F496541

General Info

Members Datasets Scaffolds Average Seq Length
2196 1338 1324 198

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_1021864|Ga0395901_1021864_63_758
Length 231
Sequence LRLGTAKSGDPMKMIRIGAALASPLKRGQGVRIMASQEIEALSQALARLPGLGPRSARRAVLHLMKKRETALQPLLAALKQVADKLSTCSVCGNVDTSDPXXXXSDPRRDEKMLCVVEEVADLWALDRSRLFPGRYHVLGGRLSALEGVRPEDLSIDKLVSRVSKGGIDEVVLAMNATLEGQTTAHYLAEQLEKFPIRLSQLAHGLPVGGELDYLDEGTLAQALRARRPIS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
11 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
12 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
13 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
14 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
18 2512875024 Mesorhizobium loti R88b Isolate Nodule
19 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
20 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
21 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
22 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
23 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
24 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
25 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
26 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
27 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
28 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
29 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
30 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
31 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
32 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
33 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
34 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
35 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
36 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
37 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
38 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
39 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
40 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
41 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
42 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
43 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
44 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
45 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
46 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
47 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
48 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
49 2516143018 Ensifer sp. BR816 Isolate Nodule
50 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
51 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
52 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
53 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
54 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
55 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
56 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
57 2519899620 Rhizobium sp. Pop5 Isolate Nodule
58 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
59 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
60 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
61 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
62 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
63 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
64 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
65 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
66 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
67 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
68 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
69 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
70 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
71 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
72 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
73 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
74 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
75 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
76 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
77 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
78 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
79 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
80 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
81 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
82 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
83 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
84 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
85 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
86 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
87 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
88 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
89 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
90 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
91 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
92 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
93 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
94 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
95 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
96 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
97 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
98 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
99 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
100 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
101 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
102 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
103 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
104 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
105 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
106 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
107 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
108 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
109 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
110 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
111 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
112 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
113 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
114 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
115 2643221557 Ensifer sp. Root558 Isolate Unclassified
116 2643221558 Rhizobium sp. Root149 Isolate Unclassified
117 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
118 2643221568 Rhizobium sp. Root564 Isolate Unclassified
119 2643221582 Rhizobium sp. Root651 Isolate Unclassified
120 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
121 2643221607 Rhizobium sp. Root73 Isolate Unclassified
122 2643221610 Ensifer sp. Root74 Isolate Unclassified
123 2643221618 Ensifer sp. Root231 Isolate Unclassified
124 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
125 2643221626 Ensifer sp. Root31 Isolate Unclassified
126 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
127 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
128 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
129 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
130 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
131 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
132 2643221655 Ensifer sp. Root1252 Isolate Unclassified
133 2643221659 Ensifer sp. Root127 Isolate Unclassified
134 2643221668 Ensifer sp. Root423 Isolate Unclassified
135 2643221675 Ensifer sp. Root1298 Isolate Unclassified
136 2643221680 Ensifer sp. Root1312 Isolate Unclassified
137 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
138 2643221688 Rhizobium sp. Root482 Isolate Unclassified
139 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
140 2643221693 Rhizobium sp. Root491 Isolate Unclassified
141 2643221698 Ensifer sp. Root142 Isolate Unclassified
142 2643221712 Ensifer sp. Root258 Isolate Unclassified
143 2643221718 Rhizobium sp. Root268 Isolate Unclassified
144 2643221719 Rhizobium sp. Root274 Isolate Unclassified
145 2643221723 Ensifer sp. Root278 Isolate Unclassified
146 2643221726 Ensifer sp. Root954 Isolate Unclassified
147 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
148 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
149 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
150 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
151 2718217882 Rhizobium sp. N741 Isolate Nodule
152 2718217927 Rhizobium sp. N324 Isolate Nodule
153 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
154 2718218009 Rhizobium sp. N561 Isolate Nodule
155 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
156 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
157 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
158 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
159 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
160 2718218363 Rhizobium sp. N113 Isolate Nodule
161 2718218365 Rhizobium sp. N731 Isolate Nodule
162 2718218366 Rhizobium sp. N621 Isolate Nodule
163 2718218423 Rhizobium sp. N941 Isolate Nodule
164 2721755514 Rhizobium sp. N6212 Isolate Nodule
165 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
166 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
167 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
168 2721755809 Rhizobium sp. N541 Isolate Nodule
169 2721755810 Rhizobium sp. N871 Isolate Nodule
170 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
171 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
172 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
173 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
174 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
175 2728369365 Rhizobium sp. N1341 Isolate Nodule
176 2728369397 Rhizobium sp. N1314 Isolate Nodule
177 2738541293 Rhizobium sp. GV031 Isolate Unclassified
178 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
179 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
180 2738543024 Aminobacter sp. AP02 Isolate Unclassified
181 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
182 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
183 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
184 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
185 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
186 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
187 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
188 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
189 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
190 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
191 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
192 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
193 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
194 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
195 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
196 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
197 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
198 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
199 2791355256 Rhizobium sp. M10 Isolate Nodule
200 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
201 2791355260 Rhizobium sp. L9 Isolate Nodule
202 2791355261 Rhizobium sp. J15 Isolate Nodule
203 2791355262 Rhizobium sp. M1 Isolate Nodule
204 2791355263 Rhizobium chutanense C5 Isolate Nodule
205 2791355264 Rhizobium sp. S9 Isolate Nodule
206 2791355265 Rhizobium sp. H4 Isolate Nodule
207 2791355266 Rhizobium sp. L43 Isolate Nodule
208 2791355267 Rhizobium sp. L18 Isolate Nodule
209 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
210 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
211 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
212 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
213 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
214 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
215 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
216 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
217 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
218 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
219 2802429633 Rhizobium anhuiense J3 Isolate Nodule
220 2802429634 Rhizobium anhuiense S10 Isolate Nodule
221 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
222 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
223 2802429637 Rhizobium anhuiense C15 Isolate Nodule
224 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
225 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
226 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
227 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
228 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
229 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
230 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
231 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
232 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
233 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
234 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
235 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
236 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
237 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
238 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
239 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
240 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
241 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
242 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
243 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
244 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
245 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
246 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
247 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
248 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
249 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
250 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
251 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
252 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
253 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
254 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
255 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
256 2838048938 Rhizobium pisi 27/80 Isolate Nodule
257 2838061910 Rhizobium phaseoli L15 Isolate Nodule
258 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
259 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
260 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
261 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
262 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
263 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
264 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
265 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
266 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
267 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
268 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
269 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
270 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
271 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
272 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
273 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
274 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
275 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
276 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
277 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
278 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
279 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
280 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
281 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
282 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
283 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
284 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
285 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
286 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
287 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
288 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
289 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
290 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
291 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
292 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
293 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
294 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
295 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
296 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
297 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
298 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
299 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
300 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
301 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
302 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
303 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
304 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
305 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
306 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
307 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
308 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
309 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
310 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
311 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
312 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
313 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
314 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
315 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
316 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
317 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
318 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
319 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
320 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
321 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
322 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
323 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
324 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
325 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
326 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
327 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
328 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
329 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
330 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
331 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
332 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
333 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
334 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
335 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
336 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
337 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
338 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
339 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
340 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
341 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
342 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
343 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
344 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
345 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
346 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
347 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
348 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
349 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
350 2844163670 Ensifer sp. 1H6 Isolate Unclassified
351 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
352 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
353 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
354 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
355 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
356 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
357 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
358 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
359 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
360 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
361 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
362 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
363 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
364 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
365 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
366 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
367 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
368 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
369 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
370 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
371 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
372 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
373 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
374 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
375 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
376 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
377 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
378 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
379 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
380 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
381 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
382 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
383 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
384 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
385 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
386 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
387 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
388 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
389 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
390 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
391 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
392 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
393 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
394 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
395 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
396 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
397 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
398 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
399 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
400 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
401 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
402 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
403 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
404 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
405 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
406 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
407 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
408 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
409 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
410 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
411 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
412 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
413 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
414 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
415 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
416 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
417 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
418 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
419 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
420 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
421 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
422 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
423 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
424 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
425 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
426 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
427 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
428 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
429 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
430 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
431 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
432 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
433 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
434 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
435 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
436 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
437 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
438 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
439 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
440 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
441 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
442 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
443 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
444 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
445 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
446 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
447 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
448 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
449 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
450 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
451 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
452 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
453 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
454 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
455 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
456 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
457 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
458 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
459 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
460 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
461 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
462 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
463 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
464 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
465 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
466 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
467 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
468 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
469 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
470 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
471 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
472 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
473 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
474 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
475 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
476 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
477 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
478 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
479 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
480 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
481 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
482 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
483 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
484 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
485 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
486 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
487 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
488 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
489 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
490 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
491 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
492 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
493 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
494 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
495 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
496 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
497 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
498 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
499 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
500 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
501 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
502 2922368715
503 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
504 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
505 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
506 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
507 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
508 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
509 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
510 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
511 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
512 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
513 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
514 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
515 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
516 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
517 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
518 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
519 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
520 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
521 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
522 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
523 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
524 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
525 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
526 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
527 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
528 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
529 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
530 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
531 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
532 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
533 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
534 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
535 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
536 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
537 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
538 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
539 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
540 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
541 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
542 2933599457 Rhizobium phaseoli M3 Isolate Nodule
543 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
544 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
545 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
546 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
547 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
548 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
549 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
550 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
551 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
552 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
553 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
554 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
555 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
556 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
557 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
558 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
559 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
560 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
561 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
562 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
563 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
564 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
565 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
566 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
567 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
568 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
569 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
570 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
571 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
572 2936381700 Rhizobium chutanense C16 Isolate Unclassified
573 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
574 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
575 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
576 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
577 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
578 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
579 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
580 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
581 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
582 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
583 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
584 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
585 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
586 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
587 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
588 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
589 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
590 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
591 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
592 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
593 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
594 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
595 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
596 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
597 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
598 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
599 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
600 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
601 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
602 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
603 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
604 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
605 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
606 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
607 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
608 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
609 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
610 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
611 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
612 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
613 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
614 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
615 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
616 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
617 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
618 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
619 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
620 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
621 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
622 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
623 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
624 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
625 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
626 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
627 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
628 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
629 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
630 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
631 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
632 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
633 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
634 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
635 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
636 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
637 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
638 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
639 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
640 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
641 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
642 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
643 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
644 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
645 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
646 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
647 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
648 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
649 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
650 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
651 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
652 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
653 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
654 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
655 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
656 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
657 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
658 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
659 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
660 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
661 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
662 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
663 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
664 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
665 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
666 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
667 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
668 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
669 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
670 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
671 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
672 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
673 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
674 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
675 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
676 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
677 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
678 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
679 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
680 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
681 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
682 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
683 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
684 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
685 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
686 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
687 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
688 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
689 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
690 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
691 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
692 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
693 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
694 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
695 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
696 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
697 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
698 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
699 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
700 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
701 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
702 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
703 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
704 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
705 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
706 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
707 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
708 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
709 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
710 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
711 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
712 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
713 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
714 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
715 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
716 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
717 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
718 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
719 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
720 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
721 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
722 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
723 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
724 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
725 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
726 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
727 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
728 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
729 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
730 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
731 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
732 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
733 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
734 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
735 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
736 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
737 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
738 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
739 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
740 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
741 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
742 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
743 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
744 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
745 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
746 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
747 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
748 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
749 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
750 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
751 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
752 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
753 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
754 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
755 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
756 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
757 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
758 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
759 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
760 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
761 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
762 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
763 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
764 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
765 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
766 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
767 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
768 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
769 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
770 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
771 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
772 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
773 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
774 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
775 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
776 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
777 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
778 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
