria 2599185322 2600061036 357
1902 iso_pu_bacteria 2599185323 2600066380 357
1903 iso_pu_bacteria 2599185325 2600076550 357
1904 iso_pu_bacteria 2599185356 2600212780 357
1905 iso_pu_bacteria 2599185356 2600215432 357
1906 iso_pu_bacteria 2600254930 2600359004 357
1907 iso_pu_bacteria 2600254931 2600363560 357
1908 iso_pu_bacteria 2600255296 2601693457 357
1909 iso_pu_bacteria 2600255313 2601772948 357
1910 iso_pu_bacteria 2600255313 2601775598 357
1911 iso_pu_bacteria 2600255318 2601798572 357
1912 iso_pu_bacteria 2603880185 2606077466 357
1913 iso_pu_bacteria 2603880199 2606129288 357
1914 iso_pu_bacteria 2619619299 2621296858 357
1915 iso_pu_bacteria 2623620443 2624483400 357
1916 iso_pu_bacteria 2623620446 2624494920 357
1917 iso_pu_bacteria 2643221565 2643842951 357
1918 iso_pu_bacteria 2643221571 2643872252 357
1919 iso_pu_bacteria 2643221589 2643955646 357
1920 iso_pu_bacteria 2643221602 2644020440 357
1921 iso_pu_bacteria 2643221633 2644184495 357
1922 iso_pu_bacteria 2643221650 2644283240 357
1923 iso_pu_bacteria 2643221713 2644620155 357
1924 iso_pu_bacteria 2651869719 2652544922 357
1925 iso_pu_bacteria 2667528171 2671095094 357
1926 iso_pu_bacteria 2667528171 2671099266 357
1927 iso_pu_bacteria 2667528176 2671128596 357
1928 iso_pu_bacteria 2671180172 2671771685 357
1929 iso_pu_bacteria 2675903420 2677897118 357
1930 iso_pu_bacteria 2675903515 2678266136 357
1931 iso_pu_bacteria 2713897148 2715749843 357
1932 iso_pu_bacteria 2713897149 2715754859 357
1933 iso_pu_bacteria 2718217725 2718636601 357
1934 iso_pu_bacteria 2721755607 2723251354 357
1935 iso_pu_bacteria 2738541265 2738671678 357
1936 iso_pu_bacteria 2738541282 2738750072 357
1937 iso_pu_bacteria 2738541294 2738807241 357
1938 iso_pu_bacteria 2738541303 2738859112 357
1939 iso_pu_bacteria 2738541309 2738894601 357
1940 iso_pu_bacteria 2738543004 2739199046 357
1941 iso_pu_bacteria 2738543015 2739258987 357
1942 iso_pu_bacteria 2738543025 2739312518 357
1943 iso_pu_bacteria 2740892503 2743736822 357
1944 iso_pu_bacteria 2740892503 2743740410 357
1945 iso_pu_bacteria 2744054620 2745007368 357
1946 iso_pu_bacteria 2773857670 2774118390 357
1947 iso_pu_bacteria 2773857673 2774135580 357
1948 iso_pu_bacteria 2784132063 2784261831 357
1949 iso_pu_bacteria 2784132072 2784313562 357
1950 iso_pu_bacteria 2808606361 2808855707 357
1951 iso_pu_bacteria 2808606376 2808926498 357
1952 iso_pu_bacteria 2808606377 2808928455 357
1953 iso_pu_bacteria 2808606378 2808935456 357
1954 iso_pu_bacteria 2808606380 2808948659 357
1955 iso_pu_bacteria 2808606381 2808950362 357
1956 iso_pu_bacteria 2808606382 2808959856 357
1957 iso_pu_bacteria 2808606383 2808964064 357
1958 iso_pu_bacteria 2808606385 2808976137 357
1959 iso_pu_bacteria 2808606388 2808993237 357
1960 iso_pu_bacteria 2808606389 2808999100 357
1961 iso_pu_bacteria 2808606445 2809217173 357
1962 iso_pu_bacteria 2811994881 2812369484 357
1963 iso_pu_bacteria 2816332298 2817494029 357
1964 iso_pu_bacteria 2818991456 2819655118 357
1965 iso_pu_bacteria 2818991464 2819704388 357
1966 iso_pu_bacteria 2818991464 2819705549 357
1967 iso_pu_bacteria 2825651385 2825655107 357
1968 iso_pu_bacteria 2834028612 2834030938 357
1969 iso_pu_bacteria 2842826826 2842831297 357
1970 iso_pu_bacteria 2842832357 2842833448 357
1971 iso_pu_bacteria 2842837860 2842837887 357
1972 iso_pu_bacteria 2842843487 2842845678 357
1973 iso_pu_bacteria 2842854478 2842855609 357
1974 iso_pu_bacteria 2844665904 2844667075 357
1975 iso_pu_bacteria 2844665904 2844669820 357
1976 iso_pu_bacteria 2844665904 2844670165 357
1977 iso_pu_bacteria 2852612431 2852616339 357
1978 iso_pu_bacteria 2852657418 2852659665 357
1979 iso_pu_bacteria 2852667396 2852671307 357
1980 iso_pu_bacteria 2860339153 2860341701 357
1981 iso_pu_bacteria 2860867994 2860873016 357
1982 iso_pu_bacteria 2878029506 2878035342 357
1983 iso_pu_bacteria 2880230671 2880235983 357
1984 iso_pu_bacteria 2904518522 2904518969 357
1985 iso_pu_bacteria 2904550169 2904551340 357
1986 iso_pu_bacteria 2908446538 2908452569 357
1987 iso_pu_bacteria 2913036834 2913042517 357
1988 iso_pu_bacteria 2917070673 2917073483 357
1989 iso_pu_bacteria 2917070673 2917076720 357
1990 iso_pu_bacteria 2919063839 2919065529 357
1991 iso_pu_bacteria 2919385768 2919389201 357
1992 iso_pu_bacteria 2919456309 2919457535 357
1993 iso_pu_bacteria 2919481497 2919485644 357
1994 iso_pu_bacteria 2919487758 2919488178 357
1995 iso_pu_bacteria 2919697872 2919700588 357
1996 iso_pu_bacteria 2923153595 2923155845 357
1997 iso_pu_bacteria 2923153595 2923159503 357
1998 iso_pu_bacteria 2923519811 2923523570 357
1999 iso_pu_bacteria 2923586266 2923588987 357
2000 iso_pu_bacteria 2929144301 2929149908 357
2001 iso_pu_bacteria 2929189879 2929195138 357
2002 iso_pu_bacteria 2931369376 2931372652 357
2003 iso_pu_bacteria 2931390751 2931396398 357
2004 iso_pu_bacteria 2931396565 2931398066 357
2005 iso_pu_bacteria 2935353572 2935357509 357
2006 iso_pu_bacteria 2935353572 2935358313 357
2007 iso_pu_bacteria 2939636861 2939640817 357
2008 iso_pu_bacteria 2945928738 2945930921 357
2009 iso_pu_bacteria 2945961074 2945966843 357
2010 iso_pu_bacteria 2946006987 2946013298 357
2011 iso_pu_bacteria 2946027586 2946027891 357
2012 iso_pu_bacteria 2947233263 2947234411 357
2013 iso_pu_bacteria 2969304461 2969310162 357
2014 iso_pu_bacteria 2974289157 2974294090 357
2015 iso_pu_bacteria 2984286254 2984286613 357
2016 iso_pu_bacteria 2984286254 2984290176 357
2017 iso_pu_bacteria 2988728565 2988731449 357
2018 iso_pu_bacteria 2998139840 2998145385 357
2019 iso_pu_bacteria 3007395558 3007399410 357
2020 iso_pu_bacteria 3007395558 3007401388 357
2021 iso_pu_bacteria 3007419365 3007419829 357
2022 iso_pu_bacteria 3007511990 3007517166 357
2023 iso_pu_bacteria 3007614139 3007618519 357
2024 iso_pu_bacteria 3007619802 3007622510 357
2025 iso_pu_bacteria 3007718800 3007721743 357
2026 iso_pu_bacteria 3007855910 3007859180 357
2027 iso_pu_bacteria 3007861166 3007865114 357
2028 iso_pu_bacteria 3007866637 3007866791 357
2029 iso_pu_bacteria 637000220 637319995 357
2030 iso_pu_bacteria 8015687852 8015690089 357
2031 iso_pu_bacteria 8015687852 8015693602 357
2032 iso_pu_bacteria 8019769354 8019769782 357
2033 iso_pu_bacteria 8019775933 8019777695 357
2034 iso_pu_bacteria 8029995093 8029995516 357
2035 iso_pu_bacteria 8054285046 8054287909 357
2036 iso_pu_bacteria 8054347763 8054349594 357
2037 iso_pu_bacteria 8054503363 8054508920 357
2038 iso_pu_bacteria 8055770955 8055773210 357
2039 iso_pu_bacteria 8055770955 8055776848 357
2040 iso_pu_bacteria 8055817908 8055823889 357
2041 iso_pu_bacteria 8056125926 8056131592 357
2042 iso_pu_bacteria 8056131705 8056137296 357
2043 iso_pu_bacteria 8056143049 8056148758 357
2044 iso_pu_bacteria 8056148874 8056151506 357
2045 iso_pu_bacteria 8056155041 8056160839 357
2046 iso_pu_bacteria 8056161164 8056163620 357
2047 iso_pu_bacteria 8056166840 8056171319 357
2048 iso_pu_bacteria 8056172158 8056177421 357
2049 iso_pu_bacteria 8056177738 8056181987 357
2050 iso_pu_bacteria 8056569372 8056570453 357
2051 iso_pu_bacteria 8057798959 8057799763 357
2052 iso_pu_bacteria 8057798959 8057801928 357
2053 3300003215 JGI25153J46596_10002234 JGI25153J46596_100022345 358
2054 3300005339 Ga0070660_100002432 Ga0070660_1000024323 358
2055 3300005536 Ga0070697_100041824 Ga0070697_1000418244 358
2056 3300005539 Ga0068853_100002462 Ga0068853_1000024624 358
2057 3300005563 Ga0068855_100013031 Ga0068855_1000130312 358
2058 3300005983 Ga0081540_1004236 Ga0081540_100423614 358
2059 3300007265 Ga0099794_10111701 Ga0099794_101117012 358
2060 3300009093 Ga0105240_10010458 Ga0105240_100104583 358
2061 3300009545 Ga0105237_10018185 Ga0105237_100181858 358
2062 3300009551 Ga0105238_10005132 Ga0105238_1000513213 358
2063 3300010159 Ga0099796_10008410 Ga0099796_100084103 358
2064 3300010159 Ga0099796_10009635 Ga0099796_100096352 358
2065 3300010375 Ga0105239_10007603 Ga0105239_1000760311 358
2066 3300013104 Ga0157370_10233505 Ga0157370_102335052 358
2067 3300013105 Ga0157369_10005049 Ga0157369_1000504911 358
2068 3300025297 Ga0209758_1000068 Ga0209758_100006863 358
2069 3300025913 Ga0207695_10019286 Ga0207695_100192866 358
2070 3300025914 Ga0207671_10050917 Ga0207671_100509172 358
2071 3300025917 Ga0207660_10006978 Ga0207660_100069782 358
2072 3300025919 Ga0207657_10000658 Ga0207657_1000065817 358
2073 3300025920 Ga0207649_10268068 Ga0207649_102680681 358
2074 3300025921 Ga0207652_10003041 Ga0207652_100030413 358
2075 3300025949 Ga0207667_10011875 Ga0207667_100118753 358
2076 3300027471 Ga0209995_1004381 Ga0209995_10043811 358
2077 3300027526 Ga0209968_1003426 Ga0209968_10034262 358
2078 3300027665 Ga0209983_1001634 Ga0209983_10016344 358
2079 3300027682 Ga0209971_1000237 Ga0209971_10002379 358
2080 3300027717 Ga0209998_10006573 Ga0209998_100065732 358
2081 3300027876 Ga0209974_10003263 Ga0209974_100032632 358
2082 3300027876 Ga0209974_10005244 Ga0209974_100052443 358
2083 3300031251 Ga0265327_10003967 Ga0265327_1000396717 358
2084 3300031507 Ga0307509_10079255 Ga0307509_100792552 358
2085 3300031548 Ga0307408_100000002 Ga0307408_100000002400 358
2086 3300031824 Ga0307413_10014552 Ga0307413_100145522 358
2087 3300035118 Ga0373954_0022928 Ga0373954_0022928_251_1366 358
2088 3300035172 Ga0373955_0005969 Ga0373955_0005969_137_1252 358
2089 3300035695 Ga0373927_0004346 Ga0373927_0004346_5135_6250 358
