F496513

General Info

Members Datasets Scaffolds Average Seq Length
2178 795 1949 175

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_11119497|Ga0105242_111194972
Length 202
Sequence MVRKSGNRFSEKIMLKVKLVSRRRVTMPVYTVHAPVNSGADLWATDKFVFVRDGFHFWAAVFSPVWLAWHRLWLALVGWIAVTAAVDIGLMALGAGRGATLAAEMLIAILMGFEAASLRRWTLSRRNWRQLDIVVADDEESAERRFFDRWTARQRGLTNDQWAIDRGAPPPTRNIPGQPFSKPPPMPQGGIIGLFPEPGGSR

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2791355199
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
40 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
41 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
42 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
43 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
44 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
45 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
46 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
47 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
48 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
49 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
50 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
51 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
52 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
53 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
54 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
55 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
56 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
57 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
58 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
59 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
60 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
61 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
62 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
63 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
64 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
65 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
66 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
67 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
68 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
69 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
74 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
75 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
76 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
77 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
78 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
79 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
80 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
81 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
82 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
83 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
84 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
85 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
86 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
90 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
91 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
92 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
93 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
94 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
95 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
96 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
97 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
98 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
99 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
100 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
101 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
102 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
103 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
104 2904699407
105 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
106 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
107 2906610324
108 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
109 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
110 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
111 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
112 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
113 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
114 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
115 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
116 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
117 2922368715
118 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
119 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
120 2922425934
121 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
122 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
123 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
124 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
125 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
126 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
127 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
128 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
129 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
130 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
131 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
132 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
133 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
134 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
135 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
136 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
137 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
138 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
139 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
140 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
141 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
142 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
143 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
144 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
145 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
146 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
147 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
148 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
149 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
150 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
151 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
152 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
153 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
154 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
155 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
156 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
157 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
158 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
159 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
160 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
161 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
162 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
163 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
164 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
165 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
166 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
167 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
168 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
169 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
170 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
171 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
172 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
173 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
174 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
175 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
176 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
177 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
178 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
179 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
180 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
181 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
182 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
183 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
184 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
185 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
186 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
187 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
188 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
189 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
190 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
191 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
192 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
193 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
194 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
195 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
196 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
197 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
198 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
199 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
200 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
201 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
202 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
203 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
204 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
205 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
206 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
207 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
208 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
209 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
210 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
211 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
212 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
213 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
214 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
215 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
216 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
217 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
218 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
219 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
220 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
221 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
222 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
223 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
224 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
225 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
226 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
227 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
228 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
229 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
230 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
231 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
232 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
233 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
234 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
235 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
236 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
237 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
238 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
239 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
240 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
241 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