779 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
780 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
781 2996893221 Rhizobium sp. R635 Isolate Nodule
782 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
783 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
784 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
785 3004167301 Mesorhizobium loti 582 Isolate Unclassified
786 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
787 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
788 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
789 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
790 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
791 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
792 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
793 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
794 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
795 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
796 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
797 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
798 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
799 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
800 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
801 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
802 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
803 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
804 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
805 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
806 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
807 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
808 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
809 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
810 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
811 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
812 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
813 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
814 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
815 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
816 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
817 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
818 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
819 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
820 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
821 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
822 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
823 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
824 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
825 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
826 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
827 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
828 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
829 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
830 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
831 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
832 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
833 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
834 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
835 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
836 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
837 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
838 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
839 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
840 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
841 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
842 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
843 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
844 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
845 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
846 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
847 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
848 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
849 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
850 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
851 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
852 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
853 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
854 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
855 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
856 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
857 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
858 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
859 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
860 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
861 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
862 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
863 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
864 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
865 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
866 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
867 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
868 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
869 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
870 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
871 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
872 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
873 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
874 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
875 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
876 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
877 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
878 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
879 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
880 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
881 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
882 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
883 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
884 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
885 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
886 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
887 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
888 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
889 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
890 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
891 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
892 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
893 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
894 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
895 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
896 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
897 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
898 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
899 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
900 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
901 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
902 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
903 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
904 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
905 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
906 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
907 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
908 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
909 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
910 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
911 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
912 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
913 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
914 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
915 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
916 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
917 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
918 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
919 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
920 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
921 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
922 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
923 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
924 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
925 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
926 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
927 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
928 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
929 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
930 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
931 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
932 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
933 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
934 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
935 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
936 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
937 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
938 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
939 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
940 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
941 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
942 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
943 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
944 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
945 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
946 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
947 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
948 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
949 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
950 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
951 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
952 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
953 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
954 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
955 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
956 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
957 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
958 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
959 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
960 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
961 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
962 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
963 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
964 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
965 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
966 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
967 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
968 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
969 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
970 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
971 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
972 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
973 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
974 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
975 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
976 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
977 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
978 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
979 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
980 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
981 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
982 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
983 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
984 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
985 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
986 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
987 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
988 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
989 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
990 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
991 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
992 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
993 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
994 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
995 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
996 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
997 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
998 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
999 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1000 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1001 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1002 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1003 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1004 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1005 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1006 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1007 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1008 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1009 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1010 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1011 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1012 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1013 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1014 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1015 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1016 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1017 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1018 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1019 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1020 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1021 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1022 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1023 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1024 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1025 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1026 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1027 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1028 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1029 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1030 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1031 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1032 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1033 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1034 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1035 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1036 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1037 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1038 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1039 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1040 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1041 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1042 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1043 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1044 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1045 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1046 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1047 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1048 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1049 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
1050 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1051 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1052 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1053 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1054 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1055 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1056 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
1057 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1058 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1059 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1060 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1061 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
1062 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1063 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1064 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
1065 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1066 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1067 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1068 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1069 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1070 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
1071 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1072 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1073 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1074 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1075 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
1076 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
1077 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1078 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1079 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1080 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1081 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1082 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1083 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1084 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1085 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1086 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1087 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1088 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1089 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1090 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1091 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1092 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
1093 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1094 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
1095 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
1096 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
1097 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
1098 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
1099 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
1100 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
1101 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1102 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
1103 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
1105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1106 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
1107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
1108 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
1109 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
1110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
1111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
1137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1177 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
1212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
1213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
1218 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
1219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1222 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
1223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1240 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1242 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1244 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1245 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
1246 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1247 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1248 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1249 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1250 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1251 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1252 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
1253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1254 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1256 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1257 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1258 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1261 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1263 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1265 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1270 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1271 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1272 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1273 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1274 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1275 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1276 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1277 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1278 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1279 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1280 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1281 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1282 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1283 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1284 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1285 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1286 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1287 8005275841 Rhizobium sp. N4311 Isolate Nodule
1288 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1289 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1290 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1291 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1292 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1293 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1294 8005382845 Rhizobium sp. R634 Isolate Nodule
1295 8005395548 Rhizobium sp. R339 Isolate Nodule
1296 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1297 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1298 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1299 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1300 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1301 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1302 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1303 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1304 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1305 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1306 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1307 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1308 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1309 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1310 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1311 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1312 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1313 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1314 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1315 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1316 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1317 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1318 8018176218 Rhizobium sp. N122 Isolate Nodule
1319 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1320 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1321 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1322 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1323 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1324 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1325 8024501048 Rhizobium sp. H4 Isolate Nodule
1326 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1327 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1328 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1329 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1330 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1331 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1332 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1333 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1334 8056382006 Rhizobium croatiense 13T Isolate Nodule
1335 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1336 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1337 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1338 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.23
Metatranscriptomes 0.09
Isolates 39.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 11.43
Nodule 30.1
Rhizoplane 3.51
Rhizosphere 41.07
Stem 0
Stem Tuber 0
Unclassified 13.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001390 3300001976 Bacteria 3267
2 JGI24740J21852_10030451 3300001979 Bacteria 1755
3 JGI24739J22299_10006127 3300001989 Bacteria 4542
4 JGI24739J22299_10023529 3300001989 Bacteria 2177
5 JGI24737J22298_10002277 3300001990 Bacteria 6826
6 JGI24737J22298_10006099 3300001990 Bacteria 4130
7 JGI24737J22298_10045694 3300001990 Bacteria 1337
8 JGI24743J22301_10023704 3300001991 Bacteria 1182
9 JGI24735J21928_10007014 3300002067 Bacteria 3683
10 JGI24735J21928_10060394 3300002067 Bacteria 1089
11 JGI24735J21928_10071112 3300002067 Bacteria 997
12 JGI24748J21848_1000044 3300002074 Bacteria 59119
13 JGI24738J21930_10004739 3300002075 Bacteria 3313
14 JGI24034J26672_10000020 3300002239 Bacteria 122643
15 JGI24742J22300_10000620 3300002244 Bacteria 5334
16 JGI25155J39150_1000069 3300002704 Bacteria 64645
17 JGI25156J39149_1000095 3300002705 Bacteria 64645
18 JGI25162J39368_1002190 3300002737 Bacteria 8063
19 JGI25154J39366_1000560 3300002738 Bacteria 18262
20 JGI25158J39367_1000029 3300002739 Bacteria 33536
21 JGI25157J39369_1000216 3300002741 Bacteria 47231
22 JGI25152J39213_1003369 3300002773 Bacteria 5485
23 JGI25152J39213_1003399 3300002773 Bacteria 5452
24 JGI25152J39213_1004307 3300002773 Bacteria 4530
25 JGI25152J39213_1006750 3300002773 Bacteria 3058
26 JGI25152J39213_1009332 3300002773 Bacteria 2339
27 JGI25150J39212_1000232 3300002774 Bacteria 30243
28 JGI25150J39212_1022674 3300002774 Bacteria 941
29 JGI25159J45721_1000192 3300002987 Bacteria 28420
30 JGI25159J45721_1000479 3300002987 Bacteria 18398
31 JGI25159J45721_1000621 3300002987 Bacteria 15796
32 JGI25151J46595_10000439 3300003187 Bacteria 41010
33 JGI25151J46595_10001371 3300003187 Bacteria 16854
34 JGI25151J46595_10003061 3300003187 Bacteria 9452
35 JGI25165J46597_1001961 3300003214 Bacteria 8063
36 JGI25165J46597_1001999 3300003214 Bacteria 7828
37 JGI25165J46597_1008125 3300003214 Bacteria 1674
38 JGI25153J46596_10007562 3300003215 Bacteria 5320
39 JGI25153J46596_10011190 3300003215 Bacteria 3985
40 JGI25153J46596_10013163 3300003215 Bacteria 3516
41 JGI25153J46596_10015668 3300003215 Bacteria 3075
42 JGI25153J46596_10018074 3300003215 Bacteria 2752
43 JGI25160J50197_1000003 3300003354 Bacteria 482719
44 JGI25160J50197_1000287 3300003354 Bacteria 36528
45 JGI25160J50197_1001532 3300003354 Bacteria 11456
46 JGI25160J50197_1011524 3300003354 Bacteria 3129
47 JGI25161J50226_1000176 3300003374 Bacteria 42677
48 JGI25161J50226_1000523 3300003374 Bacteria 16594
49 JGI25161J50226_1002174 3300003374 Bacteria 5224
50 JGI25161J50226_1004992 3300003374 Bacteria 2673
51 Ga0006562J51391_1115539 3300003578 Bacteria 1241
52 Ga0055526_1003881 3300003771 Bacteria 9270
53 Ga0055526_1003970 3300003771 Bacteria 9116
54 Ga0055526_1005084 3300003771 Bacteria 7678
55 Ga0055526_1005149 3300003771 Bacteria 7617
56 Ga0055526_1005215 3300003771 Bacteria 7547
57 Ga0055526_1019122 3300003771 Bacteria 2511
58 Ga0055537_1001041 3300003773 Bacteria 12442
59 Ga0055524_1001632 3300003775 Bacteria 12512
60 Ga0055524_1010414 3300003775 Bacteria 3704
61 Ga0055524_1012005 3300003775 Bacteria 3349
62 Ga0055524_1020751 3300003775 Bacteria 2202
63 Ga0055524_1034537 3300003775 Bacteria 1396
64 Ga0055536_1008181 3300003781 Bacteria 4545
65 Ga0055536_1008884 3300003781 Bacteria 4245
66 Ga0055536_1010749 3300003781 Bacteria 3588
67 Ga0055528_1003156 3300003790 Bacteria 8441
68 Ga0055528_1003713 3300003790 Bacteria 7554
69 Ga0055528_1005850 3300003790 Bacteria 5648
70 Ga0055528_1007342 3300003790 Bacteria 4888
71 Ga0055528_1013747 3300003790 Bacteria 3047
72 Ga0055540_1003870 3300003792 Bacteria 7029
73 Ga0055540_1016096 3300003792 Bacteria 2144
74 Ga0055531_10040672 3300003794 Bacteria 1358
75 Ga0058692_1002554 3300003856 Bacteria 6028
76 Ga0058692_1006913 3300003856 Bacteria 3061
77 Ga0055543_1000069 3300004625 Bacteria 94040
78 Ga0055543_1000114 3300004625 Bacteria 69144
79 Ga0055543_1000187 3300004625 Bacteria 50429
80 Ga0055543_1000247 3300004625 Bacteria 41352
81 Ga0065165_1000047 3300005262 Bacteria 197811
82 Ga0065165_1000511 3300005262 Bacteria 59722
83 Ga0065165_1015496 3300005262 Bacteria 2903
84 Ga0065165_1038045 3300005262 Bacteria 1453
85 Ga0065165_1062844 3300005262 Bacteria 1011
86 Ga0065707_10081865 3300005295 Bacteria 32547
87 Ga0070658_10000409 3300005327 Bacteria 37237
88 Ga0070658_10013265 3300005327 Bacteria 6611
89 Ga0070658_10026510 3300005327 Bacteria 4650
90 Ga0070658_10287900 3300005327 Bacteria 1400
91 Ga0070683_100000644 3300005329 Bacteria 25133
92 Ga0070690_100049725 3300005330 Bacteria 2673
93 Ga0070670_100006682 3300005331 Bacteria 9778
94 Ga0070670_100016813 3300005331 Bacteria 6278
95 Ga0070670_100067225 3300005331 Bacteria 3076
96 Ga0070670_101319407 3300005331 Bacteria 661
97 Ga0070677_10088305 3300005333 Bacteria 1343
98 Ga0068869_100021828 3300005334 Bacteria 4406
99 Ga0068869_100138345 3300005334 Bacteria 1878
100 Ga0070666_10001050 3300005335 Bacteria 16895
101 Ga0070666_10002373 3300005335 Bacteria 11380
102 Ga0070666_10642496 3300005335 Bacteria 776
103 Ga0070680_100004572 3300005336 Bacteria 10403
104 Ga0070680_100009894 3300005336 Bacteria 7340
105 Ga0070660_100000055 3300005339 Bacteria 67100
106 Ga0070660_100016630 3300005339 Bacteria 5344
107 Ga0070660_100034146 3300005339 Bacteria 3841
108 Ga0070660_100136974 3300005339 Bacteria 1962
109 Ga0070691_10209227 3300005341 Bacteria 1028
110 Ga0070691_10546220 3300005341 Bacteria 676
111 Ga0070661_100000340 3300005344 Bacteria 37237
112 Ga0070661_100013551 3300005344 Bacteria 5724
113 Ga0070661_100152831 3300005344 Bacteria 1746
114 Ga0070661_100305165 3300005344 Bacteria 1240
115 Ga0070692_10001570 3300005345 Bacteria 8386
116 Ga0070692_10013728 3300005345 Bacteria 3784
117 Ga0070668_100125420 3300005347 Bacteria 2056
118 Ga0070668_100603126 3300005347 Bacteria 961
119 Ga0070669_100017639 3300005353 Bacteria 5092
120 Ga0070669_100080824 3300005353 Bacteria 2420
121 Ga0070669_100081351 3300005353 Bacteria 2412
122 Ga0070669_100112579 3300005353 Bacteria 2067
123 Ga0070669_100223456 3300005353 Bacteria 1490
124 Ga0070675_100442176 3300005354 Bacteria 1165
125 Ga0070671_100031788 3300005355 Bacteria 4363
126 Ga0070671_100050065 3300005355 Bacteria 3475
127 Ga0070671_100112218 3300005355 Bacteria 2290
128 Ga0070671_100170118 3300005355 Bacteria 1843
129 Ga0070674_100065353 3300005356 Bacteria 2553
130 Ga0070674_100633863 3300005356 Bacteria 907
131 Ga0070673_100015703 3300005364 Bacteria 5328
132 Ga0070673_100071965 3300005364 Bacteria 2779
133 Ga0070673_100171550 3300005364 Bacteria 1852
134 Ga0070673_100603259 3300005364 Bacteria 1001
135 Ga0070659_100000139 3300005366 Bacteria 55743
136 Ga0070659_100011162 3300005366 Bacteria 6636
137 Ga0070659_100012287 3300005366 Bacteria 6349
138 Ga0070659_100503646 3300005366 Bacteria 1032
139 Ga0070659_100541874 3300005366 Bacteria 995
140 Ga0070667_100005245 3300005367 Bacteria 10835
141 Ga0070667_100023846 3300005367 Bacteria 5080
142 Ga0070667_100157513 3300005367 Bacteria 1998
143 Ga0070667_100178909 3300005367 Bacteria 1875
144 Ga0070667_100320248 3300005367 Bacteria 1399
145 Ga0070667_100339932 3300005367 Bacteria 1357
146 Ga0070703_10001725 3300005406 Bacteria 6486
147 Ga0070701_10015566 3300005438 Bacteria 3516
148 Ga0070705_100003836 3300005440 Bacteria 7349
149 Ga0070700_100010792 3300005441 Bacteria 5049
150 Ga0070694_100000725 3300005444 Bacteria 18394
151 Ga0070708_100156154 3300005445 Bacteria 2124
152 Ga0070663_100044978 3300005455 Bacteria 3117
153 Ga0070663_100260991 3300005455 Bacteria 1374
154 Ga0070663_100390871 3300005455 Bacteria 1135
155 Ga0070662_100000024 3300005457 Bacteria 91042
156 Ga0070662_100001433 3300005457 Bacteria 14710
157 Ga0070662_100015527 3300005457 Bacteria 5103
158 Ga0070662_100022218 3300005457 Bacteria 4339
159 Ga0070662_100022652 3300005457 Bacteria 4302
160 Ga0070662_100104788 3300005457 Bacteria 2146
161 Ga0070681_10024817 3300005458 Bacteria 6031
162 Ga0068867_100012473 3300005459 Bacteria 6015
163 Ga0070706_100069679 3300005467 Bacteria 3253
164 Ga0070699_100000188 3300005518 Bacteria 60070
165 Ga0070679_100060223 3300005530 Bacteria 3783
166 Ga0070684_100100316 3300005535 Bacteria 2585
167 Ga0070684_100353189 3300005535 Bacteria 1352
168 Ga0070697_100476289 3300005536 Bacteria 1090
169 Ga0068853_100000342 3300005539 Bacteria 32471
170 Ga0068853_100002373 3300005539 Bacteria 14072
171 Ga0068853_100013841 3300005539 Bacteria 6594
172 Ga0068853_100164151 3300005539 Bacteria 2006
173 Ga0068853_100223366 3300005539 Bacteria 1721
174 Ga0068853_100237579 3300005539 Bacteria 1669
175 Ga0068853_100376264 3300005539 Bacteria 1325
176 Ga0070672_100132185 3300005543 Bacteria 2052
177 Ga0070686_100168806 3300005544 Bacteria 1546
178 Ga0070695_100000657 3300005545 Bacteria 18437
179 Ga0070696_100007361 3300005546 Bacteria 7350
180 Ga0070696_100386486 3300005546 Bacteria 1092
181 Ga0070665_100000937 3300005548 Bacteria 37328
182 Ga0070665_100159460 3300005548 Bacteria 2258
183 Ga0070665_100245297 3300005548 Bacteria 1792
184 Ga0070665_100306322 3300005548 Bacteria 1592
185 Ga0070665_100419424 3300005548 Bacteria 1347
186 Ga0070665_100423525 3300005548 Bacteria 1340
187 Ga0070665_100532976 3300005548 Bacteria 1186
188 Ga0070665_100737797 3300005548 Bacteria 998
189 Ga0070704_100001753 3300005549 Bacteria 11864
190 Ga0070704_100302493 3300005549 Bacteria 1333
191 Ga0068855_100021596 3300005563 Bacteria 7721
192 Ga0068855_100190786 3300005563 Bacteria 2312
193 Ga0068855_100495888 3300005563 Bacteria 1328
194 Ga0068855_100823789 3300005563 Bacteria 985
195 Ga0070664_100000082 3300005564 Bacteria 60083
196 Ga0070664_100004455 3300005564 Bacteria 11251
197 Ga0070664_100326470 3300005564 Bacteria 1391
198 Ga0070664_100985737 3300005564 Bacteria 792
199 Ga0068857_100004407 3300005577 Bacteria 11899
200 Ga0068857_100015287 3300005577 Bacteria 6700
201 Ga0068857_100131484 3300005577 Bacteria 2257
202 Ga0068854_100061948 3300005578 Bacteria 2710
203 Ga0068854_100163575 3300005578 Bacteria 1726
204 Ga0068854_100408998 3300005578 Bacteria 1124
205 Ga0068856_100000085 3300005614 Bacteria 87665
206 Ga0068856_100015293 3300005614 Bacteria 7415
207 Ga0068856_100082663 3300005614 Bacteria 3187
208 Ga0068856_100111687 3300005614 Bacteria 2730
209 Ga0068856_100140701 3300005614 Bacteria 2420
210 Ga0070702_100122429 3300005615 Bacteria 1630
211 Ga0068852_100007528 3300005616 Bacteria 7950
212 Ga0068852_100207630 3300005616 Bacteria 1856
213 Ga0068859_100000068 3300005617 Bacteria 96701
214 Ga0068859_100014603 3300005617 Bacteria 7888
215 Ga0068859_100021782 3300005617 Bacteria 6428
216 Ga0068859_100043104 3300005617 Bacteria 4534
217 Ga0068864_100000339 3300005618 Bacteria 41252
218 Ga0068864_100007897 3300005618 Bacteria 8767
219 Ga0068864_100029139 3300005618 Bacteria 4671
220 Ga0068864_100041811 3300005618 Bacteria 3920
221 Ga0068864_100068189 3300005618 Bacteria 3090
222 Ga0068861_100365092 3300005719 Bacteria 1271
223 Ga0068861_100704500 3300005719 Bacteria 938
224 Ga0068851_10004531 3300005834 Bacteria 6267
225 Ga0068851_10017285 3300005834 Bacteria 3463
226 Ga0068851_10034334 3300005834 Bacteria 2531
227 Ga0068851_10067695 3300005834 Bacteria 1842
228 Ga0068851_10505859 3300005834 Bacteria 725
229 Ga0068870_10261182 3300005840 Bacteria 1078
230 Ga0068870_10279070 3300005840 Bacteria 1047
231 Ga0068863_100000535 3300005841 Bacteria 38753
232 Ga0068863_100009175 3300005841 Bacteria 9650
233 Ga0068863_100040654 3300005841 Bacteria 4421
234 Ga0068863_100067181 3300005841 Bacteria 3391
235 Ga0068863_100320759 3300005841 Bacteria 1505
236 Ga0068858_100069802 3300005842 Bacteria 3257
237 Ga0068860_100015416 3300005843 Bacteria 7466
238 Ga0068860_100052325 3300005843 Bacteria 3884
239 Ga0068862_100007255 3300005844 Bacteria 9201
240 Ga0068862_100008073 3300005844 Bacteria 8713
241 Ga0068862_100205887 3300005844 Bacteria 1776
242 Ga0068862_100483681 3300005844 Bacteria 1172
243 Ga0081455_10000545 3300005937 Bacteria 48941
244 Ga0081455_10074535 3300005937 Bacteria 2803
245 Ga0081455_10109732 3300005937 Bacteria 2195
246 Ga0081539_10070068 3300005985 Bacteria 1884
247 Ga0075365_10002469 3300006038 Bacteria 9082
248 Ga0075365_10003608 3300006038 Bacteria 8011
249 Ga0075365_10032760 3300006038 Bacteria 3344
250 Ga0075368_10000791 3300006042 Bacteria 9712
251 Ga0075368_10001299 3300006042 Bacteria 7919
252 Ga0075368_10005248 3300006042 Bacteria 4449
253 Ga0075368_10025919 3300006042 Bacteria 2252
254 Ga0075368_10031036 3300006042 Bacteria 2071
255 Ga0075368_10048083 3300006042 Bacteria 1690
256 Ga0075368_10140048 3300006042 Bacteria 1008
257 Ga0075363_100021865 3300006048 Bacteria 3228
258 Ga0075363_100024186 3300006048 Bacteria 3085
259 Ga0075363_100030337 3300006048 Bacteria 2798
260 Ga0075363_100054278 3300006048 Bacteria 2143
261 Ga0075363_100056239 3300006048 Bacteria 2109
262 Ga0075364_10003077 3300006051 Bacteria 9425
263 Ga0075364_10017668 3300006051 Bacteria 4460
264 Ga0075364_10139176 3300006051 Bacteria 1632
265 Ga0075362_10010129 3300006177 Bacteria 3671
266 Ga0075367_10004018 3300006178 Bacteria 7113
267 Ga0075367_10007480 3300006178 Bacteria 5595
268 Ga0075367_10020318 3300006178 Bacteria 3696
269 Ga0075367_10321591 3300006178 Bacteria 975
270 Ga0075369_10056310 3300006186 Bacteria 1709
271 Ga0075369_10289131 3300006186 Bacteria 764
272 Ga0075366_10000883 3300006195 Bacteria 14482
273 Ga0097621_100010319 3300006237 Bacteria 6827
274 Ga0097621_100066229 3300006237 Bacteria 2975
275 Ga0075370_10018662 3300006353 Bacteria 3764
276 Ga0075370_10034556 3300006353 Bacteria 2834
277 Ga0075370_10206516 3300006353 Bacteria 1159
278 Ga0075370_10225078 3300006353 Bacteria 1109
279 Ga0075370_10283212 3300006353 Bacteria 985
280 Ga0075370_10358183 3300006353 Bacteria 872
281 Ga0068871_100039095 3300006358 Bacteria 3794
282 Ga0075428_100917773 3300006844 Bacteria 929
283 Ga0075430_100069684 3300006846 Bacteria 2950
284 Ga0075430_100078448 3300006846 Bacteria 2768
285 Ga0075430_100619620 3300006846 Bacteria 893
286 Ga0075431_100003896 3300006847 Bacteria 14523
287 Ga0075431_100004223 3300006847 Bacteria 14073
288 Ga0075431_100042858 3300006847 Bacteria 4668
289 Ga0075431_100049916 3300006847 Bacteria 4314
290 Ga0075431_100236910 3300006847 Bacteria 1858
291 Ga0075431_100269453 3300006847 Bacteria 1726
292 Ga0075433_10031492 3300006852 Bacteria 4535
293 Ga0075433_11032696 3300006852 Bacteria 716
294 Ga0075434_100081577 3300006871 Bacteria 3232
295 Ga0075434_100194051 3300006871 Bacteria 2051
296 Ga0075434_100255331 3300006871 Bacteria 1772
297 Ga0075434_100335797 3300006871 Bacteria 1532
298 Ga0075429_100026019 3300006880 Bacteria 5078
299 Ga0068865_100362021 3300006881 Bacteria 1178
300 Ga0097620_100000068 3300006931 Bacteria 96701
301 Ga0097620_100014604 3300006931 Bacteria 7888
302 Ga0097620_100021781 3300006931 Bacteria 6428
303 Ga0097620_100043105 3300006931 Bacteria 4534
304 Ga0099824_1005597 3300006942 Bacteria 17628
305 Ga0079104_1000125 3300006946 Bacteria 110104
306 Ga0079104_1000777 3300006946 Bacteria 27197
307 Ga0079104_1018873 3300006946 Bacteria 1942
308 Ga0099826_10015705 3300006948 Bacteria 5721
309 Ga0099826_10020216 3300006948 Bacteria 4998
310 Ga0075435_100467799 3300007076 Bacteria 1088
311 Ga0105250_10005874 3300009092 Bacteria 5439
312 Ga0105250_10098485 3300009092 Bacteria 1192
313 Ga0105240_10000310 3300009093 Bacteria 93883
314 Ga0105240_10045075 3300009093 Bacteria 5597
315 Ga0105240_10216325 3300009093 Bacteria 2235
316 Ga0105240_10479266 3300009093 Bacteria 1387
317 Ga0105240_10829396 3300009093 Bacteria 1000
318 Ga0111539_10020472 3300009094 Bacteria 8146
319 Ga0105245_10005749 3300009098 Bacteria 10885
320 Ga0105245_10923469 3300009098 Bacteria 915
321 Ga0105247_10019921 3300009101 Bacteria 4029
322 Ga0105247_10070905 3300009101 Bacteria 2178
323 Ga0114129_10159134 3300009147 Bacteria 3087
324 Ga0114129_10221355 3300009147 Bacteria 2553
325 Ga0114129_10233827 3300009147 Bacteria 2474
326 Ga0114129_10297959 3300009147 Bacteria 2150
327 Ga0114129_10805595 3300009147 Bacteria 1198
328 Ga0105243_10003568 3300009148 Bacteria 12561
329 Ga0105243_10241288 3300009148 Bacteria 1608
330 Ga0105243_10674710 3300009148 Bacteria 1004
331 Ga0105241_10242644 3300009174 Bacteria 1524
332 Ga0105241_10338070 3300009174 Bacteria 1304
333 Ga0105241_10449044 3300009174 Bacteria 1140
334 Ga0105241_10633525 3300009174 Bacteria 969
335 Ga0105241_10657845 3300009174 Bacteria 952
336 Ga0105241_11203511 3300009174 Bacteria 718
337 Ga0105242_10016587 3300009176 Bacteria 5728
338 Ga0105248_10000059 3300009177 Bacteria 137176
339 Ga0105248_10000071 3300009177 Bacteria 118281
340 Ga0105248_10016891 3300009177 Bacteria 8035
341 Ga0105248_10125939 3300009177 Bacteria 2890
342 Ga0105248_10442637 3300009177 Bacteria 1464
343 Ga0105248_10652117 3300009177 Bacteria 1188
344 Ga0105237_10000459 3300009545 Bacteria 57762
345 Ga0105237_10002190 3300009545 Bacteria 24450
346 Ga0105237_10027740 3300009545 Bacteria 5773
347 Ga0105237_10517685 3300009545 Bacteria 1199
348 Ga0105238_10002270 3300009551 Bacteria 19365
349 Ga0105238_10009673 3300009551 Bacteria 9649
350 Ga0105238_10039938 3300009551 Bacteria 4756
351 Ga0105238_10396975 3300009551 Bacteria 1372
352 Ga0105238_10639347 3300009551 Bacteria 1073
353 Ga0105238_11193250 3300009551 Bacteria 785
354 Ga0105249_10000064 3300009553 Bacteria 151646
355 Ga0105249_10004443 3300009553 Bacteria 12140
356 Ga0105249_10676556 3300009553 Bacteria 1091
357 Ga0123341_1000017 3300009765 Bacteria 82963
358 Ga0123342_1029556 3300009766 Bacteria 2837
359 Ga0105239_10006653 3300010375 Bacteria 13371
360 Ga0105239_10012124 3300010375 Bacteria 9611
361 Ga0105239_10056820 3300010375 Bacteria 4292
362 Ga0105239_10218974 3300010375 Bacteria 2135
363 Ga0105239_10338430 3300010375 Bacteria 1698
364 Ga0105239_10370956 3300010375 Bacteria 1617
365 Ga0105239_10409896 3300010375 Bacteria 1534
366 Ga0105239_10504550 3300010375 Bacteria 1375
367 Ga0105239_10538971 3300010375 Bacteria 1329
368 Ga0105239_10565985 3300010375 Bacteria 1295
369 Ga0105239_10801957 3300010375 Bacteria 1079
370 Ga0105246_10008225 3300011119 Bacteria 6408
371 Ga0105246_10018438 3300011119 Bacteria 4448
372 Ga0157322_1000372 3300012490 Bacteria 1588
373 Ga0157373_10007416 3300013100 Bacteria 8156
374 Ga0157373_10036131 3300013100 Bacteria 3547
375 Ga0157373_10038404 3300013100 Bacteria 3432
376 Ga0157373_10093807 3300013100 Bacteria 2114
377 Ga0157373_10477277 3300013100 Bacteria 899
378 Ga0157371_10000004 3300013102 Bacteria 512593
379 Ga0157371_10006091 3300013102 Bacteria 10029
380 Ga0157371_10008339 3300013102 Bacteria 8268
381 Ga0157371_10037322 3300013102 Bacteria 3478
382 Ga0157371_10875522 3300013102 Bacteria 680
383 Ga0157370_10001506 3300013104 Bacteria 28774
384 Ga0157370_10010062 3300013104 Bacteria 10000
385 Ga0157370_10039889 3300013104 Bacteria 4535
386 Ga0157370_10153906 3300013104 Bacteria 2139
387 Ga0157369_10034621 3300013105 Bacteria 5540
388 Ga0157369_10049778 3300013105 Bacteria 4540
389 Ga0157369_10148721 3300013105 Bacteria 2476
390 Ga0171463_1001 3300013249 Bacteria 1406070
391 Ga0157374_10035946 3300013296 Bacteria 4535
392 Ga0157378_10023762 3300013297 Bacteria 5392
393 Ga0157378_10078681 3300013297 Bacteria 2975
394 Ga0163162_10077001 3300013306 Bacteria 3398
395 Ga0163162_10244138 3300013306 Bacteria 1927
396 Ga0163162_10965851 3300013306 Bacteria 962
397 Ga0157372_10181542 3300013307 Bacteria 2436
398 Ga0157372_10973294 3300013307 Bacteria 983
399 Ga0157372_11329973 3300013307 Bacteria 829