2090 3300035695 Ga0373927_0020940 Ga0373927_0020940_28_1143 358
2091 3300035725 Ga0373947_0001007 Ga0373947_0001007_10080_11195 358
2092 3300035725 Ga0373947_0023591 Ga0373947_0023591_2240_3355 358
2093 3300037068 Ga0373925_0033053 Ga0373925_0033053_887_2002 358
2094 3300039437 Ga0436365_1119744 Ga0436365_1119744_2473_3579 358
2095 3300041411 Ga0439466_0001135 Ga0439466_0001135_3508_4620 358
2096 3300042013 Ga0439456_006645 Ga0439456_006645_301_1413 358
2097 3300046455 Ga0495603_0001705 Ga0495603_0001705_6757_7872 358
2098 3300046459 Ga0495629_0000606 Ga0495629_0000606_1816_2931 358
2099 3300046461 Ga0495641_0016685 Ga0495641_0016685_1332_2447 358
2100 3300046472 Ga0495580_0001160 Ga0495580_0001160_12615_13730 358
2101 3300046472 Ga0495580_0002907 Ga0495580_0002907_9684_10799 358
2102 3300046473 Ga0495582_0000174 Ga0495582_0000174_28919_30034 358
2103 3300046475 Ga0495639_0000136 Ga0495639_0000136_26302_27417 358
2104 3300046476 Ga0495662_0000723 Ga0495662_0000723_7008_8123 358
2105 3300046499 Ga0495594_0002231 Ga0495594_0002231_634_1749 358
2106 3300046514 Ga0495618_0115837 Ga0495618_0115837_533_1648 358
2107 3300046516 Ga0495628_0125305 Ga0495628_0125305_363_1478 358
2108 3300046517 Ga0495630_0002539 Ga0495630_0002539_4166_5281 358
2109 3300046531 Ga0495665_0000026 Ga0495665_0000026_13471_14586 358
2110 3300046533 Ga0495640_0005169 Ga0495640_0005169_5834_6949 358
2111 3300046642 Ga0495634_0000634 Ga0495634_0000634_6644_7759 358
2112 3300046663 Ga0495635_0001841 Ga0495635_0001841_6652_7767 358
2113 3300046674 Ga0495588_0033296 Ga0495588_0033296_952_2067 358
2114 3300046680 Ga0495646_0050695 Ga0495646_0050695_1070_2185 358
2115 3300046681 Ga0495647_0000987 Ga0495647_0000987_313_1428 358
2116 3300046683 Ga0495658_0002317 Ga0495658_0002317_712_1827 358
2117 3300046683 Ga0495658_0072018 Ga0495658_0072018_232_1347 358
2118 3300046690 Ga0495624_0004274 Ga0495624_0004274_1872_2987 358
2119 3300047315 Ga0495581_0001078 Ga0495581_0001078_11138_12253 358
2120 3300047319 Ga0495674_0005676 Ga0495674_0005676_6767_7882 358
2121 3300047321 Ga0495676_0025513 Ga0495676_0025513_941_2056 358
2122 3300047321 Ga0495676_0112090 Ga0495676_0112090_595_1710 358
2123 3300047443 Ga0495687_028062 Ga0495687_028062_597_1754 358
2124 3300047469 Ga0495673_0009096 Ga0495673_0009096_2038_3153 358
2125 3300047471 Ga0495684_0011084 Ga0495684_0011084_4643_5758 358
2126 3300047673 Ga0495593_0001096 Ga0495593_0001096_10475_11590 358
2127 3300048913 Ga0496110_0079448 Ga0496110_0079448_1284_2396 358
2128 3300048924 Ga0496121_0000594 Ga0496121_0000594_56084_57208 358
2129 3300050492 nmdc:mga0yw44_103586_c1 nmdc:mga0yw44_103586_c1_305_1462 358
2130 3300053091 Ga0500647_0105885 Ga0500647_0105885_83_1198 358
2131 3300053094 Ga0500566_0000204 Ga0500566_0000204_10373_11488 358
2132 3300053111 Ga0500572_000995 Ga0500572_000995_2332_3447 358
2133 3300053122 Ga0500608_004606 Ga0500608_004606_810_1925 358
2134 3300053123 Ga0500614_000876 Ga0500614_000876_4575_5690 358
2135 3300053136 Ga0500559_0001636 Ga0500559_0001636_4431_5546 358
2136 3300053159 Ga0500630_000027 Ga0500630_000027_17773_18888 358
2137 3300053162 Ga0500638_094639 Ga0500638_094639_276_1391 358
2138 3300053163 Ga0500639_000020 Ga0500639_000020_7329_8444 358
2139 3300053735 Ga0500596_000114 Ga0500596_000114_6848_7963 358
2140 iso_pu_bacteria 2842454564 2842461054 358
2141 3300002737 JGI25162J39368_1000505 JGI25162J39368_100050525 359
2142 3300002771 JGI25163J39215_1002499 JGI25163J39215_10024992 359
2143 3300002772 JGI25164J39214_1000342 JGI25164J39214_10003424 359
2144 3300003214 JGI25165J46597_1000629 JGI25165J46597_10006294 359
2145 3300003323 rootH1_10006273 rootH1_100062732 359
2146 3300005434 Ga0070709_10006118 Ga0070709_100061182 359
2147 3300005436 Ga0070713_100033148 Ga0070713_1000331482 359
2148 3300005437 Ga0070710_10001287 Ga0070710_1000128712 359
2149 3300005439 Ga0070711_100004377 Ga0070711_1000043779 359
2150 3300006173 Ga0070716_100020409 Ga0070716_1000204092 359
2151 3300006175 Ga0070712_100018569 Ga0070712_1000185692 359
2152 3300007265 Ga0099794_10072809 Ga0099794_100728092 359
2153 3300017792 Ga0163161_10071145 Ga0163161_100711452 359
2154 3300025207 Ga0209760_100197 Ga0209760_1001974 359
2155 3300025230 Ga0209563_101931 Ga0209563_1019314 359
2156 3300025231 Ga0207427_100005 Ga0207427_100005319 359
2157 3300025233 Ga0209437_100018 Ga0209437_100018229 359
2158 3300025261 Ga0209233_1000021 Ga0209233_1000021319 359
2159 3300025291 Ga0209675_1015233 Ga0209675_10152332 359
2160 3300025711 Ga0207696_1006588 Ga0207696_10065882 359
2161 3300025728 Ga0207655_1013044 Ga0207655_10130443 359
2162 3300025728 Ga0207655_1017975 Ga0207655_10179753 359
2163 3300025898 Ga0207692_10000175 Ga0207692_1000017510 359
2164 3300025906 Ga0207699_10001765 Ga0207699_100017655 359
2165 3300025915 Ga0207693_10018169 Ga0207693_100181694 359
2166 3300025933 Ga0207706_10047830 Ga0207706_100478303 359
2167 3300025939 Ga0207665_10015055 Ga0207665_100150554 359
2168 3300026067 Ga0207678_10114319 Ga0207678_101143192 359
2169 3300027111 Ga0209281_1001944 Ga0209281_10019443 359
2170 3300030734 Ga0316179_1035710 Ga0316179_10357101 359
2171 3300031548 Ga0307408_100031929 Ga0307408_1000319292 359
2172 3300031548 Ga0307408_100094932 Ga0307408_1000949321 359
2173 3300031995 Ga0307409_100160375 Ga0307409_1001603752 359
2174 3300038705 Ga0237819_01098 Ga0237819_01098_5546_6625 359
2175 3300046455 Ga0495603_0035234 Ga0495603_0035234_761_1840 359
2176 3300046471 Ga0495650_0041090 Ga0495650_0041090_636_1868 359
2177 3300046557 Ga0495622_0021988 Ga0495622_0021988_1623_2702 359
2178 3300046674 Ga0495588_0026025 Ga0495588_0026025_493_1605 359
2179 3300048091 Ga0495626_0059123 Ga0495626_0059123_160_1239 359
2180 3300048919 Ga0496116_0018636 Ga0496116_0018636_3977_5056 359
2181 3300053138 Ga0500564_063243 Ga0500564_063243_264_1379 359
2182 iso_pu_bacteria 2600254954 2600444085 359
2183 iso_pu_bacteria 2600255389 2602008430 359
2184 iso_pu_bacteria 2823421272 2823425714 359
2185 iso_pu_bacteria 2919501602 2919502460 359
2186 iso_pu_bacteria 2926063275 2926064133 359
2187 iso_pu_bacteria 8034962539 8034963654 359
2188 2124908027 MRS2a_Contig_136 MRS2a_00036450 360
2189 2162886007 SwRhRL2b_contig_180730 SwRhRL2b_0225.00003560 360
2190 2162886007 SwRhRL2b_contig_478269 SwRhRL2b_0022.00006490 360
2191 3300001979 JGI24740J21852_10007980 JGI24740J21852_100079804 360
2192 3300002738 JGI25154J39366_1002638 JGI25154J39366_10026382 360
2193 3300002741 JGI25157J39369_1000038 JGI25157J39369_100003839 360
2194 3300002772 JGI25164J39214_1002979 JGI25164J39214_10029792 360
2195 3300003323 rootH1_10006274 rootH1_100062741 360
2196 3300003751 Ga0055538_1000032 Ga0055538_1000032124 360
2197 3300003752 Ga0055539_1000043 Ga0055539_1000043124 360
2198 3300003756 Ga0055533_1000026 Ga0055533_1000026178 360
2199 3300003756 Ga0055533_1000052 Ga0055533_1000052124 360
2200 3300003758 Ga0055532_1000047 Ga0055532_1000047104 360
2201 3300003759 Ga0055525_1000062 Ga0055525_1000062124 360
2202 3300003761 Ga0055535_1004623 Ga0055535_10046231 360
2203 3300003781 Ga0055536_1001013 Ga0055536_100101314 360
2204 3300003781 Ga0055536_1004708 Ga0055536_10047083 360
2205 3300003781 Ga0055536_1004755 Ga0055536_10047553 360
2206 3300003791 Ga0055530_10001395 Ga0055530_1000139514 360
2207 3300003791 Ga0055530_10004701 Ga0055530_100047013 360
2208 3300003791 Ga0055530_10009077 Ga0055530_100090772 360
2209 3300003792 Ga0055540_1002862 Ga0055540_10028625 360
2210 3300003792 Ga0055540_1003956 Ga0055540_10039563 360
2211 3300003794 Ga0055531_10008572 Ga0055531_100085723 360
2212 3300003841 Ga0055541_1000030 Ga0055541_1000030124 360
2213 3300005288 Ga0065714_10003458 Ga0065714_100034584 360
2214 3300005288 Ga0065714_10008959 Ga0065714_100089592 360
2215 3300005288 Ga0065714_10068635 Ga0065714_100686351 360
2216 3300005288 Ga0065714_10069870 Ga0065714_100698702 360
2217 3300005288 Ga0065714_10070155 Ga0065714_100701552 360
2218 3300005288 Ga0065714_10122356 Ga0065714_101223561 360
2219 3300005289 Ga0065704_10071473 Ga0065704_100714734 360
2220 3300005289 Ga0065704_10099092 Ga0065704_100990921 360
2221 3300005289 Ga0065704_10102686 Ga0065704_101026862 360
2222 3300005289 Ga0065704_10146024 Ga0065704_101460241 360
2223 3300005290 Ga0065712_10000927 Ga0065712_100009273 360
2224 3300005290 Ga0065712_10072290 Ga0065712_100722903 360
2225 3300005293 Ga0065715_10002954 Ga0065715_100029544 360
2226 3300005327 Ga0070658_10034248 Ga0070658_100342484 360
2227 3300005327 Ga0070658_10051402 Ga0070658_100514025 360
2228 3300005330 Ga0070690_100010717 Ga0070690_1000107171 360
2229 3300005331 Ga0070670_100001953 Ga0070670_1000019533 360
2230 3300005334 Ga0068869_100041073 Ga0068869_1000410732 360
2231 3300005344 Ga0070661_100001640 Ga0070661_1000016403 360
2232 3300005353 Ga0070669_100002598 Ga0070669_1000025983 360
2233 3300005353 Ga0070669_100011283 Ga0070669_1000112834 360
2234 3300005457 Ga0070662_100008312 Ga0070662_1000083124 360
2235 3300005457 Ga0070662_100166156 Ga0070662_1001661561 360
2236 3300005535 Ga0070684_100231098 Ga0070684_1002310981 360
2237 3300005539 Ga0068853_100000187 Ga0068853_10000018722 360
2238 3300005548 Ga0070665_100095898 Ga0070665_1000958981 360
2239 3300005564 Ga0070664_100001886 Ga0070664_10000188610 360
2240 3300005564 Ga0070664_100090486 Ga0070664_1000904862 360