242 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
243 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
244 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
245 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
246 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
247 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
248 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
249 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
250 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
251 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
252 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
253 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
254 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
255 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
256 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
257 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
258 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
259 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
260 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
261 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
262 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
263 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
264 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
265 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
266 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
267 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
268 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
269 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
270 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
271 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
272 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
273 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
274 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
275 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
276 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
277 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
278 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
279 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
280 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
281 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
282 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
283 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
284 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
285 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
286 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
287 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
288 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
289 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
290 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
291 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
292 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
293 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
294 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
295 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
296 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
297 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
298 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
299 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
300 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
301 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
302 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
303 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
304 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
305 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
306 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
307 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
308 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
309 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
310 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
311 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
312 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
313 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
314 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
315 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
316 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
317 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
318 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
319 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
320 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
321 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
322 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
323 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
324 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
325 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
326 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
327 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
328 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
329 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
330 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
331 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
332 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
335 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
337 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
338 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
339 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
340 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
341 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
409 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
410 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
411 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
412 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
415 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
416 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
420 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
421 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
422 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
423 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
424 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
425 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
426 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
427 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
428 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
429 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
430 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
431 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
432 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
433 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
434 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
435 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
436 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
437 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
438 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
439 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
440 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
441 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
442 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
443 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
444 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
445 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
446 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
447 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
448 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
449 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
450 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
451 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
452 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
453 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
454 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
455 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
456 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
457 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
458 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
459 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
460 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
461 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
462 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
463 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
464 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
465 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
466 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
467 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
468 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
469 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
470 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
471 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
472 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
473 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
474 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
475 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
476 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
477 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
478 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
479 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
480 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
481 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
482 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
483 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
484 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
485 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
486 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
487 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
488 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
489 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
490 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
491 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
492 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
493 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
494 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
495 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
496 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
497 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
498 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
499 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
500 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
501 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
502 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
503 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
504 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
505 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
506 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
507 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
508 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
509 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
510 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
511 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
512 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
513 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
514 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
515 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
516 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