400 Ga0157375_10073535 3300013308 Bacteria 3437
401 Ga0157375_10705360 3300013308 Bacteria 1162
402 Ga0157375_11329578 3300013308 Bacteria 845
403 Ga0163163_10000763 3300014325 Bacteria 27341
404 Ga0163163_10000995 3300014325 Bacteria 23981
405 Ga0163163_10020373 3300014325 Bacteria 6244
406 Ga0163163_10083912 3300014325 Bacteria 3192
407 Ga0163163_10493253 3300014325 Bacteria 1286
408 Ga0163163_10517943 3300014325 Bacteria 1255
409 Ga0163163_10579196 3300014325 Bacteria 1185
410 Ga0157380_10000086 3300014326 Bacteria 51604
411 Ga0157380_10000723 3300014326 Bacteria 20585
412 Ga0157380_10028805 3300014326 Bacteria 4239
413 Ga0157380_10591695 3300014326 Bacteria 1096
414 Ga0182008_10020916 3300014497 Bacteria 3366
415 Ga0182008_10025465 3300014497 Bacteria 3004
416 Ga0157379_10002697 3300014968 Bacteria 14964
417 Ga0157379_10012611 3300014968 Bacteria 7382
418 Ga0157379_10050744 3300014968 Bacteria 3704
419 Ga0157379_10062874 3300014968 Bacteria 3319
420 Ga0157379_10285667 3300014968 Bacteria 1502
421 Ga0157379_11349690 3300014968 Bacteria 690
422 Ga0182007_10001994 3300015262 Bacteria 10528
423 Ga0183365_10115 3300015684 Bacteria 1996
424 Ga0183363_1187 3300015690 Bacteria 13377
425 Ga0214544_1000434 3300021320 Bacteria 75507
426 Ga0214542_1000146 3300021321 Bacteria 103035
427 Ga0214542_1025313 3300021321 Bacteria 3121
428 Ga0214543_1000049 3300021327 Bacteria 149506
429 Ga0214543_1000054 3300021327 Bacteria 140288
430 Ga0213873_10000008 3300021358 Bacteria 263363
431 Ga0213874_10014768 3300021377 Bacteria 2048
432 Ga0213876_10000005 3300021384 Bacteria 727326
433 Ga0228711_1000006 3300022739 Bacteria 202437
434 Ga0228710_1000004 3300022740 Bacteria 250560
435 Ga0209435_100049 3300025206 Bacteria 92067
436 Ga0209760_103481 3300025207 Bacteria 1395
437 Ga0209436_100107 3300025208 Bacteria 41305
438 Ga0209436_101564 3300025208 Bacteria 7745
439 Ga0209563_104898 3300025230 Bacteria 2497
440 Ga0209437_100376 3300025233 Bacteria 45400
441 Ga0209437_100981 3300025233 Bacteria 10063
442 Ga0207425_1000052 3300025245 Bacteria 162123
443 Ga0207425_1007278 3300025245 Bacteria 2940
444 Ga0207425_1015373 3300025245 Bacteria 1719
445 Ga0207425_1019367 3300025245 Bacteria 1466
446 Ga0207425_1025537 3300025245 Bacteria 1218
447 Ga0209646_1000159 3300025246 Bacteria 92067
448 Ga0209646_1031776 3300025246 Bacteria 705
449 Ga0209026_1000013 3300025250 Bacteria 415633
450 Ga0209026_1000183 3300025250 Bacteria 92067
451 Ga0209677_100684 3300025253 Bacteria 17367
452 Ga0209148_1000032 3300025254 Bacteria 557660
453 Ga0209148_1012400 3300025254 Bacteria 1560
454 Ga0209759_1000058 3300025256 Bacteria 203580
455 Ga0209759_1000206 3300025256 Bacteria 92067
456 Ga0209129_1000512 3300025258 Bacteria 27712
457 Ga0209129_1000652 3300025258 Bacteria 23241
458 Ga0209129_1000779 3300025258 Bacteria 20145
459 Ga0209129_1001160 3300025258 Bacteria 15200
460 Ga0209129_1002177 3300025258 Bacteria 9873
461 Ga0209129_1008991 3300025258 Bacteria 2696
462 Ga0209233_1000034 3300025261 Bacteria 578898
463 Ga0209233_1000368 3300025261 Bacteria 40743
464 Ga0209233_1000423 3300025261 Bacteria 31308
465 Ga0209233_1000458 3300025261 Bacteria 26629
466 Ga0209233_1005874 3300025261 Bacteria 4026
467 Ga0209233_1023863 3300025261 Bacteria 1540
468 Ga0209565_1000099 3300025263 Bacteria 131080
469 Ga0209455_1000098 3300025272 Bacteria 213890
470 Ga0209673_1000024 3300025273 Bacteria 409632
471 Ga0209673_1000358 3300025273 Bacteria 82232
472 Ga0209673_1000526 3300025273 Bacteria 62641
473 Ga0209673_1005762 3300025273 Bacteria 6165
474 Ga0209673_1006556 3300025273 Bacteria 5581
475 Ga0209673_1011840 3300025273 Bacteria 3562
476 Ga0209673_1017558 3300025273 Bacteria 2635
477 Ga0209130_1000002 3300025284 Bacteria 722648
478 Ga0209130_1000005 3300025284 Bacteria 599620
479 Ga0209130_1000377 3300025284 Bacteria 50153
480 Ga0209130_1022883 3300025284 Bacteria 1387
481 Ga0209676_1000187 3300025292 Bacteria 141338
482 Ga0209676_1008136 3300025292 Bacteria 4747
483 Ga0209025_1000037 3300025294 Bacteria 383429
484 Ga0209025_1000144 3300025294 Bacteria 181446
485 Ga0209025_1000274 3300025294 Bacteria 119322
486 Ga0209025_1000553 3300025294 Bacteria 69760
487 Ga0209025_1001763 3300025294 Bacteria 25860
488 Ga0209025_1001809 3300025294 Bacteria 25289
489 Ga0209025_1014907 3300025294 Bacteria 4736
490 Ga0209025_1017884 3300025294 Bacteria 4061
491 Ga0209025_1028305 3300025294 Bacteria 2751
492 Ga0209564_1000113 3300025295 Bacteria 211564
493 Ga0209564_1001082 3300025295 Bacteria 32571
494 Ga0209564_1003178 3300025295 Bacteria 11543
495 Ga0209564_1003326 3300025295 Bacteria 11170
496 Ga0209564_1003465 3300025295 Bacteria 10757
497 Ga0209564_1004032 3300025295 Bacteria 9283
498 Ga0209564_1004773 3300025295 Bacteria 8092
499 Ga0209758_1000519 3300025297 Bacteria 61859
500 Ga0209758_1000744 3300025297 Bacteria 47380
501 Ga0209758_1003444 3300025297 Bacteria 14386
502 Ga0209758_1003617 3300025297 Bacteria 13829
503 Ga0209758_1003869 3300025297 Bacteria 13112
504 Ga0209758_1006551 3300025297 Bacteria 8296
505 Ga0209758_1010846 3300025297 Bacteria 5381
506 Ga0209758_1019765 3300025297 Bacteria 3228
507 Ga0209050_1010553 3300025298 Bacteria 4532
508 Ga0209050_1012338 3300025298 Bacteria 3929
509 Ga0209050_1022296 3300025298 Bacteria 2272
510 Ga0209256_1000595 3300025299 Bacteria 50352
511 Ga0209256_1000779 3300025299 Bacteria 41192
512 Ga0209256_1001173 3300025299 Bacteria 29524
513 Ga0209256_1001742 3300025299 Bacteria 20785
514 Ga0209256_1003431 3300025299 Bacteria 11131
515 Ga0209256_1006686 3300025299 Bacteria 5991
516 Ga0207426_1000013 3300025302 Bacteria 721897
517 Ga0207426_1000015 3300025302 Bacteria 599316
518 Ga0207426_1000142 3300025302 Bacteria 194023
519 Ga0207426_1000330 3300025302 Bacteria 89992
520 Ga0207426_1016841 3300025302 Bacteria 2611
521 Ga0209051_1000170 3300025303 Bacteria 119026
522 Ga0209051_1003992 3300025303 Bacteria 9367
523 Ga0209051_1041857 3300025303 Bacteria 1625
524 Ga0209051_1072126 3300025303 Bacteria 1034
525 Ga0209257_1003747 3300025304 Bacteria 12587
526 Ga0209257_1004397 3300025304 Bacteria 10948
527 Ga0207697_10015942 3300025315 Bacteria 3099
528 Ga0207656_10011471 3300025321 Bacteria 3349
529 Ga0207656_10064926 3300025321 Bacteria 1610
530 Ga0207653_10001613 3300025885 Bacteria 7261
531 Ga0207710_10154789 3300025900 Bacteria 1114
532 Ga0207688_10270608 3300025901 Bacteria 1033
533 Ga0207680_10001402 3300025903 Bacteria 11401
534 Ga0207680_10001928 3300025903 Bacteria 9728
535 Ga0207647_10007819 3300025904 Bacteria 7697
536 Ga0207647_10015676 3300025904 Bacteria 5190
537 Ga0207647_10017963 3300025904 Bacteria 4795
538 Ga0207647_10036486 3300025904 Bacteria 3123
539 Ga0207647_10313909 3300025904 Bacteria 891
540 Ga0207645_10477341 3300025907 Bacteria 843
541 Ga0207705_10000062 3300025909 Bacteria 149432
542 Ga0207705_10009913 3300025909 Bacteria 6936
543 Ga0207705_10035585 3300025909 Bacteria 3562
544 Ga0207654_10000874 3300025911 Bacteria 16703
545 Ga0207654_10103025 3300025911 Bacteria 1762
546 Ga0207654_10170111 3300025911 Bacteria 1414
547 Ga0207707_10049317 3300025912 Bacteria 3668
548 Ga0207707_10635272 3300025912 Bacteria 901
549 Ga0207695_10000403 3300025913 Bacteria 96385
550 Ga0207695_10078433 3300025913 Bacteria 3351
551 Ga0207695_10299401 3300025913 Bacteria 1500
552 Ga0207695_10468702 3300025913 Bacteria 1142
553 Ga0207671_10000277 3300025914 Bacteria 76473
554 Ga0207671_10014940 3300025914 Bacteria 6104
555 Ga0207671_10040568 3300025914 Bacteria 3446
556 Ga0207660_10008981 3300025917 Bacteria 6468
557 Ga0207660_10217892 3300025917 Bacteria 1497
558 Ga0207657_10000015 3300025919 Bacteria 175776
559 Ga0207657_10002661 3300025919 Bacteria 19282
560 Ga0207657_10015543 3300025919 Bacteria 7372
561 Ga0207657_10036956 3300025919 Bacteria 4367
562 Ga0207657_10174156 3300025919 Bacteria 1742
563 Ga0207649_10000264 3300025920 Bacteria 41423
564 Ga0207649_10089675 3300025920 Bacteria 2010
565 Ga0207649_10291322 3300025920 Bacteria 1190
566 Ga0207649_10435508 3300025920 Bacteria 987
567 Ga0207652_10048966 3300025921 Bacteria 3615
568 Ga0207652_10874395 3300025921 Bacteria 795
569 Ga0207646_10353556 3300025922 Bacteria 1328
570 Ga0207681_10074068 3300025923 Bacteria 2384
571 Ga0207681_10086320 3300025923 Bacteria 2229
572 Ga0207681_10182161 3300025923 Bacteria 1601
573 Ga0207681_10280828 3300025923 Bacteria 1311
574 Ga0207694_10000306 3300025924 Bacteria 46009
575 Ga0207694_10021174 3300025924 Bacteria 4924
576 Ga0207694_10142708 3300025924 Bacteria 1926
577 Ga0207694_10215765 3300025924 Bacteria 1564
578 Ga0207694_10490150 3300025924 Bacteria 1028
579 Ga0207650_10007746 3300025925 Bacteria 7321
580 Ga0207650_10014713 3300025925 Bacteria 5437
581 Ga0207687_10126221 3300025927 Bacteria 1921
582 Ga0207687_10146986 3300025927 Bacteria 1794
583 Ga0207644_10000274 3300025931 Bacteria 34175
584 Ga0207644_10025358 3300025931 Bacteria 4078
585 Ga0207644_10109491 3300025931 Bacteria 2087
586 Ga0207644_10114325 3300025931 Bacteria 2045
587 Ga0207644_10137528 3300025931 Bacteria 1877
588 Ga0207644_10265209 3300025931 Bacteria 1374
589 Ga0207690_10000032 3300025932 Bacteria 152479
590 Ga0207690_10181782 3300025932 Bacteria 1584
591 Ga0207690_10239786 3300025932 Bacteria 1396
592 Ga0207690_10403487 3300025932 Bacteria 1090
593 Ga0207706_10000032 3300025933 Bacteria 142723
594 Ga0207706_10000143 3300025933 Bacteria 77680
595 Ga0207706_10013628 3300025933 Bacteria 7383
596 Ga0207706_10025353 3300025933 Bacteria 5313
597 Ga0207706_10110034 3300025933 Bacteria 2424
598 Ga0207686_10167263 3300025934 Bacteria 1547
599 Ga0207709_10074535 3300025935 Bacteria 2166
600 Ga0207670_10167942 3300025936 Bacteria 1643
601 Ga0207669_10004579 3300025937 Bacteria 6099
602 Ga0207691_10003446 3300025940 Bacteria 15387
603 Ga0207691_10066693 3300025940 Bacteria 3256
604 Ga0207691_10280006 3300025940 Bacteria 1435
605 Ga0207711_10000046 3300025941 Bacteria 153238
606 Ga0207711_10000476 3300025941 Bacteria 41373
607 Ga0207711_10194323 3300025941 Bacteria 1850
608 Ga0207711_10472544 3300025941 Bacteria 1168
609 Ga0207689_10372285 3300025942 Bacteria 1189
610 Ga0207661_10007272 3300025944 Bacteria 7877
611 Ga0207679_10001577 3300025945 Bacteria 14256
612 Ga0207679_10076796 3300025945 Bacteria 2539
613 Ga0207679_10265120 3300025945 Bacteria 1467
614 Ga0207667_10028393 3300025949 Bacteria 6078
615 Ga0207667_10038209 3300025949 Bacteria 5128
616 Ga0207667_10326844 3300025949 Bacteria 1566
617 Ga0207667_10545678 3300025949 Bacteria 1173
618 Ga0207667_10674262 3300025949 Bacteria 1038
619 Ga0207651_10013384 3300025960 Bacteria 4693
620 Ga0207651_10042757 3300025960 Bacteria 3018
621 Ga0207651_10244291 3300025960 Bacteria 1465
622 Ga0207712_10000886 3300025961 Bacteria 21743
623 Ga0207712_10488670 3300025961 Bacteria 1050
624 Ga0207668_10004433 3300025972 Bacteria 8244
625 Ga0207668_10071369 3300025972 Bacteria 2480
626 Ga0207668_10235057 3300025972 Bacteria 1480
627 Ga0207668_10239049 3300025972 Bacteria 1468
628 Ga0207668_10590693 3300025972 Bacteria 966
629 Ga0207668_10671616 3300025972 Bacteria 908
630 Ga0207668_11053288 3300025972 Bacteria 728
631 Ga0207640_10103651 3300025981 Bacteria 2000
632 Ga0207640_10293073 3300025981 Bacteria 1283
633 Ga0207640_10508731 3300025981 Bacteria 1004
634 Ga0207658_10004756 3300025986 Bacteria 9397
635 Ga0207658_10005211 3300025986 Bacteria 8947
636 Ga0207658_10027076 3300025986 Bacteria 4026
637 Ga0207658_10029233 3300025986 Bacteria 3890
638 Ga0207658_10032979 3300025986 Bacteria 3691
639 Ga0207658_10397342 3300025986 Bacteria 1211
640 Ga0207677_10153672 3300026023 Bacteria 1779
641 Ga0207703_10002986 3300026035 Bacteria 14344
642 Ga0207703_10005757 3300026035 Bacteria 9930
643 Ga0207703_10063370 3300026035 Bacteria 3031
644 Ga0207703_10505838 3300026035 Bacteria 1135
645 Ga0207703_10552794 3300026035 Bacteria 1085
646 Ga0207639_10000803 3300026041 Bacteria 21340
647 Ga0207639_10007131 3300026041 Bacteria 7616
648 Ga0207639_10008528 3300026041 Bacteria 7032
649 Ga0207639_10039824 3300026041 Bacteria 3504
650 Ga0207639_10109867 3300026041 Bacteria 2245
651 Ga0207639_10175006 3300026041 Bacteria 1821
652 Ga0207639_10209237 3300026041 Bacteria 1678
653 Ga0207678_10001844 3300026067 Bacteria 19420
654 Ga0207678_10068205 3300026067 Bacteria 3052
655 Ga0207678_10070354 3300026067 Bacteria 3000
656 Ga0207708_10001520 3300026075 Bacteria 17286
657 Ga0207708_10889159 3300026075 Bacteria 770
658 Ga0207702_10000072 3300026078 Bacteria 113840
659 Ga0207702_10000122 3300026078 Bacteria 91685
660 Ga0207702_10049364 3300026078 Bacteria 3551
661 Ga0207702_10069413 3300026078 Bacteria 3030
662 Ga0207641_10002509 3300026088 Bacteria 16932
663 Ga0207641_10002978 3300026088 Bacteria 15327
664 Ga0207641_10032289 3300026088 Bacteria 4346
665 Ga0207641_10552997 3300026088 Bacteria 1122
666 Ga0207648_10002810 3300026089 Bacteria 18461
667 Ga0207648_10110950 3300026089 Bacteria 2408
668 Ga0207648_10198516 3300026089 Bacteria 1779
669 Ga0207648_10566387 3300026089 Bacteria 1045
670 Ga0207676_10021524 3300026095 Bacteria 4730
671 Ga0207676_10026852 3300026095 Bacteria 4283
672 Ga0207676_10133358 3300026095 Bacteria 2115
673 Ga0207676_11107667 3300026095 Bacteria 783
674 Ga0207674_10001996 3300026116 Bacteria 25880
675 Ga0207674_10014657 3300026116 Bacteria 8644
676 Ga0207674_10019607 3300026116 Bacteria 7323
677 Ga0207674_10021817 3300026116 Bacteria 6892
678 Ga0207674_10049158 3300026116 Bacteria 4314
679 Ga0207674_10064762 3300026116 Bacteria 3686
680 Ga0207674_10093240 3300026116 Bacteria 3000
681 Ga0207675_100245415 3300026118 Bacteria 1731
682 Ga0207675_100440132 3300026118 Bacteria 1290
683 Ga0207675_100795184 3300026118 Bacteria 959
684 Ga0207683_10014479 3300026121 Bacteria 6716
685 Ga0207683_10277533 3300026121 Bacteria 1531
686 Ga0207683_10434647 3300026121 Bacteria 1209
687 Ga0207698_10359265 3300026142 Bacteria 1379
688 Ga0207698_10635680 3300026142 Bacteria 1056
689 Ga0209281_1000102 3300027111 Bacteria 221665
690 Ga0209281_1000242 3300027111 Bacteria 110116
691 Ga0209281_1001000 3300027111 Bacteria 22299
692 Ga0209371_1000009 3300027312 Bacteria 963030
693 Ga0209371_1000753 3300027312 Bacteria 27006
694 Ga0209371_1010361 3300027312 Bacteria 2877
695 Ga0209282_1000013 3300027666 Bacteria 215053
696 Ga0209282_1054350 3300027666 Bacteria 2273
697 Ga0209813_10000400 3300027866 Bacteria 10671
698 Ga0209813_10006650 3300027866 Bacteria 2861
699 Ga0209813_10099328 3300027866 Bacteria 988
700 Ga0209813_10256829 3300027866 Bacteria 666
701 Ga0209974_10090688 3300027876 Bacteria 1060
702 Ga0207428_10142986 3300027907 Bacteria 1825
703 Ga0268266_10015894 3300028379 Bacteria 6441
704 Ga0268266_10029225 3300028379 Bacteria 4686
705 Ga0268266_10075513 3300028379 Bacteria 2928
706 Ga0268266_10196760 3300028379 Bacteria 1843
707 Ga0268266_10373791 3300028379 Bacteria 1343
708 Ga0268266_10455714 3300028379 Bacteria 1216
709 Ga0268265_10001073 3300028380 Bacteria 24373
710 Ga0268265_10011654 3300028380 Bacteria 5946
711 Ga0268265_10326542 3300028380 Bacteria 1392
712 Ga0268265_10450413 3300028380 Bacteria 1202
713 Ga0268265_10565486 3300028380 Bacteria 1081
714 Ga0268264_10000395 3300028381 Bacteria 62904
715 Ga0268264_10001789 3300028381 Bacteria 19645
716 Ga0268264_10073176 3300028381 Bacteria 2907
717 Ga0268264_10173491 3300028381 Bacteria 1952
718 Ga0307515_10000029 3300028794 Bacteria 365410
719 Ga0307515_10004789 3300028794 Bacteria 27696
720 Ga0307515_10090749 3300028794 Bacteria 3828
721 Ga0307515_10452174 3300028794 Bacteria 900
722 Ga0268256_1000010 3300030500 Bacteria 963034
723 Ga0268256_1006679 3300030500 Bacteria 4246
724 Ga0268256_1011108 3300030500 Bacteria 2877
725 Ga0316183_1167184 3300030742 Bacteria 1093
726 Ga0316181_1012451 3300030744 Bacteria 1527
727 Ga0307513_10000259 3300031456 Bacteria 76155
728 Ga0307513_10006892 3300031456 Bacteria 14788
729 Ga0307513_10612286 3300031456 Bacteria 798
730 Ga0307408_100139087 3300031548 Bacteria 1904
731 Ga0307408_100188754 3300031548 Bacteria 1659
732 Ga0307408_100224344 3300031548 Bacteria 1535
733 Ga0307408_100356614 3300031548 Bacteria 1242
734 Ga0307408_100560723 3300031548 Bacteria 1009
735 Ga0307408_100624612 3300031548 Bacteria 960
736 Ga0307405_10008332 3300031731 Bacteria 5245
737 Ga0307405_10054996 3300031731 Bacteria 2488
738 Ga0307405_10059053 3300031731 Bacteria 2416
739 Ga0307413_10031611 3300031824 Bacteria 2989
740 Ga0307410_10006758 3300031852 Bacteria 6220
741 Ga0307410_10288213 3300031852 Bacteria 1291
742 Ga0307410_10627656 3300031852 Bacteria 899
743 Ga0307410_10738817 3300031852 Bacteria 832
744 Ga0307406_10016724 3300031901 Bacteria 4268
745 Ga0307406_10018389 3300031901 Bacteria 4083
746 Ga0307406_10111758 3300031901 Bacteria 1882
747 Ga0307407_10002381 3300031903 Bacteria 7336
748 Ga0307412_10002473 3300031911 Bacteria 10282
749 Ga0307412_10023437 3300031911 Bacteria 3798
750 Ga0307412_10053096 3300031911 Bacteria 2685
751 Ga0307412_10134912 3300031911 Bacteria 1799
752 Ga0307412_10140704 3300031911 Bacteria 1767
753 Ga0307412_10246717 3300031911 Bacteria 1384
754 Ga0307412_10876026 3300031911 Bacteria 785
755 Ga0315914_1000004 3300031967 Bacteria 288534
756 Ga0307409_100107301 3300031995 Bacteria 2332
757 Ga0307409_100164025 3300031995 Bacteria 1947
758 Ga0307409_101405674 3300031995 Bacteria 724
759 Ga0307416_100083007 3300032002 Bacteria 2717
760 Ga0307416_100102709 3300032002 Bacteria 2493
761 Ga0307416_101127068 3300032002 Bacteria 889
762 Ga0307414_10006754 3300032004 Bacteria 6419
763 Ga0307414_10292130 3300032004 Bacteria 1374
764 Ga0307411_10585835 3300032005 Bacteria 957
765 Ga0307415_100099954 3300032126 Bacteria 2124
766 Ga0307415_100284250 3300032126 Bacteria 1362
767 Ga0307510_10142663 3300033180 Bacteria 2035
768 Ga0315913_1000011 3300033430 Bacteria 140532
769 Ga0315915_1000003 3300033464 Bacteria 407996
770 Ga0373929_0058171 3300035085 Bacteria 899
771 Ga0373932_0104003 3300035112 Bacteria 928
772 Ga0373936_0272166 3300035113 Bacteria 760
773 Ga0373961_0022011 3300035241 Bacteria 1701
774 Ga0373931_0021546 3300035691 Bacteria 3234
775 Ga0373931_0100984 3300035691 Bacteria 1622
776 Ga0373933_0152060 3300035724 Bacteria 1466
777 Ga0373947_0424826 3300035725 Bacteria 898
778 Ga0395899_0000014 3300037312 Bacteria 488813
779 Ga0395899_0000971 3300037312 Bacteria 26509
780 Ga0395899_0060950 3300037312 Bacteria 2779
781 Ga0395899_0121864 3300037312 Bacteria 1867
782 Ga0395899_0130225 3300037312 Bacteria 1797
783 Ga0395899_0326182 3300037312 Bacteria 1033
784 Ga0395899_0533627 3300037312 Bacteria 757
785 Ga0395900_0000007 3300037418 Bacteria 488860
786 Ga0395900_0000036 3300037418 Bacteria 250619
787 Ga0395900_0018509 3300037418 Bacteria 7104
788 Ga0395900_0028651 3300037418 Bacteria 5708
789 Ga0395900_0042991 3300037418 Bacteria 4655
790 Ga0395900_0084674 3300037418 Bacteria 3258
791 Ga0395900_0135408 3300037418 Bacteria 2524
792 Ga0395900_0157240 3300037418 Bacteria 2321
793 Ga0395900_0317510 3300037418 Bacteria 1539
794 Ga0395900_0445879 3300037418 Bacteria 1251
795 Ga0395900_0745373 3300037418 Bacteria 910
796 Ga0395898_0000011 3300037466 Bacteria 488860
797 Ga0395898_0034098 3300037466 Bacteria 5076
798 Ga0395898_0290469 3300037466 Bacteria 1560
799 Ga0395898_0442827 3300037466 Bacteria 1238
800 Ga0395898_0603793 3300037466 Bacteria 1040
801 Ga0395898_0792537 3300037466 Bacteria 888
802 Ga0395905_0000008 3300037471 Bacteria 488860
803 Ga0395905_0000193 3300037471 Bacteria 96667
804 Ga0395905_0001786 3300037471 Bacteria 24960
805 Ga0395905_0012864 3300037471 Bacteria 8044
806 Ga0395905_0022817 3300037471 Bacteria 5916
807 Ga0395905_0026548 3300037471 Bacteria 5460
808 Ga0395905_0049007 3300037471 Bacteria 3958
809 Ga0395905_0112217 3300037471 Bacteria 2560
810 Ga0395905_0171943 3300037471 Bacteria 2035
811 Ga0395905_0176885 3300037471 Bacteria 2003
812 Ga0395905_0332612 3300037471 Bacteria 1409
813 Ga0395905_0364926 3300037471 Bacteria 1337
814 Ga0395905_0472204 3300037471 Bacteria 1153
815 Ga0395905_0483027 3300037471 Bacteria 1138
816 Ga0395905_0740775 3300037471 Bacteria 885
817 Ga0395901_0000020 3300038443 Bacteria 314918
818 Ga0395901_0000036 3300038443 Bacteria 214274
819 Ga0395901_0039656 3300038443 Bacteria 4875
820 Ga0395901_0044421 3300038443 Bacteria 4609
821 Ga0395901_0047397 3300038443 Bacteria 4462
822 Ga0395901_0118490 3300038443 Bacteria 2781
823 Ga0395901_0123607 3300038443 Bacteria 2719
824 Ga0395901_0254740 3300038443 Bacteria 1828
825 Ga0395901_0443470 3300038443 Bacteria 1328
826 Ga0395901_0588547 3300038443 Bacteria 1123
827 Ga0395901_0858477 3300038443 Bacteria 892
828 Ga0395901_1021864 3300038443 Bacteria 801
829 Ga0436365_1858586 3300039437 Bacteria 166193
830 Ga0436361_0925979 3300039447 Bacteria 6184
831 Ga0436363_0580193 3300039450 Bacteria 2424
832 Ga0436362_1035670 3300039453 Bacteria 125910
833 Ga0439436_0004015 3300041404 Bacteria 4509
834 Ga0439436_0119861 3300041404 Bacteria 736
835 Ga0439466_0010643 3300041411 Bacteria 3419
836 Ga0439465_0010834 3300041413 Bacteria 2860
837 Ga0439465_0047824 3300041413 Bacteria 1395
838 Ga0439465_0054871 3300041413 Bacteria 1311
839 Ga0439465_0104418 3300041413 Bacteria 981
840 Ga0439465_0111060 3300041413 Bacteria 954
841 Ga0451791_1632668 3300041451 Bacteria 866
842 Ga0451802_0635447 3300041460 Bacteria 872
843 Ga0451802_2010556 3300041460 Bacteria 857
844 Ga0451833_1047326 3300041491 Bacteria 1632
845 Ga0451835_0225566 3300041492 Bacteria 2770
846 Ga0451837_0612366 3300041494 Bacteria 2050
847 Ga0451839_0144518 3300041496 Bacteria 4834
848 Ga0451845_0139134 3300041501 Bacteria 2205
849 Ga0451849_0490860 3300041505 Bacteria 1755
850 Ga0451850_44427 3300041506 Bacteria 1028
851 Ga0451851_0942673 3300041507 Bacteria 1173
852 Ga0451843_0920087 3300041509 Bacteria 1045
853 Ga0451853_1426223 3300041512 Bacteria 2374
854 Ga0439445_0020758 3300042004 Bacteria 1647
855 Ga0439445_0040819 3300042004 Bacteria 1232
856 Ga0439432_016049 3300042006 Bacteria 2523
857 Ga0439432_021943 3300042006 Bacteria 2112
858 Ga0439452_049293 3300042010 Bacteria 969
859 Ga0450898_036743 3300042134 Bacteria 916
860 Ga0439434_0012666 3300042435 Bacteria 2497
861 Ga0466965_0289886 3300044683 Bacteria 886
862 Ga0466970_0040589 3300044765 Bacteria 2471
863 Ga0495592_0169386 3300046454 Bacteria 1497
864 Ga0495629_0103741 3300046459 Bacteria 1983
865 Ga0495638_0000546 3300046460 Bacteria 42990
866 Ga0495638_0077751 3300046460 Bacteria 2020
867 Ga0495638_0244486 3300046460 Bacteria 992
868 Ga0495605_0054245 3300046474 Bacteria 1942
869 Ga0495605_0130573 3300046474 Bacteria 1133
870 Ga0495639_0045687 3300046475 Bacteria 1982
871 Ga0495662_0015245 3300046476 Bacteria 3734
872 Ga0495664_0209758 3300046477 Bacteria 1180
873 Ga0495585_0020311 3300046492 Bacteria 3821
874 Ga0495585_0037183 3300046492 Bacteria 2742
875 Ga0495585_0099951 3300046492 Bacteria 1552
876 Ga0495607_0128246 3300046501 Bacteria 1323
877 Ga0495583_0008658 3300046506 Bacteria 6191
878 Ga0495606_0002266 3300046507 Bacteria 22765
879 Ga0495606_0073940 3300046507 Bacteria 2136
880 Ga0495606_0147526 3300046507 Bacteria 1383
881 Ga0495606_0222122 3300046507 Bacteria 1064
882 Ga0495608_0278944 3300046511 Bacteria 1038
883 Ga0495610_0005975 3300046512 Bacteria 8516
884 Ga0495610_0020444 3300046512 Bacteria 3675
885 Ga0495610_0023252 3300046512 Bacteria 3374
886 Ga0495616_0293280 3300046513 Bacteria 688
887 Ga0495618_0100793 3300046514 Bacteria 1849
888 Ga0495620_0019578 3300046515 Bacteria 3325
889 Ga0495620_0046384 3300046515 Bacteria 1876
890 Ga0495631_0001028 3300046518 Bacteria 17326
891 Ga0495631_0156984 3300046518 Bacteria 976
892 Ga0495632_0005041 3300046519 Bacteria 8841
893 Ga0495632_0019634 3300046519 Bacteria 3677
894 Ga0495632_0044432 3300046519 Bacteria 2217
895 Ga0495632_0109648 3300046519 Bacteria 1297
896 Ga0495643_0015915 3300046522 Bacteria 4430
897 Ga0495643_0296305 3300046522 Bacteria 739
898 Ga0495648_0096410 3300046524 Bacteria 1643
899 Ga0495648_0208941 3300046524 Bacteria 971
900 Ga0495663_0002151 3300046525 Bacteria 6009
901 Ga0495663_0167341 3300046525 Bacteria 756
902 Ga0495654_0008624 3300046530 Bacteria 5621
903 Ga0495654_0015378 3300046530 Bacteria 4063
904 Ga0495654_0122724 3300046530 Bacteria 1174
905 Ga0495609_0034048 3300046538 Bacteria 2310
906 Ga0495609_0070785 3300046538 Bacteria 1533
907 Ga0495621_0090838 3300046539 Bacteria 1150
908 Ga0495633_0040533 3300046558 Bacteria 2218
909 Ga0495633_0158958 3300046558 Bacteria 1043
910 Ga0495668_0005443 3300046616 Bacteria 8636
911 Ga0495668_0005580 3300046616 Bacteria 8460
912 Ga0495668_0012118 3300046616 Bacteria 5128
913 Ga0495668_0117107 3300046616 Bacteria 1457
914 Ga0495668_0237065 3300046616 Bacteria 999
915 Ga0495625_0018733 3300046660 Bacteria 5393
916 Ga0495625_0077382 3300046660 Bacteria 2324
917 Ga0495625_0083613 3300046660 Bacteria 2218
918 Ga0495625_0197453 3300046660 Bacteria 1330
919 Ga0495625_0443835 3300046660 Bacteria 803
920 Ga0495625_0476483 3300046660 Bacteria 767
921 Ga0495635_0060576 3300046663 Bacteria 2601
922 Ga0495588_0011538 3300046674 Bacteria 4149
923 Ga0495588_0188301 3300046674 Bacteria 1090
924 Ga0495588_0383667 3300046674 Bacteria 738
925 Ga0495657_0027079 3300046675 Bacteria 4051
926 Ga0495658_0154600 3300046683 Bacteria 1411
927 Ga0495669_0017398 3300046684 Bacteria 3086
928 Ga0495624_0059561 3300046690 Bacteria 2396
929 Ga0495670_0012454 3300046691 Bacteria 4183
930 Ga0495670_0129084 3300046691 Bacteria 1317
931 Ga0495671_0056499 3300046692 Bacteria 1943
932 Ga0495649_0083801 3300046694 Bacteria 1703
933 Ga0495600_0094487 3300046809 Bacteria 1949
934 Ga0495660_0101960 3300046810 Bacteria 1476
935 Ga0495660_0114109 3300046810 Bacteria 1375
936 Ga0495604_0012170 3300047317 Bacteria 6839
937 Ga0495636_0006784 3300047318 Bacteria 4501
938 Ga0495636_0119252 3300047318 Bacteria 1166
939 Ga0495672_0127518 3300047320 Bacteria 1343
940 Ga0495676_0180875 3300047321 Bacteria 1478
941 Ga0495676_0728792 3300047321 Bacteria 641
942 Ga0495687_045699 3300047443 Bacteria 1894
943 Ga0495681_0009047 3300047470 Bacteria 6174
944 Ga0495681_0087484 3300047470 Bacteria 1381
945 Ga0495686_0002692 3300047472 Bacteria 16309
946 Ga0495686_0008891 3300047472 Bacteria 7305
947 Ga0495686_0024874 3300047472 Bacteria 3929
948 Ga0495686_0106470 3300047472 Bacteria 1686
949 Ga0496100_0000539 3300048903 Bacteria 17954
950 Ga0496100_0052620 3300048903 Bacteria 2648
951 Ga0496100_0230937 3300048903 Bacteria 1361
952 Ga0496101_0001051 3300048904 Bacteria 16323
953 Ga0496101_0068013 3300048904 Bacteria 2603
954 Ga0496101_0140812 3300048904 Bacteria 1838
955 Ga0496101_0720618 3300048904 Bacteria 787
956 Ga0496102_0004672 3300048905 Bacteria 11585
957 Ga0496102_0029874 3300048905 Bacteria 4877
958 Ga0496102_0283808 3300048905 Bacteria 1560
959 Ga0496102_0305582 3300048905 Bacteria 1499
960 Ga0496102_0724333 3300048905 Bacteria 917
961 Ga0496102_0871759 3300048905 Bacteria 822
962 Ga0496103_0023449 3300048906 Bacteria 3721
963 Ga0496103_0039938 3300048906 Bacteria 2884
964 Ga0496103_0048969 3300048906 Bacteria 2612
965 Ga0496103_0343755 3300048906 Bacteria 959
966 Ga0496104_0000516 3300048907 Bacteria 33106
967 Ga0496104_0001175 3300048907 Bacteria 22476
968 Ga0496104_0131427 3300048907 Bacteria 2405
969 Ga0496104_0151214 3300048907 Bacteria 2228
970 Ga0496104_0310088 3300048907 Bacteria 1491
971 Ga0496105_0014075 3300048908 Bacteria 6366
972 Ga0496105_0148874 3300048908 Bacteria 1925
973 Ga0496105_0167920 3300048908 Bacteria 1800
974 Ga0496106_0001500 3300048909 Bacteria 17550
975 Ga0496106_0019514 3300048909 Bacteria 5030
976 Ga0496106_0038635 3300048909 Bacteria 3573
977 Ga0496106_0095009 3300048909 Bacteria 2305
978 Ga0496106_0105565 3300048909 Bacteria 2189
979 Ga0496106_0219559 3300048909 Bacteria 1516
980 Ga0496106_0634488 3300048909 Bacteria 854
981 Ga0496107_0000744 3300048910 Bacteria 18671
982 Ga0496107_0005294 3300048910 Bacteria 8814
983 Ga0496107_0027556 3300048910 Bacteria 4034
984 Ga0496107_0147097 3300048910 Bacteria 1742
985 Ga0496108_0003683 3300048911 Bacteria 12292
986 Ga0496108_0017150 3300048911 Bacteria 5922
987 Ga0496108_0027601 3300048911 Bacteria 4691
988 Ga0496108_0092744 3300048911 Bacteria 2568
989 Ga0496109_0025205 3300048912 Bacteria 5297
990 Ga0496109_0170583 3300048912 Bacteria 2041
991 Ga0496109_0246123 3300048912 Bacteria 1683
992 Ga0496109_0274186 3300048912 Bacteria 1589
993 Ga0496109_1342714 3300048912 Bacteria 651
994 Ga0496110_0014915 3300048913 Bacteria 6458
995 Ga0496110_0092811 3300048913 Bacteria 2702
996 Ga0496111_0000536 3300048914 Bacteria 19644
997 Ga0496111_0012450 3300048914 Bacteria 5759
998 Ga0496111_0056730 3300048914 Bacteria 2834
999 Ga0496111_0221687 3300048914 Bacteria 1405
1000 Ga0496111_0327211 3300048914 Bacteria 1135
1001 Ga0496112_0001133 3300048915 Bacteria 19825
1002 Ga0496112_0009912 3300048915 Bacteria 8616
1003 Ga0496112_0115472 3300048915 Bacteria 2655
1004 Ga0496112_0222777 3300048915 Bacteria 1842
1005 Ga0496112_0444048 3300048915 Bacteria 1235
1006 Ga0496113_0012994 3300048916 Bacteria 5618
1007 Ga0496113_0034741 3300048916 Bacteria 3681
1008 Ga0496113_0043669 3300048916 Bacteria 3318
1009 Ga0496113_0591913 3300048916 Bacteria 888
1010 Ga0496114_0046637 3300048917 Bacteria 3602
1011 Ga0496114_0079087 3300048917 Bacteria 2775
1012 Ga0496114_0375323 3300048917 Bacteria 1259
1013 Ga0496114_0789337 3300048917 Bacteria 828
1014 Ga0496116_0003263 3300048919 Bacteria 16162
1015 Ga0496116_0008065 3300048919 Bacteria 9210
1016 Ga0496116_0010337 3300048919 Bacteria 7837
1017 Ga0496116_0010585 3300048919 Bacteria 7714
1018 Ga0496116_0017190 3300048919 Bacteria 5626
1019 Ga0496116_0032150 3300048919 Bacteria 3744
1020 Ga0496116_0049407 3300048919 Bacteria 2813
1021 Ga0496116_0099238 3300048919 Bacteria 1744
1022 Ga0496116_0158685 3300048919 Bacteria 1244
1023 Ga0496116_0244906 3300048919 Bacteria 897
1024 Ga0496117_0000002 3300048920 Bacteria 2483758
1025 Ga0496117_0005540 3300048920 Bacteria 13216
1026 Ga0496117_0007528 3300048920 Bacteria 10614
1027 Ga0496117_0013881 3300048920 Bacteria 6985
1028 Ga0496117_0019256 3300048920 Bacteria 5613
1029 Ga0496117_0027688 3300048920 Bacteria 4408
1030 Ga0496117_0029148 3300048920 Bacteria 4260
1031 Ga0496117_0067483 3300048920 Bacteria 2420
1032 Ga0496117_0086136 3300048920 Bacteria 2042
1033 Ga0496118_0001144 3300048921 Bacteria 40942
1034 Ga0496118_0001927 3300048921 Bacteria 29427
1035 Ga0496118_0010886 3300048921 Bacteria 8947
1036 Ga0496118_0012872 3300048921 Bacteria 7973
1037 Ga0496118_0015478 3300048921 Bacteria 7059
1038 Ga0496118_0026093 3300048921 Bacteria 4988
1039 Ga0496118_0031868 3300048921 Bacteria 4359
1040 Ga0496118_0037645 3300048921 Bacteria 3890
1041 Ga0496118_0096433 3300048921 Bacteria 2015
1042 Ga0496118_0144614 3300048921 Bacteria 1500
1043 Ga0496118_0263923 3300048921 Bacteria 969
1044 Ga0496118_0263933 3300048921 Bacteria 969
1045 Ga0496119_0030183 3300048922 Bacteria 3660
1046 Ga0496119_0039982 3300048922 Bacteria 3006
1047 Ga0496119_0061336 3300048922 Bacteria 2246
1048 Ga0496119_0074717 3300048922 Bacteria 1972
1049 Ga0496119_0127794 3300048922 Bacteria 1388
1050 Ga0496119_0210866 3300048922 Bacteria 999
1051 Ga0496119_0287327 3300048922 Bacteria 815
1052 Ga0496120_0000897 3300048923 Bacteria 41807
1053 Ga0496120_0004732 3300048923 Bacteria 11183
1054 Ga0496120_0006409 3300048923 Bacteria 9043
1055 Ga0496120_0033065 3300048923 Bacteria 3111
1056 Ga0496120_0051950 3300048923 Bacteria 2337
1057 Ga0496120_0053389 3300048923 Bacteria 2296
1058 Ga0496121_0000001 3300048924 Bacteria 1830318
1059 Ga0496121_0014826 3300048924 Bacteria 8230
1060 Ga0496121_0015513 3300048924 Bacteria 7974
1061 Ga0496121_0037849 3300048924 Bacteria 4279
1062 Ga0496121_0048170 3300048924 Bacteria 3628
1063 Ga0496121_0061121 3300048924 Bacteria 3093
1064 Ga0496121_0068259 3300048924 Bacteria 2876
1065 Ga0496121_0100418 3300048924 Bacteria 2234
1066 Ga0496121_0109219 3300048924 Bacteria 2114
1067 Ga0496121_0241237 3300048924 Bacteria 1259
1068 Ga0496121_0338160 3300048924 Bacteria 1007
1069 Ga0496122_0000001 3300048925 Bacteria 1827766
1070 Ga0496122_0000147 3300048925 Bacteria 165589
1071 Ga0496122_0014175 3300048925 Bacteria 7729
1072 Ga0496122_0017929 3300048925 Bacteria 6573
1073 Ga0496122_0032102 3300048925 Bacteria 4349
1074 Ga0496122_0048435 3300048925 Bacteria 3267
1075 Ga0496122_0073416 3300048925 Bacteria 2425
1076 Ga0496122_0075366 3300048925 Bacteria 2380
1077 Ga0496123_0000001 3300048926 Bacteria 1831497
1078 Ga0496123_0000339 3300048926 Bacteria 88118
1079 Ga0496123_0009975 3300048926 Bacteria 8465
1080 Ga0496123_0026193 3300048926 Bacteria 4376
1081 Ga0496123_0030893 3300048926 Bacteria 3912
1082 Ga0496123_0093601 3300048926 Bacteria 1774
1083 Ga0496123_0167018 3300048926 Bacteria 1165
1084 Ga0496124_0000855 3300048927 Bacteria 49698
1085 Ga0496124_0005152 3300048927 Bacteria 14874
1086 Ga0496124_0009075 3300048927 Bacteria 10287
1087 Ga0496124_0013491 3300048927 Bacteria 7973
1088 Ga0496124_0013971 3300048927 Bacteria 7796
1089 Ga0496124_0035734 3300048927 Bacteria 4345
1090 Ga0496124_0044318 3300048927 Bacteria 3817
1091 Ga0496124_0049119 3300048927 Bacteria 3601
1092 Ga0496124_0065713 3300048927 Bacteria 3023
1093 Ga0496124_0107705 3300048927 Bacteria 2248
1094 Ga0496124_0130299 3300048927 Bacteria 1999
1095 Ga0496124_0165087 3300048927 Bacteria 1722
1096 Ga0496125_0000001 3300048928 Bacteria 1766138
1097 Ga0496125_0000299 3300048928 Bacteria 97532
1098 Ga0496125_0011662 3300048928 Bacteria 8771
1099 Ga0496125_0043778 3300048928 Bacteria 3794
1100 Ga0496125_0127984 3300048928 Bacteria 1795
1101 Ga0496125_0168506 3300048928 Bacteria 1476
1102 Ga0496125_0251824 3300048928 Bacteria 1113
1103 Ga0496126_0007868 3300048929 Bacteria 11604
1104 Ga0496126_0008341 3300048929 Bacteria 11182
1105 Ga0496126_0008758 3300048929 Bacteria 10861
1106 Ga0496126_0017034 3300048929 Bacteria 7251
1107 Ga0496126_0167311 3300048929 Bacteria 1875
1108 Ga0496126_0222780 3300048929 Bacteria 1583
1109 Ga0496126_0245018 3300048929 Bacteria 1495
1110 Ga0496126_0247081 3300048929 Bacteria 1488
1111 Ga0496126_0390062 3300048929 Bacteria 1131
1112 Ga0496126_0494138 3300048929 Bacteria 979
1113 Ga0496126_0895315 3300048929 Bacteria 673
1114 Ga0495678_005547 3300049459 Bacteria 6932
1115 Ga0495678_017432 3300049459 Bacteria 3256
1116 Ga0495682_0049575 3300049460 Bacteria 1530
1117 Ga0501031_0000076 3300049568 Bacteria 51870
1118 Ga0501031_0146384 3300049568 Bacteria 1543
1119 Ga0501032_0000004 3300049569 Bacteria 310855
1120 Ga0501032_0001730 3300049569 Bacteria 17269
1121 Ga0501032_0349534 3300049569 Bacteria 953
1122 Ga0501033_0000156 3300049570 Bacteria 65847
1123 Ga0501033_0004642 3300049570 Bacteria 10996
1124 Ga0501033_0016132 3300049570 Bacteria 5656
1125 Ga0501033_0064673 3300049570 Bacteria 2691
1126 Ga0501034_0000011 3300049571 Bacteria 310855
1127 Ga0501034_0012488 3300049571 Bacteria 8772
1128 Ga0501034_0049747 3300049571 Bacteria 4229
1129 Ga0501034_1101560 3300049571 Bacteria 675
1130 Ga0501036_0000001 3300049572 Bacteria 310855
1131 Ga0501036_0163307 3300049572 Bacteria 1877
1132 Ga0501036_0325085 3300049572 Bacteria 1285
1133 Ga0501036_0481590 3300049572 Bacteria 1033
1134 Ga0501037_0000064 3300049573 Bacteria 97087
1135 Ga0501037_0026452 3300049573 Bacteria 4289
1136 Ga0501037_0423780 3300049573 Bacteria 910
1137 Ga0501037_0561145 3300049573 Bacteria 770
1138 Ga0501038_0000003 3300049574 Bacteria 310855
1139 Ga0501038_0010727 3300049574 Bacteria 8376
1140 Ga0501038_0011121 3300049574 Bacteria 8218
1141 Ga0501038_0532178 3300049574 Bacteria 896
1142 Ga0501038_0703206 3300049574 Bacteria 757
1143 Ga0501039_0000004 3300049575 Bacteria 310855
1144 Ga0501039_0087466 3300049575 Bacteria 2427
1145 Ga0501039_0300938 3300049575 Bacteria 1261
1146 Ga0501039_0376594 3300049575 Bacteria 1115
1147 Ga0501040_0040897 3300049576 Bacteria 3156
1148 Ga0501040_0126891 3300049576 Bacteria 1793
1149 Ga0501040_0173746 3300049576 Bacteria 1526
1150 Ga0501040_0665786 3300049576 Bacteria 752
1151 Ga0501041_0259838 3300049577 Bacteria 1092
1152 Ga0501041_0281211 3300049577 Bacteria 1047
1153 Ga0501041_0644761 3300049577 Bacteria 677
1154 Ga0501042_0385045 3300049578 Bacteria 1015
1155 Ga0501043_0000417 3300049579 Bacteria 38233
1156 Ga0501043_0043205 3300049579 Bacteria 3542
1157 Ga0501043_0107312 3300049579 Bacteria 2193
1158 Ga0501043_0406448 3300049579 Bacteria 1028
1159 Ga0501046_0008545 3300049580 Bacteria 8907
1160 Ga0501046_0037795 3300049580 Bacteria 3878
1161 Ga0501047_0002889 3300049581 Bacteria 16294
1162 Ga0501047_0007276 3300049581 Bacteria 10405
1163 Ga0501047_0599042 3300049581 Bacteria 924
1164 Ga0501048_0006355 3300049582 Bacteria 8982
1165 Ga0501067_0052908 3300049583 Bacteria 2250
1166 Ga0501067_0063546 3300049583 Bacteria 2044
1167 Ga0501067_0066419 3300049583 Bacteria 1996
1168 Ga0501067_0139844 3300049583 Bacteria 1348
1169 Ga0501067_0523979 3300049583 Bacteria 663
1170 Ga0501068_0010696 3300049584 Bacteria 5159
1171 Ga0501070_0009102 3300049586 Bacteria 8397
1172 Ga0501070_0017361 3300049586 Bacteria 6041
1173 Ga0501070_0110086 3300049586 Bacteria 2276
1174 Ga0501070_0269089 3300049586 Bacteria 1392
1175 Ga0501070_0324490 3300049586 Bacteria 1252
1176 Ga0501071_0025630 3300049587 Bacteria 4133
1177 Ga0501071_0332522 3300049587 Bacteria 1155
1178 Ga0501072_0216553 3300049588 Bacteria 1526
1179 Ga0501072_0955943 3300049588 Bacteria 668
1180 Ga0501073_0019818 3300049589 Bacteria 4853
1181 Ga0501073_0203768 3300049589 Bacteria 1368
1182 Ga0501073_0233733 3300049589 Bacteria 1270
1183 Ga0501073_0238232 3300049589 Bacteria 1257
1184 Ga0501073_0539823 3300049589 Bacteria 806
1185 Ga0501074_0112138 3300049590 Bacteria 1951
1186 Ga0501074_0232249 3300049590 Bacteria 1313
1187 Ga0501074_0355804 3300049590 Bacteria 1039
1188 Ga0501075_0005939 3300049591 Bacteria 8355
1189 Ga0501075_0035153 3300049591 Bacteria 3736
1190 Ga0501075_0202729 3300049591 Bacteria 1513
1191 Ga0501076_0015278 3300049592 Bacteria 5800
1192 Ga0501076_0141292 3300049592 Bacteria 1956
1193 Ga0501077_0192544 3300049593 Bacteria 1295
1194 Ga0501249_000464 3300049679 Bacteria 10123
1195 Ga0501249_028485 3300049679 Bacteria 1239
1196 Ga0501225_0035028 3300049705 Bacteria 1382
1197 Ga0501079_0062339 3300049741 Bacteria 2876
1198 Ga0501079_0270581 3300049741 Bacteria 1328
1199 Ga0501079_0661250 3300049741 Bacteria 822
1200 Ga0501079_0775233 3300049741 Bacteria 755
1201 Ga0501080_0019003 3300049742 Bacteria 6364
1202 Ga0501080_0062699 3300049742 Bacteria 3460
1203 Ga0501081_0051720 3300049743 Bacteria 2833
1204 Ga0501081_0068873 3300049743 Bacteria 2464
1205 Ga0501081_0113044 3300049743 Bacteria 1928
1206 Ga0501081_0218675 3300049743 Bacteria 1385
1207 Ga0501081_0227659 3300049743 Bacteria 1357
1208 Ga0501081_0642817 3300049743 Bacteria 795
1209 Ga0501083_0034469 3300049744 Bacteria 3461
1210 Ga0501083_0051249 3300049744 Bacteria 2776
1211 Ga0501268_002627 3300049765 Bacteria 2381
1212 Ga0501273_000192 3300049770 Bacteria 4397
1213 Ga0501035_0000009 3300049822 Bacteria 310827
1214 Ga0501035_0000529 3300049822 Bacteria 42811
1215 Ga0501035_0071606 3300049822 Bacteria 3069
1216 Ga0501035_0074295 3300049822 Bacteria 3007
1217 Ga0501044_0000005 3300049823 Bacteria 310855
1218 Ga0501044_0003713 3300049823 Bacteria 17150
1219 Ga0501044_0055686 3300049823 Bacteria 4061
1220 Ga0501045_0005304 3300049824 Bacteria 8932
1221 Ga0501045_0114330 3300049824 Bacteria 2002
1222 Ga0501045_0208144 3300049824 Bacteria 1457
1223 Ga0501045_0682439 3300049824 Bacteria 758
1224 Ga0501204_020093 3300049850 Bacteria 866
1225 nmdc:mga03683_291862_c1 3300050489 Bacteria 763
1226 nmdc:mga03683_32311_c1 3300050489 Bacteria 2105
1227 nmdc:mga03n38_233173_c1 3300050490 Bacteria 966
1228 nmdc:mga03n38_303_c1 3300050490 Bacteria 11863
1229 nmdc:mga03n38_5304_c1 3300050490 Bacteria 4376
1230 nmdc:mga03n38_70047_c1 3300050490 Bacteria 1621
1231 nmdc:mga00v17_102_c1 3300050491 Bacteria 50732
1232 nmdc:mga00v17_1909_c1 3300050491 Bacteria 10778
1233 nmdc:mga00v17_58439_c1 3300050491 Bacteria 2363
1234 nmdc:mga00v17_86644_c1 3300050491 Bacteria 1963
1235 nmdc:mga00v17_88117_c1 3300050491 Bacteria 1946
1236 nmdc:mga0yw44_183_c1 3300050492 Bacteria 22031
1237 nmdc:mga0yw44_5626_c1 3300050492 Bacteria 5959
1238 nmdc:mga0yw44_7212_c1 3300050492 Bacteria 5448
1239 nmdc:mga0k408_13416_c1 3300050493 Bacteria 4493
1240 nmdc:mga0k408_14555_c1 3300050493 Bacteria 4338
1241 nmdc:mga06z11_1093_c1 3300050494 Bacteria 9890
1242 nmdc:mga06z11_1406_c1 3300050494 Bacteria 8943
1243 nmdc:mga06z11_3460_c1 3300050494 Bacteria 6111
1244 nmdc:mga06z11_39349_c1 3300050494 Bacteria 2353
1245 nmdc:mga04h51_117533_c1 3300050495 Bacteria 987
1246 nmdc:mga04h51_178406_c1 3300050495 Bacteria 826
1247 nmdc:mga04h51_18788_c1 3300050495 Bacteria 2041
1248 nmdc:mga07m45_224961_c1 3300050496 Bacteria 1092
1249 nmdc:mga07m45_70146_c1 3300050496 Bacteria 1993
1250 nmdc:mga05p37_133337_c1 3300050507 Bacteria 3047
1251 nmdc:mga05p37_194265_c1 3300050507 Bacteria 2462
1252 nmdc:mga05p37_538973_c1 3300050507 Bacteria 1331
1253 nmdc:mga09592_15193_c2 3300050508 Bacteria 5136
1254 nmdc:mga09592_199910_c1 3300050508 Bacteria 1731
1255 nmdc:mga0qj67_13558_c1 3300050509 Bacteria 6149
1256 nmdc:mga0qj67_226329_c1 3300050509 Bacteria 1518
1257 nmdc:mga0qj67_24345_c1 3300050509 Bacteria 4666
1258 nmdc:mga06r32_121796_c1 3300050510 Bacteria 2574
1259 nmdc:mga06r32_48108_c1 3300050510 Bacteria 4076
1260 nmdc:mga06r32_49318_c1 3300050510 Bacteria 4026
1261 nmdc:mga06r32_6618_c1 3300050510 Bacteria 10413
1262 nmdc:mga06r32_67386_c1 3300050510 Bacteria 3455
1263 nmdc:mga08y16_113950_c1 3300050511 Bacteria 2815
1264 nmdc:mga08y16_99164_c1 3300050511 Bacteria 3033
1265 nmdc:mga0n895_136398_c1 3300050512 Bacteria 2480
1266 nmdc:mga0n895_85511_c1 3300050512 Bacteria 3149
1267 nmdc:mga0rr50_65904_c1 3300050513 Bacteria 2745
1268 nmdc:mga0rr50_712999_c1 3300050513 Bacteria 856
1269 nmdc:mga0a205_395282_c1 3300050515 Bacteria 1246
1270 nmdc:mga0a205_57133_c1 3300050515 Bacteria 3768
1271 nmdc:mga0sz30_126005_c2 3300050516 Bacteria 670
1272 nmdc:mga0sz30_186200_c1 3300050516 Bacteria 922
1273 nmdc:mga0sz30_21092_c1 3300050516 Bacteria 2633
1274 nmdc:mga0sz30_2245_c1 3300050516 Bacteria 6913
1275 nmdc:mga0sz30_8262_c1 3300050516 Bacteria 3569
1276 Ga0500610_0172121 3300053079 Bacteria 1068
1277 Ga0495619_0209830 3300053085 Bacteria 1349
1278 Ga0500578_0023226 3300053086 Bacteria 3982
1279 Ga0500578_0315407 3300053086 Bacteria 923
1280 Ga0500643_000115 3300053087 Bacteria 84126
1281 Ga0500643_000326 3300053087 Bacteria 38307
1282 Ga0500643_011498 3300053087 Bacteria 3227
1283 Ga0500651_0267223 3300053093 Bacteria 990
1284 Ga0500650_0106819 3300053098 Bacteria 1308
1285 Ga0500569_001711 3300053109 Bacteria 4192
1286 Ga0500569_069772 3300053109 Bacteria 1103
1287 Ga0500592_000322 3300053116 Bacteria 8191
1288 Ga0500594_0008368 3300053118 Bacteria 2357
1289 Ga0500595_120985 3300053119 Bacteria 740
1290 Ga0500608_048497 3300053122 Bacteria 2040
1291 Ga0500618_001168 3300053125 Bacteria 12688
1292 Ga0500621_073642 3300053126 Bacteria 1375
1293 Ga0500658_0001271 3300053134 Bacteria 10232
1294 Ga0500658_0026298 3300053134 Bacteria 2241
1295 Ga0500561_0000341 3300053137 Bacteria 7800
1296 Ga0500568_0000611 3300053139 Bacteria 25855
1297 Ga0500568_0004778 3300053139 Bacteria 7171
1298 Ga0500568_0005331 3300053139 Bacteria 6665
1299 Ga0500568_0055059 3300053139 Bacteria 1554
1300 Ga0500588_0084584 3300053146 Bacteria 1068
1301 Ga0500590_010535 3300053148 Bacteria 4671
1302 Ga0500604_0184196 3300053151 Bacteria 716
1303 Ga0500616_0008121 3300053153 Bacteria 6562
1304 Ga0500616_0053271 3300053153 Bacteria 2123
1305 Ga0500616_0066960 3300053153 Bacteria 1842
1306 Ga0500622_0004278 3300053156 Bacteria 9056
1307 Ga0500624_000676 3300053157 Bacteria 8709
1308 Ga0500627_0000211 3300053158 Bacteria 16854
1309 Ga0500627_0065024 3300053158 Bacteria 1609
1310 Ga0500634_0063231 3300053161 Bacteria 1958
1311 Ga0500636_0000094 3300053177 Bacteria 44967
1312 Ga0500636_0004270 3300053177 Bacteria 8096
1313 Ga0500611_000548 3300053727 Bacteria 3803
1314 Ga0501084_0006560 3300054114 Bacteria 9561
1315 Ga0501084_0203461 3300054114 Bacteria 1671
1316 Ga0501084_0259778 3300054114 Bacteria 1466
1317 Ga0501084_0462928 3300054114 Bacteria 1072
1318 Ga0501082_0002773 3300060353 Bacteria 15309
1319 Ga0501082_0086060 3300060353 Bacteria 2711
1320 Ga0501082_0150797 3300060353 Bacteria 2019
1321 Ga0501082_0650619 3300060353 Bacteria 922
1322 Ga0501082_1060610 3300060353 Bacteria 708
1323 Ga0466962_0072730 3300061719 Bacteria 1643
1324 Ga0530510_0233780 3300061734 Bacteria 1367