2241 3300005578 Ga0068854_100003296 Ga0068854_1000032968 360
2242 3300005578 Ga0068854_100175651 Ga0068854_1001756512 360
2243 3300005614 Ga0068856_100001621 Ga0068856_10000162116 360
2244 3300005834 Ga0068851_10000007 Ga0068851_1000000726 360
2245 3300006051 Ga0075364_10132834 Ga0075364_101328343 360
2246 3300006058 Ga0075432_10007217 Ga0075432_100072173 360
2247 3300006186 Ga0075369_10031582 Ga0075369_100315822 360
2248 3300006195 Ga0075366_10072326 Ga0075366_100723262 360
2249 3300006237 Ga0097621_100318574 Ga0097621_1003185741 360
2250 3300006353 Ga0075370_10049899 Ga0075370_100498993 360
2251 3300006946 Ga0079104_1001103 Ga0079104_10011035 360
2252 3300006948 Ga0099826_10004877 Ga0099826_100048777 360
2253 3300009011 Ga0105251_10017375 Ga0105251_100173753 360
2254 3300009011 Ga0105251_10022129 Ga0105251_100221292 360
2255 3300009036 Ga0105244_10056448 Ga0105244_100564482 360
2256 3300009036 Ga0105244_10058050 Ga0105244_100580501 360
2257 3300009036 Ga0105244_10098258 Ga0105244_100982581 360
2258 3300009092 Ga0105250_10008783 Ga0105250_100087832 360
2259 3300009092 Ga0105250_10009972 Ga0105250_100099722 360
2260 3300009092 Ga0105250_10009972 Ga0105250_100099723 360
2261 3300009092 Ga0105250_10060814 Ga0105250_100608141 360
2262 3300009092 Ga0105250_10086053 Ga0105250_100860531 360
2263 3300009093 Ga0105240_10039056 Ga0105240_100390562 360
2264 3300009148 Ga0105243_10001069 Ga0105243_1000106924 360
2265 3300009148 Ga0105243_10001572 Ga0105243_1000157218 360
2266 3300009148 Ga0105243_10001599 Ga0105243_1000159916 360
2267 3300009148 Ga0105243_10011620 Ga0105243_100116204 360
2268 3300009176 Ga0105242_10001499 Ga0105242_100014996 360
2269 3300009177 Ga0105248_10007834 Ga0105248_100078348 360
2270 3300009545 Ga0105237_10010598 Ga0105237_100105986 360
2271 3300009553 Ga0105249_10007064 Ga0105249_100070645 360
2272 3300011119 Ga0105246_10002803 Ga0105246_100028033 360
2273 3300011119 Ga0105246_10007983 Ga0105246_100079835 360
2274 3300011119 Ga0105246_10009162 Ga0105246_100091622 360
2275 3300012498 Ga0157345_1000628 Ga0157345_10006281 360
2276 3300012502 Ga0157347_1000415 Ga0157347_10004152 360
2277 3300013100 Ga0157373_10043030 Ga0157373_100430303 360
2278 3300013100 Ga0157373_10178305 Ga0157373_101783051 360
2279 3300013102 Ga0157371_10000162 Ga0157371_1000016289 360
2280 3300013102 Ga0157371_10013168 Ga0157371_100131684 360
2281 3300013102 Ga0157371_10043778 Ga0157371_100437782 360
2282 3300013102 Ga0157371_10165556 Ga0157371_101655561 360
2283 3300013104 Ga0157370_10063716 Ga0157370_100637163 360
2284 3300013104 Ga0157370_10112745 Ga0157370_101127452 360
2285 3300013105 Ga0157369_10030463 Ga0157369_100304633 360
2286 3300013105 Ga0157369_10055802 Ga0157369_100558023 360
2287 3300013306 Ga0163162_10030569 Ga0163162_100305693 360
2288 3300013307 Ga0157372_10067862 Ga0157372_100678623 360
2289 3300014497 Ga0182008_10006484 Ga0182008_100064843 360
2290 3300014497 Ga0182008_10029815 Ga0182008_100298151 360
2291 3300014497 Ga0182008_10032915 Ga0182008_100329151 360
2292 3300014497 Ga0182008_10037407 Ga0182008_100374072 360
2293 3300014497 Ga0182008_10055382 Ga0182008_100553821 360
2294 3300015261 Ga0182006_1012007 Ga0182006_10120072 360
2295 3300015261 Ga0182006_1016596 Ga0182006_10165962 360
2296 3300015261 Ga0182006_1019954 Ga0182006_10199542 360
2297 3300015261 Ga0182006_1023774 Ga0182006_10237742 360
2298 3300017792 Ga0163161_10071145 Ga0163161_100711451 360
2299 3300017792 Ga0163161_10102782 Ga0163161_101027822 360
2300 3300025206 Ga0209435_100764 Ga0209435_1007644 360
2301 3300025224 Ga0209784_100007 Ga0209784_100007392 360
2302 3300025225 Ga0209566_100009 Ga0209566_100009392 360
2303 3300025226 Ga0209674_100021 Ga0209674_100021392 360
2304 3300025226 Ga0209674_100024 Ga0209674_100024122 360
2305 3300025229 Ga0209147_100009 Ga0209147_100009392 360
2306 3300025230 Ga0209563_100018 Ga0209563_100018392 360
2307 3300025230 Ga0209563_100069 Ga0209563_100069122 360
2308 3300025230 Ga0209563_101931 Ga0209563_1019313 360
2309 3300025231 Ga0207427_100303 Ga0207427_1003037 360
2310 3300025233 Ga0209437_101479 Ga0209437_1014793 360
2311 3300025242 Ga0209258_100169 Ga0209258_10016992 360
2312 3300025242 Ga0209258_100456 Ga0209258_10045616 360
2313 3300025246 Ga0209646_1000012 Ga0209646_1000012380 360
2314 3300025246 Ga0209646_1000184 Ga0209646_10001848 360
2315 3300025250 Ga0209026_1000004 Ga0209026_1000004240 360
2316 3300025253 Ga0209677_100012 Ga0209677_100012392 360
2317 3300025253 Ga0209677_100048 Ga0209677_10004811 360
2318 3300025253 Ga0209677_100232 Ga0209677_10023218 360
2319 3300025256 Ga0209759_1000003 Ga0209759_1000003488 360
2320 3300025292 Ga0209676_1000015 Ga0209676_1000015422 360
2321 3300025292 Ga0209676_1000030 Ga0209676_1000030257 360
2322 3300025292 Ga0209676_1000041 Ga0209676_1000041183 360
2323 3300025292 Ga0209676_1007365 Ga0209676_10073652 360
2324 3300025298 Ga0209050_1000030 Ga0209050_100003016 360
2325 3300025298 Ga0209050_1000518 Ga0209050_100051846 360
2326 3300025298 Ga0209050_1000647 Ga0209050_100064714 360
2327 3300025303 Ga0209051_1000012 Ga0209051_1000012258 360
2328 3300025303 Ga0209051_1000881 Ga0209051_100088125 360
2329 3300025303 Ga0209051_1011455 Ga0209051_10114552 360
2330 3300025304 Ga0209257_1000069 Ga0209257_10000695 360
2331 3300025304 Ga0209257_1026696 Ga0209257_10266961 360
2332 3300025321 Ga0207656_10000006 Ga0207656_1000000676 360
2333 3300025711 Ga0207696_1000031 Ga0207696_1000031222 360
2334 3300025711 Ga0207696_1000105 Ga0207696_10001054 360
2335 3300025711 Ga0207696_1000541 Ga0207696_10005417 360
2336 3300025711 Ga0207696_1000902 Ga0207696_100090218 360
2337 3300025711 Ga0207696_1006588 Ga0207696_10065881 360
2338 3300025711 Ga0207696_1018949 Ga0207696_10189492 360
2339 3300025728 Ga0207655_1000014 Ga0207655_1000014422 360
2340 3300025728 Ga0207655_1000202 Ga0207655_100020253 360
2341 3300025728 Ga0207655_1000388 Ga0207655_100038852 360
2342 3300025728 Ga0207655_1009633 Ga0207655_10096333 360
2343 3300025728 Ga0207655_1013044 Ga0207655_10130442 360
2344 3300025728 Ga0207655_1016142 Ga0207655_10161422 360
2345 3300025728 Ga0207655_1017975 Ga0207655_10179752 360
2346 3300025728 Ga0207655_1024145 Ga0207655_10241452 360
2347 3300025728 Ga0207655_1047018 Ga0207655_10470182 360
2348 3300025735 Ga0207713_1001506 Ga0207713_10015063 360
2349 3300025735 Ga0207713_1001707 Ga0207713_10017072 360
2350 3300025735 Ga0207713_1003359 Ga0207713_10033598 360
2351 3300025735 Ga0207713_1006013 Ga0207713_10060132 360
2352 3300025735 Ga0207713_1007874 Ga0207713_10078743 360
2353 3300025735 Ga0207713_1017229 Ga0207713_10172292 360
2354 3300025735 Ga0207713_1042048 Ga0207713_10420482 360
2355 3300025735 Ga0207713_1068035 Ga0207713_10680351 360
2356 3300025735 Ga0207713_1068036 Ga0207713_10680361 360
2357 3300025909 Ga0207705_10049526 Ga0207705_100495262 360
2358 3300025913 Ga0207695_10018901 Ga0207695_100189015 360
2359 3300025913 Ga0207695_10027028 Ga0207695_100270285 360
2360 3300025914 Ga0207671_10000131 Ga0207671_1000013130 360
2361 3300025914 Ga0207671_10055068 Ga0207671_100550682 360
2362 3300025920 Ga0207649_10000012 Ga0207649_1000001295 360
2363 3300025923 Ga0207681_10000099 Ga0207681_1000009948 360
2364 3300025923 Ga0207681_10008578 Ga0207681_100085783 360
2365 3300025925 Ga0207650_10000157 Ga0207650_1000015777 360
2366 3300025925 Ga0207650_10000185 Ga0207650_1000018565 360
2367 3300025927 Ga0207687_10357830 Ga0207687_103578301 360
2368 3300025933 Ga0207706_10001069 Ga0207706_100010693 360
2369 3300025933 Ga0207706_10047830 Ga0207706_100478302 360
2370 3300025934 Ga0207686_10000319 Ga0207686_1000031918 360
2371 3300025934 Ga0207686_10048050 Ga0207686_100480501 360
2372 3300025935 Ga0207709_10000071 Ga0207709_1000007134 360
2373 3300025935 Ga0207709_10000337 Ga0207709_1000033743 360
2374 3300025935 Ga0207709_10010923 Ga0207709_100109232 360
2375 3300025935 Ga0207709_10013313 Ga0207709_100133133 360
2376 3300025935 Ga0207709_10250329 Ga0207709_102503291 360
2377 3300025942 Ga0207689_10017839 Ga0207689_100178391 360
2378 3300025945 Ga0207679_10000015 Ga0207679_1000001595 360
2379 3300025945 Ga0207679_10074449 Ga0207679_100744492 360
2380 3300025949 Ga0207667_10103685 Ga0207667_101036852 360
2381 3300025961 Ga0207712_10004516 Ga0207712_100045165 360
2382 3300025981 Ga0207640_10005343 Ga0207640_100053435 360
2383 3300026041 Ga0207639_10000775 Ga0207639_1000077518 360
2384 3300026078 Ga0207702_10000253 Ga0207702_1000025358 360
2385 3300026116 Ga0207674_10118327 Ga0207674_101183271 360
2386 3300027111 Ga0209281_1000016 Ga0209281_1000016301 360
2387 3300027111 Ga0209281_1000019 Ga0209281_1000019235 360
2388 3300027111 Ga0209281_1001944 Ga0209281_10019444 360
2389 3300027907 Ga0207428_10115673 Ga0207428_101156732 360
2390 3300028379 Ga0268266_10060264 Ga0268266_100602642 360
2391 3300028379 Ga0268266_10156704 Ga0268266_101567042 360
2392 3300030500 Ga0268256_1000050 Ga0268256_1000050116 360
2393 3300030521 Ga0307511_10066924 Ga0307511_100669241 360
2394 3300030733 Ga0314311_1099326 Ga0314311_10993264 360
2395 3300030735 Ga0316178_1008333 Ga0316178_10083335 360
2396 3300030744 Ga0316181_1037347 Ga0316181_10373472 360
2397 3300031548 Ga0307408_100022947 Ga0307408_1000229473 360
2398 3300031548 Ga0307408_100027281 Ga0307408_1000272813 360
2399 3300031548 Ga0307408_100031929 Ga0307408_1000319291 360
2400 3300031548 Ga0307408_100070276 Ga0307408_1000702761 360