517 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
518 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
519 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
520 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
521 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
522 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
523 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
524 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
525 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
526 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
527 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
528 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
529 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
530 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
531 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
532 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
533 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
534 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
535 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
536 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
537 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
538 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
539 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
540 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
541 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
542 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
543 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
544 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
545 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
546 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
547 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
548 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
549 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
550 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
551 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
552 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
553 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
554 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
555 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
556 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
557 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
558 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
559 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
560 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
561 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
562 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
563 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
564 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
565 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
566 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
567 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
568 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
569 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
570 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
571 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
572 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
573 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
574 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
575 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
576 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
577 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
578 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
579 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
580 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
581 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
582 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
583 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
584 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
585 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
586 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
587 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
588 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
589 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
590 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
591 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
592 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
593 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
594 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
595 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
596 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
597 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
598 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
599 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
600 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
601 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
602 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
603 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
604 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
605 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
606 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
607 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
608 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
609 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
610 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
611 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
612 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
613 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
614 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
615 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
616 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
617 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
618 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
619 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
620 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
621 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
622 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
623 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
624 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
625 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
626 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
627 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
628 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
629 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
630 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
631 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
632 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
633 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
634 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
635 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
636 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
637 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
638 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
639 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
640 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
641 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
642 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
643 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
644 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
645 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
646 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
647 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
648 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
649 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
650 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
651 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
652 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
653 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
654 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
655 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
656 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
657 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
658 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
659 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
660 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
661 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
662 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
663 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
664 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
665 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
666 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
667 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
668 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
669 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
670 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
671 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
672 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
673 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
674 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
675 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
676 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
677 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
678 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
679 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
680 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
681 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
682 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
683 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
684 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
685 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
686 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
687 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
688 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
689 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
690 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
691 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
692 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
693 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
694 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
695 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
696 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
697 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
698 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
699 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
700 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
701 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
702 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
703 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
704 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
705 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
706 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
707 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
708 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
709 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
710 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
711 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
712 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
713 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
714 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
715 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
716 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