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025912 Ga0207707_10635272 Ga0207707_106352722 153
2 3300025917 Ga0207660_10217892 Ga0207660_102178923 153
3 3300025920 Ga0207649_10291322 Ga0207649_102913222 153
4 3300025932 Ga0207690_10181782 Ga0207690_101817822 153
5 3300025933 Ga0207706_10000143 Ga0207706_1000014326 153
6 3300006042 Ga0075368_10140048 Ga0075368_101400481 161
7 3300049583 Ga0501067_0063546 Ga0501067_0063546_622_1227 162
8 3300005539 Ga0068853_100013841 Ga0068853_1000138412 163
9 3300009093 Ga0105240_10045075 Ga0105240_100450754 163
10 3300009551 Ga0105238_10002270 Ga0105238_1000227016 163
11 3300010375 Ga0105239_10012124 Ga0105239_100121242 163
12 3300013105 Ga0157369_10148721 Ga0157369_101487212 163
13 3300025261 Ga0209233_1000034 Ga0209233_1000034390 163
14 3300025261 Ga0209233_1023863 Ga0209233_10238632 163
15 3300025924 Ga0207694_10021174 Ga0207694_100211745 163
16 3300026041 Ga0207639_10039824 Ga0207639_100398242 163
17 3300037418 Ga0395900_0135408 Ga0395900_0135408_1064_1669 163
18 3300037471 Ga0395905_0472204 Ga0395905_0472204_55_660 163
19 3300038443 Ga0395901_0254740 Ga0395901_0254740_1199_1804 163
20 3300048924 Ga0496121_0338160 Ga0496121_0338160_331_936 163
21 3300048928 Ga0496125_0168506 Ga0496125_0168506_11_616 163
22 3300049589 Ga0501073_0238232 Ga0501073_0238232_141_746 163
23 3300006038 Ga0075365_10002469 Ga0075365_100024693 164
24 3300031456 Ga0307513_10612286 Ga0307513_106122861 164
25 3300031548 Ga0307408_100624612 Ga0307408_1006246121 164
26 3300053079 Ga0500610_0172121 Ga0500610_0172121_96_701 165
27 3300001989 JGI24739J22299_10006127 JGI24739J22299_100061274 170
28 3300002067 JGI24735J21928_10060394 JGI24735J21928_100603942 170
29 3300005614 Ga0068856_100111687 Ga0068856_1001116872 170
30 3300005834 Ga0068851_10505859 Ga0068851_105058591 170
31 3300005937 Ga0081455_10074535 Ga0081455_100745351 170
32 3300006042 Ga0075368_10025919 Ga0075368_100259192 170
33 3300010375 Ga0105239_10409896 Ga0105239_104098962 170
34 3300025297 Ga0209758_1003869 Ga0209758_10038697 170
35 3300025904 Ga0207647_10007819 Ga0207647_100078194 170
36 3300026116 Ga0207674_10064762 Ga0207674_100647624 170
37 3300027866 Ga0209813_10099328 Ga0209813_100993282 170
38 3300037312 Ga0395899_0533627 Ga0395899_0533627_86_691 170
39 3300037471 Ga0395905_0176885 Ga0395905_0176885_159_764 170
40 3300038443 Ga0395901_0118490 Ga0395901_0118490_676_1281 170
41 3300048905 Ga0496102_0871759 Ga0496102_0871759_64_669 170
42 3300048922 Ga0496119_0287327 Ga0496119_0287327_176_781 170
43 3300048923 Ga0496120_0004732 Ga0496120_0004732_6891_7496 170
44 3300050495 nmdc:mga04h51_117533_c1 nmdc:mga04h51_117533_c1_257_862 170
45 3300026089 Ga0207648_10110950 Ga0207648_101109502 173
46 3300005327 Ga0070658_10013265 Ga0070658_100132659 176
47 3300005333 Ga0070677_10088305 Ga0070677_100883052 176
48 3300005339 Ga0070660_100016630 Ga0070660_1000166307 176
49 3300005345 Ga0070692_10001570 Ga0070692_100015706 176
50 3300005345 Ga0070692_10013728 Ga0070692_100137283 176
51 3300005366 Ga0070659_100541874 Ga0070659_1005418742 176
52 3300005457 Ga0070662_100001433 Ga0070662_10000143315 176
53 3300005840 Ga0068870_10261182 Ga0068870_102611822 176
54 3300013100 Ga0157373_10007416 Ga0157373_100074168 176
55 3300013308 Ga0157375_10705360 Ga0157375_107053601 176
56 3300025909 Ga0207705_10009913 Ga0207705_1000991311 176
57 3300025919 Ga0207657_10002661 Ga0207657_100026616 176
58 3300026121 Ga0207683_10277533 Ga0207683_102775332 176
59 3300037312 Ga0395899_0000971 Ga0395899_0000971_11241_11837 176
60 3300037418 Ga0395900_0000036 Ga0395900_0000036_158868_159464 176
61 3300038443 Ga0395901_0000036 Ga0395901_0000036_60434_61030 176
62 3300053085 Ga0495619_0209830 Ga0495619_0209830_149_754 176
63 3300037418 Ga0395900_0745373 Ga0395900_0745373_285_881 177
64 3300046539 Ga0495621_0090838 Ga0495621_0090838_71_667 177
65 3300025250 Ga0209026_1000013 Ga0209026_1000013189 178
66 3300025256 Ga0209759_1000058 Ga0209759_1000058127 178
67 3300042004 Ga0439445_0040819 Ga0439445_0040819_558_1154 178
68 3300042006 Ga0439432_016049 Ga0439432_016049_346_942 178
69 3300048917 Ga0496114_0789337 Ga0496114_0789337_111_716 178
70 3300005353 Ga0070669_100112579 Ga0070669_1001125793 179
71 3300005364 Ga0070673_100171550 Ga0070673_1001715502 179
72 3300014326 Ga0157380_10028805 Ga0157380_100288052 179
73 3300026118 Ga0207675_100440132 Ga0207675_1004401321 179
74 3300049589 Ga0501073_0203768 Ga0501073_0203768_461_1066 179
75 3300050511 nmdc:mga08y16_99164_c1 nmdc:mga08y16_99164_c1_2157_2753 179
76 iso_pu_bacteria 2965102966 2965107742 179
77 3300013306 Ga0163162_10965851 Ga0163162_109658511 181
78 3300031995 Ga0307409_100164025 Ga0307409_1001640252 181
79 3300002773 JGI25152J39213_1003399 JGI25152J39213_10033994 182
80 3300002774 JGI25150J39212_1022674 JGI25150J39212_10226742 182
81 3300003215 JGI25153J46596_10018074 JGI25153J46596_100180742 182
82 3300003771 Ga0055526_1003970 Ga0055526_10039707 182
83 3300003773 Ga0055537_1001041 Ga0055537_10010419 182
84 3300005262 Ga0065165_1062844 Ga0065165_10628441 182
85 3300014325 Ga0163163_10579196 Ga0163163_105791962 182
86 3300025245 Ga0207425_1015373 Ga0207425_10153732 182
87 3300025258 Ga0209129_1000779 Ga0209129_100077914 182
88 3300025263 Ga0209565_1000099 Ga0209565_1000099100 182
89 3300025273 Ga0209673_1011840 Ga0209673_10118402 182
90 3300025295 Ga0209564_1003178 Ga0209564_10031789 182
91 3300025295 Ga0209564_1004032 Ga0209564_10040322 182
92 3300025297 Ga0209758_1000744 Ga0209758_100074439 182
93 3300025298 Ga0209050_1022296 Ga0209050_10222963 182
94 3300025302 Ga0207426_1016841 Ga0207426_10168412 182
95 3300025961 Ga0207712_10488670 Ga0207712_104886701 182
96 3300032002 Ga0307416_100083007 Ga0307416_1000830072 183
97 3300005535 Ga0070684_100353189 Ga0070684_1003531892 184
98 3300048917 Ga0496114_0375323 Ga0496114_0375323_77_667 184
99 3300042134 Ga0450898_036743 Ga0450898_036743_152_748 185
100 iso_pu_bacteria 3004195979 3004198415 185
101 3300009545 Ga0105237_10000459 Ga0105237_1000045943 187
102 3300041413 Ga0439465_0047824 Ga0439465_0047824_11_607 187
103 3300048926 Ga0496123_0093601 Ga0496123_0093601_313_918 187
104 3300049569 Ga0501032_0349534 Ga0501032_0349534_218_814 187
105 3300049586 Ga0501070_0110086 Ga0501070_0110086_1243_1839 187
106 3300005331 Ga0070670_101319407 Ga0070670_1013194071 188
107 3300005334 Ga0068869_100138345 Ga0068869_1001383452 188
108 3300005335 Ga0070666_10642496 Ga0070666_106424961 188
109 3300005336 Ga0070680_100009894 Ga0070680_1000098941 188
110 3300005341 Ga0070691_10209227 Ga0070691_102092272 188
111 3300005347 Ga0070668_100603126 Ga0070668_1006031262 188
112 3300005354 Ga0070675_100442176 Ga0070675_1004421761 188
113 3300005367 Ga0070667_100320248 Ga0070667_1003202481 188
114 3300005406 Ga0070703_10001725 Ga0070703_100017251 188
115 3300005438 Ga0070701_10015566 Ga0070701_100155663 188
116 3300005440 Ga0070705_100003836 Ga0070705_1000038361 188
117 3300005441 Ga0070700_100010792 Ga0070700_1000107924 188
118 3300005444 Ga0070694_100000725 Ga0070694_1000007257 188
119 3300005445 Ga0070708_100156154 Ga0070708_1001561541 188
120 3300005455 Ga0070663_100260991 Ga0070663_1002609911 188
121 3300005457 Ga0070662_100015527 Ga0070662_1000155273 188
122 3300005458 Ga0070681_10024817 Ga0070681_100248176 188
123 3300005467 Ga0070706_100069679 Ga0070706_1000696792 188
124 3300005518 Ga0070699_100000188 Ga0070699_10000018851 188
125 3300005530 Ga0070679_100060223 Ga0070679_1000602233 188
126 3300005536 Ga0070697_100476289 Ga0070697_1004762891 188
127 3300005539 Ga0068853_100237579 Ga0068853_1002375793 188
128 3300005545 Ga0070695_100000657 Ga0070695_10000065715 188
129 3300005546 Ga0070696_100007361 Ga0070696_1000073611 188
130 3300005548 Ga0070665_100419424 Ga0070665_1004194242 188
131 3300005549 Ga0070704_100001753 Ga0070704_10000175314 188
132 3300005549 Ga0070704_100302493 Ga0070704_1003024931 188
133 3300005577 Ga0068857_100131484 Ga0068857_1001314841 188
134 3300005615 Ga0070702_100122429 Ga0070702_1001224291 188
135 3300005617 Ga0068859_100014603 Ga0068859_1000146038 188
136 3300005618 Ga0068864_100007897 Ga0068864_1000078973 188
137 3300005719 Ga0068861_100365092 Ga0068861_1003650921 188
138 3300005719 Ga0068861_100704500 Ga0068861_1007045001 188
139 3300005840 Ga0068870_10279070 Ga0068870_102790701 188
140 3300005841 Ga0068863_100320759 Ga0068863_1003207591 188
141 3300005843 Ga0068860_100015416 Ga0068860_1000154162 188
142 3300005844 Ga0068862_100007255 Ga0068862_1000072553 188
143 3300005985 Ga0081539_10070068 Ga0081539_100700683 188
144 3300006042 Ga0075368_10001299 Ga0075368_100012996 188
145 3300006042 Ga0075368_10005248 Ga0075368_100052483 188
146 3300006048 Ga0075363_100021865 Ga0075363_1000218653 188
147 3300006048 Ga0075363_100024186 Ga0075363_1000241861 188
148 3300006051 Ga0075364_10003077 Ga0075364_100030779 188
149 3300006178 Ga0075367_10004018 Ga0075367_100040185 188
150 3300006178 Ga0075367_10007480 Ga0075367_100074803 188
151 3300006178 Ga0075367_10020318 Ga0075367_100203183 188
152 3300006844 Ga0075428_100917773 Ga0075428_1009177731 188
153 3300006846 Ga0075430_100069684 Ga0075430_1000696842 188
154 3300006846 Ga0075430_100078448 Ga0075430_1000784483 188
155 3300006846 Ga0075430_100619620 Ga0075430_1006196201 188
156 3300006847 Ga0075431_100003896 Ga0075431_10000389613 188
157 3300006847 Ga0075431_100004223 Ga0075431_1000042237 188
158 3300006847 Ga0075431_100042858 Ga0075431_1000428582 188
159 3300006847 Ga0075431_100049916 Ga0075431_1000499165 188
160 3300006847 Ga0075431_100236910 Ga0075431_1002369103 188
161 3300006852 Ga0075433_11032696 Ga0075433_110326961 188
162 3300006871 Ga0075434_100081577 Ga0075434_1000815771 188
163 3300006871 Ga0075434_100255331 Ga0075434_1002553313 188
164 3300006871 Ga0075434_100335797 Ga0075434_1003357972 188
165 3300006880 Ga0075429_100026019 Ga0075429_1000260194 188
166 3300006931 Ga0097620_100014604 Ga0097620_1000146048 188
167 3300009094 Ga0111539_10020472 Ga0111539_100204722 188
168 3300009147 Ga0114129_10159134 Ga0114129_101591341 188
169 3300009147 Ga0114129_10221355 Ga0114129_102213553 188
170 3300009147 Ga0114129_10233827 Ga0114129_102338272 188
171 3300009147 Ga0114129_10297959 Ga0114129_102979593 188
172 3300009147 Ga0114129_10805595 Ga0114129_108055952 188
173 3300009174 Ga0105241_11203511 Ga0105241_112035111 188
174 3300009553 Ga0105249_10004443 Ga0105249_1000444312 188
175 3300009553 Ga0105249_10676556 Ga0105249_106765562 188
176 3300011119 Ga0105246_10008225 Ga0105246_100082254 188
177 3300013308 Ga0157375_11329578 Ga0157375_113295781 188
178 3300014325 Ga0163163_10493253 Ga0163163_104932531 188
179 3300014968 Ga0157379_10285667 Ga0157379_102856672 188
180 3300014968 Ga0157379_11349690 Ga0157379_113496901 188
181 3300025885 Ga0207653_10001613 Ga0207653_100016132 188
182 3300025912 Ga0207707_10049317 Ga0207707_100493173 188
183 3300025917 Ga0207660_10008981 Ga0207660_100089815 188
184 3300025921 Ga0207652_10048966 Ga0207652_100489663 188
185 3300025922 Ga0207646_10353556 Ga0207646_103535561 188
186 3300025942 Ga0207689_10372285 Ga0207689_103722852 188
187 3300025961 Ga0207712_10000886 Ga0207712_100008867 188
188 3300026035 Ga0207703_10063370 Ga0207703_100633703 188
189 3300026035 Ga0207703_10505838 Ga0207703_105058382 188
190 3300026041 Ga0207639_10209237 Ga0207639_102092373 188
191 3300026067 Ga0207678_10001844 Ga0207678_100018441 188
192 3300026075 Ga0207708_10001520 Ga0207708_1000152012 188
193 3300026075 Ga0207708_10889159 Ga0207708_108891591 188
194 3300026095 Ga0207676_10133358 Ga0207676_101333581 188
195 3300026095 Ga0207676_11107667 Ga0207676_111076671 188
196 3300026116 Ga0207674_10019607 Ga0207674_100196071 188
197 3300026118 Ga0207675_100245415 Ga0207675_1002454152 188
198 3300026118 Ga0207675_100795184 Ga0207675_1007951841 188
199 3300026121 Ga0207683_10434647 Ga0207683_104346471 188
200 3300027866 Ga0209813_10000400 Ga0209813_100004007 188
201 3300027866 Ga0209813_10006650 Ga0209813_100066503 188
202 3300027907 Ga0207428_10142986 Ga0207428_101429861 188
203 3300028380 Ga0268265_10001073 Ga0268265_1000107325 188
204 3300028380 Ga0268265_10326542 Ga0268265_103265421 188
205 3300028381 Ga0268264_10001789 Ga0268264_1000178914 188
206 3300035725 Ga0373947_0424826 Ga0373947_0424826_99_701 188
207 3300046616 Ga0495668_0237065 Ga0495668_0237065_355_969 188
208 3300048903 Ga0496100_0052620 Ga0496100_0052620_1089_1715 188
209 3300048903 Ga0496100_0230937 Ga0496100_0230937_544_1146 188
210 3300048904 Ga0496101_0140812 Ga0496101_0140812_331_957 188
211 3300048905 Ga0496102_0004672 Ga0496102_0004672_5183_5785 188
212 3300048905 Ga0496102_0305582 Ga0496102_0305582_138_764 188
213 3300048907 Ga0496104_0000516 Ga0496104_0000516_20589_21191 188
214 3300048907 Ga0496104_0001175 Ga0496104_0001175_14384_15010 188
215 3300048908 Ga0496105_0148874 Ga0496105_0148874_1270_1896 188
216 3300048909 Ga0496106_0038635 Ga0496106_0038635_2488_3090 188
217 3300048909 Ga0496106_0095009 Ga0496106_0095009_1293_1919 188
218 3300048909 Ga0496106_0219559 Ga0496106_0219559_534_1136 188
219 3300048910 Ga0496107_0027556 Ga0496107_0027556_3417_4019 188
220 3300048911 Ga0496108_0027601 Ga0496108_0027601_3492_4094 188
221 3300048911 Ga0496108_0092744 Ga0496108_0092744_1334_1960 188
222 3300048912 Ga0496109_0246123 Ga0496109_0246123_779_1381 188
223 3300048914 Ga0496111_0056730 Ga0496111_0056730_754_1356 188
224 3300048915 Ga0496112_0222777 Ga0496112_0222777_219_821 188
225 3300048915 Ga0496112_0444048 Ga0496112_0444048_47_673 188
226 3300048916 Ga0496113_0034741 Ga0496113_0034741_440_1042 188
227 3300048916 Ga0496113_0591913 Ga0496113_0591913_102_704 188
228 3300048917 Ga0496114_0046637 Ga0496114_0046637_1124_1750 188
229 3300049572 Ga0501036_0481590 Ga0501036_0481590_375_977 188
230 3300049573 Ga0501037_0561145 Ga0501037_0561145_77_679 188
231 3300049574 Ga0501038_0532178 Ga0501038_0532178_211_813 188
232 3300049574 Ga0501038_0703206 Ga0501038_0703206_122_724 188
233 3300049575 Ga0501039_0300938 Ga0501039_0300938_367_969 188
234 3300049576 Ga0501040_0126891 Ga0501040_0126891_1042_1644 188
235 3300049576 Ga0501040_0173746 Ga0501040_0173746_787_1389 188
236 3300049576 Ga0501040_0665786 Ga0501040_0665786_112_714 188
237 3300049577 Ga0501041_0259838 Ga0501041_0259838_454_1056 188
238 3300049577 Ga0501041_0281211 Ga0501041_0281211_20_622 188
239 3300049577 Ga0501041_0644761 Ga0501041_0644761_22_624 188
240 3300049583 Ga0501067_0052908 Ga0501067_0052908_17_619 188
241 3300049583 Ga0501067_0523979 Ga0501067_0523979_30_632 188
242 3300049586 Ga0501070_0269089 Ga0501070_0269089_54_656 188
243 3300049587 Ga0501071_0332522 Ga0501071_0332522_47_649 188
244 3300049588 Ga0501072_0955943 Ga0501072_0955943_39_641 188
245 3300049589 Ga0501073_0539823 Ga0501073_0539823_193_795 188
246 3300049590 Ga0501074_0112138 Ga0501074_0112138_1332_1934 188
247 3300049590 Ga0501074_0232249 Ga0501074_0232249_218_820 188
248 3300049590 Ga0501074_0355804 Ga0501074_0355804_154_756 188
249 3300049591 Ga0501075_0005939 Ga0501075_0005939_5871_6473 188
250 3300049591 Ga0501075_0035153 Ga0501075_0035153_56_658 188
251 3300049591 Ga0501075_0202729 Ga0501075_0202729_326_928 188
252 3300049592 Ga0501076_0015278 Ga0501076_0015278_2782_3384 188
253 3300049592 Ga0501076_0141292 Ga0501076_0141292_613_1215 188
254 3300049593 Ga0501077_0192544 Ga0501077_0192544_215_817 188
255 3300049741 Ga0501079_0062339 Ga0501079_0062339_107_709 188
256 3300049741 Ga0501079_0270581 Ga0501079_0270581_382_984 188
257 3300049741 Ga0501079_0661250 Ga0501079_0661250_190_792 188
258 3300049742 Ga0501080_0062699 Ga0501080_0062699_168_770 188
259 3300049743 Ga0501081_0051720 Ga0501081_0051720_201_803 188
260 3300049743 Ga0501081_0068873 Ga0501081_0068873_1555_2157 188
261 3300049743 Ga0501081_0113044 Ga0501081_0113044_347_949 188
262 3300049743 Ga0501081_0218675 Ga0501081_0218675_172_774 188
263 3300049743 Ga0501081_0227659 Ga0501081_0227659_668_1270 188
264 3300049743 Ga0501081_0642817 Ga0501081_0642817_10_612 188
265 3300049824 Ga0501045_0114330 Ga0501045_0114330_1197_1799 188
266 3300049824 Ga0501045_0208144 Ga0501045_0208144_525_1127 188
267 3300050490 nmdc:mga03n38_303_c1 nmdc:mga03n38_303_c1_2407_3021 188
268 3300050490 nmdc:mga03n38_5304_c1 nmdc:mga03n38_5304_c1_1707_2309 188
269 3300050491 nmdc:mga00v17_88117_c1 nmdc:mga00v17_88117_c1_807_1421 188
270 3300050492 nmdc:mga0yw44_5626_c1 nmdc:mga0yw44_5626_c1_1768_2382 188
271 3300050494 nmdc:mga06z11_1093_c1 nmdc:mga06z11_1093_c1_5486_6088 188
272 3300050494 nmdc:mga06z11_1406_c1 nmdc:mga06z11_1406_c1_4364_4978 188
273 3300050507 nmdc:mga05p37_133337_c1 nmdc:mga05p37_133337_c1_1477_2079 188
274 3300050507 nmdc:mga05p37_194265_c1 nmdc:mga05p37_194265_c1_23_625 188
275 3300050507 nmdc:mga05p37_538973_c1 nmdc:mga05p37_538973_c1_502_1104 188
276 3300050508 nmdc:mga09592_15193_c2 nmdc:mga09592_15193_c2_3268_3870 188
277 3300050508 nmdc:mga09592_199910_c1 nmdc:mga09592_199910_c1_278_880 188
278 3300050509 nmdc:mga0qj67_13558_c1 nmdc:mga0qj67_13558_c1_3959_4561 188
279 3300050509 nmdc:mga0qj67_226329_c1 nmdc:mga0qj67_226329_c1_146_748 188
280 3300050509 nmdc:mga0qj67_24345_c1 nmdc:mga0qj67_24345_c1_3280_3882 188
281 3300050510 nmdc:mga06r32_121796_c1 nmdc:mga06r32_121796_c1_1452_2054 188
282 3300050510 nmdc:mga06r32_48108_c1 nmdc:mga06r32_48108_c1_1160_1762 188
283 3300050510 nmdc:mga06r32_49318_c1 nmdc:mga06r32_49318_c1_3175_3777 188
284 3300050510 nmdc:mga06r32_6618_c1 nmdc:mga06r32_6618_c1_3946_4548 188
285 3300050510 nmdc:mga06r32_67386_c1 nmdc:mga06r32_67386_c1_931_1533 188
286 3300050511 nmdc:mga08y16_113950_c1 nmdc:mga08y16_113950_c1_964_1566 188
287 3300050512 nmdc:mga0n895_136398_c1 nmdc:mga0n895_136398_c1_500_1102 188
288 3300050512 nmdc:mga0n895_85511_c1 nmdc:mga0n895_85511_c1_2449_3051 188
289 3300050513 nmdc:mga0rr50_65904_c1 nmdc:mga0rr50_65904_c1_1246_1848 188
290 3300050515 nmdc:mga0a205_395282_c1 nmdc:mga0a205_395282_c1_362_964 188
291 3300054114 Ga0501084_0006560 Ga0501084_0006560_2551_3153 188
292 3300054114 Ga0501084_0259778 Ga0501084_0259778_19_621 188
293 3300054114 Ga0501084_0462928 Ga0501084_0462928_86_688 188
294 3300060353 Ga0501082_0002773 Ga0501082_0002773_13712_14314 188
295 3300060353 Ga0501082_0150797 Ga0501082_0150797_254_856 188
296 3300060353 Ga0501082_0650619 Ga0501082_0650619_191_793 188
297 3300061734 Ga0530510_0233780 Ga0530510_0233780_551_1153 188
298 iso_pu_bacteria 2524023228 2524540384 188
299 3300001979 JGI24740J21852_10030451 JGI24740J21852_100304512 189
300 3300002704 JGI25155J39150_1000069 JGI25155J39150_100006928 189
301 3300002705 JGI25156J39149_1000095 JGI25156J39149_100009528 189
302 3300002737 JGI25162J39368_1002190 JGI25162J39368_10021903 189
303 3300002738 JGI25154J39366_1000560 JGI25154J39366_100056023 189
304 3300002739 JGI25158J39367_1000029 JGI25158J39367_100002925 189
305 3300002741 JGI25157J39369_1000216 JGI25157J39369_100021643 189
306 3300002773 JGI25152J39213_1003369 JGI25152J39213_10033692 189
307 3300002773 JGI25152J39213_1004307 JGI25152J39213_10043075 189
308 3300002773 JGI25152J39213_1006750 JGI25152J39213_10067502 189
309 3300002773 JGI25152J39213_1009332 JGI25152J39213_10093323 189
310 3300002774 JGI25150J39212_1000232 JGI25150J39212_100023229 189
311 3300002987 JGI25159J45721_1000192 JGI25159J45721_100019223 189
312 3300002987 JGI25159J45721_1000479 JGI25159J45721_100047913 189
313 3300002987 JGI25159J45721_1000621 JGI25159J45721_100062112 189
314 3300003187 JGI25151J46595_10000439 JGI25151J46595_1000043939 189
315 3300003187 JGI25151J46595_10001371 JGI25151J46595_100013714 189
316 3300003187 JGI25151J46595_10003061 JGI25151J46595_100030613 189
317 3300003214 JGI25165J46597_1001961 JGI25165J46597_10019618 189
318 3300003214 JGI25165J46597_1001999 JGI25165J46597_10019997 189
319 3300003214 JGI25165J46597_1008125 JGI25165J46597_10081252 189
320 3300003215 JGI25153J46596_10007562 JGI25153J46596_100075623 189
321 3300003215 JGI25153J46596_10011190 JGI25153J46596_100111904 189
322 3300003215 JGI25153J46596_10013163 JGI25153J46596_100131632 189
323 3300003215 JGI25153J46596_10015668 JGI25153J46596_100156682 189
324 3300003354 JGI25160J50197_1000003 JGI25160J50197_10000034 189
325 3300003354 JGI25160J50197_1000287 JGI25160J50197_10002877 189
326 3300003354 JGI25160J50197_1001532 JGI25160J50197_10015324 189
327 3300003354 JGI25160J50197_1011524 JGI25160J50197_10115243 189
328 3300003374 JGI25161J50226_1000176 JGI25161J50226_100017637 189
329 3300003374 JGI25161J50226_1000523 JGI25161J50226_100052312 189
330 3300003374 JGI25161J50226_1002174 JGI25161J50226_10021743 189
331 3300003374 JGI25161J50226_1004992 JGI25161J50226_10049923 189
332 3300003578 Ga0006562J51391_1115539 Ga0006562J51391_11155392 189
333 3300003771 Ga0055526_1003881 Ga0055526_10038812 189
334 3300003771 Ga0055526_1005084 Ga0055526_10050844 189
335 3300003771 Ga0055526_1005149 Ga0055526_10051495 189
336 3300003771 Ga0055526_1005215 Ga0055526_10052156 189
337 3300003771 Ga0055526_1019122 Ga0055526_10191222 189
338 3300003775 Ga0055524_1001632 Ga0055524_10016325 189
339 3300003775 Ga0055524_1010414 Ga0055524_10104141 189
340 3300003775 Ga0055524_1012005 Ga0055524_10120053 189
341 3300003775 Ga0055524_1020751 Ga0055524_10207512 189
342 3300003775 Ga0055524_1034537 Ga0055524_10345372 189
343 3300003781 Ga0055536_1008884 Ga0055536_10088842 189
344 3300003781 Ga0055536_1010749 Ga0055536_10107494 189
345 3300003790 Ga0055528_1003156 Ga0055528_10031565 189
346 3300003790 Ga0055528_1003713 Ga0055528_10037134 189
347 3300003790 Ga0055528_1005850 Ga0055528_10058505 189
348 3300003790 Ga0055528_1007342 Ga0055528_10073425 189
349 3300003790 Ga0055528_1013747 Ga0055528_10137473 189
350 3300003792 Ga0055540_1003870 Ga0055540_10038706 189
351 3300003792 Ga0055540_1016096 Ga0055540_10160963 189
352 3300003794 Ga0055531_10040672 Ga0055531_100406721 189
353 3300003856 Ga0058692_1002554 Ga0058692_10025544 189
354 3300003856 Ga0058692_1006913 Ga0058692_10069132 189
355 3300004625 Ga0055543_1000069 Ga0055543_10000698 189
356 3300004625 Ga0055543_1000114 Ga0055543_100011442 189
357 3300004625 Ga0055543_1000187 Ga0055543_10001876 189
358 3300004625 Ga0055543_1000247 Ga0055543_100024749 189
359 3300005262 Ga0065165_1000047 Ga0065165_1000047124 189
360 3300005262 Ga0065165_1000511 Ga0065165_100051142 189
361 3300005262 Ga0065165_1015496 Ga0065165_10154962 189
362 3300005262 Ga0065165_1038045 Ga0065165_10380452 189
363 3300005327 Ga0070658_10287900 Ga0070658_102879001 189
364 3300005331 Ga0070670_100006682 Ga0070670_1000066824 189
365 3300005339 Ga0070660_100136974 Ga0070660_1001369742 189
366 3300005341 Ga0070691_10546220 Ga0070691_105462201 189
367 3300005344 Ga0070661_100152831 Ga0070661_1001528311 189
368 3300005353 Ga0070669_100080824 Ga0070669_1000808242 189
369 3300005539 Ga0068853_100164151 Ga0068853_1001641512 189
370 3300005539 Ga0068853_100376264 Ga0068853_1003762642 189
371 3300005546 Ga0070696_100386486 Ga0070696_1003864861 189
372 3300005548 Ga0070665_100000937 Ga0070665_10000093732 189
373 3300005548 Ga0070665_100159460 Ga0070665_1001594602 189
374 3300005548 Ga0070665_100245297 Ga0070665_1002452972 189
375 3300005563 Ga0068855_100495888 Ga0068855_1004958882 189
376 3300005578 Ga0068854_100061948 Ga0068854_1000619482 189
377 3300005578 Ga0068854_100163575 Ga0068854_1001635752 189
378 3300005614 Ga0068856_100015293 Ga0068856_1000152934 189
379 3300005614 Ga0068856_100082663 Ga0068856_1000826631 189
380 3300005616 Ga0068852_100207630 Ga0068852_1002076303 189
381 3300005834 Ga0068851_10067695 Ga0068851_100676951 189
382 3300005844 Ga0068862_100483681 Ga0068862_1004836812 189
383 3300005937 Ga0081455_10109732 Ga0081455_101097322 189
384 3300006038 Ga0075365_10003608 Ga0075365_100036081 189
385 3300006038 Ga0075365_10032760 Ga0075365_100327602 189
386 3300006042 Ga0075368_10000791 Ga0075368_100007913 189
387 3300006042 Ga0075368_10031036 Ga0075368_100310362 189
388 3300006042 Ga0075368_10048083 Ga0075368_100480832 189
389 3300006048 Ga0075363_100030337 Ga0075363_1000303372 189
390 3300006048 Ga0075363_100054278 Ga0075363_1000542784 189
391 3300006048 Ga0075363_100056239 Ga0075363_1000562392 189
392 3300006051 Ga0075364_10017668 Ga0075364_100176684 189
393 3300006051 Ga0075364_10139176 Ga0075364_101391762 189
394 3300006177 Ga0075362_10010129 Ga0075362_100101292 189
395 3300006178 Ga0075367_10321591 Ga0075367_103215911 189
396 3300006186 Ga0075369_10056310 Ga0075369_100563102 189
397 3300006186 Ga0075369_10289131 Ga0075369_102891311 189
398 3300006195 Ga0075366_10000883 Ga0075366_1000088315 189
399 3300006353 Ga0075370_10018662 Ga0075370_100186621 189
400 3300006353 Ga0075370_10034556 Ga0075370_100345564 189
401 3300006353 Ga0075370_10206516 Ga0075370_102065162 189
402 3300006353 Ga0075370_10225078 Ga0075370_102250781 189
403 3300006353 Ga0075370_10283212 Ga0075370_102832121 189
404 3300006353 Ga0075370_10358183 Ga0075370_103581831 189
405 3300006871 Ga0075434_100194051 Ga0075434_1001940514 189