2401 3300031730 Ga0307516_10068537 Ga0307516_100685372 360
2402 3300031730 Ga0307516_10178855 Ga0307516_101788552 360
2403 3300031731 Ga0307405_10037461 Ga0307405_100374612 360
2404 3300031731 Ga0307405_10092485 Ga0307405_100924851 360
2405 3300031731 Ga0307405_10128733 Ga0307405_101287332 360
2406 3300031824 Ga0307413_10023143 Ga0307413_100231432 360
2407 3300031901 Ga0307406_10067092 Ga0307406_100670921 360
2408 3300031901 Ga0307406_10096106 Ga0307406_100961062 360
2409 3300031903 Ga0307407_10021661 Ga0307407_100216612 360
2410 3300031903 Ga0307407_10141511 Ga0307407_101415111 360
2411 3300031911 Ga0307412_10016127 Ga0307412_100161273 360
2412 3300031911 Ga0307412_10039128 Ga0307412_100391282 360
2413 3300032004 Ga0307414_10016650 Ga0307414_100166503 360
2414 3300032005 Ga0307411_10033211 Ga0307411_100332113 360
2415 3300032005 Ga0307411_10216930 Ga0307411_102169301 360
2416 3300033180 Ga0307510_10174285 Ga0307510_101742851 360
2417 3300038705 Ga0237819_01098 Ga0237819_01098_4231_5340 360
2418 3300039447 Ga0436361_0243524 Ga0436361_0243524_156_1325 360
2419 3300041405 Ga0439438_004878 Ga0439438_004878_3679_4791 360
2420 3300041405 Ga0439438_006392 Ga0439438_006392_2076_3278 360
2421 3300041405 Ga0439438_006392 Ga0439438_006392_790_1872 360
2422 3300041407 Ga0439447_003423 Ga0439447_003423_2249_3361 360
2423 3300041407 Ga0439447_003817 Ga0439447_003817_2282_3394 360
2424 3300041407 Ga0439447_008152 Ga0439447_008152_2127_3239 360
2425 3300041411 Ga0439466_0000466 Ga0439466_0000466_4030_5142 360
2426 3300041411 Ga0439466_0002245 Ga0439466_0002245_3504_4616 360
2427 3300041411 Ga0439466_0003958 Ga0439466_0003958_2323_3435 360
2428 3300041411 Ga0439466_0013317 Ga0439466_0013317_1624_2706 360
2429 3300041411 Ga0439466_0042605 Ga0439466_0042605_26_1138 360
2430 3300042006 Ga0439432_001621 Ga0439432_001621_4074_5186 360
2431 3300042006 Ga0439432_037495 Ga0439432_037495_138_1250 360
2432 3300042009 Ga0439451_001456 Ga0439451_001456_2963_4075 360
2433 3300042009 Ga0439451_003084 Ga0439451_003084_1253_2365 360
2434 3300042009 Ga0439451_020102 Ga0439451_020102_177_1289 360
2435 3300042010 Ga0439452_000592 Ga0439452_000592_621_1703 360
2436 3300042010 Ga0439452_003753 Ga0439452_003753_1583_2695 360
2437 3300042010 Ga0439452_004104 Ga0439452_004104_1467_2579 360
2438 3300042010 Ga0439452_004757 Ga0439452_004757_1094_2206 360
2439 3300042010 Ga0439452_007409 Ga0439452_007409_274_1386 360
2440 3300042010 Ga0439452_011662 Ga0439452_011662_1001_2113 360
2441 3300042013 Ga0439456_015616 Ga0439456_015616_305_1417 360
2442 3300042016 Ga0439463_002378 Ga0439463_002378_467_1579 360
2443 3300042115 Ga0450911_002622 Ga0450911_002622_1588_2700 360
2444 3300042115 Ga0450911_003135 Ga0450911_003135_918_2030 360
2445 3300042127 Ga0450890_000509 Ga0450890_000509_2301_3413 360
2446 3300042137 Ga0450902_003775 Ga0450902_003775_172_1284 360
2447 3300042145 Ga0450906_001379 Ga0450906_001379_3254_4366 360
2448 3300042146 Ga0450907_001254 Ga0450907_001254_2043_3155 360
2449 3300042146 Ga0450907_001751 Ga0450907_001751_2466_3578 360
2450 3300042146 Ga0450907_004826 Ga0450907_004826_797_1879 360
2451 3300042156 Ga0439446_0006254 Ga0439446_0006254_892_1974 360
2452 3300042184 Ga0450908_003622 Ga0450908_003622_1800_2882 360
2453 3300042184 Ga0450908_003622 Ga0450908_003622_394_1596 360
2454 3300042435 Ga0439434_0003416 Ga0439434_0003416_2076_3188 360
2455 3300042461 Ga0439460_0000875 Ga0439460_0000875_2054_3166 360
2456 3300042461 Ga0439460_0006176 Ga0439460_0006176_722_1924 360
2457 3300042993 Ga0439440_0008256 Ga0439440_0008256_868_1980 360
2458 3300042993 Ga0439440_0018048 Ga0439440_0018048_151_1233 360
2459 3300046452 Ga0495617_014034 Ga0495617_014034_731_1933 360
2460 3300046452 Ga0495617_024452 Ga0495617_024452_123_1235 360
2461 3300046452 Ga0495617_046184 Ga0495617_046184_93_1202 360
2462 3300046453 Ga0495627_014046 Ga0495627_014046_1525_2637 360
2463 3300046453 Ga0495627_022656 Ga0495627_022656_303_1412 360
2464 3300046454 Ga0495592_0137254 Ga0495592_0137254_220_1329 360
2465 3300046455 Ga0495603_0153418 Ga0495603_0153418_130_1242 360
2466 3300046457 Ga0495590_0025192 Ga0495590_0025192_577_1689 360
2467 3300046457 Ga0495590_0056214 Ga0495590_0056214_115_1224 360
2468 3300046458 Ga0495591_004959 Ga0495591_004959_3662_4774 360
2469 3300046458 Ga0495591_015032 Ga0495591_015032_529_1638 360
2470 3300046460 Ga0495638_0037952 Ga0495638_0037952_508_1620 360
2471 3300046460 Ga0495638_0044398 Ga0495638_0044398_1270_2382 360
2472 3300046463 Ga0495653_0022923 Ga0495653_0022923_3614_4726 360
2473 3300046463 Ga0495653_0048713 Ga0495653_0048713_1826_2935 360
2474 3300046463 Ga0495653_0067297 Ga0495653_0067297_1465_2577 360
2475 3300046463 Ga0495653_0111731 Ga0495653_0111731_343_1452 360
2476 3300046471 Ga0495650_0015211 Ga0495650_0015211_1920_3032 360
2477 3300046474 Ga0495605_0027479 Ga0495605_0027479_1703_2815 360
2478 3300046474 Ga0495605_0027696 Ga0495605_0027696_985_2187 360
2479 3300046474 Ga0495605_0095699 Ga0495605_0095699_153_1235 360
2480 3300046475 Ga0495639_0015202 Ga0495639_0015202_16_1098 360
2481 3300046491 Ga0495584_0009566 Ga0495584_0009566_2033_3145 360
2482 3300046491 Ga0495584_0012700 Ga0495584_0012700_1877_2989 360
2483 3300046491 Ga0495584_0015742 Ga0495584_0015742_2173_3285 360
2484 3300046491 Ga0495584_0020473 Ga0495584_0020473_2184_3266 360
2485 3300046491 Ga0495584_0020473 Ga0495584_0020473_869_1981 360
2486 3300046491 Ga0495584_0054801 Ga0495584_0054801_38_1150 360
2487 3300046491 Ga0495584_0107262 Ga0495584_0107262_230_1339 360
2488 3300046492 Ga0495585_0010687 Ga0495585_0010687_3660_4772 360
2489 3300046492 Ga0495585_0025626 Ga0495585_0025626_2054_3166 360
2490 3300046492 Ga0495585_0028569 Ga0495585_0028569_1992_3104 360
2491 3300046492 Ga0495585_0032083 Ga0495585_0032083_1407_2519 360
2492 3300046492 Ga0495585_0094590 Ga0495585_0094590_482_1594 360
2493 3300046492 Ga0495585_0100931 Ga0495585_0100931_12_1124 360
2494 3300046499 Ga0495594_0086633 Ga0495594_0086633_382_1494 360
2495 3300046500 Ga0495596_0004395 Ga0495596_0004395_2105_3217 360
2496 3300046501 Ga0495607_0024248 Ga0495607_0024248_1499_2611 360
2497 3300046501 Ga0495607_0025959 Ga0495607_0025959_705_1817 360
2498 3300046501 Ga0495607_0037662 Ga0495607_0037662_397_1509 360
2499 3300046501 Ga0495607_0045134 Ga0495607_0045134_1426_2538 360
2500 3300046501 Ga0495607_0064247 Ga0495607_0064247_349_1461 360
2501 3300046501 Ga0495607_0072460 Ga0495607_0072460_657_1766 360
2502 3300046501 Ga0495607_0078102 Ga0495607_0078102_80_1192 360
2503 3300046506 Ga0495583_0000018 Ga0495583_0000018_4434_5552 360
2504 3300046506 Ga0495583_0013180 Ga0495583_0013180_2329_3441 360
2505 3300046507 Ga0495606_0000870 Ga0495606_0000870_3916_5034 360
2506 3300046507 Ga0495606_0018166 Ga0495606_0018166_2274_3386 360
2507 3300046507 Ga0495606_0027999 Ga0495606_0027999_744_1856 360
2508 3300046507 Ga0495606_0043525 Ga0495606_0043525_604_1713 360
2509 3300046507 Ga0495606_0047295 Ga0495606_0047295_464_1573 360
2510 3300046507 Ga0495606_0053925 Ga0495606_0053925_174_1286 360
2511 3300046513 Ga0495616_0030952 Ga0495616_0030952_1423_2535 360
2512 3300046513 Ga0495616_0032179 Ga0495616_0032179_339_1448 360
2513 3300046513 Ga0495616_0041414 Ga0495616_0041414_250_1362 360
2514 3300046513 Ga0495616_0079499 Ga0495616_0079499_11_1123 360
2515 3300046515 Ga0495620_0014267 Ga0495620_0014267_2379_3491 360
2516 3300046515 Ga0495620_0021445 Ga0495620_0021445_891_2003 360
2517 3300046515 Ga0495620_0021774 Ga0495620_0021774_93_1205 360
2518 3300046518 Ga0495631_0004242 Ga0495631_0004242_3667_4779 360
2519 3300046519 Ga0495632_0022095 Ga0495632_0022095_1694_2806 360
2520 3300046519 Ga0495632_0043632 Ga0495632_0043632_378_1487 360
2521 3300046519 Ga0495632_0081149 Ga0495632_0081149_208_1317 360
2522 3300046520 Ga0495637_0005947 Ga0495637_0005947_2081_3193 360
2523 3300046520 Ga0495637_0015531 Ga0495637_0015531_2281_3393 360
2524 3300046520 Ga0495637_0023917 Ga0495637_0023917_1186_2295 360
2525 3300046520 Ga0495637_0024971 Ga0495637_0024971_743_1855 360
2526 3300046520 Ga0495637_0026881 Ga0495637_0026881_1449_2561 360
2527 3300046520 Ga0495637_0046376 Ga0495637_0046376_164_1273 360
2528 3300046522 Ga0495643_0033048 Ga0495643_0033048_1512_2624 360
2529 3300046523 Ga0495644_0011302 Ga0495644_0011302_1445_2557 360
2530 3300046523 Ga0495644_0013763 Ga0495644_0013763_573_1685 360
2531 3300046523 Ga0495644_0029586 Ga0495644_0029586_407_1516 360
2532 3300046524 Ga0495648_0022735 Ga0495648_0022735_2108_3220 360
2533 3300046524 Ga0495648_0029830 Ga0495648_0029830_1454_2566 360
2534 3300046524 Ga0495648_0030158 Ga0495648_0030158_239_1351 360
2535 3300046524 Ga0495648_0037236 Ga0495648_0037236_846_1958 360
2536 3300046524 Ga0495648_0084817 Ga0495648_0084817_89_1201 360
2537 3300046524 Ga0495648_0115655 Ga0495648_0115655_126_1208 360
2538 3300046528 Ga0495642_0000631 Ga0495642_0000631_12960_14042 360
2539 3300046528 Ga0495642_0000631 Ga0495642_0000631_14246_15448 360
2540 3300046528 Ga0495642_0012032 Ga0495642_0012032_1368_2480 360
2541 3300046530 Ga0495654_0015523 Ga0495654_0015523_984_2096 360
2542 3300046530 Ga0495654_0015833 Ga0495654_0015833_2072_3184 360
2543 3300046530 Ga0495654_0021575 Ga0495654_0021575_1578_2690 360
2544 3300046530 Ga0495654_0043164 Ga0495654_0043164_909_2018 360
2545 3300046530 Ga0495654_0073951 Ga0495654_0073951_13_1125 360