717 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
718 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
719 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
720 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
721 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
722 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
723 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
724 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
725 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
726 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
727 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
728 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
729 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
730 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
731 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
732 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
733 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
734 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
735 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
736 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
737 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
738 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
739 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
740 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
741 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
742 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
743 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
744 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
745 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
746 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
747 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
748 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
749 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
750 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
751 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
752 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
753 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
754 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
755 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
756 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
757 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
758 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
759 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
760 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
761 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
762 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
763 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
764 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
765 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
766 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
767 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
768 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
769 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
770 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
771 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
772 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
773 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
774 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
775 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
776 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
777 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
778 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
779 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
780 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
781 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
782 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
783 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
784 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
785 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
786 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
787 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
788 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
789 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
790 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
791 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
792 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
793 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
794 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
795 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.6
Metatranscriptomes 0.09
Isolates 10.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.89
Nodule 8.54
Rhizoplane 6.43
Rhizosphere 64.19
Stem 0
Stem Tuber 0
Unclassified 8.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C8699 2010549000 Bacteria 1527
2 JGI24739J22299_10003170 3300001989 Bacteria 6278
3 JGI24737J22298_10011436 3300001990 Bacteria 2909
4 JGI24735J21928_10017184 3300002067 Bacteria 2238
5 JGI24735J21928_10019021 3300002067 Bacteria 2115
6 JGI24735J21928_10027426 3300002067 Bacteria 1707
7 JGI24738J21930_10016718 3300002075 Bacteria 1547
8 JGI25406J46586_10050842 3300003203 Bacteria 1391
9 JGI25153J46596_10031557 3300003215 Bacteria 1781
10 JGI25153J46596_10082937 3300003215 Bacteria 794
11 JGI25160J50197_1001121 3300003354 Bacteria 13681
12 JGI25160J50197_1002067 3300003354 Bacteria 9554
13 JGI25160J50197_1032040 3300003354 Bacteria 1342
14 JGI25404J52841_10016136 3300003659 Bacteria 1620
15 Ga0055539_1002659 3300003752 Bacteria 2661
16 Ga0055531_10011367 3300003794 Bacteria 4303
17 Ga0065165_1003932 3300005262 Bacteria 9781
18 Ga0065165_1045156 3300005262 Bacteria 1284
19 Ga0070658_10126929 3300005327 Bacteria 2124
20 Ga0070676_10290060 3300005328 Bacteria 1105
21 Ga0070683_100008779 3300005329 Bacteria 8593
22 Ga0070683_100082583 3300005329 Bacteria 3009
23 Ga0070683_100677158 3300005329 Bacteria 988
24 Ga0070670_100317610 3300005331 Bacteria 1364
25 Ga0070670_100437679 3300005331 Bacteria 1157
26 Ga0070670_100538610 3300005331 Bacteria 1041
27 Ga0070670_100820204 3300005331 Bacteria 841
28 Ga0068869_100071759 3300005334 Bacteria 2565
29 Ga0068869_100215603 3300005334 Bacteria 1519
30 Ga0068869_100358232 3300005334 Bacteria 1190
31 Ga0070666_10438190 3300005335 Bacteria 943
32 Ga0070680_100021893 3300005336 Bacteria 5085
33 Ga0070680_100045032 3300005336 Bacteria 3586
34 Ga0070680_100137066 3300005336 Bacteria 2051
35 Ga0070680_100234873 3300005336 Bacteria 1549
36 Ga0070680_100315981 3300005336 Bacteria 1326
37 Ga0070680_100645346 3300005336 Bacteria 910
38 Ga0070680_100703107 3300005336 Bacteria 870
39 Ga0070682_100034028 3300005337 Bacteria 3100
40 Ga0070682_100229762 3300005337 Bacteria 1325
41 Ga0068868_100154727 3300005338 Bacteria 1890
42 Ga0068868_100193578 3300005338 Bacteria 1692
43 Ga0068868_100221909 3300005338 Bacteria 1583
44 Ga0068868_100334897 3300005338 Bacteria 1292
45 Ga0068868_100398833 3300005338 Bacteria 1187
46 Ga0068868_100901414 3300005338 Bacteria 803
47 Ga0070660_100002843 3300005339 Bacteria 11922
48 Ga0070660_100093403 3300005339 Bacteria 2375
49 Ga0070660_100122651 3300005339 Bacteria 2074
50 Ga0070660_100253025 3300005339 Bacteria 1437
51 Ga0070660_100434657 3300005339 Bacteria 1087
52 Ga0070660_100844866 3300005339 Bacteria 771
53 Ga0070689_100148307 3300005340 Bacteria 1890
54 Ga0070689_101422936 3300005340 Bacteria 627
55 Ga0070691_10018986 3300005341 Bacteria 3169
56 Ga0070661_100219198 3300005344 Bacteria 1459
57 Ga0070661_100597898 3300005344 Bacteria 892
58 Ga0070661_100728504 3300005344 Bacteria 809
59 Ga0070661_100869333 3300005344 Bacteria 743
60 Ga0070692_10299990 3300005345 Bacteria 981
61 Ga0070668_100261828 3300005347 Bacteria 1438
62 Ga0070668_100316534 3300005347 Bacteria 1312
63 Ga0070668_100340197 3300005347 Bacteria 1267
64 Ga0070668_100659971 3300005347 Bacteria 920
65 Ga0070668_100731660 3300005347 Bacteria 874
66 Ga0070675_100069705 3300005354 Bacteria 2913
67 Ga0070675_100154841 3300005354 Bacteria 1967
68 Ga0070671_100169969 3300005355 Bacteria 1844
69 Ga0070671_100188801 3300005355 Bacteria 1746
70 Ga0070671_100447165 3300005355 Bacteria 1108
71 Ga0070671_100846478 3300005355 Bacteria 798
72 Ga0070674_100148301 3300005356 Bacteria 1767
73 Ga0070674_100194091 3300005356 Bacteria 1563
74 Ga0070674_100284213 3300005356 Bacteria 1312
75 Ga0070674_100954471 3300005356 Bacteria 750
76 Ga0070673_100176883 3300005364 Bacteria 1824
77 Ga0070673_100192895 3300005364 Bacteria 1751
78 Ga0070688_100075203 3300005365 Bacteria 2170
79 Ga0070688_100589312 3300005365 Bacteria 850
80 Ga0070659_100028298 3300005366 Bacteria 4327
81 Ga0070659_100226684 3300005366 Bacteria 1544
82 Ga0070659_100379331 3300005366 Bacteria 1191
83 Ga0070659_100406124 3300005366 Bacteria 1150
84 Ga0070659_100412394 3300005366 Bacteria 1141
85 Ga0070659_100483820 3300005366 Bacteria 1053
86 Ga0070659_100502489 3300005366 Bacteria 1033
87 Ga0070659_100556001 3300005366 Bacteria 983
88 Ga0070667_100126588 3300005367 Bacteria 2227
89 Ga0070667_100131176 3300005367 Bacteria 2187
90 Ga0070667_101421751 3300005367 Bacteria 651
91 Ga0070709_10000584 3300005434 Bacteria 21359
92 Ga0070709_10001183 3300005434 Bacteria 14356
93 Ga0070709_10002047 3300005434 Bacteria 10949
94 Ga0070709_10255174 3300005434 Bacteria 1265
95 Ga0070709_10374635 3300005434 Bacteria 1057
96 Ga0070709_10523707 3300005434 Bacteria 904
97 Ga0070709_10542558 3300005434 Bacteria 889
98 Ga0070709_10792458 3300005434 Bacteria 743
99 Ga0070714_100014031 3300005435 Bacteria 6428
100 Ga0070714_100024145 3300005435 Bacteria 5000
101 Ga0070714_100025356 3300005435 Bacteria 4893
102 Ga0070714_100037866 3300005435 Bacteria 4055
103 Ga0070714_100381118 3300005435 Bacteria 1330
104 Ga0070714_100423183 3300005435 Bacteria 1262
105 Ga0070714_100482390 3300005435 Bacteria 1180
106 Ga0070714_100484883 3300005435 Bacteria 1177
107 Ga0070714_100723580 3300005435 Bacteria 961
108 Ga0070714_100770573 3300005435 Bacteria 931
109 Ga0070713_100002056 3300005436 Bacteria 12998
110 Ga0070713_100002424 3300005436 Bacteria 12160
111 Ga0070713_100078945 3300005436 Bacteria 2803
112 Ga0070713_100159180 3300005436 Bacteria 2014
113 Ga0070713_100412843 3300005436 Bacteria 1262
114 Ga0070710_10002631 3300005437 Bacteria 8527
115 Ga0070710_10007182 3300005437 Bacteria 5384
116 Ga0070710_10097118 3300005437 Bacteria 1747
117 Ga0070710_10425556 3300005437 Bacteria 895
118 Ga0070701_10362392 3300005438 Bacteria 909
119 Ga0070711_100004532 3300005439 Bacteria 8215
120 Ga0070711_100034277 3300005439 Bacteria 3385
121 Ga0070711_100043573 3300005439 Bacteria 3040
122 Ga0070711_100223617 3300005439 Bacteria 1464
123 Ga0070663_100007267 3300005455 Bacteria 6733
124 Ga0070663_100072598 3300005455 Bacteria 2508
125 Ga0070663_100103273 3300005455 Bacteria 2130
126 Ga0070663_100116311 3300005455 Bacteria 2015
127 Ga0070663_100125598 3300005455 Bacteria 1943
128 Ga0070663_100143614 3300005455 Bacteria 1824
129 Ga0070663_100157500 3300005455 Bacteria 1746
130 Ga0070663_100238764 3300005455 Bacteria 1434
131 Ga0070663_100388242 3300005455 Bacteria 1138
132 Ga0070663_100393225 3300005455 Bacteria 1132
133 Ga0070663_100787490 3300005455 Bacteria 814
134 Ga0070678_100038830 3300005456 Bacteria 3354
135 Ga0070678_100040252 3300005456 Bacteria 3305
136 Ga0070678_100079882 3300005456 Bacteria 2475
137 Ga0070678_100147751 3300005456 Bacteria 1889
138 Ga0070678_100654292 3300005456 Bacteria 943
139 Ga0070678_100690689 3300005456 Bacteria 919
140 Ga0070678_100814552 3300005456 Bacteria 849
141 Ga0070662_100184042 3300005457 Bacteria 1648
142 Ga0070662_100806271 3300005457 Bacteria 798