406 3300006881 Ga0068865_100362021 Ga0068865_1003620211 189
407 3300006942 Ga0099824_1005597 Ga0099824_100559710 189
408 3300006946 Ga0079104_1000125 Ga0079104_1000125106 189
409 3300006946 Ga0079104_1000777 Ga0079104_100077720 189
410 3300006946 Ga0079104_1018873 Ga0079104_10188732 189
411 3300006948 Ga0099826_10015705 Ga0099826_100157055 189
412 3300006948 Ga0099826_10020216 Ga0099826_100202164 189
413 3300009092 Ga0105250_10098485 Ga0105250_100984851 189
414 3300009093 Ga0105240_10000310 Ga0105240_1000031058 189
415 3300009093 Ga0105240_10216325 Ga0105240_102163252 189
416 3300009093 Ga0105240_10479266 Ga0105240_104792662 189
417 3300009093 Ga0105240_10829396 Ga0105240_108293962 189
418 3300009098 Ga0105245_10923469 Ga0105245_109234692 189
419 3300009148 Ga0105243_10003568 Ga0105243_1000356811 189
420 3300009148 Ga0105243_10241288 Ga0105243_102412882 189
421 3300009174 Ga0105241_10657845 Ga0105241_106578451 189
422 3300009177 Ga0105248_10652117 Ga0105248_106521172 189
423 3300009545 Ga0105237_10002190 Ga0105237_1000219014 189
424 3300009765 Ga0123341_1000017 Ga0123341_100001769 189
425 3300009766 Ga0123342_1029556 Ga0123342_10295564 189
426 3300010375 Ga0105239_10006653 Ga0105239_100066538 189
427 3300010375 Ga0105239_10056820 Ga0105239_100568203 189
428 3300010375 Ga0105239_10218974 Ga0105239_102189742 189
429 3300010375 Ga0105239_10370956 Ga0105239_103709562 189
430 3300010375 Ga0105239_10538971 Ga0105239_105389711 189
431 3300010375 Ga0105239_10801957 Ga0105239_108019572 189
432 3300011119 Ga0105246_10018438 Ga0105246_100184383 189
433 3300012490 Ga0157322_1000372 Ga0157322_10003722 189
434 3300013100 Ga0157373_10038404 Ga0157373_100384043 189
435 3300013100 Ga0157373_10093807 Ga0157373_100938072 189
436 3300013100 Ga0157373_10477277 Ga0157373_104772772 189
437 3300013102 Ga0157371_10000004 Ga0157371_1000000432 189
438 3300013102 Ga0157371_10008339 Ga0157371_100083394 189
439 3300013102 Ga0157371_10875522 Ga0157371_108755221 189
440 3300013104 Ga0157370_10001506 Ga0157370_1000150617 189
441 3300013104 Ga0157370_10010062 Ga0157370_100100627 189
442 3300013249 Ga0171463_1001 Ga0171463_10011279 189
443 3300013307 Ga0157372_11329973 Ga0157372_113299731 189
444 3300014325 Ga0163163_10517943 Ga0163163_105179431 189
445 3300014497 Ga0182008_10025465 Ga0182008_100254652 189
446 3300015262 Ga0182007_10001994 Ga0182007_100019944 189
447 3300015684 Ga0183365_10115 Ga0183365_101153 189
448 3300015690 Ga0183363_1187 Ga0183363_118712 189
449 3300021320 Ga0214544_1000434 Ga0214544_100043414 189
450 3300021321 Ga0214542_1000146 Ga0214542_100014626 189
451 3300021321 Ga0214542_1025313 Ga0214542_10253134 189
452 3300021327 Ga0214543_1000049 Ga0214543_10000499 189
453 3300021327 Ga0214543_1000054 Ga0214543_100005470 189
454 3300022739 Ga0228711_1000006 Ga0228711_100000667 189
455 3300022740 Ga0228710_1000004 Ga0228710_1000004115 189
456 3300025206 Ga0209435_100049 Ga0209435_10004941 189
457 3300025207 Ga0209760_103481 Ga0209760_1034812 189
458 3300025208 Ga0209436_100107 Ga0209436_1001075 189
459 3300025208 Ga0209436_101564 Ga0209436_1015643 189
460 3300025230 Ga0209563_104898 Ga0209563_1048982 189
461 3300025233 Ga0209437_100376 Ga0209437_10037643 189
462 3300025233 Ga0209437_100981 Ga0209437_1009817 189
463 3300025245 Ga0207425_1000052 Ga0207425_100005242 189
464 3300025245 Ga0207425_1007278 Ga0207425_10072784 189
465 3300025245 Ga0207425_1019367 Ga0207425_10193672 189
466 3300025245 Ga0207425_1025537 Ga0207425_10255372 189
467 3300025246 Ga0209646_1000159 Ga0209646_100015941 189
468 3300025246 Ga0209646_1031776 Ga0209646_10317761 189
469 3300025250 Ga0209026_1000183 Ga0209026_100018341 189
470 3300025253 Ga0209677_100684 Ga0209677_1006846 189
471 3300025254 Ga0209148_1000032 Ga0209148_100003254 189
472 3300025254 Ga0209148_1012400 Ga0209148_10124002 189
473 3300025256 Ga0209759_1000206 Ga0209759_100020641 189
474 3300025258 Ga0209129_1000512 Ga0209129_10005127 189
475 3300025258 Ga0209129_1000652 Ga0209129_100065217 189
476 3300025258 Ga0209129_1001160 Ga0209129_100116017 189
477 3300025258 Ga0209129_1002177 Ga0209129_10021775 189
478 3300025258 Ga0209129_1008991 Ga0209129_10089914 189
479 3300025261 Ga0209233_1000368 Ga0209233_100036843 189
480 3300025261 Ga0209233_1000423 Ga0209233_10004236 189
481 3300025261 Ga0209233_1000458 Ga0209233_10004584 189
482 3300025261 Ga0209233_1005874 Ga0209233_10058743 189
483 3300025272 Ga0209455_1000098 Ga0209455_1000098145 189
484 3300025273 Ga0209673_1000024 Ga0209673_100002421 189
485 3300025273 Ga0209673_1000358 Ga0209673_100035814 189
486 3300025273 Ga0209673_1000526 Ga0209673_10005267 189
487 3300025273 Ga0209673_1005762 Ga0209673_10057623 189
488 3300025273 Ga0209673_1006556 Ga0209673_10065563 189
489 3300025273 Ga0209673_1017558 Ga0209673_10175584 189
490 3300025284 Ga0209130_1000002 Ga0209130_1000002660 189
491 3300025284 Ga0209130_1000005 Ga0209130_1000005476 189
492 3300025284 Ga0209130_1000377 Ga0209130_100037741 189
493 3300025284 Ga0209130_1022883 Ga0209130_10228832 189
494 3300025292 Ga0209676_1008136 Ga0209676_10081363 189
495 3300025294 Ga0209025_1000037 Ga0209025_1000037298 189
496 3300025294 Ga0209025_1000144 Ga0209025_1000144154 189
497 3300025294 Ga0209025_1000274 Ga0209025_1000274111 189
498 3300025294 Ga0209025_1000553 Ga0209025_100055351 189
499 3300025294 Ga0209025_1001763 Ga0209025_10017635 189
500 3300025294 Ga0209025_1001809 Ga0209025_100180928 189
501 3300025294 Ga0209025_1014907 Ga0209025_10149072 189
502 3300025294 Ga0209025_1017884 Ga0209025_10178841 189
503 3300025294 Ga0209025_1028305 Ga0209025_10283053 189
504 3300025295 Ga0209564_1000113 Ga0209564_1000113167 189
505 3300025295 Ga0209564_1001082 Ga0209564_100108228 189
506 3300025295 Ga0209564_1003326 Ga0209564_10033267 189
507 3300025295 Ga0209564_1003465 Ga0209564_10034653 189
508 3300025295 Ga0209564_1004773 Ga0209564_10047733 189
509 3300025297 Ga0209758_1000519 Ga0209758_100051941 189
510 3300025297 Ga0209758_1003444 Ga0209758_10034447 189
511 3300025297 Ga0209758_1003617 Ga0209758_10036174 189
512 3300025297 Ga0209758_1006551 Ga0209758_10065516 189
513 3300025297 Ga0209758_1010846 Ga0209758_10108463 189
514 3300025297 Ga0209758_1019765 Ga0209758_10197653 189
515 3300025298 Ga0209050_1010553 Ga0209050_10105534 189
516 3300025298 Ga0209050_1012338 Ga0209050_10123383 189
517 3300025299 Ga0209256_1000595 Ga0209256_100059511 189
518 3300025299 Ga0209256_1000779 Ga0209256_100077943 189
519 3300025299 Ga0209256_1001173 Ga0209256_100117311 189
520 3300025299 Ga0209256_1001742 Ga0209256_10017426 189
521 3300025299 Ga0209256_1003431 Ga0209256_10034315 189
522 3300025299 Ga0209256_1006686 Ga0209256_10066864 189
523 3300025302 Ga0207426_1000013 Ga0207426_1000013660 189
524 3300025302 Ga0207426_1000015 Ga0207426_1000015123 189
525 3300025302 Ga0207426_1000142 Ga0207426_1000142190 189
526 3300025302 Ga0207426_1000330 Ga0207426_100033055 189
527 3300025303 Ga0209051_1000170 Ga0209051_10001707 189
528 3300025303 Ga0209051_1003992 Ga0209051_10039927 189
529 3300025303 Ga0209051_1041857 Ga0209051_10418572 189
530 3300025303 Ga0209051_1072126 Ga0209051_10721262 189
531 3300025304 Ga0209257_1003747 Ga0209257_10037474 189
532 3300025304 Ga0209257_1004397 Ga0209257_10043972 189
533 3300025904 Ga0207647_10313909 Ga0207647_103139092 189
534 3300025911 Ga0207654_10000874 Ga0207654_100008745 189
535 3300025913 Ga0207695_10000403 Ga0207695_1000040342 189
536 3300025913 Ga0207695_10078433 Ga0207695_100784333 189
537 3300025913 Ga0207695_10299401 Ga0207695_102994012 189
538 3300025913 Ga0207695_10468702 Ga0207695_104687021 189
539 3300025914 Ga0207671_10000277 Ga0207671_1000027757 189
540 3300025914 Ga0207671_10040568 Ga0207671_100405684 189
541 3300025919 Ga0207657_10036956 Ga0207657_100369562 189
542 3300025920 Ga0207649_10435508 Ga0207649_104355082 189
543 3300025923 Ga0207681_10280828 Ga0207681_102808282 189
544 3300025924 Ga0207694_10000306 Ga0207694_1000030633 189
545 3300025924 Ga0207694_10215765 Ga0207694_102157652 189
546 3300025925 Ga0207650_10007746 Ga0207650_100077464 189
547 3300025935 Ga0207709_10074535 Ga0207709_100745351 189
548 3300025941 Ga0207711_10472544 Ga0207711_104725442 189
549 3300025949 Ga0207667_10326844 Ga0207667_103268441 189
550 3300025949 Ga0207667_10545678 Ga0207667_105456782 189
551 3300025972 Ga0207668_10235057 Ga0207668_102350571 189
552 3300025972 Ga0207668_10590693 Ga0207668_105906931 189
553 3300025972 Ga0207668_11053288 Ga0207668_110532881 189
554 3300025981 Ga0207640_10103651 Ga0207640_101036512 189
555 3300025981 Ga0207640_10293073 Ga0207640_102930731 189
556 3300026041 Ga0207639_10007131 Ga0207639_100071315 189
557 3300026078 Ga0207702_10000122 Ga0207702_1000012249 189
558 3300026078 Ga0207702_10069413 Ga0207702_100694132 189
559 3300026089 Ga0207648_10198516 Ga0207648_101985162 189
560 3300026116 Ga0207674_10014657 Ga0207674_100146574 189
561 3300026142 Ga0207698_10635680 Ga0207698_106356802 189
562 3300027111 Ga0209281_1000102 Ga0209281_100010250 189
563 3300027111 Ga0209281_1000242 Ga0209281_1000242103 189
564 3300027111 Ga0209281_1001000 Ga0209281_10010002 189
565 3300027312 Ga0209371_1000009 Ga0209371_1000009961 189
566 3300027312 Ga0209371_1000753 Ga0209371_100075321 189
567 3300027312 Ga0209371_1010361 Ga0209371_10103612 189
568 3300027666 Ga0209282_1000013 Ga0209282_100001385 189
569 3300027666 Ga0209282_1054350 Ga0209282_10543502 189
570 3300027866 Ga0209813_10256829 Ga0209813_102568291 189
571 3300027876 Ga0209974_10090688 Ga0209974_100906882 189
572 3300028379 Ga0268266_10015894 Ga0268266_100158944 189
573 3300028379 Ga0268266_10196760 Ga0268266_101967602 189
574 3300028379 Ga0268266_10373791 Ga0268266_103737911 189
575 3300028380 Ga0268265_10450413 Ga0268265_104504131 189
576 3300028794 Ga0307515_10000029 Ga0307515_1000002973 189
577 3300028794 Ga0307515_10004789 Ga0307515_100047893 189
578 3300028794 Ga0307515_10090749 Ga0307515_100907495 189
579 3300030500 Ga0268256_1000010 Ga0268256_1000010960 189
580 3300030500 Ga0268256_1006679 Ga0268256_10066793 189
581 3300030500 Ga0268256_1011108 Ga0268256_10111082 189
582 3300030744 Ga0316181_1012451 Ga0316181_10124512 189
583 3300031456 Ga0307513_10000259 Ga0307513_1000025960 189
584 3300031456 Ga0307513_10006892 Ga0307513_1000689210 189
585 3300031548 Ga0307408_100139087 Ga0307408_1001390872 189
586 3300031548 Ga0307408_100188754 Ga0307408_1001887541 189
587 3300031548 Ga0307408_100224344 Ga0307408_1002243441 189
588 3300031731 Ga0307405_10008332 Ga0307405_100083326 189
589 3300031731 Ga0307405_10059053 Ga0307405_100590532 189
590 3300031852 Ga0307410_10288213 Ga0307410_102882132 189
591 3300031852 Ga0307410_10627656 Ga0307410_106276562 189
592 3300031901 Ga0307406_10016724 Ga0307406_100167242 189
593 3300031901 Ga0307406_10018389 Ga0307406_100183895 189
594 3300031911 Ga0307412_10002473 Ga0307412_100024735 189
595 3300031911 Ga0307412_10140704 Ga0307412_101407042 189
596 3300031911 Ga0307412_10876026 Ga0307412_108760261 189
597 3300031967 Ga0315914_1000004 Ga0315914_1000004120 189
598 3300032004 Ga0307414_10006754 Ga0307414_100067542 189
599 3300032126 Ga0307415_100284250 Ga0307415_1002842501 189
600 3300033180 Ga0307510_10142663 Ga0307510_101426633 189
601 3300033430 Ga0315913_1000011 Ga0315913_100001171 189
602 3300033464 Ga0315915_1000003 Ga0315915_1000003227 189
603 3300035724 Ga0373933_0152060 Ga0373933_0152060_232_834 189
604 3300037312 Ga0395899_0000014 Ga0395899_0000014_433746_434351 189
605 3300037312 Ga0395899_0130225 Ga0395899_0130225_13_618 189
606 3300037418 Ga0395900_0000007 Ga0395900_0000007_433765_434370 189
607 3300037418 Ga0395900_0028651 Ga0395900_0028651_623_1216 189
608 3300037418 Ga0395900_0157240 Ga0395900_0157240_1529_2134 189
609 3300037466 Ga0395898_0000011 Ga0395898_0000011_54491_55096 189
610 3300037466 Ga0395898_0442827 Ga0395898_0442827_68_673 189
611 3300037466 Ga0395898_0792537 Ga0395898_0792537_58_663 189
612 3300037471 Ga0395905_0000008 Ga0395905_0000008_433765_434370 189
613 3300037471 Ga0395905_0026548 Ga0395905_0026548_3085_3690 189
614 3300037471 Ga0395905_0740775 Ga0395905_0740775_264_863 189
615 3300038443 Ga0395901_0000020 Ga0395901_0000020_259823_260428 189
616 3300038443 Ga0395901_0039656 Ga0395901_0039656_70_663 189
617 3300038443 Ga0395901_0123607 Ga0395901_0123607_1959_2564 189
618 3300039447 Ga0436361_0925979 Ga0436361_0925979_4684_5277 189
619 3300041404 Ga0439436_0004015 Ga0439436_0004015_699_1304 189
620 3300041404 Ga0439436_0119861 Ga0439436_0119861_85_690 189
621 3300041411 Ga0439466_0010643 Ga0439466_0010643_921_1526 189
622 3300041413 Ga0439465_0010834 Ga0439465_0010834_1644_2249 189
623 3300041413 Ga0439465_0054871 Ga0439465_0054871_292_897 189
624 3300041413 Ga0439465_0104418 Ga0439465_0104418_123_728 189
625 3300041413 Ga0439465_0111060 Ga0439465_0111060_285_890 189
626 3300041451 Ga0451791_1632668 Ga0451791_1632668_119_724 189
627 3300041460 Ga0451802_0635447 Ga0451802_0635447_137_742 189
628 3300041460 Ga0451802_2010556 Ga0451802_2010556_55_660 189
629 3300041491 Ga0451833_1047326 Ga0451833_1047326_649_1254 189
630 3300041492 Ga0451835_0225566 Ga0451835_0225566_431_1036 189
631 3300041494 Ga0451837_0612366 Ga0451837_0612366_181_786 189
632 3300041496 Ga0451839_0144518 Ga0451839_0144518_1894_2499 189
633 3300041501 Ga0451845_0139134 Ga0451845_0139134_1521_2126 189
634 3300041505 Ga0451849_0490860 Ga0451849_0490860_885_1490 189
635 3300041506 Ga0451850_44427 Ga0451850_44427_10_615 189
636 3300041507 Ga0451851_0942673 Ga0451851_0942673_464_1069 189
637 3300041509 Ga0451843_0920087 Ga0451843_0920087_10_615 189
638 3300041512 Ga0451853_1426223 Ga0451853_1426223_81_686 189
639 3300042004 Ga0439445_0020758 Ga0439445_0020758_74_679 189
640 3300042006 Ga0439432_021943 Ga0439432_021943_186_791 189
641 3300042010 Ga0439452_049293 Ga0439452_049293_100_705 189
642 3300042435 Ga0439434_0012666 Ga0439434_0012666_1868_2473 189
643 3300044683 Ga0466965_0289886 Ga0466965_0289886_234_839 189
644 3300044765 Ga0466970_0040589 Ga0466970_0040589_956_1561 189
645 3300046454 Ga0495592_0169386 Ga0495592_0169386_275_880 189
646 3300046459 Ga0495629_0103741 Ga0495629_0103741_729_1334 189
647 3300046460 Ga0495638_0000546 Ga0495638_0000546_39411_40016 189
648 3300046460 Ga0495638_0077751 Ga0495638_0077751_527_1132 189
649 3300046460 Ga0495638_0244486 Ga0495638_0244486_148_753 189
650 3300046474 Ga0495605_0054245 Ga0495605_0054245_571_1176 189
651 3300046474 Ga0495605_0130573 Ga0495605_0130573_105_710 189
652 3300046475 Ga0495639_0045687 Ga0495639_0045687_833_1438 189
653 3300046476 Ga0495662_0015245 Ga0495662_0015245_2243_2848 189
654 3300046477 Ga0495664_0209758 Ga0495664_0209758_86_691 189
655 3300046492 Ga0495585_0020311 Ga0495585_0020311_793_1398 189
656 3300046492 Ga0495585_0037183 Ga0495585_0037183_1903_2508 189
657 3300046492 Ga0495585_0099951 Ga0495585_0099951_366_971 189
658 3300046501 Ga0495607_0128246 Ga0495607_0128246_667_1272 189
659 3300046506 Ga0495583_0008658 Ga0495583_0008658_194_799 189
660 3300046507 Ga0495606_0002266 Ga0495606_0002266_19488_20093 189
661 3300046507 Ga0495606_0073940 Ga0495606_0073940_947_1552 189
662 3300046507 Ga0495606_0147526 Ga0495606_0147526_153_758 189
663 3300046507 Ga0495606_0222122 Ga0495606_0222122_314_919 189
664 3300046511 Ga0495608_0278944 Ga0495608_0278944_279_884 189
665 3300046512 Ga0495610_0005975 Ga0495610_0005975_384_989 189
666 3300046512 Ga0495610_0020444 Ga0495610_0020444_1329_1934 189
667 3300046512 Ga0495610_0023252 Ga0495610_0023252_2480_3085 189
668 3300046513 Ga0495616_0293280 Ga0495616_0293280_49_654 189
669 3300046514 Ga0495618_0100793 Ga0495618_0100793_807_1412 189
670 3300046515 Ga0495620_0019578 Ga0495620_0019578_655_1260 189
671 3300046515 Ga0495620_0046384 Ga0495620_0046384_703_1308 189
672 3300046518 Ga0495631_0001028 Ga0495631_0001028_13613_14218 189
673 3300046518 Ga0495631_0156984 Ga0495631_0156984_346_951 189
674 3300046519 Ga0495632_0005041 Ga0495632_0005041_4190_4795 189
675 3300046519 Ga0495632_0019634 Ga0495632_0019634_36_641 189
676 3300046519 Ga0495632_0044432 Ga0495632_0044432_839_1444 189
677 3300046519 Ga0495632_0109648 Ga0495632_0109648_573_1178 189
678 3300046522 Ga0495643_0015915 Ga0495643_0015915_179_784 189
679 3300046522 Ga0495643_0296305 Ga0495643_0296305_97_702 189
680 3300046524 Ga0495648_0096410 Ga0495648_0096410_414_1019 189
681 3300046524 Ga0495648_0208941 Ga0495648_0208941_145_750 189
682 3300046530 Ga0495654_0015378 Ga0495654_0015378_3339_3944 189
683 3300046530 Ga0495654_0122724 Ga0495654_0122724_375_980 189
684 3300046538 Ga0495609_0034048 Ga0495609_0034048_545_1150 189
685 3300046538 Ga0495609_0070785 Ga0495609_0070785_468_1073 189
686 3300046558 Ga0495633_0040533 Ga0495633_0040533_1097_1702 189
687 3300046558 Ga0495633_0158958 Ga0495633_0158958_347_952 189
688 3300046616 Ga0495668_0005580 Ga0495668_0005580_4809_5414 189
689 3300046616 Ga0495668_0117107 Ga0495668_0117107_579_1184 189
690 3300046660 Ga0495625_0018733 Ga0495625_0018733_4696_5301 189
691 3300046660 Ga0495625_0077382 Ga0495625_0077382_1221_1826 189
692 3300046660 Ga0495625_0083613 Ga0495625_0083613_1021_1626 189
693 3300046660 Ga0495625_0197453 Ga0495625_0197453_244_849 189
694 3300046660 Ga0495625_0476483 Ga0495625_0476483_113_718 189
695 3300046663 Ga0495635_0060576 Ga0495635_0060576_1303_1908 189
696 3300046674 Ga0495588_0011538 Ga0495588_0011538_294_899 189
697 3300046674 Ga0495588_0188301 Ga0495588_0188301_278_883 189
698 3300046674 Ga0495588_0383667 Ga0495588_0383667_42_647 189
699 3300046675 Ga0495657_0027079 Ga0495657_0027079_360_965 189
700 3300046683 Ga0495658_0154600 Ga0495658_0154600_304_909 189
701 3300046690 Ga0495624_0059561 Ga0495624_0059561_1525_2130 189
702 3300046691 Ga0495670_0012454 Ga0495670_0012454_2210_2815 189
703 3300046691 Ga0495670_0129084 Ga0495670_0129084_286_891 189
704 3300046692 Ga0495671_0056499 Ga0495671_0056499_87_692 189
705 3300046694 Ga0495649_0083801 Ga0495649_0083801_696_1301 189
706 3300046809 Ga0495600_0094487 Ga0495600_0094487_801_1406 189
707 3300046810 Ga0495660_0101960 Ga0495660_0101960_374_979 189
708 3300046810 Ga0495660_0114109 Ga0495660_0114109_329_934 189
709 3300047317 Ga0495604_0012170 Ga0495604_0012170_4552_5157 189
710 3300047318 Ga0495636_0006784 Ga0495636_0006784_1671_2276 189
711 3300047318 Ga0495636_0119252 Ga0495636_0119252_137_742 189
712 3300047320 Ga0495672_0127518 Ga0495672_0127518_503_1108 189
713 3300047321 Ga0495676_0180875 Ga0495676_0180875_32_637 189
714 3300047321 Ga0495676_0728792 Ga0495676_0728792_25_630 189
715 3300047443 Ga0495687_045699 Ga0495687_045699_538_1143 189
716 3300047470 Ga0495681_0009047 Ga0495681_0009047_877_1482 189
717 3300047470 Ga0495681_0087484 Ga0495681_0087484_164_769 189
718 3300047472 Ga0495686_0002692 Ga0495686_0002692_9721_10326 189
719 3300047472 Ga0495686_0008891 Ga0495686_0008891_3557_4162 189
720 3300047472 Ga0495686_0024874 Ga0495686_0024874_3175_3780 189
721 3300047472 Ga0495686_0106470 Ga0495686_0106470_194_799 189
722 3300048904 Ga0496101_0720618 Ga0496101_0720618_80_685 189
723 3300048909 Ga0496106_0001500 Ga0496106_0001500_5457_6062 189
724 3300048912 Ga0496109_1342714 Ga0496109_1342714_64_633 189
725 3300048913 Ga0496110_0092811 Ga0496110_0092811_1788_2393 189
726 3300048915 Ga0496112_0115472 Ga0496112_0115472_208_813 189
727 3300048916 Ga0496113_0043669 Ga0496113_0043669_1566_2171 189
728 3300048917 Ga0496114_0079087 Ga0496114_0079087_969_1574 189
729 3300048919 Ga0496116_0003263 Ga0496116_0003263_12912_13517 189
730 3300048919 Ga0496116_0008065 Ga0496116_0008065_4895_5500 189
731 3300048919 Ga0496116_0010337 Ga0496116_0010337_3352_3957 189
732 3300048919 Ga0496116_0010585 Ga0496116_0010585_4145_4750 189
733 3300048919 Ga0496116_0017190 Ga0496116_0017190_2556_3161 189
734 3300048919 Ga0496116_0032150 Ga0496116_0032150_1238_1843 189
735 3300048919 Ga0496116_0049407 Ga0496116_0049407_1969_2574 189
736 3300048919 Ga0496116_0099238 Ga0496116_0099238_57_668 189
737 3300048919 Ga0496116_0158685 Ga0496116_0158685_482_1087 189
738 3300048920 Ga0496117_0000002 Ga0496117_0000002_2448830_2449435 189
739 3300048920 Ga0496117_0007528 Ga0496117_0007528_7464_8069 189
740 3300048920 Ga0496117_0019256 Ga0496117_0019256_1121_1726 189
741 3300048920 Ga0496117_0027688 Ga0496117_0027688_1659_2264 189
742 3300048920 Ga0496117_0029148 Ga0496117_0029148_132_737 189
743 3300048920 Ga0496117_0086136 Ga0496117_0086136_740_1345 189
744 3300048921 Ga0496118_0001144 Ga0496118_0001144_28655_29260 189
745 3300048921 Ga0496118_0010886 Ga0496118_0010886_5294_5899 189
746 3300048921 Ga0496118_0012872 Ga0496118_0012872_4884_5489 189
747 3300048921 Ga0496118_0015478 Ga0496118_0015478_4684_5289 189
748 3300048921 Ga0496118_0026093 Ga0496118_0026093_1930_2535 189
749 3300048921 Ga0496118_0031868 Ga0496118_0031868_155_760 189
750 3300048921 Ga0496118_0037645 Ga0496118_0037645_2055_2660 189
751 3300048921 Ga0496118_0096433 Ga0496118_0096433_368_973 189
752 3300048921 Ga0496118_0144614 Ga0496118_0144614_759_1364 189
753 3300048922 Ga0496119_0030183 Ga0496119_0030183_467_1072 189
754 3300048922 Ga0496119_0039982 Ga0496119_0039982_660_1265 189
755 3300048922 Ga0496119_0061336 Ga0496119_0061336_853_1458 189
756 3300048922 Ga0496119_0074717 Ga0496119_0074717_810_1415 189
757 3300048922 Ga0496119_0127794 Ga0496119_0127794_28_633 189
758 3300048922 Ga0496119_0210866 Ga0496119_0210866_160_765 189
759 3300048923 Ga0496120_0000897 Ga0496120_0000897_28680_29285 189
760 3300048923 Ga0496120_0006409 Ga0496120_0006409_3145_3750 189
761 3300048923 Ga0496120_0033065 Ga0496120_0033065_659_1264 189
762 3300048923 Ga0496120_0051950 Ga0496120_0051950_1681_2286 189
763 3300048923 Ga0496120_0053389 Ga0496120_0053389_651_1256 189
764 3300048924 Ga0496121_0000001 Ga0496121_0000001_345758_346369 189
765 3300048924 Ga0496121_0014826 Ga0496121_0014826_3266_3871 189
766 3300048924 Ga0496121_0015513 Ga0496121_0015513_4222_4827 189
767 3300048924 Ga0496121_0037849 Ga0496121_0037849_1169_1774 189
768 3300048924 Ga0496121_0048170 Ga0496121_0048170_2044_2649 189
769 3300048924 Ga0496121_0061121 Ga0496121_0061121_1183_1788 189
770 3300048924 Ga0496121_0068259 Ga0496121_0068259_680_1285 189
771 3300048924 Ga0496121_0100418 Ga0496121_0100418_1403_2008 189
772 3300048924 Ga0496121_0109219 Ga0496121_0109219_819_1424 189
773 3300048925 Ga0496122_0000001 Ga0496122_0000001_1792838_1793443 189
774 3300048925 Ga0496122_0000147 Ga0496122_0000147_62653_63258 189
775 3300048925 Ga0496122_0014175 Ga0496122_0014175_6125_6730 189
776 3300048925 Ga0496122_0017929 Ga0496122_0017929_2611_3216 189
777 3300048925 Ga0496122_0032102 Ga0496122_0032102_543_1148 189
778 3300048925 Ga0496122_0048435 Ga0496122_0048435_2574_3179 189
779 3300048925 Ga0496122_0073416 Ga0496122_0073416_1376_1981 189
780 3300048925 Ga0496122_0075366 Ga0496122_0075366_1459_2064 189
781 3300048926 Ga0496123_0000001 Ga0496123_0000001_1796569_1797174 189
782 3300048926 Ga0496123_0000339 Ga0496123_0000339_72925_73530 189
783 3300048926 Ga0496123_0009975 Ga0496123_0009975_2817_3422 189
784 3300048926 Ga0496123_0026193 Ga0496123_0026193_2044_2649 189
785 3300048926 Ga0496123_0030893 Ga0496123_0030893_3151_3756 189
786 3300048926 Ga0496123_0167018 Ga0496123_0167018_516_1127 189
787 3300048927 Ga0496124_0000855 Ga0496124_0000855_28056_28661 189
788 3300048927 Ga0496124_0005152 Ga0496124_0005152_12640_13245 189
789 3300048927 Ga0496124_0009075 Ga0496124_0009075_6152_6757 189
790 3300048927 Ga0496124_0013491 Ga0496124_0013491_2427_3032 189
791 3300048927 Ga0496124_0013971 Ga0496124_0013971_3750_4355 189
792 3300048927 Ga0496124_0044318 Ga0496124_0044318_729_1334 189
793 3300048927 Ga0496124_0049119 Ga0496124_0049119_2596_3201 189
794 3300048927 Ga0496124_0065713 Ga0496124_0065713_1043_1648 189
795 3300048927 Ga0496124_0107705 Ga0496124_0107705_945_1550 189
796 3300048927 Ga0496124_0130299 Ga0496124_0130299_62_667 189
797 3300048928 Ga0496125_0000001 Ga0496125_0000001_457792_458397 189
798 3300048928 Ga0496125_0000299 Ga0496125_0000299_8049_8654 189
799 3300048928 Ga0496125_0011662 Ga0496125_0011662_4658_5263 189
800 3300048928 Ga0496125_0043778 Ga0496125_0043778_505_1110 189
801 3300048928 Ga0496125_0127984 Ga0496125_0127984_730_1335 189
802 3300048928 Ga0496125_0251824 Ga0496125_0251824_415_1020 189
803 3300048929 Ga0496126_0007868 Ga0496126_0007868_8487_9092 189
804 3300048929 Ga0496126_0008341 Ga0496126_0008341_7302_7907 189
805 3300048929 Ga0496126_0008758 Ga0496126_0008758_2604_3209 189
806 3300048929 Ga0496126_0017034 Ga0496126_0017034_2259_2864 189
807 3300048929 Ga0496126_0167311 Ga0496126_0167311_1242_1847 189
808 3300048929 Ga0496126_0222780 Ga0496126_0222780_295_900 189
809 3300048929 Ga0496126_0245018 Ga0496126_0245018_526_1131 189
810 3300048929 Ga0496126_0247081 Ga0496126_0247081_705_1310 189
811 3300048929 Ga0496126_0390062 Ga0496126_0390062_159_764 189
812 3300048929 Ga0496126_0494138 Ga0496126_0494138_150_755 189
813 3300048929 Ga0496126_0895315 Ga0496126_0895315_25_630 189