2546 3300046530 Ga0495654_0076462 Ga0495654_0076462_285_1397 360
2547 3300046536 Ga0495587_0007618 Ga0495587_0007618_5534_6616 360
2548 3300046538 Ga0495609_0042360 Ga0495609_0042360_454_1566 360
2549 3300046538 Ga0495609_0064848 Ga0495609_0064848_17_1129 360
2550 3300046542 Ga0495597_0039743 Ga0495597_0039743_819_1928 360
2551 3300046557 Ga0495622_0021988 Ga0495622_0021988_304_1416 360
2552 3300046557 Ga0495622_0027108 Ga0495622_0027108_684_1796 360
2553 3300046558 Ga0495633_0021030 Ga0495633_0021030_865_1977 360
2554 3300046615 Ga0495656_0003150 Ga0495656_0003150_2684_3796 360
2555 3300046616 Ga0495668_0017608 Ga0495668_0017608_918_2030 360
2556 3300046642 Ga0495634_0019357 Ga0495634_0019357_2317_3429 360
2557 3300046660 Ga0495625_0023162 Ga0495625_0023162_154_1272 360
2558 3300046660 Ga0495625_0067465 Ga0495625_0067465_1313_2425 360
2559 3300046660 Ga0495625_0084474 Ga0495625_0084474_855_1967 360
2560 3300046660 Ga0495625_0120513 Ga0495625_0120513_316_1428 360
2561 3300046660 Ga0495625_0124201 Ga0495625_0124201_549_1658 360
2562 3300046663 Ga0495635_0020678 Ga0495635_0020678_1362_2474 360
2563 3300046663 Ga0495635_0020678 Ga0495635_0020678_76_1158 360
2564 3300046665 Ga0495661_0019070 Ga0495661_0019070_2506_3615 360
2565 3300046665 Ga0495661_0050682 Ga0495661_0050682_595_1704 360
2566 3300046674 Ga0495588_0022122 Ga0495588_0022122_1208_2320 360
2567 3300046679 Ga0495623_0022811 Ga0495623_0022811_2061_3173 360
2568 3300046679 Ga0495623_0042377 Ga0495623_0042377_1283_2395 360
2569 3300046680 Ga0495646_0092638 Ga0495646_0092638_302_1411 360
2570 3300046684 Ga0495669_0022338 Ga0495669_0022338_833_1951 360
2571 3300046684 Ga0495669_0048523 Ga0495669_0048523_276_1388 360
2572 3300046689 Ga0495613_0141974 Ga0495613_0141974_284_1393 360
2573 3300046689 Ga0495613_0170065 Ga0495613_0170065_401_1510 360
2574 3300046690 Ga0495624_0078701 Ga0495624_0078701_593_1702 360
2575 3300046691 Ga0495670_0019432 Ga0495670_0019432_774_1883 360
2576 3300046691 Ga0495670_0052903 Ga0495670_0052903_196_1308 360
2577 3300046692 Ga0495671_0014734 Ga0495671_0014734_2009_3121 360
2578 3300046692 Ga0495671_0014734 Ga0495671_0014734_724_1806 360
2579 3300046692 Ga0495671_0018334 Ga0495671_0018334_1445_2557 360
2580 3300046692 Ga0495671_0022432 Ga0495671_0022432_1369_2478 360
2581 3300046692 Ga0495671_0027626 Ga0495671_0027626_1390_2502 360
2582 3300046692 Ga0495671_0027626 Ga0495671_0027626_47_1129 360
2583 3300046692 Ga0495671_0049292 Ga0495671_0049292_74_1186 360
2584 3300046694 Ga0495649_0000107 Ga0495649_0000107_52201_53319 360
2585 3300046694 Ga0495649_0023432 Ga0495649_0023432_1911_3023 360
2586 3300046694 Ga0495649_0049014 Ga0495649_0049014_454_1566 360
2587 3300046794 Ga0495589_0024440 Ga0495589_0024440_99_1217 360
2588 3300046794 Ga0495589_0026631 Ga0495589_0026631_1497_2609 360
2589 3300046809 Ga0495600_0092764 Ga0495600_0092764_334_1443 360
2590 3300046810 Ga0495660_0036242 Ga0495660_0036242_1429_2541 360
2591 3300046810 Ga0495660_0039445 Ga0495660_0039445_761_1870 360
2592 3300046810 Ga0495660_0079343 Ga0495660_0079343_508_1590 360
2593 3300046810 Ga0495660_0111576 Ga0495660_0111576_22_1134 360
2594 3300047315 Ga0495581_0025764 Ga0495581_0025764_2185_3267 360
2595 3300047317 Ga0495604_0050010 Ga0495604_0050010_1313_2425 360
2596 3300047317 Ga0495604_0127862 Ga0495604_0127862_392_1501 360
2597 3300047318 Ga0495636_0040808 Ga0495636_0040808_668_1780 360
2598 3300047319 Ga0495674_0118139 Ga0495674_0118139_601_1713 360
2599 3300047320 Ga0495672_0021245 Ga0495672_0021245_1251_2363 360
2600 3300047320 Ga0495672_0027088 Ga0495672_0027088_632_1744 360
2601 3300047320 Ga0495672_0028318 Ga0495672_0028318_1251_2453 360
2602 3300047320 Ga0495672_0032463 Ga0495672_0032463_2116_3228 360
2603 3300047320 Ga0495672_0039727 Ga0495672_0039727_1012_2124 360
2604 3300047320 Ga0495672_0044741 Ga0495672_0044741_1052_2161 360
2605 3300047320 Ga0495672_0065055 Ga0495672_0065055_615_1724 360
2606 3300047320 Ga0495672_0096138 Ga0495672_0096138_48_1160 360
2607 3300047321 Ga0495676_0040008 Ga0495676_0040008_2405_3514 360
2608 3300047321 Ga0495676_0190525 Ga0495676_0190525_151_1260 360
2609 3300047322 Ga0495680_0048211 Ga0495680_0048211_1370_2482 360
2610 3300047323 Ga0495683_0007048 Ga0495683_0007048_3658_4770 360
2611 3300047323 Ga0495683_0008997 Ga0495683_0008997_2157_3269 360
2612 3300047323 Ga0495683_0021909 Ga0495683_0021909_1596_2708 360
2613 3300047445 Ga0495677_0028517 Ga0495677_0028517_722_1834 360
2614 3300047446 Ga0495679_000482 Ga0495679_000482_26432_27523 360
2615 3300047469 Ga0495673_0007829 Ga0495673_0007829_3663_4775 360
2616 3300047469 Ga0495673_0015631 Ga0495673_0015631_1016_2128 360
2617 3300047469 Ga0495673_0021205 Ga0495673_0021205_722_1834 360
2618 3300047469 Ga0495673_0029934 Ga0495673_0029934_625_1734 360
2619 3300047469 Ga0495673_0038250 Ga0495673_0038250_584_1696 360
2620 3300047469 Ga0495673_0070722 Ga0495673_0070722_211_1323 360
2621 3300047469 Ga0495673_0076183 Ga0495673_0076183_32_1141 360
2622 3300047469 Ga0495673_0102147 Ga0495673_0102147_17_1099 360
2623 3300047470 Ga0495681_0012867 Ga0495681_0012867_148_1230 360
2624 3300047470 Ga0495681_0018926 Ga0495681_0018926_1904_3016 360
2625 3300047470 Ga0495681_0022189 Ga0495681_0022189_1377_2489 360
2626 3300047470 Ga0495681_0022796 Ga0495681_0022796_974_2086 360
2627 3300047470 Ga0495681_0028260 Ga0495681_0028260_1011_2120 360
2628 3300047470 Ga0495681_0037106 Ga0495681_0037106_956_2068 360
2629 3300047471 Ga0495684_0060720 Ga0495684_0060720_476_1588 360
2630 3300047471 Ga0495684_0234970 Ga0495684_0234970_160_1269 360
2631 3300047472 Ga0495686_0034862 Ga0495686_0034862_611_1723 360
2632 3300047472 Ga0495686_0089654 Ga0495686_0089654_465_1574 360
2633 3300047673 Ga0495593_0014851 Ga0495593_0014851_190_1302 360
2634 3300047673 Ga0495593_0041936 Ga0495593_0041936_433_1545 360
2635 3300047673 Ga0495593_0064136 Ga0495593_0064136_372_1481 360
2636 3300048088 Ga0495602_0157704 Ga0495602_0157704_302_1411 360
2637 3300048091 Ga0495626_0005680 Ga0495626_0005680_4171_5253 360
2638 3300048091 Ga0495626_0007093 Ga0495626_0007093_3434_4546 360
2639 3300048091 Ga0495626_0008893 Ga0495626_0008893_2296_3408 360
2640 3300048091 Ga0495626_0024603 Ga0495626_0024603_652_1764 360
2641 3300048091 Ga0495626_0061484 Ga0495626_0061484_117_1199 360
2642 3300048905 Ga0496102_0026312 Ga0496102_0026312_1465_2577 360
2643 3300048906 Ga0496103_0026858 Ga0496103_0026858_1434_2546 360
2644 3300048909 Ga0496106_0288858 Ga0496106_0288858_117_1199 360
2645 3300048917 Ga0496114_0231185 Ga0496114_0231185_279_1391 360
2646 3300048919 Ga0496116_0008830 Ga0496116_0008830_3485_4597 360
2647 3300048919 Ga0496116_0018636 Ga0496116_0018636_2661_3770 360
2648 3300048919 Ga0496116_0044478 Ga0496116_0044478_1473_2582 360
2649 3300048919 Ga0496116_0096804 Ga0496116_0096804_355_1464 360
2650 3300048920 Ga0496117_0025481 Ga0496117_0025481_2107_3216 360
2651 3300048920 Ga0496117_0113845 Ga0496117_0113845_460_1569 360
2652 3300048920 Ga0496117_0115773 Ga0496117_0115773_466_1575 360
2653 3300048920 Ga0496117_0150264 Ga0496117_0150264_136_1218 360
2654 3300048921 Ga0496118_0089826 Ga0496118_0089826_382_1491 360
2655 3300048921 Ga0496118_0104783 Ga0496118_0104783_136_1218 360
2656 3300048921 Ga0496118_0105960 Ga0496118_0105960_479_1588 360
2657 3300048922 Ga0496119_0122633 Ga0496119_0122633_286_1395 360
2658 3300048922 Ga0496119_0169704 Ga0496119_0169704_32_1141 360
2659 3300048924 Ga0496121_0083015 Ga0496121_0083015_864_1976 360
2660 3300048924 Ga0496121_0103123 Ga0496121_0103123_542_1624 360
2661 3300048924 Ga0496121_0142522 Ga0496121_0142522_354_1463 360
2662 3300048925 Ga0496122_0117185 Ga0496122_0117185_149_1258 360
2663 3300048926 Ga0496123_0088936 Ga0496123_0088936_465_1574 360
2664 3300048927 Ga0496124_0043552 Ga0496124_0043552_2014_3126 360
2665 3300048927 Ga0496124_0067679 Ga0496124_0067679_1142_2251 360
2666 3300048927 Ga0496124_0120638 Ga0496124_0120638_414_1523 360
2667 3300048927 Ga0496124_0128685 Ga0496124_0128685_841_1923 360
2668 3300048928 Ga0496125_0040602 Ga0496125_0040602_1447_2556 360
2669 3300048928 Ga0496125_0051779 Ga0496125_0051779_803_1912 360
2670 3300048928 Ga0496125_0056938 Ga0496125_0056938_1155_2267 360
2671 3300048928 Ga0496125_0130265 Ga0496125_0130265_396_1505 360
2672 3300048928 Ga0496125_0130919 Ga0496125_0130919_170_1252 360
2673 3300048929 Ga0496126_0110833 Ga0496126_0110833_573_1685 360
2674 3300049459 Ga0495678_018021 Ga0495678_018021_2054_3166 360
2675 3300049459 Ga0495678_018168 Ga0495678_018168_1138_2250 360
2676 3300049459 Ga0495678_031421 Ga0495678_031421_357_1469 360
2677 3300049459 Ga0495678_041091 Ga0495678_041091_421_1530 360
2678 3300049459 Ga0495678_042169 Ga0495678_042169_575_1657 360
2679 3300049460 Ga0495682_0015357 Ga0495682_0015357_765_1877 360
2680 3300049460 Ga0495682_0024581 Ga0495682_0024581_977_2086 360
2681 3300049460 Ga0495682_0055348 Ga0495682_0055348_28_1140 360
2682 3300049662 Ga0501222_005457 Ga0501222_005457_429_1541 360
2683 3300049665 Ga0501227_021756 Ga0501227_021756_208_1320 360
2684 3300049766 Ga0501269_007525 Ga0501269_007525_137_1249 360
2685 3300050493 nmdc:mga0k408_80381_c1 nmdc:mga0k408_80381_c1_253_1428 360
2686 3300053093 Ga0500651_0139549 Ga0500651_0139549_193_1311 360
2687 3300053177 Ga0500636_0123862 Ga0500636_0123862_114_1232 360
2688 iso_pu_bacteria 2511231024 2511377393 360