143 Ga0070681_10038172 3300005458 Bacteria 4817
144 Ga0070681_10046167 3300005458 Bacteria 4356
145 Ga0070681_10058550 3300005458 Bacteria 3832
146 Ga0070681_11024242 3300005458 Bacteria 746
147 Ga0068867_100084004 3300005459 Bacteria 2404
148 Ga0070706_100168553 3300005467 Bacteria 2045
149 Ga0070706_100652987 3300005467 Bacteria 977
150 Ga0070706_101617190 3300005467 Bacteria 591
151 Ga0070706_101621706 3300005467 Bacteria 590
152 Ga0070698_100155406 3300005471 Bacteria 2233
153 Ga0070698_100442819 3300005471 Bacteria 1234
154 Ga0070698_101049498 3300005471 Bacteria 763
155 Ga0070699_100838150 3300005518 Bacteria 842
156 Ga0070699_101133094 3300005518 Bacteria 718
157 Ga0070679_100032033 3300005530 Bacteria 5198
158 Ga0070679_100065012 3300005530 Bacteria 3636
159 Ga0070679_100356179 3300005530 Bacteria 1411
160 Ga0070679_100638598 3300005530 Bacteria 1007
161 Ga0070679_101255947 3300005530 Bacteria 686
162 Ga0070679_101524017 3300005530 Bacteria 616
163 Ga0070684_100006680 3300005535 Bacteria 8942
164 Ga0070684_100030415 3300005535 Bacteria 4587
165 Ga0070684_100543653 3300005535 Bacteria 1078
166 Ga0070697_100209173 3300005536 Bacteria 1660
167 Ga0070697_100688542 3300005536 Bacteria 901
168 Ga0070697_101359073 3300005536 Bacteria 634
169 Ga0068853_100002454 3300005539 Bacteria 13873
170 Ga0068853_100005594 3300005539 Bacteria 9870
171 Ga0068853_100065184 3300005539 Bacteria 3161
172 Ga0068853_100135742 3300005539 Bacteria 2205
173 Ga0068853_100188534 3300005539 Bacteria 1873
174 Ga0068853_100250980 3300005539 Bacteria 1623
175 Ga0068853_100270085 3300005539 Bacteria 1566
176 Ga0068853_100294942 3300005539 Bacteria 1497
177 Ga0068853_100438892 3300005539 Bacteria 1226
178 Ga0068853_100494069 3300005539 Bacteria 1155
179 Ga0068853_100707080 3300005539 Bacteria 961
180 Ga0070672_100258979 3300005543 Bacteria 1467
181 Ga0070686_100091124 3300005544 Bacteria 2039
182 Ga0070686_101453318 3300005544 Bacteria 576
183 Ga0070695_100328597 3300005545 Bacteria 1139
184 Ga0070693_100164323 3300005547 Bacteria 1416
185 Ga0070665_100123487 3300005548 Bacteria 2591
186 Ga0070665_100182052 3300005548 Bacteria 2102
187 Ga0070665_100218270 3300005548 Bacteria 1907
188 Ga0070665_100280103 3300005548 Bacteria 1669
189 Ga0070665_100364948 3300005548 Bacteria 1450
190 Ga0070665_100578935 3300005548 Bacteria 1135
191 Ga0070665_100684506 3300005548 Bacteria 1038
192 Ga0070665_100759521 3300005548 Bacteria 983
193 Ga0070665_100833159 3300005548 Bacteria 935
194 Ga0070665_100870754 3300005548 Bacteria 914
195 Ga0070665_100938932 3300005548 Bacteria 878
196 Ga0070665_100954490 3300005548 Bacteria 870
197 Ga0070665_101613057 3300005548 Bacteria 656
198 Ga0070665_101737629 3300005548 Bacteria 631
199 Ga0068855_100006336 3300005563 Bacteria 14418
200 Ga0068855_100033421 3300005563 Bacteria 6138
201 Ga0068855_100129932 3300005563 Bacteria 2877
202 Ga0068855_100138570 3300005563 Bacteria 2775
203 Ga0068855_100167826 3300005563 Bacteria 2487
204 Ga0068855_100824982 3300005563 Bacteria 984
205 Ga0068855_101809260 3300005563 Bacteria 620
206 Ga0070664_100250334 3300005564 Bacteria 1593
207 Ga0070664_101196088 3300005564 Bacteria 717
208 Ga0068857_100026860 3300005577 Bacteria 5076
209 Ga0068857_100128570 3300005577 Bacteria 2284
210 Ga0068857_100168714 3300005577 Bacteria 1988
211 Ga0068857_100213611 3300005577 Bacteria 1761
212 Ga0068857_100291983 3300005577 Bacteria 1501
213 Ga0068857_100579844 3300005577 Bacteria 1059
214 Ga0068854_100003752 3300005578 Bacteria 9498
215 Ga0068854_100008844 3300005578 Bacteria 6481
216 Ga0068854_100292675 3300005578 Bacteria 1314
217 Ga0068854_100460796 3300005578 Bacteria 1063
218 Ga0068854_100530467 3300005578 Bacteria 996
219 Ga0068854_100999619 3300005578 Bacteria 740
220 Ga0068854_101016365 3300005578 Bacteria 735
221 Ga0068854_101098080 3300005578 Bacteria 709
222 Ga0068856_100006298 3300005614 Bacteria 11641
223 Ga0068856_100011349 3300005614 Bacteria 8643
224 Ga0068856_100060014 3300005614 Bacteria 3757
225 Ga0068856_100108247 3300005614 Bacteria 2775
226 Ga0068856_100222198 3300005614 Bacteria 1904
227 Ga0068856_100281482 3300005614 Bacteria 1680
228 Ga0068856_100483113 3300005614 Bacteria 1260
229 Ga0068856_100498396 3300005614 Bacteria 1239
230 Ga0070702_100196428 3300005615 Bacteria 1332
231 Ga0068852_100030996 3300005616 Bacteria 4407
232 Ga0068852_100060856 3300005616 Bacteria 3279
233 Ga0068852_100119230 3300005616 Bacteria 2412
234 Ga0068852_100257643 3300005616 Bacteria 1674
235 Ga0068852_100467050 3300005616 Bacteria 1252
236 Ga0068852_100854894 3300005616 Bacteria 925
237 Ga0068852_100924867 3300005616 Bacteria 890
238 Ga0068859_100346894 3300005617 Bacteria 1579
239 Ga0068859_101665179 3300005617 Bacteria 705
240 Ga0068864_100044295 3300005618 Bacteria 3813
241 Ga0068864_100222851 3300005618 Bacteria 1741
242 Ga0068864_100236672 3300005618 Bacteria 1690
243 Ga0068864_100317442 3300005618 Bacteria 1462
244 Ga0068864_100636986 3300005618 Bacteria 1037
245 Ga0068864_100764402 3300005618 Bacteria 948
246 Ga0068861_100220611 3300005719 Bacteria 1602
247 Ga0068861_100262398 3300005719 Bacteria 1479
248 Ga0068861_100996437 3300005719 Bacteria 799
249 Ga0068861_101278229 3300005719 Bacteria 713
250 Ga0068851_10000408 3300005834 Bacteria 19412
251 Ga0068851_10005095 3300005834 Bacteria 5962
252 Ga0068851_10254032 3300005834 Bacteria 998
253 Ga0068863_100812718 3300005841 Bacteria 933
254 Ga0068863_101586255 3300005841 Bacteria 663
255 Ga0068858_100097230 3300005842 Bacteria 2745
256 Ga0068858_100144409 3300005842 Bacteria 2235
257 Ga0068858_100256252 3300005842 Bacteria 1662
258 Ga0068858_100306658 3300005842 Bacteria 1515
259 Ga0068858_100395939 3300005842 Bacteria 1327
260 Ga0068860_100000835 3300005843 Bacteria 34457
261 Ga0068860_100280720 3300005843 Bacteria 1627
262 Ga0068860_100465397 3300005843 Bacteria 1258
263 Ga0068860_100670455 3300005843 Bacteria 1045
264 Ga0068860_100786476 3300005843 Bacteria 964
265 Ga0068860_101087981 3300005843 Bacteria 819
266 Ga0068862_100317800 3300005844 Bacteria 1436
267 Ga0068862_100466676 3300005844 Bacteria 1193
268 Ga0068862_100996217 3300005844 Bacteria 828
269 Ga0081455_10007101 3300005937 Bacteria 11861
270 Ga0081455_10050365 3300005937 Bacteria 3583
271 Ga0081455_10150940 3300005937 Bacteria 1792
272 Ga0081538_10044577 3300005981 Bacteria 2764
273 Ga0081538_10067457 3300005981 Bacteria 1997
274 Ga0081540_1003522 3300005983 Bacteria 12352
275 Ga0081540_1005183 3300005983 Bacteria 9759
276 Ga0081540_1009347 3300005983 Bacteria 6761
277 Ga0081540_1012550 3300005983 Bacteria 5568
278 Ga0081540_1015783 3300005983 Bacteria 4764
279 Ga0081540_1064448 3300005983 Bacteria 1729
280 Ga0081540_1075387 3300005983 Bacteria 1542
281 Ga0081539_10002259 3300005985 Bacteria 28018
282 Ga0081539_10081468 3300005985 Bacteria 1700
283 Ga0081539_10135939 3300005985 Bacteria 1201
284 Ga0070717_10000598 3300006028 Bacteria 23163
285 Ga0070717_10023337 3300006028 Bacteria 4900
286 Ga0070717_10157915 3300006028 Bacteria 1966
287 Ga0070717_10169579 3300006028 Bacteria 1898
288 Ga0070717_10869129 3300006028 Bacteria 821
289 Ga0075365_10001379 3300006038 Bacteria 10928
290 Ga0075365_10027661 3300006038 Bacteria 3610
291 Ga0075365_10063183 3300006038 Bacteria 2478
292 Ga0075365_10079812 3300006038 Bacteria 2214
293 Ga0075365_10087003 3300006038 Bacteria 2124
294 Ga0075365_10264180 3300006038 Bacteria 1210
295 Ga0075365_10968013 3300006038 Bacteria 600
296 Ga0075368_10005988 3300006042 Bacteria 4217
297 Ga0075368_10136857 3300006042 Bacteria 1019
298 Ga0075368_10183007 3300006042 Bacteria 883
299 Ga0075368_10193902 3300006042 Bacteria 858
300 Ga0075368_10194840 3300006042 Bacteria 856
301 Ga0075363_100008692 3300006048 Bacteria 4741
302 Ga0075363_100013057 3300006048 Bacteria 4016
303 Ga0075363_100050670 3300006048 Bacteria 2213
304 Ga0075363_100306340 3300006048 Bacteria 922
305 Ga0075363_100348554 3300006048 Bacteria 864
306 Ga0075363_100468350 3300006048 Bacteria 746
307 Ga0075364_10013009 3300006051 Bacteria 5105
308 Ga0075364_10091969 3300006051 Bacteria 2013
309 Ga0075364_10471996 3300006051 Bacteria 857
310 Ga0075364_10573121 3300006051 Bacteria 771
311 Ga0075364_10752970 3300006051 Bacteria 664
312 Ga0075432_10079793 3300006058 Bacteria 1185
313 Ga0070715_10001673 3300006163 Bacteria 6581
314 Ga0070715_10037875 3300006163 Bacteria 1999
315 Ga0070716_100009624 3300006173 Bacteria 4820
316 Ga0070716_100011397 3300006173 Bacteria 4474
317 Ga0070716_100077216 3300006173 Bacteria 1976
318 Ga0070716_100793012 3300006173 Bacteria 733
319 Ga0070716_101122963 3300006173 Bacteria 628
320 Ga0070712_100017822 3300006175 Bacteria 4601
321 Ga0070712_100034599 3300006175 Bacteria 3425
322 Ga0070712_100043417 3300006175 Bacteria 3095
323 Ga0070712_100182425 3300006175 Bacteria 1637
324 Ga0070712_100264867 3300006175 Bacteria 1378
325 Ga0070712_100367116 3300006175 Bacteria 1182
326 Ga0075362_10063945 3300006177 Bacteria 1669
327 Ga0075362_10255967 3300006177 Bacteria 862
328 Ga0075362_10300825 3300006177 Bacteria 796
329 Ga0075362_10363798 3300006177 Bacteria 726
330 Ga0075367_10003520 3300006178 Bacteria 7484
331 Ga0075367_10039183 3300006178 Bacteria 2762
332 Ga0075367_10065396 3300006178 Bacteria 2177
333 Ga0075367_10092705 3300006178 Bacteria 1839
334 Ga0075367_10183832 3300006178 Bacteria 1303
335 Ga0075367_10216183 3300006178 Bacteria 1199
336 Ga0075367_10281965 3300006178 Bacteria 1045
337 Ga0075367_10312573 3300006178 Bacteria 990
338 Ga0075369_10115792 3300006186 Bacteria 1210
339 Ga0075369_10122647 3300006186 Bacteria 1177
340 Ga0075369_10158937 3300006186 Bacteria 1035
341 Ga0075369_10221664 3300006186 Bacteria 875
342 Ga0075366_10403288 3300006195 Bacteria 841
343 Ga0075366_10485822 3300006195 Bacteria 763
344 Ga0075366_10556171 3300006195 Bacteria 710
345 Ga0097621_100736626 3300006237 Bacteria 910
346 Ga0075370_10138880 3300006353 Bacteria 1420
347 Ga0075370_10217481 3300006353 Bacteria 1129
348 Ga0075370_10418014 3300006353 Bacteria 805
349 Ga0075370_10505514 3300006353 Bacteria 729
350 Ga0068871_100068569 3300006358 Bacteria 2912
351 Ga0068871_100578052 3300006358 Bacteria 1020
352 Ga0075428_100508019 3300006844 Bacteria 1289
353 Ga0075428_100835098 3300006844 Bacteria 979
354 Ga0075434_100123660 3300006871 Bacteria 2604
355 Ga0075434_101090454 3300006871 Bacteria 812
356 Ga0068865_100168927 3300006881 Bacteria 1675
357 Ga0068865_100186076 3300006881 Bacteria 1602
358 Ga0068865_100349374 3300006881 Bacteria 1198
359 Ga0068865_100725039 3300006881 Bacteria 852
360 Ga0097620_100248051 3300006931 Bacteria 1870
361 Ga0097620_100346884 3300006931 Bacteria 1579
362 Ga0097620_101665284 3300006931 Bacteria 705
363 Ga0099825_1038134 3300006941 Bacteria 1547
364 Ga0099825_1041705 3300006941 Bacteria 1304
365 Ga0099824_1011583 3300006942 Bacteria 9925
366 Ga0099824_1014421 3300006942 Bacteria 7852
367 Ga0099822_1000827 3300006943 Bacteria 32648
368 Ga0099822_1066359 3300006943 Bacteria 1083
369 Ga0099823_1033731 3300006944 Bacteria 4096
370 Ga0075435_100354073 3300007076 Bacteria 1259
371 Ga0099794_10061710 3300007265 Bacteria 1822
372 Ga0099794_10147248 3300007265 Bacteria 1194
373 Ga0099795_10029924 3300007788 Bacteria 1865
374 Ga0099795_10077633 3300007788 Bacteria 1265
375 Ga0099795_10140751 3300007788 Bacteria 981
376 Ga0099795_10200946 3300007788 Bacteria 841
377 Ga0099795_10322464 3300007788 Bacteria 684
378 Ga0099795_10436876 3300007788 Bacteria 600
379 Ga0105250_10091468 3300009092 Bacteria 1238
380 Ga0105250_10377382 3300009092 Bacteria 625
381 Ga0105240_10003692 3300009093 Bacteria 23676
382 Ga0105240_10006014 3300009093 Bacteria 17940