814 3300049459 Ga0495678_005547 Ga0495678_005547_3578_4183 189
815 3300049460 Ga0495682_0049575 Ga0495682_0049575_445_1050 189
816 3300049568 Ga0501031_0000076 Ga0501031_0000076_33157_33762 189
817 3300049568 Ga0501031_0146384 Ga0501031_0146384_740_1345 189
818 3300049569 Ga0501032_0000004 Ga0501032_0000004_292142_292747 189
819 3300049569 Ga0501032_0001730 Ga0501032_0001730_5631_6236 189
820 3300049570 Ga0501033_0000156 Ga0501033_0000156_47134_47739 189
821 3300049570 Ga0501033_0004642 Ga0501033_0004642_1106_1711 189
822 3300049570 Ga0501033_0016132 Ga0501033_0016132_3314_3919 189
823 3300049570 Ga0501033_0064673 Ga0501033_0064673_88_693 189
824 3300049571 Ga0501034_0000011 Ga0501034_0000011_292142_292747 189
825 3300049571 Ga0501034_0012488 Ga0501034_0012488_2962_3567 189
826 3300049571 Ga0501034_1101560 Ga0501034_1101560_49_654 189
827 3300049572 Ga0501036_0000001 Ga0501036_0000001_292142_292747 189
828 3300049572 Ga0501036_0163307 Ga0501036_0163307_1074_1679 189
829 3300049572 Ga0501036_0325085 Ga0501036_0325085_541_1146 189
830 3300049573 Ga0501037_0000064 Ga0501037_0000064_21734_22339 189
831 3300049573 Ga0501037_0026452 Ga0501037_0026452_2611_3216 189
832 3300049573 Ga0501037_0423780 Ga0501037_0423780_15_620 189
833 3300049574 Ga0501038_0000003 Ga0501038_0000003_292142_292747 189
834 3300049574 Ga0501038_0010727 Ga0501038_0010727_2953_3558 189
835 3300049574 Ga0501038_0011121 Ga0501038_0011121_5165_5770 189
836 3300049575 Ga0501039_0000004 Ga0501039_0000004_292142_292747 189
837 3300049575 Ga0501039_0087466 Ga0501039_0087466_1482_2087 189
838 3300049575 Ga0501039_0376594 Ga0501039_0376594_238_843 189
839 3300049576 Ga0501040_0040897 Ga0501040_0040897_2319_2924 189
840 3300049578 Ga0501042_0385045 Ga0501042_0385045_198_803 189
841 3300049579 Ga0501043_0000417 Ga0501043_0000417_6062_6667 189
842 3300049579 Ga0501043_0043205 Ga0501043_0043205_1456_2061 189
843 3300049579 Ga0501043_0107312 Ga0501043_0107312_161_766 189
844 3300049579 Ga0501043_0406448 Ga0501043_0406448_243_848 189
845 3300049580 Ga0501046_0008545 Ga0501046_0008545_5206_5811 189
846 3300049580 Ga0501046_0037795 Ga0501046_0037795_1994_2599 189
847 3300049581 Ga0501047_0002889 Ga0501047_0002889_5367_5972 189
848 3300049581 Ga0501047_0007276 Ga0501047_0007276_5206_5811 189
849 3300049581 Ga0501047_0599042 Ga0501047_0599042_58_663 189
850 3300049582 Ga0501048_0006355 Ga0501048_0006355_1567_2172 189
851 3300049583 Ga0501067_0066419 Ga0501067_0066419_1032_1637 189
852 3300049584 Ga0501068_0010696 Ga0501068_0010696_2933_3538 189
853 3300049586 Ga0501070_0009102 Ga0501070_0009102_6719_7324 189
854 3300049586 Ga0501070_0017361 Ga0501070_0017361_1357_1962 189
855 3300049586 Ga0501070_0324490 Ga0501070_0324490_487_1092 189
856 3300049587 Ga0501071_0025630 Ga0501071_0025630_1074_1679 189
857 3300049588 Ga0501072_0216553 Ga0501072_0216553_734_1339 189
858 3300049589 Ga0501073_0019818 Ga0501073_0019818_2716_3321 189
859 3300049589 Ga0501073_0233733 Ga0501073_0233733_616_1221 189
860 3300049741 Ga0501079_0775233 Ga0501079_0775233_34_639 189
861 3300049742 Ga0501080_0019003 Ga0501080_0019003_5244_5849 189
862 3300049744 Ga0501083_0034469 Ga0501083_0034469_1455_2060 189
863 3300049744 Ga0501083_0051249 Ga0501083_0051249_459_1064 189
864 3300049822 Ga0501035_0000009 Ga0501035_0000009_18081_18686 189
865 3300049822 Ga0501035_0000529 Ga0501035_0000529_41502_42107 189
866 3300049822 Ga0501035_0071606 Ga0501035_0071606_1217_1822 189
867 3300049822 Ga0501035_0074295 Ga0501035_0074295_1729_2334 189
868 3300049823 Ga0501044_0000005 Ga0501044_0000005_292142_292747 189
869 3300049823 Ga0501044_0003713 Ga0501044_0003713_12226_12831 189
870 3300049823 Ga0501044_0055686 Ga0501044_0055686_62_667 189
871 3300049824 Ga0501045_0005304 Ga0501045_0005304_8186_8791 189
872 3300049824 Ga0501045_0682439 Ga0501045_0682439_79_684 189
873 3300050489 nmdc:mga03683_32311_c1 nmdc:mga03683_32311_c1_379_984 189
874 3300050490 nmdc:mga03n38_233173_c1 nmdc:mga03n38_233173_c1_83_688 189
875 3300050490 nmdc:mga03n38_70047_c1 nmdc:mga03n38_70047_c1_285_890 189
876 3300050491 nmdc:mga00v17_102_c1 nmdc:mga00v17_102_c1_34379_34984 189
877 3300050491 nmdc:mga00v17_1909_c1 nmdc:mga00v17_1909_c1_5558_6181 189
878 3300050491 nmdc:mga00v17_58439_c1 nmdc:mga00v17_58439_c1_689_1294 189
879 3300050491 nmdc:mga00v17_86644_c1 nmdc:mga00v17_86644_c1_810_1415 189
880 3300050492 nmdc:mga0yw44_183_c1 nmdc:mga0yw44_183_c1_18379_18984 189
881 3300050492 nmdc:mga0yw44_7212_c1 nmdc:mga0yw44_7212_c1_416_1021 189
882 3300050493 nmdc:mga0k408_13416_c1 nmdc:mga0k408_13416_c1_369_974 189
883 3300050493 nmdc:mga0k408_14555_c1 nmdc:mga0k408_14555_c1_285_890 189
884 3300050494 nmdc:mga06z11_3460_c1 nmdc:mga06z11_3460_c1_5295_5900 189
885 3300050494 nmdc:mga06z11_39349_c1 nmdc:mga06z11_39349_c1_228_833 189
886 3300050495 nmdc:mga04h51_178406_c1 nmdc:mga04h51_178406_c1_210_815 189
887 3300050495 nmdc:mga04h51_18788_c1 nmdc:mga04h51_18788_c1_587_1192 189
888 3300050496 nmdc:mga07m45_224961_c1 nmdc:mga07m45_224961_c1_415_1020 189
889 3300050496 nmdc:mga07m45_70146_c1 nmdc:mga07m45_70146_c1_337_942 189
890 3300050516 nmdc:mga0sz30_126005_c2 nmdc:mga0sz30_126005_c2_14_619 189
891 3300050516 nmdc:mga0sz30_186200_c1 nmdc:mga0sz30_186200_c1_332_904 189
892 3300050516 nmdc:mga0sz30_21092_c1 nmdc:mga0sz30_21092_c1_366_971 189
893 3300050516 nmdc:mga0sz30_2245_c1 nmdc:mga0sz30_2245_c1_4074_4679 189
894 3300050516 nmdc:mga0sz30_8262_c1 nmdc:mga0sz30_8262_c1_2242_2847 189
895 3300053086 Ga0500578_0023226 Ga0500578_0023226_423_1028 189
896 3300053086 Ga0500578_0315407 Ga0500578_0315407_149_754 189
897 3300053087 Ga0500643_011498 Ga0500643_011498_2541_3149 189
898 3300053093 Ga0500651_0267223 Ga0500651_0267223_110_715 189
899 3300053098 Ga0500650_0106819 Ga0500650_0106819_473_1078 189
900 3300053109 Ga0500569_001711 Ga0500569_001711_2827_3432 189
901 3300053109 Ga0500569_069772 Ga0500569_069772_346_951 189
902 3300053118 Ga0500594_0008368 Ga0500594_0008368_1039_1644 189
903 3300053119 Ga0500595_120985 Ga0500595_120985_30_635 189
904 3300053122 Ga0500608_048497 Ga0500608_048497_230_835 189
905 3300053125 Ga0500618_001168 Ga0500618_001168_7376_7981 189
906 3300053126 Ga0500621_073642 Ga0500621_073642_205_810 189
907 3300053134 Ga0500658_0001271 Ga0500658_0001271_2624_3229 189
908 3300053134 Ga0500658_0026298 Ga0500658_0026298_487_1092 189
909 3300053137 Ga0500561_0000341 Ga0500561_0000341_4723_5328 189
910 3300053139 Ga0500568_0000611 Ga0500568_0000611_19880_20485 189
911 3300053139 Ga0500568_0004778 Ga0500568_0004778_4358_4963 189
912 3300053139 Ga0500568_0005331 Ga0500568_0005331_2916_3521 189
913 3300053146 Ga0500588_0084584 Ga0500588_0084584_280_885 189
914 3300053148 Ga0500590_010535 Ga0500590_010535_1960_2565 189
915 3300053151 Ga0500604_0184196 Ga0500604_0184196_63_668 189
916 3300053153 Ga0500616_0008121 Ga0500616_0008121_3100_3705 189
917 3300053153 Ga0500616_0053271 Ga0500616_0053271_1288_1893 189
918 3300053153 Ga0500616_0066960 Ga0500616_0066960_390_995 189
919 3300053156 Ga0500622_0004278 Ga0500622_0004278_5266_5871 189
920 3300053157 Ga0500624_000676 Ga0500624_000676_2590_3195 189
921 3300053158 Ga0500627_0065024 Ga0500627_0065024_115_720 189
922 3300053161 Ga0500634_0063231 Ga0500634_0063231_433_1038 189
923 3300053177 Ga0500636_0000094 Ga0500636_0000094_27071_27676 189
924 3300053177 Ga0500636_0004270 Ga0500636_0004270_4711_5316 189
925 3300054114 Ga0501084_0203461 Ga0501084_0203461_82_687 189
926 3300060353 Ga0501082_0086060 Ga0501082_0086060_653_1258 189
927 3300060353 Ga0501082_1060610 Ga0501082_1060610_13_618 189
928 iso_pu_bacteria 2503198000 2503198054 189
929 iso_pu_bacteria 2508501122 2509111503 189
930 iso_pu_bacteria 2508501127 2509140279 189
931 iso_pu_bacteria 2509276019 2509375501 189
932 iso_pu_bacteria 2509276021 2509389070 189
933 iso_pu_bacteria 2509276033 2509444656 189
934 iso_pu_bacteria 2510065019 2510135597 189
935 iso_pu_bacteria 2510065057 2510308058 189
936 iso_pu_bacteria 2510065059 2510314400 189
937 iso_pu_bacteria 2510461069 2510838940 189
938 iso_pu_bacteria 2510461076 2510897067 189
939 iso_pu_bacteria 2510917022 2511132141 189
940 iso_pu_bacteria 2510917030 2511194261 189
941 iso_pu_bacteria 2511231027 2511389206 189
942 iso_pu_bacteria 2511231052 2511498834 189
943 iso_pu_bacteria 2512047086 2512534970 189
944 iso_pu_bacteria 2512875016 2512934463 189
945 iso_pu_bacteria 2512875024 2512962809 189
946 iso_pu_bacteria 2512875026 2512973208 189
947 iso_pu_bacteria 2513237084 2513570760 189
948 iso_pu_bacteria 2513237085 2513575027 189
949 iso_pu_bacteria 2513237086 2513587522 189
950 iso_pu_bacteria 2513237089 2513603568 189
951 iso_pu_bacteria 2513237091 2513618993 189
952 iso_pu_bacteria 2513237092 2513627009 189
953 iso_pu_bacteria 2513237093 2513633810 189
954 iso_pu_bacteria 2513237094 2513638540 189
955 iso_pu_bacteria 2513237095 2513653111 189
956 iso_pu_bacteria 2513237103 2513713036 189
957 iso_pu_bacteria 2513237104 2513714856 189
958 iso_pu_bacteria 2513237139 2513875654 189
959 iso_pu_bacteria 2513237140 2513882549 189
960 iso_pu_bacteria 2513237143 2513904533 189
961 iso_pu_bacteria 2513237144 2513914464 189
962 iso_pu_bacteria 2513237146 2513924230 189
963 iso_pu_bacteria 2513237156 2513983273 189
964 iso_pu_bacteria 2513237159 2513996244 189
965 iso_pu_bacteria 2513237160 2514005808 189
966 iso_pu_bacteria 2513237161 2514016322 189
967 iso_pu_bacteria 2513237162 2514023603 189
968 iso_pu_bacteria 2513237164 2514037518 189
969 iso_pu_bacteria 2513237351 2514586128 189
970 iso_pu_bacteria 2515075009 2515114760 189
971 iso_pu_bacteria 2515154107 2515607262 189
972 iso_pu_bacteria 2515154113 2515638072 189
973 iso_pu_bacteria 2515154114 2515641499 189
974 iso_pu_bacteria 2515154116 2515659389 189
975 iso_pu_bacteria 2515154134 2515741254 189
976 iso_pu_bacteria 2516143018 2516204849 189
977 iso_pu_bacteria 2516653046 2516895112 189
978 iso_pu_bacteria 2516653077 2517038376 189
979 iso_pu_bacteria 2516653085 2517078655 189
980 iso_pu_bacteria 2517093000 2517097397 189
981 iso_pu_bacteria 2517093001 2517105834 189
982 iso_pu_bacteria 2517287029 2517408851 189
983 iso_pu_bacteria 2517487022 2517571789 189
984 iso_pu_bacteria 2519899620 2520381716 189
985 iso_pu_bacteria 2524023205 2524438629 189
986 iso_pu_bacteria 2524023207 2524452483 189
987 iso_pu_bacteria 2524023209 2524462147 189
988 iso_pu_bacteria 2528768022 2528851477 189
989 iso_pu_bacteria 2529292951 2530648414 189
990 iso_pu_bacteria 2537561587 2537877237 189
991 iso_pu_bacteria 2551306084 2551678036 189
992 iso_pu_bacteria 2551306085 2551685816 189
993 iso_pu_bacteria 2551306086 2551691144 189
994 iso_pu_bacteria 2551306087 2551698495 189
995 iso_pu_bacteria 2551306089 2551708237 189
996 iso_pu_bacteria 2551306090 2551715806 189
997 iso_pu_bacteria 2551306091 2551725145 189
998 iso_pu_bacteria 2551306092 2551731856 189
999 iso_pu_bacteria 2551306093 2551743225 189
1000 iso_pu_bacteria 2554235003 2554246133 189
1001 iso_pu_bacteria 2558860100 2558866599 189
1002 iso_pu_bacteria 2558860242 2559293356 189
1003 iso_pu_bacteria 2582581283 2585164414 189
1004 iso_pu_bacteria 2582581298 2585223176 189
1005 iso_pu_bacteria 2582581299 2585232339 189
1006 iso_pu_bacteria 2582581304 2585259568 189
1007 iso_pu_bacteria 2582581306 2585264709 189
1008 iso_pu_bacteria 2582581307 2585276369 189
1009 iso_pu_bacteria 2582581308 2585282464 189
1010 iso_pu_bacteria 2582581315 2585328572 189
1011 iso_pu_bacteria 2582581316 2585336126 189
1012 iso_pu_bacteria 2582581865 2585386220 189
1013 iso_pu_bacteria 2582581866 2585394830 189
1014 iso_pu_bacteria 2585427526 2585524030 189
1015 iso_pu_bacteria 2585427527 2585536603 189
1016 iso_pu_bacteria 2585427528 2585542193 189
1017 iso_pu_bacteria 2585427529 2585546228 189
1018 iso_pu_bacteria 2585427530 2585557187 189
1019 iso_pu_bacteria 2585427531 2585564169 189
1020 iso_pu_bacteria 2585427593 2585840611 189
1021 iso_pu_bacteria 2585427594 2585843601 189
1022 iso_pu_bacteria 2585427608 2585897301 189
1023 iso_pu_bacteria 2585427609 2585902970 189
1024 iso_pu_bacteria 2585428125 2587978455 189
1025 iso_pu_bacteria 2588253730 2588520633 189
1026 iso_pu_bacteria 2599185170 2599419816 189
1027 iso_pu_bacteria 2599185210 2599604239 189
1028 iso_pu_bacteria 2599185236 2599718576 189
1029 iso_pu_bacteria 2599185352 2600195250 189
1030 iso_pu_bacteria 2600255279 2601609625 189
1031 iso_pu_bacteria 2600255308 2601746400 189
1032 iso_pu_bacteria 2602042107 2603857931 189
1033 iso_pu_bacteria 2615840624 2616294030 189
1034 iso_pu_bacteria 2615840626 2616311576 189
1035 iso_pu_bacteria 2615840698 2616551708 189
1036 iso_pu_bacteria 2617270735 2617347491 189
1037 iso_pu_bacteria 2617270741 2617377106 189
1038 iso_pu_bacteria 2617270742 2617386449 189
1039 iso_pu_bacteria 2643221551 2643777740 189
1040 iso_pu_bacteria 2643221555 2643796188 189
1041 iso_pu_bacteria 2643221557 2643805757 189
1042 iso_pu_bacteria 2643221558 2643812437 189
1043 iso_pu_bacteria 2643221564 2643839677 189
1044 iso_pu_bacteria 2643221568 2643857473 189
1045 iso_pu_bacteria 2643221582 2643920513 189
1046 iso_pu_bacteria 2643221595 2643985011 189
1047 iso_pu_bacteria 2643221607 2644051647 189
1048 iso_pu_bacteria 2643221610 2644065932 189
1049 iso_pu_bacteria 2643221618 2644103820 189
1050 iso_pu_bacteria 2643221623 2644133593 189
1051 iso_pu_bacteria 2643221626 2644144702 189
1052 iso_pu_bacteria 2643221627 2644154059 189
1053 iso_pu_bacteria 2643221634 2644191121 189
1054 iso_pu_bacteria 2643221636 2644200130 189
1055 iso_pu_bacteria 2643221637 2644207307 189
1056 iso_pu_bacteria 2643221643 2644237831 189
1057 iso_pu_bacteria 2643221653 2644298117 189
1058 iso_pu_bacteria 2643221655 2644306750 189
1059 iso_pu_bacteria 2643221659 2644330942 189
1060 iso_pu_bacteria 2643221668 2644380237 189
1061 iso_pu_bacteria 2643221675 2644417263 189
1062 iso_pu_bacteria 2643221680 2644450659 189
1063 iso_pu_bacteria 2643221686 2644480516 189
1064 iso_pu_bacteria 2643221688 2644495345 189
1065 iso_pu_bacteria 2643221689 2644498771 189
1066 iso_pu_bacteria 2643221693 2644519678 189
1067 iso_pu_bacteria 2643221698 2644541161 189
1068 iso_pu_bacteria 2643221712 2644612361 189
1069 iso_pu_bacteria 2643221718 2644650955 189
1070 iso_pu_bacteria 2643221719 2644656369 189
1071 iso_pu_bacteria 2643221723 2644671444 189
1072 iso_pu_bacteria 2643221726 2644692916 189
1073 iso_pu_bacteria 2657244999 2657682771 189
1074 iso_pu_bacteria 2667528174 2671116341 189
1075 iso_pu_bacteria 2687453392 2688595367 189
1076 iso_pu_bacteria 2690316117 2692320641 189
1077 iso_pu_bacteria 2718217882 2719183263 189
1078 iso_pu_bacteria 2718217927 2719388020 189
1079 iso_pu_bacteria 2718217997 2719667638 189
1080 iso_pu_bacteria 2718218009 2719733980 189
1081 iso_pu_bacteria 2718218199 2720494058 189
1082 iso_pu_bacteria 2718218232 2720615521 189
1083 iso_pu_bacteria 2718218233 2720622304 189
1084 iso_pu_bacteria 2718218235 2720633658 189
1085 iso_pu_bacteria 2718218269 2720777358 189
1086 iso_pu_bacteria 2718218363 2721149375 189
1087 iso_pu_bacteria 2718218365 2721160778 189
1088 iso_pu_bacteria 2718218366 2721166212 189
1089 iso_pu_bacteria 2718218423 2721401653 189
1090 iso_pu_bacteria 2721755514 2722842382 189
1091 iso_pu_bacteria 2721755556 2723028956 189
1092 iso_pu_bacteria 2721755684 2723562572 189
1093 iso_pu_bacteria 2721755685 2723569265 189
1094 iso_pu_bacteria 2721755809 2724040467 189
1095 iso_pu_bacteria 2721755810 2724046736 189
1096 iso_pu_bacteria 2721755819 2724091965 189
1097 iso_pu_bacteria 2721755822 2724106530 189
1098 iso_pu_bacteria 2721755823 2724112337 189
1099 iso_pu_bacteria 2724679232 2725947175 189
1100 iso_pu_bacteria 2728369352 2730109892 189
1101 iso_pu_bacteria 2728369365 2730166498 189
1102 iso_pu_bacteria 2728369397 2730300410 189
1103 iso_pu_bacteria 2738541293 2738800679 189
1104 iso_pu_bacteria 2738541317 2738946807 189
1105 iso_pu_bacteria 2738541333 2739037428 189
1106 iso_pu_bacteria 2738543024 2739308448 189
1107 iso_pu_bacteria 2744054633 2745077654 189
1108 iso_pu_bacteria 2751185821 2753459970 189
1109 iso_pu_bacteria 2756170246 2756674559 189
1110 iso_pu_bacteria 2757320392 2757570145 189
1111 iso_pu_bacteria 2758568016 2758640589 189
1112 iso_pu_bacteria 2765235802 2765464093 189
1113 iso_pu_bacteria 2765235942 2766067235 189
1114 iso_pu_bacteria 2767802442 2770196733 189
1115 iso_pu_bacteria 2775506902 2776272764 189
1116 iso_pu_bacteria 2775506904 2776284708 189
1117 iso_pu_bacteria 2775507049 2776915891 189
1118 iso_pu_bacteria 2775507266 2778179357 189
1119 iso_pu_bacteria 2791355082 2792583433 189
1120 iso_pu_bacteria 2791355091 2792620954 189
1121 iso_pu_bacteria 2791355092 2792625170 189
1122 iso_pu_bacteria 2791355094 2792637585 189
1123 iso_pu_bacteria 2791355123 2792746563 189
1124 iso_pu_bacteria 2791355253 2793282587 189
1125 iso_pu_bacteria 2791355256 2793298388 189
1126 iso_pu_bacteria 2791355259 2793315771 189
1127 iso_pu_bacteria 2791355260 2793323553 189
1128 iso_pu_bacteria 2791355261 2793327499 189
1129 iso_pu_bacteria 2791355262 2793335570 189
1130 iso_pu_bacteria 2791355263 2793340958 189
1131 iso_pu_bacteria 2791355264 2793350356 189
1132 iso_pu_bacteria 2791355265 2793354698 189
1133 iso_pu_bacteria 2791355266 2793358608 189
1134 iso_pu_bacteria 2791355267 2793369061 189
1135 iso_pu_bacteria 2802428858 2802720849 189
1136 iso_pu_bacteria 2802428859 2802724455 189
1137 iso_pu_bacteria 2802428860 2802729880 189
1138 iso_pu_bacteria 2802428861 2802737224 189
1139 iso_pu_bacteria 2802428862 2802746354 189
1140 iso_pu_bacteria 2802428863 2802751843 189
1141 iso_pu_bacteria 2802429268 2804753993 189
1142 iso_pu_bacteria 2802429603 2805919330 189
1143 iso_pu_bacteria 2802429605 2805928980 189
1144 iso_pu_bacteria 2802429606 2805934601 189
1145 iso_pu_bacteria 2802429633 2806047155 189
1146 iso_pu_bacteria 2802429634 2806054846 189
1147 iso_pu_bacteria 2802429635 2806061926 189
1148 iso_pu_bacteria 2802429636 2806069551 189
1149 iso_pu_bacteria 2802429637 2806076078 189
1150 iso_pu_bacteria 2808606387 2808986875 189
1151 iso_pu_bacteria 2816332527 2818243393 189
1152 iso_pu_bacteria 2818991272 2819244291 189
1153 iso_pu_bacteria 2818991439 2819556949 189
1154 iso_pu_bacteria 2818991448 2819613249 189
1155 iso_pu_bacteria 2818991453 2819643718 189
1156 iso_pu_bacteria 2821123053 2821123128 189
1157 iso_pu_bacteria 2824600985 2824608661 189
1158 iso_pu_bacteria 2824609381 2824611997 189
1159 iso_pu_bacteria 2824617872 2824622540 189
1160 iso_pu_bacteria 2824626560 2824633901 189
1161 iso_pu_bacteria 2824635225 2824642344 189
1162 iso_pu_bacteria 2824644064 2824649894 189
1163 iso_pu_bacteria 2824653114 2824660600 189
1164 iso_pu_bacteria 2824661429 2824670277 189
1165 iso_pu_bacteria 2824671348 2824674709 189
1166 iso_pu_bacteria 2824679649 2824684146 189
1167 iso_pu_bacteria 2824687955 2824696139 189
1168 iso_pu_bacteria 2824696289 2824704029 189
1169 iso_pu_bacteria 2824704595 2824711086 189
1170 iso_pu_bacteria 2824714736 2824722362 189
1171 iso_pu_bacteria 2824723954 2824730138 189
1172 iso_pu_bacteria 2824732956 2824738873 189
1173 iso_pu_bacteria 2824746037 2824752537 189
1174 iso_pu_bacteria 2824753945 2824762846 189
1175 iso_pu_bacteria 2824763712 2824770622 189
1176 iso_pu_bacteria 2824773399 2824780171 189
1177 iso_pu_bacteria 2837651117 2837651538 189
1178 iso_pu_bacteria 2838016132 2838020868 189
1179 iso_pu_bacteria 2838022645 2838026775 189
1180 iso_pu_bacteria 2838035591 2838039653 189
1181 iso_pu_bacteria 2838042994 2838044930 189
1182 iso_pu_bacteria 2838048938 2838052990 189
1183 iso_pu_bacteria 2838061910 2838064782 189
1184 iso_pu_bacteria 2838068647 2838070443 189
1185 iso_pu_bacteria 2838074704 2838074862 189
1186 iso_pu_bacteria 2838122688 2838130270 189
1187 iso_pu_bacteria 2838661181 2838663924 189
1188 iso_pu_bacteria 2838668709 2838672607 189
1189 iso_pu_bacteria 2838675328 2838677687 189
1190 iso_pu_bacteria 2838680041 2838685506 189
1191 iso_pu_bacteria 2838686498 2838689914 189
1192 iso_pu_bacteria 2838694306 2838696038 189
1193 iso_pu_bacteria 2838701080 2838705070 189
1194 iso_pu_bacteria 2838707686 2838713437 189
1195 iso_pu_bacteria 2838714209 2838716576 189
1196 iso_pu_bacteria 2838719591 2838719624 189
1197 iso_pu_bacteria 2838724970 2838727327 189
1198 iso_pu_bacteria 2838729681 2838731390 189
1199 iso_pu_bacteria 2838736955 2838739848 189
1200 iso_pu_bacteria 2838742623 2838744331 189
1201 iso_pu_bacteria 2840764183 2840769537 189
1202 iso_pu_bacteria 2841734538 2841735834 189
1203 iso_pu_bacteria 2841840854 2841844028 189
1204 iso_pu_bacteria 2841846520 2841846552 189
1205 iso_pu_bacteria 2841851746 2841852871 189
1206 iso_pu_bacteria 2841859092 2841860916 189
1207 iso_pu_bacteria 2841864319 2841870284 189
1208 iso_pu_bacteria 2841941048 2841944287 189
1209 iso_pu_bacteria 2841949485 2841954536 189
1210 iso_pu_bacteria 2841957949 2841963415 189
1211 iso_pu_bacteria 2841966195 2841969064 189
1212 iso_pu_bacteria 2841974524 2841979838 189
1213 iso_pu_bacteria 2841983080 2841989564 189
1214 iso_pu_bacteria 2842038055 2842044069 189
1215 iso_pu_bacteria 2842045827 2842051942 189
1216 iso_pu_bacteria 2842077413 2842082671 189
1217 iso_pu_bacteria 2842110456 2842112822 189
1218 iso_pu_bacteria 2842118031 2842123770 189
1219 iso_pu_bacteria 2842124991 2842127419 189
1220 iso_pu_bacteria 2842130223 2842132580 189
1221 iso_pu_bacteria 2842140634 2842143749 189
1222 iso_pu_bacteria 2842146304 2842150064 189
1223 iso_pu_bacteria 2842152218 2842152251 189
1224 iso_pu_bacteria 2842156927 2842160198 189
1225 iso_pu_bacteria 2842163707 2842165824 189
1226 iso_pu_bacteria 2842170452 2842172822 189
1227 iso_pu_bacteria 2842175837 2842175870 189
1228 iso_pu_bacteria 2842180545 2842184136 189
1229 iso_pu_bacteria 2842187318 2842189684 189
1230 iso_pu_bacteria 2842192696 2842196441 189
1231 iso_pu_bacteria 2842198810 2842202508 189
1232 iso_pu_bacteria 2842205361 2842208835 189
1233 iso_pu_bacteria 2842211629 2842213998 189
1234 iso_pu_bacteria 2842217011 2842219500 189
1235 iso_pu_bacteria 2842224351 2842224384 189
1236 iso_pu_bacteria 2842229732 2842231718 189
1237 iso_pu_bacteria 2842237096 2842242825 189
1238 iso_pu_bacteria 2842243621 2842245813 189
1239 iso_pu_bacteria 2842250916 2842254750 189
1240 iso_pu_bacteria 2842257432 2842260191 189
1241 iso_pu_bacteria 2842264693 2842267072 189
1242 iso_pu_bacteria 2842271015 2842273602 189
1243 iso_pu_bacteria 2842278818 2842282475 189
1244 iso_pu_bacteria 2842285085 2842289986 189
1245 iso_pu_bacteria 2842291075 2842296898 189
1246 iso_pu_bacteria 2842298080 2842303505 189
1247 iso_pu_bacteria 2842304105 2842308546 189
1248 iso_pu_bacteria 2842311132 2842312144 189
1249 iso_pu_bacteria 2842317721 2842321744 189
1250 iso_pu_bacteria 2842341865 2842344734 189
1251 iso_pu_bacteria 2842357229 2842362776 189
1252 iso_pu_bacteria 2842363717 2842367692 189
1253 iso_pu_bacteria 2842370503 2842376108 189
1254 iso_pu_bacteria 2842377471 2842383318 189
1255 iso_pu_bacteria 2842384541 2842390451 189
1256 iso_pu_bacteria 2842395702 2842397919 189
1257 iso_pu_bacteria 2842402390 2842407595 189
1258 iso_pu_bacteria 2842409023 2842414226 189
1259 iso_pu_bacteria 2842415677 2842420914 189
1260 iso_pu_bacteria 2842422224 2842424057 189
1261 iso_pu_bacteria 2842428310 2842431232 189
1262 iso_pu_bacteria 2842434925 2842437567 189
1263 iso_pu_bacteria 2842441272 2842444382 189
1264 iso_pu_bacteria 2842447887 2842451192 189
1265 iso_pu_bacteria 2842462802 2842465375 189
1266 iso_pu_bacteria 2842469257 2842472156 189
1267 iso_pu_bacteria 2842482326 2842487759 189
1268 iso_pu_bacteria 2842489311 2842494032 189
1269 iso_pu_bacteria 2842495871 2842501321 189
1270 iso_pu_bacteria 2842509118 2842515324 189
1271 iso_pu_bacteria 2842515876 2842517701 189
1272 iso_pu_bacteria 2842521101 2842521201 189
1273 iso_pu_bacteria 2842871566 2842873186 189
1274 iso_pu_bacteria 2844002411 2844004119 189
1275 iso_pu_bacteria 2844009547 2844010089 189
1276 iso_pu_bacteria 2844163670 2844164768 189
1277 iso_pu_bacteria 2844315083 2844316038 189
1278 iso_pu_bacteria 2844454524 2844456662 189
1279 iso_pu_bacteria 2847417321 2847421254 189
1280 iso_pu_bacteria 2847670302 2847672959 189
1281 iso_pu_bacteria 2847930680 2847931525 189
1282 iso_pu_bacteria 2847939898 2847941581 189
1283 iso_pu_bacteria 2848992105 2848996042 189
1284 iso_pu_bacteria 2849076700 2849082504 189
1285 iso_pu_bacteria 2850079185 2850079432 189
1286 iso_pu_bacteria 2852387548 2852387675 189
1287 iso_pu_bacteria 2854916844 2854918156 189
1288 iso_pu_bacteria 2855825444 2855827744 189
1289 iso_pu_bacteria 2855839649 2855843121 189
1290 iso_pu_bacteria 2855872281 2855877750 189
1291 iso_pu_bacteria 2856314179 2856320009 189
1292 iso_pu_bacteria 2856328259 2856332040 189
1293 iso_pu_bacteria 2856334872 2856339333 189
1294 iso_pu_bacteria 2856342000 2856345435 189
1295 iso_pu_bacteria 2857367948 2857374107 189
1296 iso_pu_bacteria 2857509624 2857515805 189