2689 iso_pu_bacteria 2554235341 2555672823 360
2690 iso_pu_bacteria 2597489889 2597872473 360
2691 iso_pu_bacteria 2599185188 2599500249 360
2692 iso_pu_bacteria 2599185248 2599768163 360
2693 iso_pu_bacteria 2599185288 2599879024 360
2694 iso_pu_bacteria 2599185289 2599885598 360
2695 iso_pu_bacteria 2599185291 2599897312 360
2696 iso_pu_bacteria 2599185300 2599930721 360
2697 iso_pu_bacteria 2599185303 2599951438 360
2698 iso_pu_bacteria 2599185305 2599961900 360
2699 iso_pu_bacteria 2599185306 2599965926 360
2700 iso_pu_bacteria 2599185308 2599980889 360
2701 iso_pu_bacteria 2599185313 2600004326 360
2702 iso_pu_bacteria 2599185314 2600014765 360
2703 iso_pu_bacteria 2599185315 2600020385 360
2704 iso_pu_bacteria 2599185321 2600054937 360
2705 iso_pu_bacteria 2599185324 2600074378 360
2706 iso_pu_bacteria 2619619299 2621296859 360
2707 iso_pu_bacteria 2667528170 2671089538 360
2708 iso_pu_bacteria 2675903420 2677897117 360
2709 iso_pu_bacteria 2738541265 2738671679 360
2710 iso_pu_bacteria 2738541282 2738750073 360
2711 iso_pu_bacteria 2738541294 2738807240 360
2712 iso_pu_bacteria 2738541303 2738859113 360
2713 iso_pu_bacteria 2738541309 2738894600 360
2714 iso_pu_bacteria 2765235841 2765581403 360
2715 iso_pu_bacteria 2791355520 2794593851 360
2716 iso_pu_bacteria 2808606385 2808976136 360
2717 iso_pu_bacteria 2808606388 2808993236 360
2718 iso_pu_bacteria 2816332298 2817494028 360
2719 iso_pu_bacteria 2834028612 2834030937 360
2720 iso_pu_bacteria 2844665904 2844667074 360
2721 iso_pu_bacteria 2852612431 2852616338 360
2722 iso_pu_bacteria 2852667396 2852671306 360
2723 iso_pu_bacteria 2860867994 2860873015 360
2724 iso_pu_bacteria 2908446538 2908452568 360
2725 iso_pu_bacteria 2917070673 2917076719 360
2726 iso_pu_bacteria 2919155634 2919155903 360
2727 iso_pu_bacteria 2929189879 2929195137 360
2728 iso_pu_bacteria 2931390751 2931396397 360
2729 iso_pu_bacteria 2935353572 2935358314 360
2730 iso_pu_bacteria 2945961074 2945966842 360
2731 iso_pu_bacteria 2946006987 2946013299 360
2732 iso_pu_bacteria 2946027586 2946027890 360
2733 iso_pu_bacteria 2984286254 2984286614 360
2734 iso_pu_bacteria 3007395558 3007399411 360
2735 iso_pu_bacteria 3007803356 3007807481 360
2736 iso_pu_bacteria 3007872151 3007876465 360
2737 iso_pu_bacteria 637000220 637323260 360
2738 iso_pu_bacteria 8015687852 8015693601 360
2739 iso_pu_bacteria 8019769354 8019769783 360
2740 iso_pu_bacteria 8052494512 8052494847 360
2741 iso_pu_bacteria 8054285046 8054287910 360
2742 iso_pu_bacteria 8054503363 8054508919 360
2743 iso_pu_bacteria 8054929484 8054930495 360
2744 iso_pu_bacteria 8055817908 8055823888 360
2745 iso_pu_bacteria 8055878733 8055881160 360
2746 iso_pu_bacteria 8056115690 8056116095 360
2747 iso_pu_bacteria 8056120720 8056120956 360
2748 iso_pu_bacteria 8056131705 8056137295 360
2749 iso_pu_bacteria 8056137416 8056137624 360
2750 iso_pu_bacteria 8056161164 8056163619 360
2751 iso_pu_bacteria 8057798959 8057801927 360
2752 3300009036 Ga0105244_10048939 Ga0105244_100489391 361
2753 3300015265 Ga0182005_1003074 Ga0182005_10030745 361
2754 3300035691 Ga0373931_0030359 Ga0373931_0030359_908_2029 361
2755 3300042145 Ga0450906_009937 Ga0450906_009937_172_1455 361
2756 3300042156 Ga0439446_0001826 Ga0439446_0001826_2366_3514 361
2757 3300044694 Ga0466963_0134214 Ga0466963_0134214_348_1487 361
2758 3300049460 Ga0495682_0000150 Ga0495682_0000150_36129_37238 361
2759 3300049853 Ga0501226_000002 Ga0501226_000002_165114_166205 361
2760 3300053177 Ga0500636_0069343 Ga0500636_0069343_480_1619 361
2761 iso_pu_bacteria 2511231004 2511254011 361
2762 iso_pu_bacteria 2511231007 2511272445 361
2763 iso_pu_bacteria 2511231008 2511275104 361
2764 iso_pu_bacteria 2511231010 2511289392 361
2765 iso_pu_bacteria 2511231011 2511297764 361
2766 iso_pu_bacteria 2511231012 2511302828 361
2767 iso_pu_bacteria 2511231014 2511314422 361
2768 iso_pu_bacteria 2511231015 2511317220 361
2769 iso_pu_bacteria 2511231016 2511328022 361
2770 iso_pu_bacteria 2511231017 2511329657 361
2771 iso_pu_bacteria 2511231017 2511333353 361
2772 iso_pu_bacteria 2511231018 2511336846 361
2773 iso_pu_bacteria 2511231019 2511344809 361
2774 iso_pu_bacteria 2511231020 2511349572 361
2775 iso_pu_bacteria 2511231021 2511359300 361
2776 iso_pu_bacteria 2511231022 2511360910 361
2777 iso_pu_bacteria 2511231023 2511370982 361
2778 iso_pu_bacteria 2511231031 2511413478 361
2779 iso_pu_bacteria 2511231156 2511827622 361
2780 iso_pu_bacteria 2600255318 2601798573 361
2781 iso_pu_bacteria 2603880185 2606077467 361
2782 iso_pu_bacteria 2603880199 2606129287 361
2783 iso_pu_bacteria 2623620443 2624483399 361
2784 iso_pu_bacteria 2623620446 2624494919 361
2785 iso_pu_bacteria 2643221565 2643842950 361
2786 iso_pu_bacteria 2643221589 2643955647 361
2787 iso_pu_bacteria 2643221602 2644020441 361
2788 iso_pu_bacteria 2643221633 2644184497 361
2789 iso_pu_bacteria 2643221650 2644283241 361
2790 iso_pu_bacteria 2651869719 2652544921 361
2791 iso_pu_bacteria 2713897148 2715749844 361
2792 iso_pu_bacteria 2713897149 2715754860 361
2793 iso_pu_bacteria 2738543004 2739199045 361
2794 iso_pu_bacteria 2738543015 2739258986 361
2795 iso_pu_bacteria 2738543025 2739312519 361
2796 iso_pu_bacteria 2773857670 2774118391 361
2797 iso_pu_bacteria 2773857673 2774135581 361
2798 iso_pu_bacteria 2784132063 2784261832 361
2799 iso_pu_bacteria 2784132072 2784313561 361
2800 iso_pu_bacteria 2791355520 2794593852 361
2801 iso_pu_bacteria 2808606361 2808855708 361
2802 iso_pu_bacteria 2808606376 2808926497 361
2803 iso_pu_bacteria 2808606377 2808928456 361
2804 iso_pu_bacteria 2808606378 2808935455 361
2805 iso_pu_bacteria 2808606380 2808948658 361
2806 iso_pu_bacteria 2808606381 2808950361 361
2807 iso_pu_bacteria 2808606382 2808959857 361
2808 iso_pu_bacteria 2808606383 2808964063 361
2809 iso_pu_bacteria 2808606389 2808999101 361
2810 iso_pu_bacteria 2808606445 2809217172 361
2811 iso_pu_bacteria 2818991456 2819655117 361
2812 iso_pu_bacteria 2842832357 2842833447 361
2813 iso_pu_bacteria 2842843487 2842845677 361
2814 iso_pu_bacteria 2842854478 2842855608 361
2815 iso_pu_bacteria 2852657418 2852659664 361
2816 iso_pu_bacteria 2860339153 2860341700 361
2817 iso_pu_bacteria 2878029506 2878035341 361
2818 iso_pu_bacteria 2880230671 2880235982 361
2819 iso_pu_bacteria 2904518522 2904518970 361
2820 iso_pu_bacteria 2904550169 2904551341 361
2821 iso_pu_bacteria 2919063839 2919065530 361
2822 iso_pu_bacteria 2919385768 2919389202 361
2823 iso_pu_bacteria 2919456309 2919457534 361
2824 iso_pu_bacteria 2919487758 2919488179 361
2825 iso_pu_bacteria 2919497567 2919498668 361
2826 iso_pu_bacteria 2919697872 2919700589 361
2827 iso_pu_bacteria 2929144301 2929149907 361
2828 iso_pu_bacteria 2931396565 2931398065 361
2829 iso_pu_bacteria 2939636861 2939640818 361
2830 iso_pu_bacteria 2969304461 2969310161 361
2831 iso_pu_bacteria 2998139840 2998145384 361
2832 iso_pu_bacteria 3007511990 3007517165 361
2833 iso_pu_bacteria 3007614139 3007618518 361
2834 iso_pu_bacteria 3007619802 3007622509 361
2835 iso_pu_bacteria 3007718800 3007721742 361
2836 iso_pu_bacteria 3007855910 3007859179 361
2837 iso_pu_bacteria 3007861166 3007865115 361
2838 iso_pu_bacteria 3007866637 3007866792 361
2839 iso_pu_bacteria 8019775933 8019777696 361
2840 iso_pu_bacteria 8029995093 8029995517 361
2841 iso_pu_bacteria 8056125926 8056131591 361
2842 iso_pu_bacteria 8056143049 8056148757 361
2843 iso_pu_bacteria 8056155041 8056160838 361
2844 iso_pu_bacteria 8056166840 8056171320 361
2845 iso_pu_bacteria 8056172158 8056177422 361
2846 iso_pu_bacteria 8056177738 8056181986 361
2847 iso_pu_bacteria 8056569372 8056570452 361
2848 3300009011 Ga0105251_10019600 Ga0105251_100196003 362
2849 3300037471 Ga0395905_0000427 Ga0395905_0000427_25061_26233 362
2850 3300031548 Ga0307408_100000002 Ga0307408_100000002399 363
2851 3300042000 Ga0439437_000505 Ga0439437_000505_1688_2782 363
2852 3300042006 Ga0439432_004689 Ga0439432_004689_3216_4499 363
2853 3300042439 Ga0439464_0002231 Ga0439464_0002231_642_1733 363
2854 3300049569 Ga0501032_0062528 Ga0501032_0062528_522_1616 363
2855 3300003856 Ga0058692_1005432 Ga0058692_10054323 364
2856 3300005289 Ga0065704_10006837 Ga0065704_100068371 364
2857 3300005289 Ga0065704_10012302 Ga0065704_100123023 364
2858 3300005834 Ga0068851_10000007 Ga0068851_1000000725 364
2859 3300006051 Ga0075364_10126531 Ga0075364_101265312 364
2860 3300009036 Ga0105244_10037094 Ga0105244_100370942 364
2861 3300009092 Ga0105250_10082103 Ga0105250_100821032 364
2862 3300011119 Ga0105246_10002803 Ga0105246_100028034 364
2863 3300025207 Ga0209760_100027 Ga0209760_100027121 364
2864 3300025231 Ga0207427_100006 Ga0207427_100006453 364
2865 3300025233 Ga0209437_100013 Ga0209437_100013453 364
2866 3300025261 Ga0209233_1000022 Ga0209233_1000022453 364
2867 3300025321 Ga0207656_10000006 Ga0207656_1000000677 364
2868 3300025711 Ga0207696_1000541 Ga0207696_10005418 364
2869 3300025728 Ga0207655_1009633 Ga0207655_10096334 364
2870 3300025923 Ga0207681_10000099 Ga0207681_1000009949 364
2871 3300025925 Ga0207650_10000185 Ga0207650_1000018564 364
2872 3300025935 Ga0207709_10000337 Ga0207709_1000033744 364
2873 3300026041 Ga0207639_10000775 Ga0207639_1000077519 364
2874 3300041405 Ga0439438_009786 Ga0439438_009786_711_1805 364
2875 3300046458 Ga0495591_019551 Ga0495591_019551_652_1893 364