383 Ga0105240_10058527 3300009093 Bacteria 4811
384 Ga0105240_10070189 3300009093 Bacteria 4334
385 Ga0105240_10109244 3300009093 Bacteria 3350
386 Ga0105240_10232402 3300009093 Bacteria 2142
387 Ga0105240_10245972 3300009093 Bacteria 2071
388 Ga0105240_10397198 3300009093 Bacteria 1554
389 Ga0105240_10749915 3300009093 Bacteria 1061
390 Ga0105240_10930736 3300009093 Bacteria 933
391 Ga0105240_10970126 3300009093 Bacteria 911
392 Ga0105240_11551465 3300009093 Bacteria 694
393 Ga0111539_10509565 3300009094 Bacteria 1401
394 Ga0111539_10723090 3300009094 Bacteria 1159
395 Ga0105245_10214346 3300009098 Bacteria 1855
396 Ga0105245_10526512 3300009098 Bacteria 1201
397 Ga0105245_10803147 3300009098 Bacteria 979
398 Ga0105245_11207519 3300009098 Bacteria 804
399 Ga0105245_11396820 3300009098 Bacteria 750
400 Ga0105245_11401470 3300009098 Bacteria 749
401 Ga0105245_11499279 3300009098 Bacteria 725
402 Ga0105247_10048692 3300009101 Bacteria 2604
403 Ga0105247_10064667 3300009101 Bacteria 2274
404 Ga0105247_10191981 3300009101 Bacteria 1368
405 Ga0105247_10297795 3300009101 Bacteria 1118
406 Ga0105247_10628783 3300009101 Bacteria 799
407 Ga0105247_10708285 3300009101 Bacteria 759
408 Ga0114129_11265320 3300009147 Bacteria 916
409 Ga0105243_10918277 3300009148 Bacteria 872
410 Ga0105243_11093591 3300009148 Bacteria 805
411 Ga0105241_10031270 3300009174 Bacteria 3986
412 Ga0105241_10073022 3300009174 Bacteria 2668
413 Ga0105241_10129938 3300009174 Bacteria 2038
414 Ga0105241_10295700 3300009174 Bacteria 1388
415 Ga0105241_10503033 3300009174 Bacteria 1081
416 Ga0105241_10508630 3300009174 Bacteria 1075
417 Ga0105241_10670301 3300009174 Bacteria 944
418 Ga0105241_10926027 3300009174 Bacteria 811
419 Ga0105242_10272548 3300009176 Bacteria 1534
420 Ga0105242_10563659 3300009176 Bacteria 1094
421 Ga0105242_10620734 3300009176 Bacteria 1047
422 Ga0105242_10976035 3300009176 Bacteria 853
423 Ga0105242_11119497 3300009176 Bacteria 802
424 Ga0105242_11796028 3300009176 Bacteria 651
425 Ga0105248_10272460 3300009177 Bacteria 1906
426 Ga0105248_10548045 3300009177 Bacteria 1305
427 Ga0105248_10711207 3300009177 Bacteria 1133
428 Ga0105248_10722682 3300009177 Bacteria 1124
429 Ga0105248_11421682 3300009177 Bacteria 785
430 Ga0105237_10008146 3300009545 Bacteria 11379
431 Ga0105237_10013371 3300009545 Bacteria 8609
432 Ga0105237_10075926 3300009545 Bacteria 3351
433 Ga0105237_10109729 3300009545 Bacteria 2751
434 Ga0105237_10135650 3300009545 Bacteria 2455
435 Ga0105237_10176911 3300009545 Bacteria 2134
436 Ga0105237_10194669 3300009545 Bacteria 2027
437 Ga0105237_10260777 3300009545 Bacteria 1736
438 Ga0105237_10303036 3300009545 Bacteria 1601
439 Ga0105237_10396698 3300009545 Bacteria 1384
440 Ga0105237_10801653 3300009545 Bacteria 949
441 Ga0105237_10813756 3300009545 Bacteria 941
442 Ga0105237_11106715 3300009545 Bacteria 799
443 Ga0105237_11751991 3300009545 Unclassified 629
444 Ga0105237_11771141 3300009545 Bacteria 625
445 Ga0105238_10005022 3300009551 Bacteria 13079
446 Ga0105238_10007571 3300009551 Bacteria 10881
447 Ga0105238_10073433 3300009551 Bacteria 3415
448 Ga0105238_10099826 3300009551 Bacteria 2886
449 Ga0105238_10108677 3300009551 Bacteria 2755
450 Ga0105238_10499759 3300009551 Bacteria 1217
451 Ga0105238_10521658 3300009551 Bacteria 1191
452 Ga0105238_10663803 3300009551 Bacteria 1053
453 Ga0105238_10944742 3300009551 Bacteria 882
454 Ga0105238_11103452 3300009551 Bacteria 816
455 Ga0105249_10439689 3300009553 Bacteria 1341
456 Ga0105249_11456771 3300009553 Bacteria 757
457 Ga0099796_10097202 3300010159 Bacteria 1103
458 Ga0105239_10016720 3300010375 Bacteria 8108
459 Ga0105239_10024639 3300010375 Bacteria 6628
460 Ga0105239_10041875 3300010375 Bacteria 5019
461 Ga0105239_10081881 3300010375 Bacteria 3553
462 Ga0105239_10185080 3300010375 Bacteria 2331
463 Ga0105239_10196081 3300010375 Bacteria 2262
464 Ga0105239_10456220 3300010375 Bacteria 1450
465 Ga0105239_10695614 3300010375 Bacteria 1162
466 Ga0105239_10873817 3300010375 Bacteria 1032
467 Ga0105239_10928893 3300010375 Bacteria 999
468 Ga0105239_10983870 3300010375 Bacteria 970
469 Ga0105239_11087202 3300010375 Bacteria 920
470 Ga0105246_10136861 3300011119 Bacteria 1837
471 Ga0105246_10171964 3300011119 Bacteria 1660
472 Ga0105246_10415732 3300011119 Bacteria 1121
473 Ga0105246_10855575 3300011119 Bacteria 812
474 Ga0157370_10091836 3300013104 Bacteria 2850
475 Ga0157370_11008524 3300013104 Bacteria 753
476 Ga0157369_10001511 3300013105 Bacteria 28540
477 Ga0157369_10095205 3300013105 Bacteria 3178
478 Ga0157369_10141449 3300013105 Bacteria 2546
479 Ga0157369_10856238 3300013105 Bacteria 933
480 Ga0157369_11407354 3300013105 Bacteria 710
481 Ga0157374_10082621 3300013296 Bacteria 3051
482 Ga0157374_10085571 3300013296 Bacteria 2998
483 Ga0157374_10314610 3300013296 Bacteria 1551
484 Ga0157374_10505801 3300013296 Bacteria 1213
485 Ga0157374_11319380 3300013296 Bacteria 744
486 Ga0157374_11512048 3300013296 Bacteria 695
487 Ga0157378_10026970 3300013297 Bacteria 5067
488 Ga0157378_10204429 3300013297 Bacteria 1870
489 Ga0157378_10411100 3300013297 Bacteria 1335
490 Ga0157378_10790993 3300013297 Bacteria 974
491 Ga0157378_11511763 3300013297 Bacteria 716
492 Ga0163162_10187470 3300013306 Bacteria 2196
493 Ga0163162_10280970 3300013306 Bacteria 1797
494 Ga0163162_10285884 3300013306 Bacteria 1781
495 Ga0163162_10409825 3300013306 Bacteria 1488
496 Ga0163162_10561147 3300013306 Bacteria 1269
497 Ga0163162_10675928 3300013306 Bacteria 1155
498 Ga0163162_10724638 3300013306 Bacteria 1115
499 Ga0163162_11173486 3300013306 Bacteria 871
500 Ga0163162_11316289 3300013306 Bacteria 821
501 Ga0157372_10493587 3300013307 Bacteria 1428
502 Ga0157375_10087610 3300013308 Bacteria 3166
503 Ga0157375_10344595 3300013308 Bacteria 1655
504 Ga0157375_10470136 3300013308 Bacteria 1423
505 Ga0157375_10874533 3300013308 Bacteria 1044
506 Ga0157375_10998559 3300013308 Bacteria 977
507 Ga0157375_11073115 3300013308 Bacteria 942
508 Ga0157375_11389419 3300013308 Bacteria 827
509 Ga0157375_12057344 3300013308 Bacteria 679
510 Ga0157375_12232766 3300013308 Bacteria 652
511 Ga0163163_10023630 3300014325 Bacteria 5835
512 Ga0163163_10103930 3300014325 Bacteria 2865
513 Ga0163163_10344325 3300014325 Bacteria 1546
514 Ga0163163_10374002 3300014325 Bacteria 1482
515 Ga0163163_10405781 3300014325 Bacteria 1421
516 Ga0163163_10441437 3300014325 Bacteria 1361
517 Ga0163163_11005569 3300014325 Bacteria 897
518 Ga0163163_11914759 3300014325 Bacteria 653
519 Ga0163163_12288185 3300014325 Bacteria 599
520 Ga0157380_11189124 3300014326 Bacteria 806
521 Ga0157380_11234774 3300014326 Bacteria 792
522 Ga0157380_11302763 3300014326 Bacteria 774
523 Ga0157377_10529884 3300014745 Bacteria 828
524 Ga0157379_10130611 3300014968 Bacteria 2261
525 Ga0157379_10231253 3300014968 Bacteria 1676
526 Ga0157379_10267297 3300014968 Bacteria 1555
527 Ga0157379_10483823 3300014968 Bacteria 1146
528 Ga0157376_10033090 3300014969 Bacteria 4158
529 Ga0157376_10074426 3300014969 Bacteria 2895
530 Ga0157376_10236899 3300014969 Bacteria 1698
531 Ga0157376_10360595 3300014969 Bacteria 1394
532 Ga0157376_10787087 3300014969 Bacteria 963
533 Ga0157376_11064650 3300014969 Bacteria 833
534 Ga0182006_1068530 3300015261 Bacteria 1321
535 Ga0182005_1075226 3300015265 Bacteria 930
536 Ga0163161_10272271 3300017792 Bacteria 1325
537 Ga0163161_10538920 3300017792 Bacteria 955
538 Ga0206356_10700491 3300020070 Bacteria 1088
539 Ga0214544_1000016 3300021320 Bacteria 204278
540 Ga0214542_1000016 3300021321 Bacteria 210332
541 Ga0214545_1000008 3300021324 Bacteria 215190
542 Ga0214543_1001466 3300021327 Bacteria 45567
543 Ga0214543_1046469 3300021327 Bacteria 957
544 Ga0214543_1047539 3300021327 Bacteria 918
545 Ga0213872_10078139 3300021361 Bacteria 1487
546 Ga0213876_10095185 3300021384 Bacteria 1577
547 Ga0213876_10238427 3300021384 Bacteria 967
548 Ga0213876_10314602 3300021384 Bacteria 832
549 Ga0213876_10528082 3300021384 Bacteria 628
550 Ga0213875_10231759 3300021388 Bacteria 870
551 Ga0209677_101892 3300025253 Bacteria 8453
552 Ga0209677_107016 3300025253 Bacteria 2504
553 Ga0209148_1000275 3300025254 Bacteria 80696
554 Ga0209148_1015201 3300025254 Bacteria 1349
555 Ga0209233_1006675 3300025261 Bacteria 3701
556 Ga0209233_1007954 3300025261 Bacteria 3317
557 Ga0209233_1014430 3300025261 Bacteria 2224
558 Ga0209233_1016327 3300025261 Bacteria 2047
559 Ga0209455_1002070 3300025272 Bacteria 8101
560 Ga0209455_1008927 3300025272 Bacteria 2675
561 Ga0209455_1033392 3300025272 Bacteria 846
562 Ga0209673_1081895 3300025273 Bacteria 737
563 Ga0209564_1004284 3300025295 Bacteria 8844
564 Ga0209564_1032782 3300025295 Bacteria 1557
565 Ga0209758_1000069 3300025297 Bacteria 286161
566 Ga0209758_1000635 3300025297 Bacteria 53736
567 Ga0209758_1000695 3300025297 Bacteria 49852
568 Ga0209758_1002443 3300025297 Bacteria 18966
569 Ga0209758_1003838 3300025297 Bacteria 13189
570 Ga0209758_1006620 3300025297 Bacteria 8210
571 Ga0209758_1017993 3300025297 Bacteria 3487
572 Ga0209758_1021052 3300025297 Bacteria 3057
573 Ga0209758_1062932 3300025297 Bacteria 1211
574 Ga0209758_1109110 3300025297 Bacteria 769
575 Ga0209256_1006920 3300025299 Bacteria 5802
576 Ga0209256_1056111 3300025299 Bacteria 933
577 Ga0207426_1000826 3300025302 Bacteria 33158
578 Ga0207426_1002297 3300025302 Bacteria 12602
579 Ga0207426_1005144 3300025302 Bacteria 6090
580 Ga0209257_1000473 3300025304 Bacteria 73323
581 Ga0209257_1012596 3300025304 Bacteria 3886
582 Ga0207697_10019378 3300025315 Bacteria 2786
583 Ga0207656_10000909 3300025321 Bacteria 9633
584 Ga0207656_10053979 3300025321 Bacteria 1745
585 Ga0207656_10328059 3300025321 Bacteria 761
586 Ga0207692_10001284 3300025898 Bacteria 9322
587 Ga0207692_10005810 3300025898 Bacteria 4970
588 Ga0207692_10030706 3300025898 Bacteria 2565
589 Ga0207692_10283608 3300025898 Bacteria 1003
590 Ga0207692_10403762 3300025898 Bacteria 852
591 Ga0207642_10286154 3300025899 Bacteria 950
592 Ga0207710_10022169 3300025900 Bacteria 2725
593 Ga0207710_10105965 3300025900 Bacteria 1331
594 Ga0207710_10166524 3300025900 Bacteria 1076
595 Ga0207710_10172977 3300025900 Bacteria 1056
596 Ga0207710_10181296 3300025900 Bacteria 1033
597 Ga0207710_10204478 3300025900 Bacteria 976
598 Ga0207710_10400455 3300025900 Bacteria 704
599 Ga0207688_10066663 3300025901 Bacteria 2036
600 Ga0207688_10138071 3300025901 Bacteria 1433
601 Ga0207680_10278587 3300025903 Bacteria 1161
602 Ga0207680_10361762 3300025903 Bacteria 1020
603 Ga0207647_10002277 3300025904 Bacteria 14628
604 Ga0207647_10038999 3300025904 Bacteria 3000
605 Ga0207647_10160831 3300025904 Bacteria 1310
606 Ga0207647_10182548 3300025904 Bacteria 1218
607 Ga0207647_10255132 3300025904 Bacteria 1005
608 Ga0207685_10035202 3300025905 Bacteria 1826
609 Ga0207685_10064982 3300025905 Bacteria 1459
610 Ga0207699_10001061 3300025906 Bacteria 12978
611 Ga0207699_10020586 3300025906 Bacteria 3539
612 Ga0207699_10090067 3300025906 Bacteria 1924
613 Ga0207645_10100805 3300025907 Bacteria 1863
614 Ga0207643_10444546 3300025908 Bacteria 824
615 Ga0207643_10509910 3300025908 Bacteria 769
616 Ga0207643_10548726 3300025908 Bacteria 741
617 Ga0207705_10116536 3300025909 Bacteria 1978
618 Ga0207705_10213923 3300025909 Bacteria 1462
619 Ga0207705_10452548 3300025909 Bacteria 995
620 Ga0207705_10687886 3300025909 Bacteria 795
621 Ga0207705_10866062 3300025909 Bacteria 700
622 Ga0207684_10072422 3300025910 Bacteria 2927
623 Ga0207684_10417161 3300025910 Bacteria 1153
624 Ga0207654_10351545 3300025911 Bacteria 1015
625 Ga0207654_10378327 3300025911 Bacteria 980