1297 iso_pu_bacteria 2857516855 2857520959 189
1298 iso_pu_bacteria 2857524615 2857527306 189
1299 iso_pu_bacteria 2857531043 2857533919 189
1300 iso_pu_bacteria 2858800743 2858802853 189
1301 iso_pu_bacteria 2869169390 2869169438 189
1302 iso_pu_bacteria 2869234852 2869239803 189
1303 iso_pu_bacteria 2869242130 2869246643 189
1304 iso_pu_bacteria 2869249662 2869252024 189
1305 iso_pu_bacteria 2869256925 2869261201 189
1306 iso_pu_bacteria 2869264136 2869264372 189
1307 iso_pu_bacteria 2869271264 2869271847 189
1308 iso_pu_bacteria 2871435913 2871436151 189
1309 iso_pu_bacteria 2871444079 2871451357 189
1310 iso_pu_bacteria 2871451962 2871459249 189
1311 iso_pu_bacteria 2871459585 2871460099 189
1312 iso_pu_bacteria 2871466892 2871467721 189
1313 iso_pu_bacteria 2871474448 2871478404 189
1314 iso_pu_bacteria 2871481445 2871484477 189
1315 iso_pu_bacteria 2871495908 2871499380 189
1316 iso_pu_bacteria 2874109183 2874115531 189
1317 iso_pu_bacteria 2874116593 2874117338 189
1318 iso_pu_bacteria 2874131515 2874133813 189
1319 iso_pu_bacteria 2874162495 2874162566 189
1320 iso_pu_bacteria 2874612657 2874620260 189
1321 iso_pu_bacteria 2874620515 2874621425 189
1322 iso_pu_bacteria 2874628541 2874634321 189
1323 iso_pu_bacteria 2876363079 2876363275 189
1324 iso_pu_bacteria 2876369609 2876370235 189
1325 iso_pu_bacteria 2876386047 2876387094 189
1326 iso_pu_bacteria 2876392853 2876392922 189
1327 iso_pu_bacteria 2876399893 2876405095 189
1328 iso_pu_bacteria 2876406927 2876409454 189
1329 iso_pu_bacteria 2876420981 2876423633 189
1330 iso_pu_bacteria 2876761206 2876763382 189
1331 iso_pu_bacteria 2878035449 2878035567 189
1332 iso_pu_bacteria 2878730984 2878737524 189
1333 iso_pu_bacteria 2878760144 2878763570 189
1334 iso_pu_bacteria 2878767105 2878770568 189
1335 iso_pu_bacteria 2878774303 2878776149 189
1336 iso_pu_bacteria 2878781027 2878782586 189
1337 iso_pu_bacteria 2879083081 2879091351 189
1338 iso_pu_bacteria 2879099564 2879100196 189
1339 iso_pu_bacteria 2881147464 2881147620 189
1340 iso_pu_bacteria 2881161766 2881164395 189
1341 iso_pu_bacteria 2881364244 2881364924 189
1342 iso_pu_bacteria 2881665667 2881673179 189
1343 iso_pu_bacteria 2885305155 2885306256 189
1344 iso_pu_bacteria 2885312484 2885314695 189
1345 iso_pu_bacteria 2885326080 2885332100 189
1346 iso_pu_bacteria 2885334103 2885336021 189
1347 iso_pu_bacteria 2885366525 2885368171 189
1348 iso_pu_bacteria 2885409591 2885413752 189
1349 iso_pu_bacteria 2888350351 2888352281 189
1350 iso_pu_bacteria 2888378607 2888378826 189
1351 iso_pu_bacteria 2888388044 2888391196 189
1352 iso_pu_bacteria 2888419890 2888427251 189
1353 iso_pu_bacteria 2889010040 2889014271 189
1354 iso_pu_bacteria 2889016732 2889021024 189
1355 iso_pu_bacteria 2889790730 2889792708 189
1356 iso_pu_bacteria 2889914905 2889916215 189
1357 iso_pu_bacteria 2891373044 2891375057 189
1358 iso_pu_bacteria 2893066018 2893071846 189
1359 iso_pu_bacteria 2894652903 2894653006 189
1360 iso_pu_bacteria 2896384573 2896388664 189
1361 iso_pu_bacteria 2899792073 2899794260 189
1362 iso_pu_bacteria 2899803654 2899808350 189
1363 iso_pu_bacteria 2899845264 2899849023 189
1364 iso_pu_bacteria 2903448605 2903454650 189
1365 iso_pu_bacteria 2903513507 2903514629 189
1366 iso_pu_bacteria 2903521522 2903525225 189
1367 iso_pu_bacteria 2903528002 2903532030 189
1368 iso_pu_bacteria 2903540706 2903544185 189
1369 iso_pu_bacteria 2903727486 2903729566 189
1370 iso_pu_bacteria 2904578770 2904579262 189
1371 iso_pu_bacteria 2904659560 2904659628 189
1372 iso_pu_bacteria 2904666416 2904668094 189
1373 iso_pu_bacteria 2904711408 2904719868 189
1374 iso_pu_bacteria 2906354277 2906361005 189
1375 iso_pu_bacteria 2906363423 2906369890 189
1376 iso_pu_bacteria 2906370794 2906374469 189
1377 iso_pu_bacteria 2906378014 2906381295 189
1378 iso_pu_bacteria 2906386501 2906391632 189
1379 iso_pu_bacteria 2906393657 2906400596 189
1380 iso_pu_bacteria 2906401398 2906404645 189
1381 iso_pu_bacteria 2906408224 2906412483 189
1382 iso_pu_bacteria 2906414383 2906420785 189
1383 iso_pu_bacteria 2906602504 2906606071 189
1384 iso_pu_bacteria 2906626472 2906635067 189
1385 iso_pu_bacteria 2906643746 2906645645 189
1386 iso_pu_bacteria 2908775508 2908783018 189
1387 iso_pu_bacteria 2913295892 2913298414 189
1388 iso_pu_bacteria 2913308742 2913311833 189
1389 iso_pu_bacteria 2915980308 2915982705 189
1390 iso_pu_bacteria 2915986958 2915989078 189
1391 iso_pu_bacteria 2915993759 2915999755 189
1392 iso_pu_bacteria 2916000859 2916002265 189
1393 iso_pu_bacteria 2916007675 2916013207 189
1394 iso_pu_bacteria 2916014648 2916019669 189
1395 iso_pu_bacteria 2916021584 2916027360 189
1396 iso_pu_bacteria 2916028427 2916033436 189
1397 iso_pu_bacteria 2916035215 2916037077 189
1398 iso_pu_bacteria 2916041962 2916047714 189
1399 iso_pu_bacteria 2916048683 2916054937 189
1400 iso_pu_bacteria 2916055098 2916056724 189
1401 iso_pu_bacteria 2916061851 2916063909 189
1402 iso_pu_bacteria 2916076590 2916078815 189
1403 iso_pu_bacteria 2919073203 2919078422 189
1404 iso_pu_bacteria 2919100787 2919101947 189
1405 iso_pu_bacteria 2919114240 2919116793 189
1406 iso_pu_bacteria 2919119836 2919121911 189
1407 iso_pu_bacteria 2919166419 2919166547 189
1408 iso_pu_bacteria 2919408235 2919414097 189
1409 iso_pu_bacteria 2919450847 2919454845 189
1410 iso_pu_bacteria 2920760137 2920763893 189
1411 iso_pu_bacteria 2920822456 2920822804 189
1412 iso_pu_bacteria 2921201388 2921207894 189
1413 iso_pu_bacteria 2921208531 2921214794 189
1414 iso_pu_bacteria 2921237296 2921243090 189
1415 iso_pu_bacteria 2921244191 2921244379 189
1416 iso_pu_bacteria 2921250672 2921256320 189
1417 iso_pu_bacteria 2921257292 2921260011 189
1418 iso_pu_bacteria 2921263974 2921265836 189
1419 iso_pu_bacteria 2921282425 2921286373 189
1420 iso_pu_bacteria 2921289301 2921294739 189
1421 iso_pu_bacteria 2921296804 2921299680 189
1422 iso_pu_bacteria 2922130491 2922138563 189
1423 iso_pu_bacteria 2922151315 2922158333 189
1424 iso_pu_bacteria 2922158528 2922165033 189
1425 iso_pu_bacteria 2922172374 2922173402 189
1426 iso_pu_bacteria 2922178524 2922181588 189
1427 iso_pu_bacteria 2922185730 2922188526 189
1428 iso_pu_bacteria 2922368715 2922378534 189
1429 iso_pu_bacteria 2922393267 2922400952 189
1430 iso_pu_bacteria 2924144063 2924145325 189
1431 iso_pu_bacteria 2924150972 2924155193 189
1432 iso_pu_bacteria 2924158325 2924162509 189
1433 iso_pu_bacteria 2924165586 2924172121 189
1434 iso_pu_bacteria 2924172951 2924177662 189
1435 iso_pu_bacteria 2924179722 2924182776 189
1436 iso_pu_bacteria 2924186466 2924187233 189
1437 iso_pu_bacteria 2924193448 2924197301 189
1438 iso_pu_bacteria 2924200457 2924202136 189
1439 iso_pu_bacteria 2924207177 2924211001 189
1440 iso_pu_bacteria 2924214083 2924220721 189
1441 iso_pu_bacteria 2924221636 2924225190 189
1442 iso_pu_bacteria 2924228884 2924230404 189
1443 iso_pu_bacteria 2924710171 2924711835 189
1444 iso_pu_bacteria 2924726620 2924732869 189
1445 iso_pu_bacteria 2924733363 2924734289 189
1446 iso_pu_bacteria 2924741084 2924746989 189
1447 iso_pu_bacteria 2924748358 2924751516 189
1448 iso_pu_bacteria 2924754689 2924756120 189
1449 iso_pu_bacteria 2926754445 2926754804 189
1450 iso_pu_bacteria 2926760298 2926761971 189
1451 iso_pu_bacteria 2928521798 2928522115 189
1452 iso_pu_bacteria 2929138655 2929138903 189
1453 iso_pu_bacteria 2929615660 2929623664 189
1454 iso_pu_bacteria 2929624759 2929632872 189
1455 iso_pu_bacteria 2932784394 2932786151 189
1456 iso_pu_bacteria 2932794094 2932799523 189
1457 iso_pu_bacteria 2932801729 2932805171 189
1458 iso_pu_bacteria 2932809354 2932816888 189
1459 iso_pu_bacteria 2932818245 2932826028 189
1460 iso_pu_bacteria 2932828146 2932829414 189
1461 iso_pu_bacteria 2933006813 2933006897 189
1462 iso_pu_bacteria 2933011516 2933015513 189
1463 iso_pu_bacteria 2933016740 2933022044 189
1464 iso_pu_bacteria 2933570622 2933574995 189
1465 iso_pu_bacteria 2933577622 2933585567 189
1466 iso_pu_bacteria 2933586486 2933588288 189
1467 iso_pu_bacteria 2933594066 2933594097 189
1468 iso_pu_bacteria 2933599457 2933601247 189
1469 iso_pu_bacteria 2935616580 2935617847 189
1470 iso_pu_bacteria 2935638405 2935647820 189
1471 iso_pu_bacteria 2935665750 2935674767 189
1472 iso_pu_bacteria 2935675223 2935678129 189
1473 iso_pu_bacteria 2935684952 2935692417 189
1474 iso_pu_bacteria 2935694250 2935699365 189
1475 iso_pu_bacteria 2935703347 2935707096 189
1476 iso_pu_bacteria 2935713505 2935721035 189
1477 iso_pu_bacteria 2935722832 2935722860 189
1478 iso_pu_bacteria 2935732158 2935739724 189
1479 iso_pu_bacteria 2935741537 2935748762 189
1480 iso_pu_bacteria 2935750917 2935758632 189
1481 iso_pu_bacteria 2935760218 2935764612 189
1482 iso_pu_bacteria 2935801545 2935806662 189
1483 iso_pu_bacteria 2935810662 2935819077 189
1484 iso_pu_bacteria 2935827899 2935837304 189
1485 iso_pu_bacteria 2935837841 2935842009 189
1486 iso_pu_bacteria 2935855204 2935856654 189
1487 iso_pu_bacteria 2935864058 2935872942 189
1488 iso_pu_bacteria 2935873716 2935874381 189
1489 iso_pu_bacteria 2935883170 2935887739 189
1490 iso_pu_bacteria 2935894831 2935900055 189
1491 iso_pu_bacteria 2935901341 2935902251 189
1492 iso_pu_bacteria 2935959822 2935967313 189
1493 iso_pu_bacteria 2935992306 2936001095 189
1494 iso_pu_bacteria 2936002035 2936010749 189
1495 iso_pu_bacteria 2936037263 2936045772 189
1496 iso_pu_bacteria 2936367885 2936369614 189
1497 iso_pu_bacteria 2936375103 2936380354 189
1498 iso_pu_bacteria 2936381700 2936385181 189
1499 iso_pu_bacteria 2936996657 2936998749 189
1500 iso_pu_bacteria 2937002841 2937005799 189
1501 iso_pu_bacteria 2937009748 2937010504 189
1502 iso_pu_bacteria 2937016420 2937017317 189
1503 iso_pu_bacteria 2937023124 2937028263 189
1504 iso_pu_bacteria 2937029754 2937030591 189
1505 iso_pu_bacteria 2937036028 2937039059 189
1506 iso_pu_bacteria 2937042894 2937045680 189
1507 iso_pu_bacteria 2937049772 2937054852 189
1508 iso_pu_bacteria 2937056579 2937062784 189
1509 iso_pu_bacteria 2937063883 2937065987 189
1510 iso_pu_bacteria 2937071275 2937076167 189
1511 iso_pu_bacteria 2937078374 2937083932 189
1512 iso_pu_bacteria 2937084907 2937090809 189
1513 iso_pu_bacteria 2937091812 2937096674 189
1514 iso_pu_bacteria 2937098957 2937104463 189
1515 iso_pu_bacteria 2937106411 2937111654 189
1516 iso_pu_bacteria 2937113482 2937115876 189
1517 iso_pu_bacteria 2937119839 2937122118 189
1518 iso_pu_bacteria 2937126314 2937130810 189
1519 iso_pu_bacteria 2937836603 2937839127 189
1520 iso_pu_bacteria 2937848649 2937849831 189
1521 iso_pu_bacteria 2937861824 2937864138 189
1522 iso_pu_bacteria 2937868953 2937873965 189
1523 iso_pu_bacteria 2937980651 2937983993 189
1524 iso_pu_bacteria 2937994558 2937998029 189
1525 iso_pu_bacteria 2940556831 2940564778 189
1526 iso_pu_bacteria 2941499720 2941504048 189
1527 iso_pu_bacteria 2941531003 2941535899 189
1528 iso_pu_bacteria 2941538514 2941547060 189
1529 iso_pu_bacteria 2954011201 2954014465 189
1530 iso_pu_bacteria 2957375807 2957378025 189
1531 iso_pu_bacteria 2957382221 2957383309 189
1532 iso_pu_bacteria 2957388812 2957390606 189
1533 iso_pu_bacteria 2957395598 2957401515 189
1534 iso_pu_bacteria 2957402308 2957407365 189
1535 iso_pu_bacteria 2957408893 2957409968 189
1536 iso_pu_bacteria 2957415311 2957415685 189
1537 iso_pu_bacteria 2957422303 2957426728 189
1538 iso_pu_bacteria 2957430029 2957435145 189
1539 iso_pu_bacteria 2957437181 2957442467 189
1540 iso_pu_bacteria 2957443900 2957450459 189
1541 iso_pu_bacteria 2957450854 2957451819 189
1542 iso_pu_bacteria 2957457609 2957460733 189
1543 iso_pu_bacteria 2957464669 2957468061 189
1544 iso_pu_bacteria 2957471148 2957475907 189
1545 iso_pu_bacteria 2957478035 2957481828 189
1546 iso_pu_bacteria 2957484790 2957490831 189
1547 iso_pu_bacteria 2957491536 2957492755 189
1548 iso_pu_bacteria 2957498199 2957502948 189
1549 iso_pu_bacteria 2957505466 2957510815 189
1550 iso_pu_bacteria 2958071322 2958076301 189
1551 iso_pu_bacteria 2958100919 2958101457 189
1552 iso_pu_bacteria 2958108152 2958112749 189
1553 iso_pu_bacteria 2958122699 2958129233 189
1554 iso_pu_bacteria 2958137437 2958143451 189
1555 iso_pu_bacteria 2958158011 2958163283 189
1556 iso_pu_bacteria 2958165035 2958168504 189
1557 iso_pu_bacteria 2958172287 2958173742 189
1558 iso_pu_bacteria 2960584000 2960585935 189
1559 iso_pu_bacteria 2960591022 2960593161 189
1560 iso_pu_bacteria 2960597568 2960600911 189
1561 iso_pu_bacteria 2960603979 2960607733 189
1562 iso_pu_bacteria 2960610863 2960616383 189
1563 iso_pu_bacteria 2960617483 2960620135 189
1564 iso_pu_bacteria 2960624210 2960626088 189
1565 iso_pu_bacteria 2960631154 2960635380 189
1566 iso_pu_bacteria 2960637947 2960640395 189
1567 iso_pu_bacteria 2960645483 2960650832 189
1568 iso_pu_bacteria 2960652885 2960656397 189
1569 iso_pu_bacteria 2960660292 2960667262 189
1570 iso_pu_bacteria 2960667422 2960670934 189
1571 iso_pu_bacteria 2960674078 2960677455 189
1572 iso_pu_bacteria 2960680706 2960682665 189
1573 iso_pu_bacteria 2960687367 2960693558 189
1574 iso_pu_bacteria 2960693952 2960700471 189
1575 iso_pu_bacteria 2961114664 2961114953 189
1576 iso_pu_bacteria 2961136820 2961140636 189
1577 iso_pu_bacteria 2961163497 2961166968 189
1578 iso_pu_bacteria 2961183825 2961189633 189
1579 iso_pu_bacteria 2963644680 2963644735 189
1580 iso_pu_bacteria 2964607997 2964614908 189
1581 iso_pu_bacteria 2964615318 2964621200 189
1582 iso_pu_bacteria 2964621998 2964627376 189
1583 iso_pu_bacteria 2964628898 2964631531 189
1584 iso_pu_bacteria 2964636051 2964641353 189
1585 iso_pu_bacteria 2964643177 2964645466 189
1586 iso_pu_bacteria 2964649959 2964651375 189
1587 iso_pu_bacteria 2964656573 2964662944 189
1588 iso_pu_bacteria 2964663802 2964668656 189
1589 iso_pu_bacteria 2964670856 2964673549 189
1590 iso_pu_bacteria 2964678106 2964682268 189
1591 iso_pu_bacteria 2964685014 2964687652 189
1592 iso_pu_bacteria 2964691889 2964695210 189
1593 iso_pu_bacteria 2964698721 2964699979 189
1594 iso_pu_bacteria 2964705432 2964710005 189
1595 iso_pu_bacteria 2964712639 2964716093 189
1596 iso_pu_bacteria 2964719344 2964726020 189
1597 iso_pu_bacteria 2965018300 2965021792 189
1598 iso_pu_bacteria 2965025482 2965028848 189
1599 iso_pu_bacteria 2965032056 2965036956 189
1600 iso_pu_bacteria 2965040258 2965046664 189
1601 iso_pu_bacteria 2965047637 2965053201 189
1602 iso_pu_bacteria 2965089291 2965090693 189
1603 iso_pu_bacteria 2965110997 2965118108 189
1604 iso_pu_bacteria 2965119406 2965121451 189
1605 iso_pu_bacteria 2967664464 2967669297 189
1606 iso_pu_bacteria 2967671571 2967676752 189
1607 iso_pu_bacteria 2967678726 2967683483 189
1608 iso_pu_bacteria 2967686174 2967688445 189
1609 iso_pu_bacteria 2967693043 2967694574 189
1610 iso_pu_bacteria 2967699805 2967701620 189
1611 iso_pu_bacteria 2967706974 2967707435 189
1612 iso_pu_bacteria 2967714385 2967716276 189
1613 iso_pu_bacteria 2967721400 2967725878 189
1614 iso_pu_bacteria 2967728569 2967733820 189
1615 iso_pu_bacteria 2967735183 2967740830 189
1616 iso_pu_bacteria 2967742019 2967748152 189
1617 iso_pu_bacteria 2967748971 2967751523 189
1618 iso_pu_bacteria 2967755722 2967756320 189
1619 iso_pu_bacteria 2967762386 2967766373 189
1620 iso_pu_bacteria 2967769361 2967771906 189
1621 iso_pu_bacteria 2967775926 2967776948 189
1622 iso_pu_bacteria 2968083720 2968088989 189
1623 iso_pu_bacteria 2968110612 2968110681 189
1624 iso_pu_bacteria 2968138860 2968146465 189
1625 iso_pu_bacteria 2968171901 2968175374 189
1626 iso_pu_bacteria 2970019648 2970020877 189
1627 iso_pu_bacteria 2970026789 2970031969 189
1628 iso_pu_bacteria 2970033650 2970038054 189
1629 iso_pu_bacteria 2970040964 2970046485 189
1630 iso_pu_bacteria 2970047711 2970052158 189
1631 iso_pu_bacteria 2970054988 2970056002 189
1632 iso_pu_bacteria 2970061556 2970064606 189
1633 iso_pu_bacteria 2970068827 2970073396 189
1634 iso_pu_bacteria 2970076120 2970077154 189
1635 iso_pu_bacteria 2970082768 2970088523 189
1636 iso_pu_bacteria 2970088815 2970094287 189
1637 iso_pu_bacteria 2970095765 2970099298 189
1638 iso_pu_bacteria 2970102677 2970104261 189
1639 iso_pu_bacteria 2970109326 2970112601 189
1640 iso_pu_bacteria 2970116247 2970118888 189
1641 iso_pu_bacteria 2970122695 2970122786 189
1642 iso_pu_bacteria 2970129317 2970130917 189
1643 iso_pu_bacteria 2970136068 2970139361 189
1644 iso_pu_bacteria 2970143518 2970145309 189
1645 iso_pu_bacteria 2970149975 2970153310 189
1646 iso_pu_bacteria 2970156795 2970160462 189
1647 iso_pu_bacteria 2970164137 2970165636 189
1648 iso_pu_bacteria 2970170962 2970172249 189
1649 iso_pu_bacteria 2970177841 2970183879 189
1650 iso_pu_bacteria 2970184632 2970190692 189
1651 iso_pu_bacteria 2970191845 2970194386 189
1652 iso_pu_bacteria 2970489779 2970494151 189
1653 iso_pu_bacteria 2970510686 2970516310 189
1654 iso_pu_bacteria 2970524798 2970525515 189
1655 iso_pu_bacteria 2970532167 2970533720 189
1656 iso_pu_bacteria 2970540015 2970545592 189
1657 iso_pu_bacteria 2970547951 2970553791 189
1658 iso_pu_bacteria 2970554993 2970558412 189
1659 iso_pu_bacteria 2970619444 2970622544 189
1660 iso_pu_bacteria 2970627176 2970632058 189
1661 iso_pu_bacteria 2977516862 2977523350 189
1662 iso_pu_bacteria 2977523885 2977525565 189
1663 iso_pu_bacteria 2977530762 2977530894 189
1664 iso_pu_bacteria 2977537788 2977538786 189
1665 iso_pu_bacteria 2977544691 2977546920 189
1666 iso_pu_bacteria 2977551784 2977556332 189
1667 iso_pu_bacteria 2977558990 2977561867 189
1668 iso_pu_bacteria 2977565890 2977570597 189
1669 iso_pu_bacteria 2977572785 2977576288 189
1670 iso_pu_bacteria 2977579622 2977581050 189
1671 iso_pu_bacteria 2977851361 2977855073 189
1672 iso_pu_bacteria 2977872689 2977879989 189
1673 iso_pu_bacteria 2977898635 2977898654 189
1674 iso_pu_bacteria 2977907340 2977913276 189
1675 iso_pu_bacteria 2977915119 2977916367 189
1676 iso_pu_bacteria 2977922695 2977925375 189
1677 iso_pu_bacteria 2977935797 2977938280 189
1678 iso_pu_bacteria 2977950692 2977953089 189
1679 iso_pu_bacteria 2977957713 2977959927 189
1680 iso_pu_bacteria 2977971508 2977977368 189
1681 iso_pu_bacteria 2977986579 2977987344 189
1682 iso_pu_bacteria 2978969890 2978972935 189
1683 iso_pu_bacteria 2979089926 2979092761 189
1684 iso_pu_bacteria 2979095461 2979099849 189
1685 iso_pu_bacteria 2979100975 2979104734 189
1686 iso_pu_bacteria 2979710463 2979712334 189
1687 iso_pu_bacteria 2979742915 2979749574 189
1688 iso_pu_bacteria 2979764755 2979768658 189
1689 iso_pu_bacteria 2979772303 2979778654 189
1690 iso_pu_bacteria 2979793036 2979794300 189
1691 iso_pu_bacteria 2984509177 2984513468 189
1692 iso_pu_bacteria 2984537506 2984539460 189
1693 iso_pu_bacteria 2984587000 2984591187 189
1694 iso_pu_bacteria 2984601300 2984601687 189
1695 iso_pu_bacteria 2987645492 2987652010 189
1696 iso_pu_bacteria 2987652177 2987658222 189
1697 iso_pu_bacteria 2987659509 2987662980 189
1698 iso_pu_bacteria 2987673487 2987679516 189
1699 iso_pu_bacteria 2989349275 2989351546 189
1700 iso_pu_bacteria 2989771324 2989774515 189
1701 iso_pu_bacteria 2989776772 2989776943 189
1702 iso_pu_bacteria 2996310559 2996314473 189
1703 iso_pu_bacteria 2996336353 2996336803 189
1704 iso_pu_bacteria 2996341866 2996346136 189
1705 iso_pu_bacteria 2996386984 2996388493 189
1706 iso_pu_bacteria 2996893221 2996897138 189
1707 iso_pu_bacteria 3000135777 3000135935 189
1708 iso_pu_bacteria 3002141150 3002142465 189
1709 iso_pu_bacteria 3003930520 3003931401 189
1710 iso_pu_bacteria 3004167301 3004172543 189
1711 iso_pu_bacteria 3004188549 3004192032 189
1712 iso_pu_bacteria 3004211236 3004216694 189
1713 iso_pu_bacteria 3004218560 3004219727 189
1714 iso_pu_bacteria 3004232784 3004233564 189
1715 iso_pu_bacteria 3004239961 3004241125 189
1716 iso_pu_bacteria 3004248173 3004255428 189
1717 iso_pu_bacteria 3004268573 3004273059 189
1718 iso_pu_bacteria 3004334049 3004338061 189
1719 iso_pu_bacteria 3005409236 3005410555 189
1720 iso_pu_bacteria 3005416602 3005419273 189
1721 iso_pu_bacteria 3005445848 3005449984 189
1722 iso_pu_bacteria 3005483717 3005490495 189
1723 iso_pu_bacteria 3005506211 3005509711 189
1724 iso_pu_bacteria 3005587118 3005591198 189
1725 iso_pu_bacteria 3005594810 3005595630 189
1726 iso_pu_bacteria 3005710791 3005711621 189
1727 iso_pu_bacteria 3005718088 3005718871 189
1728 iso_pu_bacteria 637000159 637077634 189
1729 iso_pu_bacteria 639633055 639645997 189
1730 iso_pu_bacteria 643692032 643827744 189
1731 iso_pu_bacteria 648276728 648738267 189
1732 iso_pu_bacteria 649633066 649869927 189
1733 iso_pu_bacteria 650716007 650738591 189
1734 iso_pu_bacteria 8001845381 8001850268 189
1735 iso_pu_bacteria 8003570095 8003572132 189
1736 iso_pu_bacteria 8003992118 8003995706 189
1737 iso_pu_bacteria 8003999396 8004003460 189
1738 iso_pu_bacteria 8004300914 8004307130 189
1739 iso_pu_bacteria 8004312739 8004319617 189
1740 iso_pu_bacteria 8004361976 8004365374 189
1741 iso_pu_bacteria 8004395343 8004401993 189
1742 iso_pu_bacteria 8004633249 8004638726 189
1743 iso_pu_bacteria 8004727605 8004732770 189
1744 iso_pu_bacteria 8005246636 8005248030 189
1745 iso_pu_bacteria 8005275841 8005278221 189
1746 iso_pu_bacteria 8005282627 8005282751 189
1747 iso_pu_bacteria 8005289223 8005291717 189
1748 iso_pu_bacteria 8005301065 8005305408 189
1749 iso_pu_bacteria 8005307578 8005310181 189
1750 iso_pu_bacteria 8005314921 8005317571 189
1751 iso_pu_bacteria 8005376324 8005378171 189
1752 iso_pu_bacteria 8005382845 8005384179 189
1753 iso_pu_bacteria 8005395548 8005399543 189
1754 iso_pu_bacteria 8005430974 8005432330 189
1755 iso_pu_bacteria 8005460587 8005465455 189
1756 iso_pu_bacteria 8005484373 8005489289 189
1757 iso_pu_bacteria 8005497431 8005498032 189
1758 iso_pu_bacteria 8005556819 8005559902 189
1759 iso_pu_bacteria 8005563573 8005564602 189
1760 iso_pu_bacteria 8005570704 8005571292 189
1761 iso_pu_bacteria 8005619151 8005619246 189
1762 iso_pu_bacteria 8005626139 8005627807 189
1763 iso_pu_bacteria 8005645114 8005645422 189
1764 iso_pu_bacteria 8005658619 8005661423 189
1765 iso_pu_bacteria 8005668836 8005669439 189
1766 iso_pu_bacteria 8005682033 8005687720 189
1767 iso_pu_bacteria 8005688590 8005692840 189
1768 iso_pu_bacteria 8005695170 8005701547 189
1769 iso_pu_bacteria 8006926726 8006930315 189
1770 iso_pu_bacteria 8016511872 8016518821 189
1771 iso_pu_bacteria 8016583857 8016587089 189
1772 iso_pu_bacteria 8017057580 8017057857 189
1773 iso_pu_bacteria 8018127388 8018132466 189
1774 iso_pu_bacteria 8018150411 8018151094 189
1775 iso_pu_bacteria 8018163183 8018167678 189
1776 iso_pu_bacteria 8018176218 8018176691 189
1777 iso_pu_bacteria 8019586578 8019595971 189
1778 iso_pu_bacteria 8019608314 8019612748 189
1779 iso_pu_bacteria 8019648815 8019653182 189
1780 iso_pu_bacteria 8023680758 8023681343 189
1781 iso_pu_bacteria 8024479707 8024481825 189
1782 iso_pu_bacteria 8024486573 8024489002 189
1783 iso_pu_bacteria 8024501048 8024506263 189
1784 iso_pu_bacteria 8046767195 8046771531 189
1785 iso_pu_bacteria 8049293176 8049296589 189
1786 iso_pu_bacteria 8054460903 8054464024 189
1787 iso_pu_bacteria 8054558443 8054562469 189
1788 iso_pu_bacteria 8055431914 8055433823 189
1789 iso_pu_bacteria 8055617313 8055617364 189
1790 iso_pu_bacteria 8055742211 8055750829 189
1791 iso_pu_bacteria 8056375014 8056381265 189
1792 iso_pu_bacteria 8056382006 8056382753 189
1793 iso_pu_bacteria 8056875544 8056878583 189
1794 iso_pu_bacteria 8056967851 8056970653 189
1795 iso_pu_bacteria 8057575449 8057577882 189
1796 iso_pu_bacteria 8057874678 8057877192 189
1797 3300001976 JGI24752J21851_1001390 JGI24752J21851_10013901 190
1798 3300001989 JGI24739J22299_10023529 JGI24739J22299_100235293 190
1799 3300001990 JGI24737J22298_10002277 JGI24737J22298_100022772 190
1800 3300001990 JGI24737J22298_10006099 JGI24737J22298_100060993 190
1801 3300001990 JGI24737J22298_10045694 JGI24737J22298_100456942 190
1802 3300001991 JGI24743J22301_10023704 JGI24743J22301_100237042 190
1803 3300002067 JGI24735J21928_10007014 JGI24735J21928_100070144 190
1804 3300002067 JGI24735J21928_10071112 JGI24735J21928_100711122 190
1805 3300002074 JGI24748J21848_1000044 JGI24748J21848_100004417 190
1806 3300002075 JGI24738J21930_10004739 JGI24738J21930_100047394 190
1807 3300002239 JGI24034J26672_10000020 JGI24034J26672_1000002038 190
1808 3300002244 JGI24742J22300_10000620 JGI24742J22300_100006206 190
1809 3300003781 Ga0055536_1008181 Ga0055536_10081814 190
1810 3300005295 Ga0065707_10081865 Ga0065707_1008186542 190
1811 3300005327 Ga0070658_10000409 Ga0070658_100004095 190
1812 3300005327 Ga0070658_10026510 Ga0070658_100265105 190
1813 3300005329 Ga0070683_100000644 Ga0070683_10000064419 190
1814 3300005330 Ga0070690_100049725 Ga0070690_1000497252 190
1815 3300005331 Ga0070670_100016813 Ga0070670_1000168135 190
1816 3300005331 Ga0070670_100067225 Ga0070670_1000672254 190