2876 3300046463 Ga0495653_0010997 Ga0495653_0010997_495_1589 364
2877 3300046492 Ga0495585_0005628 Ga0495585_0005628_618_1712 364
2878 3300046501 Ga0495607_0031220 Ga0495607_0031220_244_1338 364
2879 3300046507 Ga0495606_0015235 Ga0495606_0015235_948_2042 364
2880 3300046520 Ga0495637_0008829 Ga0495637_0008829_3242_4336 364
2881 3300046665 Ga0495661_0000061 Ga0495661_0000061_66894_67988 364
2882 3300046694 Ga0495649_0002324 Ga0495649_0002324_9731_10825 364
2883 3300047323 Ga0495683_0000207 Ga0495683_0000207_37420_38514 364
2884 3300048917 Ga0496114_0058276 Ga0496114_0058276_1975_3180 364
2885 3300048927 Ga0496124_0189871 Ga0496124_0189871_406_1527 364
2886 3300048928 Ga0496125_0040602 Ga0496125_0040602_188_1282 364
2887 iso_pu_bacteria 2554235231 2555247263 364
2888 iso_pu_bacteria 2945928738 2945930922 364
2889 2124908027 MRS2a_Contig_136 MRS2a_00036440 365
2890 2124908027 MRS2a_Contig_269 MRS2a_00169970 365
2891 3300003578 Ga0006562J51391_1015265 Ga0006562J51391_10152651 365
2892 3300003781 Ga0055536_1004708 Ga0055536_10047082 365
2893 3300003781 Ga0055536_1004755 Ga0055536_10047552 365
2894 3300003791 Ga0055530_10000150 Ga0055530_100001505 365
2895 3300003791 Ga0055530_10004701 Ga0055530_100047012 365
2896 3300003792 Ga0055540_1003956 Ga0055540_10039562 365
2897 3300003794 Ga0055531_10008572 Ga0055531_100085724 365
2898 3300005288 Ga0065714_10000590 Ga0065714_100005903 365
2899 3300005288 Ga0065714_10003458 Ga0065714_100034585 365
2900 3300005288 Ga0065714_10018895 Ga0065714_100188951 365
2901 3300005288 Ga0065714_10090884 Ga0065714_100908841 365
2902 3300005288 Ga0065714_10098173 Ga0065714_100981731 365
2903 3300005288 Ga0065714_10098464 Ga0065714_100984642 365
2904 3300005289 Ga0065704_10168464 Ga0065704_101684641 365
2905 3300005290 Ga0065712_10000927 Ga0065712_100009274 365
2906 3300005293 Ga0065715_10002954 Ga0065715_100029545 365
2907 3300005353 Ga0070669_100011283 Ga0070669_1000112835 365
2908 3300006058 Ga0075432_10021117 Ga0075432_100211172 365
2909 3300006946 Ga0079104_1003465 Ga0079104_10034652 365
2910 3300009011 Ga0105251_10043856 Ga0105251_100438562 365
2911 3300009036 Ga0105244_10041429 Ga0105244_100414292 365
2912 3300009036 Ga0105244_10056006 Ga0105244_100560062 365
2913 3300009036 Ga0105244_10063820 Ga0105244_100638202 365
2914 3300009036 Ga0105244_10078852 Ga0105244_100788521 365
2915 3300009036 Ga0105244_10092244 Ga0105244_100922442 365
2916 3300009092 Ga0105250_10008783 Ga0105250_100087833 365
2917 3300009092 Ga0105250_10043081 Ga0105250_100430812 365
2918 3300009092 Ga0105250_10062884 Ga0105250_100628841 365
2919 3300009148 Ga0105243_10001572 Ga0105243_1000157217 365
2920 3300009148 Ga0105243_10011620 Ga0105243_100116205 365
2921 3300009148 Ga0105243_10099939 Ga0105243_100999392 365
2922 3300009176 Ga0105242_10027006 Ga0105242_100270062 365
2923 3300010375 Ga0105239_10247080 Ga0105239_102470802 365
2924 3300011119 Ga0105246_10009162 Ga0105246_100091623 365
2925 3300011119 Ga0105246_10115159 Ga0105246_101151591 365
2926 3300011119 Ga0105246_10171484 Ga0105246_101714842 365
2927 3300012498 Ga0157345_1000628 Ga0157345_10006282 365
2928 3300012498 Ga0157345_1001643 Ga0157345_10016432 365
2929 3300012502 Ga0157347_1000415 Ga0157347_10004151 365
2930 3300013100 Ga0157373_10004409 Ga0157373_100044099 365
2931 3300013100 Ga0157373_10043030 Ga0157373_100430302 365
2932 3300013100 Ga0157373_10115237 Ga0157373_101152372 365
2933 3300013102 Ga0157371_10159592 Ga0157371_101595921 365
2934 3300013104 Ga0157370_10112745 Ga0157370_101127451 365
2935 3300013104 Ga0157370_10122605 Ga0157370_101226052 365
2936 3300013105 Ga0157369_10030463 Ga0157369_100304632 365
2937 3300013306 Ga0163162_10030569 Ga0163162_100305694 365
2938 3300013306 Ga0163162_10537436 Ga0163162_105374362 365
2939 3300013307 Ga0157372_10067862 Ga0157372_100678622 365
2940 3300013308 Ga0157375_10477150 Ga0157375_104771502 365
2941 3300014497 Ga0182008_10007506 Ga0182008_100075064 365
2942 3300014497 Ga0182008_10041095 Ga0182008_100410952 365
2943 3300015261 Ga0182006_1008964 Ga0182006_10089643 365
2944 3300015261 Ga0182006_1035964 Ga0182006_10359642 365
2945 3300015262 Ga0182007_10002733 Ga0182007_100027336 365
2946 3300015265 Ga0182005_1002836 Ga0182005_10028364 365
2947 3300015265 Ga0182005_1011009 Ga0182005_10110092 365
2948 3300017792 Ga0163161_10137255 Ga0163161_101372552 365
2949 3300025292 Ga0209676_1000015 Ga0209676_1000015423 365
2950 3300025292 Ga0209676_1000041 Ga0209676_1000041184 365
2951 3300025298 Ga0209050_1000030 Ga0209050_100003015 365
2952 3300025298 Ga0209050_1000518 Ga0209050_100051847 365
2953 3300025303 Ga0209051_1000012 Ga0209051_1000012257 365
2954 3300025304 Ga0209257_1000069 Ga0209257_10000696 365
2955 3300025711 Ga0207696_1000031 Ga0207696_1000031221 365
2956 3300025711 Ga0207696_1000105 Ga0207696_10001055 365
2957 3300025711 Ga0207696_1000902 Ga0207696_100090217 365
2958 3300025711 Ga0207696_1008859 Ga0207696_10088592 365
2959 3300025728 Ga0207655_1000202 Ga0207655_100020254 365
2960 3300025728 Ga0207655_1001189 Ga0207655_10011894 365
2961 3300025728 Ga0207655_1016142 Ga0207655_10161423 365
2962 3300025728 Ga0207655_1024145 Ga0207655_10241453 365
2963 3300025735 Ga0207713_1001506 Ga0207713_10015064 365
2964 3300025735 Ga0207713_1003359 Ga0207713_10033599 365
2965 3300025923 Ga0207681_10008578 Ga0207681_100085782 365
2966 3300025934 Ga0207686_10075823 Ga0207686_100758232 365
2967 3300025935 Ga0207709_10000071 Ga0207709_1000007135 365
2968 3300027111 Ga0209281_1000016 Ga0209281_1000016300 365
2969 3300027111 Ga0209281_1000019 Ga0209281_1000019236 365
2970 3300027907 Ga0207428_10027106 Ga0207428_100271064 365
2971 3300030521 Ga0307511_10066924 Ga0307511_100669242 365
2972 3300030735 Ga0316178_1008333 Ga0316178_10083334 365
2973 3300030742 Ga0316183_1030411 Ga0316183_10304112 365
2974 3300030744 Ga0316181_1037347 Ga0316181_10373471 365
2975 3300031548 Ga0307408_100027281 Ga0307408_1000272812 365
2976 3300031824 Ga0307413_10023143 Ga0307413_100231433 365
2977 3300031824 Ga0307413_10070878 Ga0307413_100708782 365
2978 3300031903 Ga0307407_10021661 Ga0307407_100216613 365
2979 3300031911 Ga0307412_10016127 Ga0307412_100161272 365
2980 3300031911 Ga0307412_10039128 Ga0307412_100391283 365
2981 3300031995 Ga0307409_100066784 Ga0307409_1000667842 365
2982 3300032004 Ga0307414_10016650 Ga0307414_100166504 365
2983 3300032005 Ga0307411_10033211 Ga0307411_100332112 365
2984 3300032005 Ga0307411_10110950 Ga0307411_101109502 365
2985 3300041404 Ga0439436_0000361 Ga0439436_0000361_6228_7373 365
2986 3300041405 Ga0439438_004560 Ga0439438_004560_2427_3572 365
2987 3300041405 Ga0439438_018507 Ga0439438_018507_814_1911 365
2988 3300041405 Ga0439438_024015 Ga0439438_024015_457_1554 365
2989 3300041407 Ga0439447_001182 Ga0439447_001182_1483_2628 365
2990 3300041407 Ga0439447_003423 Ga0439447_003423_964_2061 365
2991 3300041407 Ga0439447_003817 Ga0439447_003817_3583_4680 365
2992 3300041407 Ga0439447_004221 Ga0439447_004221_76_1173 365
2993 3300041411 Ga0439466_0000466 Ga0439466_0000466_5330_6427 365
2994 3300041411 Ga0439466_0000587 Ga0439466_0000587_8600_9745 365
2995 3300041411 Ga0439466_0047845 Ga0439466_0047845_75_1172 365
2996 3300042006 Ga0439432_001621 Ga0439432_001621_5374_6471 365
2997 3300042006 Ga0439432_003032 Ga0439432_003032_2856_4001 365
2998 3300042006 Ga0439432_024336 Ga0439432_024336_128_1225 365
2999 3300042009 Ga0439451_001456 Ga0439451_001456_1678_2775 365
3000 3300042010 Ga0439452_003753 Ga0439452_003753_2882_3979 365
3001 3300042010 Ga0439452_004104 Ga0439452_004104_182_1279 365
3002 3300042010 Ga0439452_006994 Ga0439452_006994_1791_2936 365
3003 3300042010 Ga0439452_012826 Ga0439452_012826_687_1784 365
3004 3300042010 Ga0439452_029753 Ga0439452_029753_181_1278 365
3005 3300042013 Ga0439456_013403 Ga0439456_013403_505_1602 365
3006 3300042016 Ga0439463_002378 Ga0439463_002378_1767_2864 365
3007 3300042016 Ga0439463_014864 Ga0439463_014864_312_1466 365
3008 3300042121 Ga0450919_001027 Ga0450919_001027_927_2024 365
3009 3300042125 Ga0450923_015542 Ga0450923_015542_61_1206 365
3010 3300042127 Ga0450890_000509 Ga0450890_000509_3658_4755 365
3011 3300042138 Ga0450903_004485 Ga0450903_004485_779_1876 365
3012 3300042145 Ga0450906_001379 Ga0450906_001379_1969_3066 365
3013 3300042146 Ga0450907_001254 Ga0450907_001254_3344_4441 365
3014 3300042146 Ga0450907_001751 Ga0450907_001751_1181_2278 365
3015 3300042156 Ga0439446_0002288 Ga0439446_0002288_644_1789 365
3016 3300042435 Ga0439434_0003416 Ga0439434_0003416_3377_4474 365
3017 3300042435 Ga0439434_0004552 Ga0439434_0004552_1482_2627 365
3018 3300042461 Ga0439460_0000875 Ga0439460_0000875_3411_4508 365
3019 3300042461 Ga0439460_0005509 Ga0439460_0005509_784_1881 365
3020 3300042531 Ga0450918_004797 Ga0450918_004797_837_1934 365
3021 3300046452 Ga0495617_003398 Ga0495617_003398_4148_5245 365
3022 3300046452 Ga0495617_027869 Ga0495617_027869_250_1347 365
3023 3300046452 Ga0495617_047126 Ga0495617_047126_145_1242 365
3024 3300046457 Ga0495590_0004917 Ga0495590_0004917_1886_2983 365
3025 3300046458 Ga0495591_000009 Ga0495591_000009_138318_139481 365
3026 3300046458 Ga0495591_004959 Ga0495591_004959_5021_6118 365
3027 3300046458 Ga0495591_022014 Ga0495591_022014_706_1803 365
3028 3300046460 Ga0495638_0037952 Ga0495638_0037952_1788_2885 365
3029 3300046460 Ga0495638_0094163 Ga0495638_0094163_524_1621 365