626 Ga0207654_10550830 3300025911 Bacteria 819
627 Ga0207707_10004287 3300025912 Bacteria 12624
628 Ga0207707_10030069 3300025912 Bacteria 4749
629 Ga0207707_10204133 3300025912 Bacteria 1723
630 Ga0207707_10663222 3300025912 Bacteria 878
631 Ga0207695_10000107 3300025913 Bacteria 252606
632 Ga0207695_10000453 3300025913 Bacteria 89314
633 Ga0207695_10021123 3300025913 Bacteria 7436
634 Ga0207695_10033190 3300025913 Bacteria 5637
635 Ga0207695_10165664 3300025913 Bacteria 2139
636 Ga0207695_10255092 3300025913 Bacteria 1653
637 Ga0207695_10364668 3300025913 Bacteria 1331
638 Ga0207695_10535680 3300025913 Bacteria 1052
639 Ga0207695_10585663 3300025913 Bacteria 997
640 Ga0207695_11199309 3300025913 Bacteria 639
641 Ga0207671_10009240 3300025914 Bacteria 8259
642 Ga0207671_10036979 3300025914 Bacteria 3620
643 Ga0207671_10043131 3300025914 Bacteria 3336
644 Ga0207671_10065615 3300025914 Bacteria 2700
645 Ga0207671_10113801 3300025914 Bacteria 2061
646 Ga0207671_10220763 3300025914 Bacteria 1485
647 Ga0207671_10300641 3300025914 Bacteria 1268
648 Ga0207671_10345483 3300025914 Bacteria 1179
649 Ga0207671_10690513 3300025914 Bacteria 812
650 Ga0207693_10003195 3300025915 Bacteria 14067
651 Ga0207693_10006870 3300025915 Bacteria 9396
652 Ga0207693_10151462 3300025915 Bacteria 1824
653 Ga0207693_10189196 3300025915 Bacteria 1620
654 Ga0207663_10000404 3300025916 Bacteria 18698
655 Ga0207663_10007470 3300025916 Bacteria 5670
656 Ga0207663_10110362 3300025916 Bacteria 1865
657 Ga0207663_10401266 3300025916 Bacteria 1049
658 Ga0207660_10001366 3300025917 Bacteria 16351
659 Ga0207660_10038196 3300025917 Bacteria 3351
660 Ga0207660_10116745 3300025917 Bacteria 2016
661 Ga0207660_10224414 3300025917 Bacteria 1475
662 Ga0207660_10260726 3300025917 Bacteria 1371
663 Ga0207660_10490074 3300025917 Bacteria 997
664 Ga0207660_10801268 3300025917 Bacteria 769
665 Ga0207662_10206376 3300025918 Bacteria 1274
666 Ga0207657_10001686 3300025919 Bacteria 23826
667 Ga0207657_10004438 3300025919 Bacteria 14843
668 Ga0207657_10071982 3300025919 Bacteria 2925
669 Ga0207657_10115685 3300025919 Bacteria 2210
670 Ga0207657_10171286 3300025919 Bacteria 1758
671 Ga0207657_10305927 3300025919 Bacteria 1259
672 Ga0207657_10328892 3300025919 Bacteria 1207
673 Ga0207649_10189714 3300025920 Bacteria 1445
674 Ga0207649_10283976 3300025920 Bacteria 1204
675 Ga0207649_10379840 3300025920 Bacteria 1053
676 Ga0207649_10400369 3300025920 Bacteria 1027
677 Ga0207652_10001889 3300025921 Bacteria 18142
678 Ga0207652_10240986 3300025921 Bacteria 1630
679 Ga0207652_10619669 3300025921 Bacteria 969
680 Ga0207652_10854766 3300025921 Bacteria 806
681 Ga0207646_10140083 3300025922 Bacteria 2178
682 Ga0207681_10065884 3300025923 Bacteria 2506
683 Ga0207694_10001512 3300025924 Bacteria 19799
684 Ga0207694_10002704 3300025924 Bacteria 14352
685 Ga0207694_10006429 3300025924 Bacteria 8953
686 Ga0207694_10075818 3300025924 Bacteria 2633
687 Ga0207694_10082295 3300025924 Bacteria 2530
688 Ga0207694_10263039 3300025924 Bacteria 1413
689 Ga0207694_10308236 3300025924 Bacteria 1304
690 Ga0207694_10434138 3300025924 Bacteria 1095
691 Ga0207650_10164909 3300025925 Bacteria 1758
692 Ga0207650_10303465 3300025925 Bacteria 1304
693 Ga0207650_11238850 3300025925 Bacteria 635
694 Ga0207659_10234781 3300025926 Bacteria 1481
695 Ga0207687_10590826 3300025927 Bacteria 935
696 Ga0207700_10001725 3300025928 Bacteria 12413
697 Ga0207700_10028048 3300025928 Bacteria 3951
698 Ga0207700_10059459 3300025928 Bacteria 2891
699 Ga0207700_10120590 3300025928 Bacteria 2126
700 Ga0207700_10420041 3300025928 Bacteria 1174
701 Ga0207700_10472860 3300025928 Bacteria 1107
702 Ga0207700_10565168 3300025928 Bacteria 1010
703 Ga0207700_10839919 3300025928 Bacteria 822
704 Ga0207664_10012728 3300025929 Bacteria 6021
705 Ga0207664_10017118 3300025929 Bacteria 5304
706 Ga0207664_10019486 3300025929 Bacteria 5015
707 Ga0207664_10028923 3300025929 Bacteria 4217
708 Ga0207664_10738060 3300025929 Bacteria 886
709 Ga0207644_10020869 3300025931 Bacteria 4457
710 Ga0207644_10130097 3300025931 Bacteria 1926
711 Ga0207644_10254632 3300025931 Bacteria 1402
712 Ga0207690_10043581 3300025932 Bacteria 2953
713 Ga0207690_10325776 3300025932 Bacteria 1209
714 Ga0207690_10606226 3300025932 Bacteria 894
715 Ga0207706_10012728 3300025933 Bacteria 7659
716 Ga0207706_10260866 3300025933 Bacteria 1513
717 Ga0207706_10642640 3300025933 Bacteria 909
718 Ga0207686_10065084 3300025934 Bacteria 2323
719 Ga0207686_10338464 3300025934 Bacteria 1129
720 Ga0207686_10393038 3300025934 Bacteria 1054
721 Ga0207686_10522343 3300025934 Bacteria 924
722 Ga0207686_10888562 3300025934 Bacteria 718
723 Ga0207709_10032140 3300025935 Bacteria 3071
724 Ga0207709_10772856 3300025935 Bacteria 774
725 Ga0207709_11046077 3300025935 Bacteria 669
726 Ga0207670_10422494 3300025936 Bacteria 1070
727 Ga0207670_10472956 3300025936 Bacteria 1014
728 Ga0207670_10482923 3300025936 Bacteria 1004
729 Ga0207670_10610462 3300025936 Bacteria 896
730 Ga0207670_10762209 3300025936 Bacteria 804
731 Ga0207669_10080009 3300025937 Bacteria 2088
732 Ga0207669_10149175 3300025937 Bacteria 1635
733 Ga0207669_10764853 3300025937 Bacteria 799
734 Ga0207669_11178749 3300025937 Bacteria 648
735 Ga0207704_10199416 3300025938 Bacteria 1463
736 Ga0207704_10407965 3300025938 Bacteria 1074
737 Ga0207704_11115897 3300025938 Bacteria 670
738 Ga0207704_11403343 3300025938 Bacteria 598
739 Ga0207665_10001034 3300025939 Bacteria 18732
740 Ga0207665_10051444 3300025939 Bacteria 2773
741 Ga0207665_10078086 3300025939 Bacteria 2273
742 Ga0207665_10270321 3300025939 Bacteria 1262
743 Ga0207691_10219174 3300025940 Bacteria 1650
744 Ga0207691_10259215 3300025940 Bacteria 1499
745 Ga0207691_10439542 3300025940 Bacteria 1111
746 Ga0207691_11211659 3300025940 Bacteria 626
747 Ga0207711_10293948 3300025941 Bacteria 1497
748 Ga0207711_10361441 3300025941 Bacteria 1345
749 Ga0207711_10580103 3300025941 Bacteria 1046
750 Ga0207689_10262663 3300025942 Bacteria 1428
751 Ga0207661_10006554 3300025944 Bacteria 8230
752 Ga0207661_10007064 3300025944 Bacteria 7970
753 Ga0207661_10433655 3300025944 Bacteria 1195
754 Ga0207661_11427283 3300025944 Bacteria 635
755 Ga0207679_10653419 3300025945 Bacteria 951
756 Ga0207667_10002324 3300025949 Bacteria 23814
757 Ga0207667_10007600 3300025949 Bacteria 12999
758 Ga0207667_10015590 3300025949 Bacteria 8623
759 Ga0207667_10126419 3300025949 Bacteria 2633
760 Ga0207667_10657710 3300025949 Bacteria 1053
761 Ga0207651_10129801 3300025960 Bacteria 1927
762 Ga0207651_10131015 3300025960 Bacteria 1920
763 Ga0207651_10152310 3300025960 Bacteria 1802
764 Ga0207651_10464890 3300025960 Bacteria 1088
765 Ga0207651_10717877 3300025960 Bacteria 882
766 Ga0207712_10191767 3300025961 Bacteria 1614
767 Ga0207712_10340140 3300025961 Bacteria 1244
768 Ga0207712_10392560 3300025961 Bacteria 1164
769 Ga0207712_10402756 3300025961 Bacteria 1150
770 Ga0207712_11158644 3300025961 Bacteria 689
771 Ga0207668_10068903 3300025972 Bacteria 2517
772 Ga0207668_10145429 3300025972 Bacteria 1828
773 Ga0207668_10193823 3300025972 Bacteria 1612
774 Ga0207668_10200311 3300025972 Bacteria 1589
775 Ga0207668_10217042 3300025972 Bacteria 1533
776 Ga0207668_10926065 3300025972 Bacteria 776
777 Ga0207640_10034701 3300025981 Bacteria 3150
778 Ga0207640_10075254 3300025981 Bacteria 2288
779 Ga0207640_10359994 3300025981 Bacteria 1172
780 Ga0207640_10535518 3300025981 Bacteria 981
781 Ga0207640_10578119 3300025981 Bacteria 948
782 Ga0207640_10596066 3300025981 Bacteria 935
783 Ga0207640_11506810 3300025981 Bacteria 604
784 Ga0207658_10082355 3300025986 Bacteria 2471
785 Ga0207658_10114391 3300025986 Bacteria 2139
786 Ga0207658_10358568 3300025986 Bacteria 1271
787 Ga0207658_10431012 3300025986 Bacteria 1164
788 Ga0207658_10954256 3300025986 Bacteria 782
789 Ga0207658_11398523 3300025986 Bacteria 640
790 Ga0207677_10137411 3300026023 Bacteria 1866
791 Ga0207677_10270948 3300026023 Bacteria 1389
792 Ga0207677_10331515 3300026023 Bacteria 1268
793 Ga0207677_10675194 3300026023 Bacteria 914
794 Ga0207703_10078142 3300026035 Bacteria 2748
795 Ga0207703_10139500 3300026035 Bacteria 2103
796 Ga0207703_10337963 3300026035 Bacteria 1383
797 Ga0207703_10443924 3300026035 Bacteria 1211
798 Ga0207703_10731748 3300026035 Bacteria 942
799 Ga0207639_10009146 3300026041 Bacteria 6829
800 Ga0207639_10028554 3300026041 Bacteria 4074
801 Ga0207639_10033329 3300026041 Bacteria 3799
802 Ga0207639_10058662 3300026041 Bacteria 2962
803 Ga0207639_10127731 3300026041 Bacteria 2099
804 Ga0207639_10210960 3300026041 Bacteria 1672
805 Ga0207639_10242186 3300026041 Bacteria 1569
806 Ga0207639_10283630 3300026041 Bacteria 1457
807 Ga0207639_10635570 3300026041 Bacteria 986
808 Ga0207639_10892389 3300026041 Bacteria 831
809 Ga0207639_10899174 3300026041 Bacteria 827
810 Ga0207678_10069768 3300026067 Bacteria 3013
811 Ga0207678_10121226 3300026067 Bacteria 2232
812 Ga0207678_10130277 3300026067 Bacteria 2145
813 Ga0207678_10182812 3300026067 Bacteria 1790
814 Ga0207678_10236693 3300026067 Bacteria 1564
815 Ga0207678_10262057 3300026067 Bacteria 1481
816 Ga0207678_10345580 3300026067 Bacteria 1282
817 Ga0207678_10376964 3300026067 Bacteria 1226
818 Ga0207678_10383939 3300026067 Bacteria 1214
819 Ga0207678_10519786 3300026067 Bacteria 1039
820 Ga0207678_10607215 3300026067 Bacteria 959
821 Ga0207678_10788587 3300026067 Bacteria 838
822 Ga0207678_10938216 3300026067 Bacteria 766
823 Ga0207678_10989896 3300026067 Bacteria 744
824 Ga0207708_10072730 3300026075 Bacteria 2634
825 Ga0207708_10448670 3300026075 Bacteria 1074
826 Ga0207708_10885026 3300026075 Bacteria 772
827 Ga0207702_10000004 3300026078 Bacteria 422182
828 Ga0207702_10008573 3300026078 Bacteria 8618
829 Ga0207702_10136551 3300026078 Bacteria 2213
830 Ga0207702_10466731 3300026078 Bacteria 1227
831 Ga0207702_10500133 3300026078 Bacteria 1185
832 Ga0207702_10646627 3300026078 Bacteria 1040
833 Ga0207702_10719843 3300026078 Bacteria 984
834 Ga0207702_10954071 3300026078 Bacteria 850
835 Ga0207702_11034036 3300026078 Bacteria 815
836 Ga0207641_10491308 3300026088 Bacteria 1191
837 Ga0207641_10971664 3300026088 Bacteria 845
838 Ga0207641_11031423 3300026088 Bacteria 820
839 Ga0207641_11548616 3300026088 Bacteria 665
840 Ga0207648_10043824 3300026089 Bacteria 3927
841 Ga0207648_10061595 3300026089 Bacteria 3272
842 Ga0207676_10147248 3300026095 Bacteria 2023
843 Ga0207676_10181723 3300026095 Bacteria 1842
844 Ga0207676_10323232 3300026095 Bacteria 1417
845 Ga0207676_10533731 3300026095 Bacteria 1119
846 Ga0207676_10577306 3300026095 Bacteria 1077
847 Ga0207676_10952136 3300026095 Bacteria 844
848 Ga0207674_10000890 3300026116 Bacteria 39065
849 Ga0207674_10004798 3300026116 Bacteria 16196
850 Ga0207674_10017171 3300026116 Bacteria 7899
851 Ga0207674_10065909 3300026116 Bacteria 3649
852 Ga0207674_10177088 3300026116 Bacteria 2085
853 Ga0207674_10258150 3300026116 Bacteria 1690
854 Ga0207674_10305663 3300026116 Bacteria 1540
855 Ga0207675_100145742 3300026118 Bacteria 2251
856 Ga0207675_100330734 3300026118 Bacteria 1489
857 Ga0207675_100400940 3300026118 Bacteria 1352
858 Ga0207683_10115944 3300026121 Bacteria 2401
859 Ga0207683_10128189 3300026121 Bacteria 2281
860 Ga0207683_10244893 3300026121 Bacteria 1635
861 Ga0207683_10280143 3300026121 Bacteria 1524
862 Ga0207683_10336618 3300026121 Bacteria 1384
863 Ga0207683_10338476 3300026121 Bacteria 1380
864 Ga0207683_10413822 3300026121 Bacteria 1241
865 Ga0207683_10735653 3300026121 Bacteria 915
866 Ga0207698_10006435 3300026142 Bacteria 7332
867 Ga0207698_10017851 3300026142 Bacteria 4823
868 Ga0207698_10144192 3300026142 Bacteria 2057