1817 3300005334 Ga0068869_100021828 Ga0068869_1000218285 190
1818 3300005335 Ga0070666_10001050 Ga0070666_1000105019 190
1819 3300005335 Ga0070666_10002373 Ga0070666_100023735 190
1820 3300005336 Ga0070680_100004572 Ga0070680_1000045729 190
1821 3300005339 Ga0070660_100000055 Ga0070660_10000005571 190
1822 3300005339 Ga0070660_100034146 Ga0070660_1000341464 190
1823 3300005344 Ga0070661_100000340 Ga0070661_1000003405 190
1824 3300005344 Ga0070661_100013551 Ga0070661_1000135514 190
1825 3300005344 Ga0070661_100305165 Ga0070661_1003051652 190
1826 3300005347 Ga0070668_100125420 Ga0070668_1001254202 190
1827 3300005353 Ga0070669_100017639 Ga0070669_1000176392 190
1828 3300005353 Ga0070669_100081351 Ga0070669_1000813514 190
1829 3300005353 Ga0070669_100223456 Ga0070669_1002234562 190
1830 3300005355 Ga0070671_100031788 Ga0070671_1000317885 190
1831 3300005355 Ga0070671_100050065 Ga0070671_1000500654 190
1832 3300005355 Ga0070671_100112218 Ga0070671_1001122183 190
1833 3300005355 Ga0070671_100170118 Ga0070671_1001701182 190
1834 3300005356 Ga0070674_100065353 Ga0070674_1000653532 190
1835 3300005356 Ga0070674_100633863 Ga0070674_1006338631 190
1836 3300005364 Ga0070673_100015703 Ga0070673_1000157034 190
1837 3300005364 Ga0070673_100071965 Ga0070673_1000719652 190
1838 3300005364 Ga0070673_100603259 Ga0070673_1006032591 190
1839 3300005366 Ga0070659_100000139 Ga0070659_10000013919 190
1840 3300005366 Ga0070659_100011162 Ga0070659_1000111623 190
1841 3300005366 Ga0070659_100012287 Ga0070659_1000122874 190
1842 3300005366 Ga0070659_100503646 Ga0070659_1005036461 190
1843 3300005367 Ga0070667_100005245 Ga0070667_1000052458 190
1844 3300005367 Ga0070667_100023846 Ga0070667_1000238463 190
1845 3300005367 Ga0070667_100157513 Ga0070667_1001575132 190
1846 3300005367 Ga0070667_100178909 Ga0070667_1001789092 190
1847 3300005367 Ga0070667_100339932 Ga0070667_1003399322 190
1848 3300005455 Ga0070663_100044978 Ga0070663_1000449784 190
1849 3300005455 Ga0070663_100390871 Ga0070663_1003908712 190
1850 3300005457 Ga0070662_100000024 Ga0070662_10000002438 190
1851 3300005457 Ga0070662_100022218 Ga0070662_1000222182 190
1852 3300005457 Ga0070662_100022652 Ga0070662_1000226524 190
1853 3300005457 Ga0070662_100104788 Ga0070662_1001047882 190
1854 3300005459 Ga0068867_100012473 Ga0068867_10001247310 190
1855 3300005535 Ga0070684_100100316 Ga0070684_1001003161 190
1856 3300005539 Ga0068853_100000342 Ga0068853_10000034211 190
1857 3300005539 Ga0068853_100002373 Ga0068853_1000023737 190
1858 3300005539 Ga0068853_100223366 Ga0068853_1002233662 190
1859 3300005543 Ga0070672_100132185 Ga0070672_1001321852 190
1860 3300005544 Ga0070686_100168806 Ga0070686_1001688062 190
1861 3300005548 Ga0070665_100306322 Ga0070665_1003063222 190
1862 3300005548 Ga0070665_100423525 Ga0070665_1004235252 190
1863 3300005548 Ga0070665_100532976 Ga0070665_1005329762 190
1864 3300005548 Ga0070665_100737797 Ga0070665_1007377972 190
1865 3300005563 Ga0068855_100021596 Ga0068855_1000215962 190
1866 3300005563 Ga0068855_100190786 Ga0068855_1001907861 190
1867 3300005563 Ga0068855_100823789 Ga0068855_1008237891 190
1868 3300005564 Ga0070664_100000082 Ga0070664_10000008217 190
1869 3300005564 Ga0070664_100004455 Ga0070664_1000044557 190
1870 3300005564 Ga0070664_100326470 Ga0070664_1003264702 190
1871 3300005564 Ga0070664_100985737 Ga0070664_1009857371 190
1872 3300005577 Ga0068857_100004407 Ga0068857_1000044076 190
1873 3300005577 Ga0068857_100015287 Ga0068857_1000152876 190
1874 3300005578 Ga0068854_100408998 Ga0068854_1004089982 190
1875 3300005614 Ga0068856_100000085 Ga0068856_10000008589 190
1876 3300005614 Ga0068856_100140701 Ga0068856_1001407012 190
1877 3300005616 Ga0068852_100007528 Ga0068852_1000075285 190
1878 3300005617 Ga0068859_100000068 Ga0068859_10000006854 190
1879 3300005617 Ga0068859_100021782 Ga0068859_1000217822 190
1880 3300005617 Ga0068859_100043104 Ga0068859_1000431045 190
1881 3300005618 Ga0068864_100000339 Ga0068864_10000033922 190
1882 3300005618 Ga0068864_100029139 Ga0068864_1000291393 190
1883 3300005618 Ga0068864_100041811 Ga0068864_1000418115 190
1884 3300005618 Ga0068864_100068189 Ga0068864_1000681894 190
1885 3300005834 Ga0068851_10004531 Ga0068851_1000453110 190
1886 3300005834 Ga0068851_10017285 Ga0068851_100172854 190
1887 3300005834 Ga0068851_10034334 Ga0068851_100343342 190
1888 3300005841 Ga0068863_100000535 Ga0068863_10000053522 190
1889 3300005841 Ga0068863_100009175 Ga0068863_10000917510 190
1890 3300005841 Ga0068863_100040654 Ga0068863_1000406544 190
1891 3300005841 Ga0068863_100067181 Ga0068863_1000671811 190
1892 3300005842 Ga0068858_100069802 Ga0068858_1000698024 190
1893 3300005843 Ga0068860_100052325 Ga0068860_1000523254 190
1894 3300005844 Ga0068862_100008073 Ga0068862_1000080737 190
1895 3300005844 Ga0068862_100205887 Ga0068862_1002058873 190
1896 3300005937 Ga0081455_10000545 Ga0081455_1000054511 190
1897 3300006237 Ga0097621_100010319 Ga0097621_1000103192 190
1898 3300006237 Ga0097621_100066229 Ga0097621_1000662294 190
1899 3300006358 Ga0068871_100039095 Ga0068871_1000390954 190
1900 3300006847 Ga0075431_100269453 Ga0075431_1002694532 190
1901 3300006852 Ga0075433_10031492 Ga0075433_100314925 190
1902 3300006931 Ga0097620_100000068 Ga0097620_10000006854 190
1903 3300006931 Ga0097620_100021781 Ga0097620_10002178110 190
1904 3300006931 Ga0097620_100043105 Ga0097620_1000431055 190
1905 3300007076 Ga0075435_100467799 Ga0075435_1004677992 190
1906 3300009092 Ga0105250_10005874 Ga0105250_100058743 190
1907 3300009098 Ga0105245_10005749 Ga0105245_1000574913 190
1908 3300009101 Ga0105247_10019921 Ga0105247_100199213 190
1909 3300009101 Ga0105247_10070905 Ga0105247_100709053 190
1910 3300009148 Ga0105243_10674710 Ga0105243_106747102 190
1911 3300009174 Ga0105241_10242644 Ga0105241_102426442 190
1912 3300009174 Ga0105241_10338070 Ga0105241_103380702 190
1913 3300009174 Ga0105241_10449044 Ga0105241_104490442 190
1914 3300009174 Ga0105241_10633525 Ga0105241_106335251 190
1915 3300009176 Ga0105242_10016587 Ga0105242_100165875 190
1916 3300009177 Ga0105248_10000059 Ga0105248_1000005987 190
1917 3300009177 Ga0105248_10000071 Ga0105248_1000007173 190
1918 3300009177 Ga0105248_10016891 Ga0105248_100168915 190
1919 3300009177 Ga0105248_10125939 Ga0105248_101259393 190
1920 3300009177 Ga0105248_10442637 Ga0105248_104426372 190
1921 3300009545 Ga0105237_10027740 Ga0105237_100277406 190
1922 3300009545 Ga0105237_10517685 Ga0105237_105176852 190
1923 3300009551 Ga0105238_10009673 Ga0105238_100096736 190
1924 3300009551 Ga0105238_10039938 Ga0105238_100399387 190
1925 3300009551 Ga0105238_10396975 Ga0105238_103969752 190
1926 3300009551 Ga0105238_10639347 Ga0105238_106393472 190
1927 3300009551 Ga0105238_11193250 Ga0105238_111932502 190
1928 3300009553 Ga0105249_10000064 Ga0105249_1000006476 190
1929 3300010375 Ga0105239_10338430 Ga0105239_103384302 190
1930 3300010375 Ga0105239_10504550 Ga0105239_105045502 190
1931 3300010375 Ga0105239_10565985 Ga0105239_105659852 190
1932 3300013100 Ga0157373_10036131 Ga0157373_100361314 190
1933 3300013102 Ga0157371_10006091 Ga0157371_100060919 190
1934 3300013102 Ga0157371_10037322 Ga0157371_100373225 190
1935 3300013104 Ga0157370_10039889 Ga0157370_100398894 190
1936 3300013104 Ga0157370_10153906 Ga0157370_101539063 190
1937 3300013105 Ga0157369_10034621 Ga0157369_100346215 190
1938 3300013105 Ga0157369_10049778 Ga0157369_100497782 190
1939 3300013296 Ga0157374_10035946 Ga0157374_100359465 190
1940 3300013297 Ga0157378_10023762 Ga0157378_100237625 190
1941 3300013297 Ga0157378_10078681 Ga0157378_100786812 190
1942 3300013306 Ga0163162_10077001 Ga0163162_100770013 190
1943 3300013306 Ga0163162_10244138 Ga0163162_102441382 190
1944 3300013307 Ga0157372_10181542 Ga0157372_101815422 190
1945 3300013307 Ga0157372_10973294 Ga0157372_109732942 190
1946 3300013308 Ga0157375_10073535 Ga0157375_100735354 190
1947 3300014325 Ga0163163_10000763 Ga0163163_100007633 190
1948 3300014325 Ga0163163_10000995 Ga0163163_1000099522 190
1949 3300014325 Ga0163163_10020373 Ga0163163_100203731 190
1950 3300014325 Ga0163163_10083912 Ga0163163_100839124 190
1951 3300014326 Ga0157380_10000086 Ga0157380_1000008637 190
1952 3300014326 Ga0157380_10000723 Ga0157380_1000072312 190
1953 3300014326 Ga0157380_10591695 Ga0157380_105916952 190
1954 3300014497 Ga0182008_10020916 Ga0182008_100209164 190
1955 3300014968 Ga0157379_10002697 Ga0157379_100026975 190
1956 3300014968 Ga0157379_10012611 Ga0157379_100126118 190
1957 3300014968 Ga0157379_10050744 Ga0157379_100507442 190
1958 3300014968 Ga0157379_10062874 Ga0157379_100628745 190
1959 3300021358 Ga0213873_10000008 Ga0213873_10000008110 190
1960 3300021377 Ga0213874_10014768 Ga0213874_100147682 190
1961 3300021384 Ga0213876_10000005 Ga0213876_10000005493 190
1962 3300025292 Ga0209676_1000187 Ga0209676_1000187118 190
1963 3300025315 Ga0207697_10015942 Ga0207697_100159423 190
1964 3300025321 Ga0207656_10011471 Ga0207656_100114713 190
1965 3300025321 Ga0207656_10064926 Ga0207656_100649262 190
1966 3300025900 Ga0207710_10154789 Ga0207710_101547892 190
1967 3300025901 Ga0207688_10270608 Ga0207688_102706081 190
1968 3300025903 Ga0207680_10001402 Ga0207680_100014023 190
1969 3300025903 Ga0207680_10001928 Ga0207680_1000192813 190
1970 3300025904 Ga0207647_10015676 Ga0207647_100156766 190
1971 3300025904 Ga0207647_10017963 Ga0207647_100179633 190
1972 3300025904 Ga0207647_10036486 Ga0207647_100364861 190
1973 3300025907 Ga0207645_10477341 Ga0207645_104773411 190
1974 3300025909 Ga0207705_10000062 Ga0207705_1000006236 190
1975 3300025909 Ga0207705_10035585 Ga0207705_100355855 190
1976 3300025911 Ga0207654_10103025 Ga0207654_101030252 190
1977 3300025911 Ga0207654_10170111 Ga0207654_101701112 190
1978 3300025914 Ga0207671_10014940 Ga0207671_100149409 190
1979 3300025919 Ga0207657_10000015 Ga0207657_10000015145 190
1980 3300025919 Ga0207657_10015543 Ga0207657_100155436 190
1981 3300025919 Ga0207657_10174156 Ga0207657_101741562 190
1982 3300025920 Ga0207649_10000264 Ga0207649_1000026418 190
1983 3300025920 Ga0207649_10089675 Ga0207649_100896752 190
1984 3300025921 Ga0207652_10874395 Ga0207652_108743951 190
1985 3300025923 Ga0207681_10074068 Ga0207681_100740684 190
1986 3300025923 Ga0207681_10086320 Ga0207681_100863203 190
1987 3300025923 Ga0207681_10182161 Ga0207681_101821612 190
1988 3300025924 Ga0207694_10142708 Ga0207694_101427082 190
1989 3300025924 Ga0207694_10490150 Ga0207694_104901502 190
1990 3300025925 Ga0207650_10014713 Ga0207650_100147132 190
1991 3300025927 Ga0207687_10126221 Ga0207687_101262212 190
1992 3300025927 Ga0207687_10146986 Ga0207687_101469862 190
1993 3300025931 Ga0207644_10000274 Ga0207644_1000027434 190
1994 3300025931 Ga0207644_10025358 Ga0207644_100253585 190
1995 3300025931 Ga0207644_10109491 Ga0207644_101094913 190
1996 3300025931 Ga0207644_10114325 Ga0207644_101143252 190
1997 3300025931 Ga0207644_10137528 Ga0207644_101375283 190
1998 3300025931 Ga0207644_10265209 Ga0207644_102652092 190
1999 3300025932 Ga0207690_10000032 Ga0207690_1000003251 190
2000 3300025932 Ga0207690_10239786 Ga0207690_102397862 190
2001 3300025932 Ga0207690_10403487 Ga0207690_104034872 190
2002 3300025933 Ga0207706_10000032 Ga0207706_10000032109 190
2003 3300025933 Ga0207706_10013628 Ga0207706_100136283 190
2004 3300025933 Ga0207706_10025353 Ga0207706_100253536 190
2005 3300025933 Ga0207706_10110034 Ga0207706_101100342 190
2006 3300025934 Ga0207686_10167263 Ga0207686_101672632 190
2007 3300025936 Ga0207670_10167942 Ga0207670_101679421 190
2008 3300025937 Ga0207669_10004579 Ga0207669_1000457910 190
2009 3300025940 Ga0207691_10003446 Ga0207691_1000344612 190
2010 3300025940 Ga0207691_10066693 Ga0207691_100666933 190
2011 3300025940 Ga0207691_10280006 Ga0207691_102800061 190
2012 3300025941 Ga0207711_10000046 Ga0207711_1000004646 190
2013 3300025941 Ga0207711_10000476 Ga0207711_100004766 190
2014 3300025941 Ga0207711_10194323 Ga0207711_101943232 190
2015 3300025944 Ga0207661_10007272 Ga0207661_100072722 190
2016 3300025945 Ga0207679_10001577 Ga0207679_100015776 190
2017 3300025945 Ga0207679_10076796 Ga0207679_100767963 190
2018 3300025945 Ga0207679_10265120 Ga0207679_102651202 190
2019 3300025949 Ga0207667_10028393 Ga0207667_100283938 190
2020 3300025949 Ga0207667_10038209 Ga0207667_100382092 190
2021 3300025949 Ga0207667_10674262 Ga0207667_106742621 190
2022 3300025960 Ga0207651_10013384 Ga0207651_100133845 190
2023 3300025960 Ga0207651_10042757 Ga0207651_100427575 190
2024 3300025960 Ga0207651_10244291 Ga0207651_102442912 190
2025 3300025972 Ga0207668_10004433 Ga0207668_100044334 190
2026 3300025972 Ga0207668_10071369 Ga0207668_100713692 190
2027 3300025972 Ga0207668_10239049 Ga0207668_102390492 190
2028 3300025972 Ga0207668_10671616 Ga0207668_106716162 190
2029 3300025981 Ga0207640_10508731 Ga0207640_105087312 190
2030 3300025986 Ga0207658_10004756 Ga0207658_100047568 190
2031 3300025986 Ga0207658_10005211 Ga0207658_1000521110 190
2032 3300025986 Ga0207658_10027076 Ga0207658_100270762 190
2033 3300025986 Ga0207658_10029233 Ga0207658_100292333 190
2034 3300025986 Ga0207658_10032979 Ga0207658_100329794 190
2035 3300025986 Ga0207658_10397342 Ga0207658_103973422 190
2036 3300026023 Ga0207677_10153672 Ga0207677_101536724 190
2037 3300026035 Ga0207703_10002986 Ga0207703_100029869 190
2038 3300026035 Ga0207703_10005757 Ga0207703_100057579 190
2039 3300026035 Ga0207703_10552794 Ga0207703_105527942 190
2040 3300026041 Ga0207639_10000803 Ga0207639_1000080320 190
2041 3300026041 Ga0207639_10008528 Ga0207639_100085283 190
2042 3300026041 Ga0207639_10109867 Ga0207639_101098672 190
2043 3300026041 Ga0207639_10175006 Ga0207639_101750063 190
2044 3300026067 Ga0207678_10068205 Ga0207678_100682052 190
2045 3300026067 Ga0207678_10070354 Ga0207678_100703543 190
2046 3300026078 Ga0207702_10000072 Ga0207702_1000007225 190
2047 3300026078 Ga0207702_10049364 Ga0207702_100493643 190
2048 3300026088 Ga0207641_10002509 Ga0207641_1000250914 190
2049 3300026088 Ga0207641_10002978 Ga0207641_1000297811 190
2050 3300026088 Ga0207641_10032289 Ga0207641_100322894 190
2051 3300026088 Ga0207641_10552997 Ga0207641_105529971 190
2052 3300026089 Ga0207648_10002810 Ga0207648_100028105 190
2053 3300026089 Ga0207648_10566387 Ga0207648_105663872 190
2054 3300026095 Ga0207676_10021524 Ga0207676_100215245 190
2055 3300026095 Ga0207676_10026852 Ga0207676_100268524 190
2056 3300026116 Ga0207674_10001996 Ga0207674_1000199627 190
2057 3300026116 Ga0207674_10021817 Ga0207674_100218175 190
2058 3300026116 Ga0207674_10049158 Ga0207674_100491583 190
2059 3300026116 Ga0207674_10093240 Ga0207674_100932403 190
2060 3300026121 Ga0207683_10014479 Ga0207683_100144796 190
2061 3300026142 Ga0207698_10359265 Ga0207698_103592652 190
2062 3300028379 Ga0268266_10029225 Ga0268266_100292252 190
2063 3300028379 Ga0268266_10075513 Ga0268266_100755133 190
2064 3300028379 Ga0268266_10455714 Ga0268266_104557142 190
2065 3300028380 Ga0268265_10011654 Ga0268265_100116549 190
2066 3300028380 Ga0268265_10565486 Ga0268265_105654862 190
2067 3300028381 Ga0268264_10000395 Ga0268264_1000039514 190
2068 3300028381 Ga0268264_10073176 Ga0268264_100731765 190
2069 3300028381 Ga0268264_10173491 Ga0268264_101734912 190
2070 3300028794 Ga0307515_10452174 Ga0307515_104521741 190
2071 3300030742 Ga0316183_1167184 Ga0316183_11671841 190
2072 3300031548 Ga0307408_100356614 Ga0307408_1003566142 190
2073 3300031548 Ga0307408_100560723 Ga0307408_1005607232 190
2074 3300031731 Ga0307405_10054996 Ga0307405_100549963 190
2075 3300031824 Ga0307413_10031611 Ga0307413_100316112 190
2076 3300031852 Ga0307410_10006758 Ga0307410_100067588 190
2077 3300031852 Ga0307410_10738817 Ga0307410_107388171 190
2078 3300031901 Ga0307406_10111758 Ga0307406_101117582 190
2079 3300031903 Ga0307407_10002381 Ga0307407_100023815 190
2080 3300031911 Ga0307412_10023437 Ga0307412_100234372 190
2081 3300031911 Ga0307412_10053096 Ga0307412_100530962 190
2082 3300031911 Ga0307412_10134912 Ga0307412_101349122 190
2083 3300031911 Ga0307412_10246717 Ga0307412_102467173 190
2084 3300031995 Ga0307409_100107301 Ga0307409_1001073013 190
2085 3300031995 Ga0307409_101405674 Ga0307409_1014056741 190
2086 3300032002 Ga0307416_100102709 Ga0307416_1001027092 190
2087 3300032002 Ga0307416_101127068 Ga0307416_1011270682 190
2088 3300032004 Ga0307414_10292130 Ga0307414_102921302 190
2089 3300032005 Ga0307411_10585835 Ga0307411_105858352 190
2090 3300032126 Ga0307415_100099954 Ga0307415_1000999542 190
2091 3300035085 Ga0373929_0058171 Ga0373929_0058171_185_847 190
2092 3300035112 Ga0373932_0104003 Ga0373932_0104003_321_917 190
2093 3300035113 Ga0373936_0272166 Ga0373936_0272166_25_621 190
2094 3300035241 Ga0373961_0022011 Ga0373961_0022011_508_1170 190
2095 3300035691 Ga0373931_0021546 Ga0373931_0021546_1173_1835 190
2096 3300035691 Ga0373931_0100984 Ga0373931_0100984_475_1071 190
2097 3300037312 Ga0395899_0060950 Ga0395899_0060950_689_1285 190
2098 3300037312 Ga0395899_0121864 Ga0395899_0121864_657_1253 190
2099 3300037312 Ga0395899_0326182 Ga0395899_0326182_281_877 190
2100 3300037418 Ga0395900_0018509 Ga0395900_0018509_3584_4180 190
2101 3300037418 Ga0395900_0042991 Ga0395900_0042991_28_624 190
2102 3300037418 Ga0395900_0084674 Ga0395900_0084674_1345_1941 190
2103 3300037418 Ga0395900_0317510 Ga0395900_0317510_355_951 190
2104 3300037418 Ga0395900_0445879 Ga0395900_0445879_105_701 190
2105 3300037466 Ga0395898_0034098 Ga0395898_0034098_561_1157 190
2106 3300037466 Ga0395898_0290469 Ga0395898_0290469_91_696 190
2107 3300037466 Ga0395898_0603793 Ga0395898_0603793_11_673 190
2108 3300037471 Ga0395905_0000193 Ga0395905_0000193_54933_55595 190
2109 3300037471 Ga0395905_0001786 Ga0395905_0001786_22874_23470 190
2110 3300037471 Ga0395905_0012864 Ga0395905_0012864_4779_5375 190
2111 3300037471 Ga0395905_0022817 Ga0395905_0022817_3455_4051 190
2112 3300037471 Ga0395905_0049007 Ga0395905_0049007_2995_3657 190
2113 3300037471 Ga0395905_0112217 Ga0395905_0112217_1751_2347 190
2114 3300037471 Ga0395905_0171943 Ga0395905_0171943_918_1514 190
2115 3300037471 Ga0395905_0332612 Ga0395905_0332612_43_639 190
2116 3300037471 Ga0395905_0364926 Ga0395905_0364926_601_1197 190
2117 3300037471 Ga0395905_0483027 Ga0395905_0483027_100_756 190
2118 3300038443 Ga0395901_0044421 Ga0395901_0044421_794_1390 190
2119 3300038443 Ga0395901_0047397 Ga0395901_0047397_3148_3744 190
2120 3300038443 Ga0395901_0443470 Ga0395901_0443470_471_1067 190
2121 3300038443 Ga0395901_0588547 Ga0395901_0588547_10_606 190
2122 3300038443 Ga0395901_0858477 Ga0395901_0858477_40_702 190
2123 3300038443 Ga0395901_1021864 Ga0395901_1021864_63_758 190
2124 3300039437 Ga0436365_1858586 Ga0436365_1858586_149771_150367 190
2125 3300039450 Ga0436363_0580193 Ga0436363_0580193_381_977 190
2126 3300039453 Ga0436362_1035670 Ga0436362_1035670_31526_32122 190
2127 3300046525 Ga0495663_0002151 Ga0495663_0002151_3453_4049 190
2128 3300046525 Ga0495663_0167341 Ga0495663_0167341_56_652 190
2129 3300046530 Ga0495654_0008624 Ga0495654_0008624_3068_3664 190
2130 3300046616 Ga0495668_0005443 Ga0495668_0005443_33_629 190
2131 3300046616 Ga0495668_0012118 Ga0495668_0012118_2868_3464 190
2132 3300046660 Ga0495625_0443835 Ga0495625_0443835_63_659 190
2133 3300046684 Ga0495669_0017398 Ga0495669_0017398_2171_2806 190
2134 3300048903 Ga0496100_0000539 Ga0496100_0000539_4330_4926 190
2135 3300048904 Ga0496101_0001051 Ga0496101_0001051_717_1313 190
2136 3300048904 Ga0496101_0068013 Ga0496101_0068013_107_703 190
2137 3300048905 Ga0496102_0029874 Ga0496102_0029874_2161_2757 190
2138 3300048905 Ga0496102_0283808 Ga0496102_0283808_571_1167 190
2139 3300048905 Ga0496102_0724333 Ga0496102_0724333_28_624 190
2140 3300048906 Ga0496103_0023449 Ga0496103_0023449_2864_3460 190
2141 3300048906 Ga0496103_0039938 Ga0496103_0039938_2028_2624 190
2142 3300048906 Ga0496103_0048969 Ga0496103_0048969_321_917 190
2143 3300048906 Ga0496103_0343755 Ga0496103_0343755_321_917 190
2144 3300048907 Ga0496104_0131427 Ga0496104_0131427_186_782 190
2145 3300048907 Ga0496104_0151214 Ga0496104_0151214_332_928 190
2146 3300048907 Ga0496104_0310088 Ga0496104_0310088_686_1282 190
2147 3300048908 Ga0496105_0014075 Ga0496105_0014075_250_846 190
2148 3300048908 Ga0496105_0167920 Ga0496105_0167920_852_1448 190
2149 3300048909 Ga0496106_0019514 Ga0496106_0019514_3484_4080 190
2150 3300048909 Ga0496106_0105565 Ga0496106_0105565_1488_2084 190
2151 3300048909 Ga0496106_0634488 Ga0496106_0634488_37_633 190
2152 3300048910 Ga0496107_0000744 Ga0496107_0000744_10237_10833 190
2153 3300048910 Ga0496107_0005294 Ga0496107_0005294_6764_7360 190
2154 3300048910 Ga0496107_0147097 Ga0496107_0147097_378_974 190
2155 3300048911 Ga0496108_0003683 Ga0496108_0003683_2446_3042 190
2156 3300048911 Ga0496108_0017150 Ga0496108_0017150_2978_3574 190
2157 3300048912 Ga0496109_0025205 Ga0496109_0025205_2604_3200 190
2158 3300048912 Ga0496109_0170583 Ga0496109_0170583_807_1469 190
2159 3300048912 Ga0496109_0274186 Ga0496109_0274186_710_1306 190
2160 3300048913 Ga0496110_0014915 Ga0496110_0014915_4558_5154 190
2161 3300048914 Ga0496111_0000536 Ga0496111_0000536_14618_15214 190
2162 3300048914 Ga0496111_0012450 Ga0496111_0012450_2269_2865 190
2163 3300048914 Ga0496111_0221687 Ga0496111_0221687_116_712 190
2164 3300048914 Ga0496111_0327211 Ga0496111_0327211_86_748 190
2165 3300048915 Ga0496112_0001133 Ga0496112_0001133_14799_15395 190
2166 3300048915 Ga0496112_0009912 Ga0496112_0009912_2467_3063 190
2167 3300048916 Ga0496113_0012994 Ga0496113_0012994_3742_4338 190
2168 3300048919 Ga0496116_0244906 Ga0496116_0244906_42_638 190
2169 3300048920 Ga0496117_0005540 Ga0496117_0005540_5402_5998 190
2170 3300048920 Ga0496117_0013881 Ga0496117_0013881_23_619 190
2171 3300048920 Ga0496117_0067483 Ga0496117_0067483_439_1035 190
2172 3300048921 Ga0496118_0001927 Ga0496118_0001927_21031_21627 190
2173 3300048921 Ga0496118_0263923 Ga0496118_0263923_321_917 190
2174 3300048921 Ga0496118_0263933 Ga0496118_0263933_321_917 190
2175 3300048924 Ga0496121_0241237 Ga0496121_0241237_155_751 190
2176 3300048927 Ga0496124_0035734 Ga0496124_0035734_667_1263 190
2177 3300048927 Ga0496124_0165087 Ga0496124_0165087_199_795 190
2178 3300049459 Ga0495678_017432 Ga0495678_017432_1709_2305 190
2179 3300049571 Ga0501034_0049747 Ga0501034_0049747_3336_3932 190
2180 3300049583 Ga0501067_0139844 Ga0501067_0139844_742_1338 190
2181 3300049679 Ga0501249_000464 Ga0501249_000464_6941_7537 190
2182 3300049679 Ga0501249_028485 Ga0501249_028485_492_1088 190
2183 3300049705 Ga0501225_0035028 Ga0501225_0035028_426_1022 190
2184 3300049765 Ga0501268_002627 Ga0501268_002627_351_947 190
2185 3300049770 Ga0501273_000192 Ga0501273_000192_1492_2088 190
2186 3300049850 Ga0501204_020093 Ga0501204_020093_55_651 190
2187 3300050489 nmdc:mga03683_291862_c1 nmdc:mga03683_291862_c1_95_691 190
2188 3300050513 nmdc:mga0rr50_712999_c1 nmdc:mga0rr50_712999_c1_112_708 190
2189 3300050515 nmdc:mga0a205_57133_c1 nmdc:mga0a205_57133_c1_1075_1671 190
2190 3300053087 Ga0500643_000115 Ga0500643_000115_57504_58100 190
2191 3300053087 Ga0500643_000326 Ga0500643_000326_6643_7239 190
2192 3300053116 Ga0500592_000322 Ga0500592_000322_2999_3595 190
2193 3300053139 Ga0500568_0055059 Ga0500568_0055059_151_747 190
2194 3300053158 Ga0500627_0000211 Ga0500627_0000211_13191_13787 190
2195 3300053727 Ga0500611_000548 Ga0500611_000548_2732_3328 190
2196 3300061719 Ga0466962_0072730 Ga0466962_0072730_40_636 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

205

228

0.99

PF13662

Toprim_4

Toprim domain

112

203

0.97

PF21176

RecR_HhH

RecR, helix-hairpin-helix

39

83

0.95

PF01751

Toprim

Toprim domain

113

202

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9385 72 162
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9189 72 162
8ab0-assembly1.cif.gz_F complex of reco-recr-dna from thermus thermophilus. 0.8339 1 158
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8147 9 189
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8105 9 189
ID Description Score Start End Superfamily
af_P9WHI3_76_174_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9482 68 161 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9312 67 161 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.922 67 161 3.40.1360.10
1vddC03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9213 68 161 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9213 68 189 3.40.1360.10
ID Description Score Start End GO Terms
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.9926 51 146 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A6P1B0M1-F1-model_v4 deleted 0.9741 49 143
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.9725 51 146 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A6P1B0M1-F1-model_v4 deleted 0.9642 49 143
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9609 62 164 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.22 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map