3030 3300046460 Ga0495638_0117552 Ga0495638_0117552_48_1145 365
3031 3300046463 Ga0495653_0032449 Ga0495653_0032449_808_1905 365
3032 3300046463 Ga0495653_0067297 Ga0495653_0067297_179_1276 365
3033 3300046471 Ga0495650_0040949 Ga0495650_0040949_697_1794 365
3034 3300046471 Ga0495650_0044530 Ga0495650_0044530_349_1446 365
3035 3300046474 Ga0495605_0019400 Ga0495605_0019400_2306_3403 365
3036 3300046474 Ga0495605_0055637 Ga0495605_0055637_768_1865 365
3037 3300046474 Ga0495605_0090222 Ga0495605_0090222_184_1281 365
3038 3300046475 Ga0495639_0003111 Ga0495639_0003111_4145_5242 365
3039 3300046491 Ga0495584_0015742 Ga0495584_0015742_836_1933 365
3040 3300046491 Ga0495584_0019702 Ga0495584_0019702_95_1192 365
3041 3300046491 Ga0495584_0029229 Ga0495584_0029229_1418_2515 365
3042 3300046492 Ga0495585_0025626 Ga0495585_0025626_768_1865 365
3043 3300046492 Ga0495585_0032083 Ga0495585_0032083_121_1218 365
3044 3300046499 Ga0495594_0021768 Ga0495594_0021768_1593_2690 365
3045 3300046501 Ga0495607_0013525 Ga0495607_0013525_4155_5252 365
3046 3300046501 Ga0495607_0037662 Ga0495607_0037662_1677_2774 365
3047 3300046501 Ga0495607_0045134 Ga0495607_0045134_89_1186 365
3048 3300046501 Ga0495607_0101501 Ga0495607_0101501_95_1192 365
3049 3300046506 Ga0495583_0058088 Ga0495583_0058088_512_1609 365
3050 3300046507 Ga0495606_0027999 Ga0495606_0027999_2103_3200 365
3051 3300046507 Ga0495606_0053925 Ga0495606_0053925_1474_2571 365
3052 3300046512 Ga0495610_0029705 Ga0495610_0029705_120_1217 365
3053 3300046512 Ga0495610_0038049 Ga0495610_0038049_42_1139 365
3054 3300046512 Ga0495610_0040034 Ga0495610_0040034_780_1877 365
3055 3300046512 Ga0495610_0064906 Ga0495610_0064906_519_1616 365
3056 3300046512 Ga0495610_0065149 Ga0495610_0065149_153_1250 365
3057 3300046513 Ga0495616_0014537 Ga0495616_0014537_2231_3328 365
3058 3300046513 Ga0495616_0030952 Ga0495616_0030952_137_1234 365
3059 3300046513 Ga0495616_0054876 Ga0495616_0054876_754_1851 365
3060 3300046513 Ga0495616_0057796 Ga0495616_0057796_170_1267 365
3061 3300046515 Ga0495620_0021774 Ga0495620_0021774_1452_2549 365
3062 3300046519 Ga0495632_0016447 Ga0495632_0016447_692_1789 365
3063 3300046519 Ga0495632_0022095 Ga0495632_0022095_350_1447 365
3064 3300046519 Ga0495632_0057379 Ga0495632_0057379_97_1194 365
3065 3300046520 Ga0495637_0018657 Ga0495637_0018657_2090_3187 365
3066 3300046520 Ga0495637_0039184 Ga0495637_0039184_757_1854 365
3067 3300046522 Ga0495643_0022708 Ga0495643_0022708_1782_2879 365
3068 3300046522 Ga0495643_0033048 Ga0495643_0033048_168_1265 365
3069 3300046523 Ga0495644_0013763 Ga0495644_0013763_1853_2950 365
3070 3300046524 Ga0495648_0022735 Ga0495648_0022735_764_1861 365
3071 3300046524 Ga0495648_0038267 Ga0495648_0038267_185_1282 365
3072 3300046524 Ga0495648_0049635 Ga0495648_0049635_829_1926 365
3073 3300046524 Ga0495648_0089855 Ga0495648_0089855_56_1153 365
3074 3300046524 Ga0495648_0109489 Ga0495648_0109489_64_1161 365
3075 3300046528 Ga0495642_0009876 Ga0495642_0009876_1379_2476 365
3076 3300046528 Ga0495642_0012032 Ga0495642_0012032_82_1179 365
3077 3300046530 Ga0495654_0005941 Ga0495654_0005941_678_1775 365
3078 3300046530 Ga0495654_0015523 Ga0495654_0015523_2343_3440 365
3079 3300046530 Ga0495654_0015833 Ga0495654_0015833_788_1885 365
3080 3300046530 Ga0495654_0019167 Ga0495654_0019167_2111_3208 365
3081 3300046530 Ga0495654_0109268 Ga0495654_0109268_115_1212 365
3082 3300046536 Ga0495587_0057032 Ga0495587_0057032_313_1410 365
3083 3300046538 Ga0495609_0003174 Ga0495609_0003174_4801_5898 365
3084 3300046542 Ga0495597_0012962 Ga0495597_0012962_721_1818 365
3085 3300046557 Ga0495622_0002873 Ga0495622_0002873_1974_3071 365
3086 3300046615 Ga0495656_0003150 Ga0495656_0003150_3985_5082 365
3087 3300046642 Ga0495634_0019357 Ga0495634_0019357_3618_4715 365
3088 3300046660 Ga0495625_0212910 Ga0495625_0212910_75_1172 365
3089 3300046664 Ga0495659_0003345 Ga0495659_0003345_2007_3104 365
3090 3300046664 Ga0495659_0019089 Ga0495659_0019089_92_1189 365
3091 3300046664 Ga0495659_0028157 Ga0495659_0028157_361_1458 365
3092 3300046665 Ga0495661_0081050 Ga0495661_0081050_691_1788 365
3093 3300046680 Ga0495646_0023046 Ga0495646_0023046_2318_3415 365
3094 3300046691 Ga0495670_0021556 Ga0495670_0021556_888_1985 365
3095 3300046692 Ga0495671_0018334 Ga0495671_0018334_180_1277 365
3096 3300046692 Ga0495671_0101986 Ga0495671_0101986_129_1226 365
3097 3300046694 Ga0495649_0021520 Ga0495649_0021520_2037_3134 365
3098 3300046694 Ga0495649_0053969 Ga0495649_0053969_729_1826 365
3099 3300046794 Ga0495589_0008703 Ga0495589_0008703_41_1138 365
3100 3300046794 Ga0495589_0010021 Ga0495589_0010021_380_1477 365
3101 3300046809 Ga0495600_0003343 Ga0495600_0003343_4156_5253 365
3102 3300046810 Ga0495660_0036242 Ga0495660_0036242_143_1240 365
3103 3300046810 Ga0495660_0061413 Ga0495660_0061413_304_1401 365
3104 3300046810 Ga0495660_0067162 Ga0495660_0067162_758_1855 365
3105 3300046810 Ga0495660_0097158 Ga0495660_0097158_300_1397 365
3106 3300047317 Ga0495604_0050010 Ga0495604_0050010_27_1124 365
3107 3300047317 Ga0495604_0073834 Ga0495604_0073834_454_1551 365
3108 3300047318 Ga0495636_0014868 Ga0495636_0014868_1863_2960 365
3109 3300047320 Ga0495672_0012072 Ga0495672_0012072_4172_5269 365
3110 3300047320 Ga0495672_0021245 Ga0495672_0021245_2552_3649 365
3111 3300047320 Ga0495672_0032463 Ga0495672_0032463_775_1872 365
3112 3300047322 Ga0495680_0014977 Ga0495680_0014977_4280_5377 365
3113 3300047322 Ga0495680_0048211 Ga0495680_0048211_84_1181 365
3114 3300047323 Ga0495683_0008997 Ga0495683_0008997_3458_4555 365
3115 3300047323 Ga0495683_0021909 Ga0495683_0021909_331_1428 365
3116 3300047323 Ga0495683_0103389 Ga0495683_0103389_115_1212 365
3117 3300047443 Ga0495687_007653 Ga0495687_007653_1289_2386 365
3118 3300047444 Ga0495675_0009055 Ga0495675_0009055_1829_2926 365
3119 3300047444 Ga0495675_0148493 Ga0495675_0148493_59_1156 365
3120 3300047445 Ga0495677_0033436 Ga0495677_0033436_123_1220 365
3121 3300047447 Ga0495685_049081 Ga0495685_049081_99_1196 365
3122 3300047469 Ga0495673_0007829 Ga0495673_0007829_4963_6060 365
3123 3300047469 Ga0495673_0015631 Ga0495673_0015631_2375_3472 365
3124 3300047469 Ga0495673_0021205 Ga0495673_0021205_2076_3173 365
3125 3300047469 Ga0495673_0026141 Ga0495673_0026141_421_1518 365
3126 3300047469 Ga0495673_0075739 Ga0495673_0075739_171_1268 365
3127 3300047673 Ga0495593_0065094 Ga0495593_0065094_168_1265 365
3128 3300047673 Ga0495593_0112358 Ga0495593_0112358_167_1264 365
3129 3300048091 Ga0495626_0007093 Ga0495626_0007093_4793_5890 365
3130 3300048091 Ga0495626_0008893 Ga0495626_0008893_3652_4749 365
3131 3300048091 Ga0495626_0018553 Ga0495626_0018553_2300_3397 365
3132 3300048091 Ga0495626_0063518 Ga0495626_0063518_95_1192 365
3133 3300048905 Ga0496102_0026312 Ga0496102_0026312_179_1276 365
3134 3300048906 Ga0496103_0026858 Ga0496103_0026858_148_1245 365
3135 3300048920 Ga0496117_0074888 Ga0496117_0074888_1098_2195 365
3136 3300048921 Ga0496118_0089431 Ga0496118_0089431_115_1212 365
3137 3300048925 Ga0496122_0019987 Ga0496122_0019987_914_2011 365
3138 3300048926 Ga0496123_0089595 Ga0496123_0089595_614_1711 365
3139 3300048927 Ga0496124_0043552 Ga0496124_0043552_749_1846 365
3140 3300049459 Ga0495678_006385 Ga0495678_006385_5094_6191 365
3141 3300049459 Ga0495678_018021 Ga0495678_018021_768_1865 365
3142 3300049459 Ga0495678_039419 Ga0495678_039419_714_1811 365
3143 3300049459 Ga0495678_046530 Ga0495678_046530_175_1272 365
3144 3300049459 Ga0495678_047054 Ga0495678_047054_436_1533 365
3145 iso_pu_bacteria 2718217725 2718636600 365
3146 iso_pu_bacteria 2974289157 2974294091 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

135

397

0.87

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

102

391

0.84

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

94

362

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyt-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine 0.979 27 362
7oyu-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine 0.9776 27 362
7oys-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine 0.9765 26 362
7oyy-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutation s247d in complex with spermidine 0.9748 26 362
7oyz-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d in complex with spermidine 0.9744 27 362
ID Description Score Start End Superfamily
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9917 29 132 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.986 29 330 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9799 29 330 3.40.190.10
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9731 29 132 3.40.190.10
af_P31133_137_369_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.966 134 362 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7X2CB03-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9948 142 238 GO:0015846
GO:0019808
GO:0042597
AF-A0A5R2MU04-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9879 158 253 GO:0015846
GO:0019808
GO:0042597
AF-A0A530N1C4-F1-model_v4 deleted 0.9866 24 345
AF-A0A0W0IFA6-F1-model_v4 ABC transporter substrate-binding protein 0.9833 98 363 GO:0015846
GO:0019808
GO:0042597
AF-A0A2M7Y8B4-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9831 98 363 GO:0015846
GO:0019808
GO:0042597

Feature Viewer

pLDDT pTM Quality
91.9 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map