869 Ga0207698_10169371 3300026142 Bacteria 1921
870 Ga0207698_10229818 3300026142 Bacteria 1683
871 Ga0207698_10634019 3300026142 Bacteria 1057
872 Ga0207698_10671936 3300026142 Bacteria 1028
873 Ga0207698_10798598 3300026142 Bacteria 946
874 Ga0207698_10806075 3300026142 Bacteria 941
875 Ga0207698_10969149 3300026142 Bacteria 860
876 Ga0209389_1000033 3300027296 Bacteria 131516
877 Ga0209389_1000182 3300027296 Bacteria 48705
878 Ga0209589_1000021 3300027357 Bacteria 186431
879 Ga0209589_1000040 3300027357 Bacteria 126550
880 Ga0209489_100028 3300027361 Bacteria 186431
881 Ga0209489_100045 3300027361 Bacteria 158225
882 Ga0209489_100209 3300027361 Bacteria 96349
883 Ga0209700_100011 3300027363 Bacteria 362159
884 Ga0209700_100037 3300027363 Bacteria 186431
885 Ga0209179_1029476 3300027512 Bacteria 1117
886 Ga0209588_1017691 3300027671 Bacteria 2212
887 Ga0209588_1034848 3300027671 Bacteria 1618
888 Ga0209813_10039420 3300027866 Bacteria 1432
889 Ga0207428_10068381 3300027907 Bacteria 2794
890 Ga0268266_10003966 3300028379 Bacteria 14358
891 Ga0268266_10006104 3300028379 Bacteria 11096
892 Ga0268266_10040428 3300028379 Bacteria 3974
893 Ga0268266_10099347 3300028379 Bacteria 2562
894 Ga0268266_10180127 3300028379 Bacteria 1923
895 Ga0268266_10212183 3300028379 Bacteria 1776
896 Ga0268266_10298409 3300028379 Bacteria 1502
897 Ga0268266_10331670 3300028379 Bacteria 1426
898 Ga0268266_10560392 3300028379 Bacteria 1095
899 Ga0268266_10560569 3300028379 Bacteria 1095
900 Ga0268266_10727120 3300028379 Bacteria 957
901 Ga0268266_10801874 3300028379 Bacteria 909
902 Ga0268266_11368562 3300028379 Bacteria 683
903 Ga0268265_10028336 3300028380 Bacteria 4008
904 Ga0268265_10052133 3300028380 Bacteria 3092
905 Ga0268265_10110006 3300028380 Bacteria 2247
906 Ga0268265_10142082 3300028380 Bacteria 2011
907 Ga0268265_10694420 3300028380 Bacteria 982
908 Ga0268265_10741620 3300028380 Bacteria 952
909 Ga0268265_11081305 3300028380 Bacteria 795
910 Ga0268265_11199603 3300028380 Bacteria 756
911 Ga0268264_10000157 3300028381 Bacteria 155163
912 Ga0268264_10107873 3300028381 Bacteria 2433
913 Ga0268264_10117569 3300028381 Bacteria 2338
914 Ga0268264_10176788 3300028381 Bacteria 1935
915 Ga0268264_10339235 3300028381 Bacteria 1427
916 Ga0268264_10502262 3300028381 Bacteria 1183
917 Ga0268264_10805540 3300028381 Bacteria 939
918 Ga0268264_11156318 3300028381 Bacteria 783
919 Ga0307517_10001338 3300028786 Bacteria 41372
920 Ga0307517_10204742 3300028786 Bacteria 1227
921 Ga0307517_10302602 3300028786 Bacteria 896
922 Ga0307515_10036525 3300028794 Bacteria 7944
923 Ga0307515_10070966 3300028794 Bacteria 4729
924 Ga0307511_10053449 3300030521 Bacteria 3201
925 Ga0307511_10221685 3300030521 Bacteria 949
926 Ga0307512_10301480 3300030522 Bacteria 746
927 Ga0265330_10015338 3300031235 Bacteria 3545
928 Ga0265330_10016402 3300031235 Bacteria 3418
929 Ga0265330_10217564 3300031235 Bacteria 806
930 Ga0265332_10002811 3300031238 Bacteria 8649
931 Ga0265332_10090317 3300031238 Bacteria 1295
932 Ga0265328_10043979 3300031239 Bacteria 1643
933 Ga0265325_10000229 3300031241 Bacteria 39809
934 Ga0265325_10007580 3300031241 Bacteria 6488
935 Ga0265340_10003064 3300031247 Bacteria 9498
936 Ga0265340_10021094 3300031247 Bacteria 3341
937 Ga0265339_10001062 3300031249 Bacteria 20880
938 Ga0265339_10053849 3300031249 Bacteria 2187
939 Ga0265339_10286080 3300031249 Bacteria 789
940 Ga0265331_10010008 3300031250 Bacteria 5273
941 Ga0265331_10024962 3300031250 Bacteria 3019
942 Ga0265316_10127547 3300031344 Bacteria 1918
943 Ga0265316_10273040 3300031344 Bacteria 1237
944 Ga0307513_10158328 3300031456 Bacteria 2161
945 Ga0307509_10052266 3300031507 Bacteria 4362
946 Ga0307509_10132253 3300031507 Bacteria 2447
947 Ga0307509_10241668 3300031507 Bacteria 1597
948 Ga0307408_100147996 3300031548 Bacteria 1851
949 Ga0307408_100196628 3300031548 Bacteria 1629
950 Ga0265313_10000227 3300031595 Bacteria 60770
951 Ga0265313_10055192 3300031595 Bacteria 1883
952 Ga0307508_10000002 3300031616 Bacteria 407635
953 Ga0307508_10097319 3300031616 Bacteria 2535
954 Ga0307508_10128550 3300031616 Bacteria 2137
955 Ga0265314_10007615 3300031711 Bacteria 9373
956 Ga0265314_10015101 3300031711 Bacteria 6142
957 Ga0265314_10037169 3300031711 Bacteria 3531
958 Ga0265342_10003978 3300031712 Bacteria 11831
959 Ga0265342_10034285 3300031712 Bacteria 3115
960 Ga0265342_10164508 3300031712 Bacteria 1224
961 Ga0307516_10008231 3300031730 Bacteria 11840
962 Ga0307516_10055028 3300031730 Bacteria 3886
963 Ga0307516_10189841 3300031730 Bacteria 1781
964 Ga0307516_10210294 3300031730 Bacteria 1660
965 Ga0307516_10291589 3300031730 Bacteria 1310
966 Ga0307516_10304144 3300031730 Bacteria 1270
967 Ga0307516_10335353 3300031730 Bacteria 1180
968 Ga0307405_10561578 3300031731 Bacteria 925
969 Ga0307405_10684375 3300031731 Bacteria 847
970 Ga0307413_10231929 3300031824 Bacteria 1356
971 Ga0307518_10281146 3300031838 Bacteria 1030
972 Ga0307410_10164480 3300031852 Bacteria 1666
973 Ga0326468_10025449 3300031889 Bacteria 744
974 Ga0307406_10637418 3300031901 Bacteria 883
975 Ga0307406_10703968 3300031901 Bacteria 844
976 Ga0307407_10085386 3300031903 Bacteria 1920
977 Ga0307412_11421641 3300031911 Bacteria 628
978 Ga0307409_100199241 3300031995 Bacteria 1790
979 Ga0307409_100446016 3300031995 Bacteria 1248
980 Ga0307409_100629509 3300031995 Bacteria 1064
981 Ga0307409_100759825 3300031995 Bacteria 974
982 Ga0307416_100142560 3300032002 Bacteria 2181
983 Ga0307416_100645711 3300032002 Bacteria 1143
984 Ga0307416_100873816 3300032002 Bacteria 998
985 Ga0307416_101447950 3300032002 Bacteria 793
986 Ga0307414_11455193 3300032004 Bacteria 637
987 Ga0307411_10080393 3300032005 Bacteria 2241
988 Ga0307411_10197863 3300032005 Bacteria 1541
989 Ga0307411_10394839 3300032005 Bacteria 1142
990 Ga0307415_100211262 3300032126 Bacteria 1548
991 Ga0307415_100792694 3300032126 Bacteria 864
992 Ga0307415_101134748 3300032126 Bacteria 733
993 Ga0316583_10003757 3300032133 Bacteria 5374
994 Ga0307507_10103482 3300033179 Bacteria 2369
995 Ga0307510_10001271 3300033180 Bacteria 27493
996 Ga0307510_10014252 3300033180 Bacteria 9415
997 Ga0307510_10084067 3300033180 Bacteria 3068
998 Ga0307510_10195997 3300033180 Bacteria 1561
999 Ga0315911_1000008 3300033442 Bacteria 381285
1000 Ga0373930_0009343 3300034816 Bacteria 1735
1001 Ga0373934_0004104 3300035086 Bacteria 5367
1002 Ga0373934_0096519 3300035086 Bacteria 1194
1003 Ga0373940_0216275 3300035088 Bacteria 635
1004 Ga0373944_0029559 3300035089 Bacteria 1639
1005 Ga0373951_0029159 3300035091 Bacteria 1296
1006 Ga0373951_0038861 3300035091 Bacteria 1142
1007 Ga0373923_0019315 3300035111 Bacteria 2637
1008 Ga0373923_0028039 3300035111 Bacteria 2250
1009 Ga0373936_0446549 3300035113 Bacteria 598
1010 Ga0373939_0065518 3300035114 Bacteria 1169
1011 Ga0373941_0024123 3300035115 Bacteria 1744
1012 Ga0373945_0112711 3300035116 Bacteria 1074
1013 Ga0373953_0005344 3300035117 Bacteria 4160
1014 Ga0373953_0048419 3300035117 Bacteria 1712
1015 Ga0373954_0001748 3300035118 Bacteria 8920
1016 Ga0373954_0004926 3300035118 Bacteria 5765
1017 Ga0373954_0148160 3300035118 Bacteria 1146
1018 Ga0373956_0011231 3300035119 Bacteria 3687
1019 Ga0373956_0077653 3300035119 Bacteria 1520
1020 Ga0373957_0003256 3300035120 Bacteria 4776
1021 Ga0373943_0237792 3300035170 Bacteria 1020
1022 Ga0373946_0120080 3300035171 Bacteria 1199
1023 Ga0373946_0268724 3300035171 Bacteria 836
1024 Ga0373955_0026378 3300035172 Bacteria 2992
1025 Ga0373955_0066609 3300035172 Bacteria 2002
1026 Ga0373955_0200951 3300035172 Bacteria 1187
1027 Ga0373962_0042358 3300035242 Bacteria 1287
1028 Ga0373924_0021110 3300035410 Bacteria 2539
1029 Ga0373931_0006849 3300035691 Bacteria 5359
1030 Ga0373931_0410472 3300035691 Bacteria 859
1031 Ga0373935_0153765 3300035692 Bacteria 1563
1032 Ga0373935_0166115 3300035692 Bacteria 1507
1033 Ga0373935_0344718 3300035692 Bacteria 1061
1034 Ga0373935_0499847 3300035692 Bacteria 883
1035 Ga0373927_0001909 3300035695 Bacteria 15400
1036 Ga0373927_0008042 3300035695 Bacteria 7121
1037 Ga0373927_0041289 3300035695 Bacteria 2992
1038 Ga0373927_0139313 3300035695 Bacteria 1586
1039 Ga0373927_0218716 3300035695 Bacteria 1251
1040 Ga0373927_0224591 3300035695 Bacteria 1234
1041 Ga0373927_0231863 3300035695 Bacteria 1213
1042 Ga0373927_0242063 3300035695 Bacteria 1186
1043 Ga0373933_0000031 3300035724 Bacteria 85038
1044 Ga0373933_0091526 3300035724 Bacteria 1877
1045 Ga0373933_0136203 3300035724 Bacteria 1547
1046 Ga0373933_0475211 3300035724 Bacteria 818
1047 Ga0373947_0016858 3300035725 Bacteria 4196
1048 Ga0373947_0165513 3300035725 Bacteria 1432
1049 Ga0373947_0422611 3300035725 Bacteria 901
1050 Ga0373937_0024272 3300036401 Bacteria 5466
1051 Ga0373937_0056247 3300036401 Bacteria 3613
1052 Ga0373937_0198151 3300036401 Bacteria 1887
1053 Ga0373937_0310717 3300036401 Bacteria 1491
1054 Ga0372808_004913 3300036459 Bacteria 1736
1055 Ga0373925_0039040 3300037068 Bacteria 3512
1056 Ga0373925_0057142 3300037068 Bacteria 2924
1057 Ga0373925_0081420 3300037068 Bacteria 2462
1058 Ga0373925_0182375 3300037068 Bacteria 1662
1059 Ga0373925_0405967 3300037068 Bacteria 1112
1060 Ga0373925_0488827 3300037068 Bacteria 1010
1061 Ga0373925_0585644 3300037068 Bacteria 918
1062 Ga0373925_0620989 3300037068 Bacteria 890
1063 Ga0395899_0251903 3300037312 Bacteria 1211
1064 Ga0395899_0491063 3300037312 Bacteria 798
1065 Ga0395900_0010736 3300037418 Bacteria 9368
1066 Ga0395900_0242343 3300037418 Bacteria 1808
1067 Ga0395900_0271956 3300037418 Bacteria 1689
1068 Ga0395900_0878214 3300037418 Bacteria 821
1069 Ga0395898_0030124 3300037466 Bacteria 5432
1070 Ga0395898_0044161 3300037466 Bacteria 4390
1071 Ga0395898_0050822 3300037466 Bacteria 4056
1072 Ga0395898_0093688 3300037466 Bacteria 2886
1073 Ga0395898_0165387 3300037466 Bacteria 2116
1074 Ga0395898_0165902 3300037466 Bacteria 2112
1075 Ga0395905_0005054 3300037471 Bacteria 13581
1076 Ga0395905_0318740 3300037471 Bacteria 1444
1077 Ga0436364_0900659 3300037853 Bacteria 1435
1078 Ga0436364_0933374 3300037853 Bacteria 2188
1079 Ga0436364_1276004 3300037853 Bacteria 9626
1080 Ga0395901_0002704 3300038443 Bacteria 17874
1081 Ga0395901_0149822 3300038443 Bacteria 2452
1082 Ga0395901_0295394 3300038443 Bacteria 1680
1083 Ga0395901_0304099 3300038443 Bacteria 1653
1084 Ga0436365_0451378 3300039437 Bacteria 1428
1085 Ga0436365_0584651 3300039437 Bacteria 1448
1086 Ga0436365_0940586 3300039437 Bacteria 3155
1087 Ga0436365_0996589 3300039437 Bacteria 726
1088 Ga0436365_1127077 3300039437 Bacteria 1233
1089 Ga0436365_1154205 3300039437 Bacteria 6237
1090 Ga0436365_1287579 3300039437 Bacteria 689
1091 Ga0436365_1477089 3300039437 Bacteria 4726
1092 Ga0436365_1779987 3300039437 Bacteria 3012
1093 Ga0436360_0159422 3300039438 Bacteria 3821
1094 Ga0436360_0980864 3300039438 Bacteria 1339
1095 Ga0436361_0087261 3300039447 Bacteria 764
1096 Ga0436361_0440082 3300039447 Bacteria 973
1097 Ga0436363_1005833 3300039450 Bacteria 1226
1098 Ga0436363_1066283 3300039450 Bacteria 3558
1099 Ga0436362_0847603 3300039453 Bacteria 2862
1100 Ga0439466_0226261 3300041411 Bacteria 568
1101 Ga0439465_0036993 3300041413 Bacteria 1569
1102 Ga0451787_838027 3300041441 Bacteria 866
1103 Ga0451789_0848106 3300041443 Bacteria 1560
1104 Ga0451800_0802753 3300041459 Bacteria 710
1105 Ga0451849_0793750 3300041505 Bacteria 1429
1106 Ga0451853_1236993 3300041512 Bacteria 943
1107 Ga0439431_0074365 3300041997 Bacteria 909
1108 Ga0439455_0097756 3300042012 Bacteria 809
1109 Ga0466972_0062029 3300044658 Bacteria 1792
1110 Ga0466972_0148210 3300044658 Bacteria 1103
1111 Ga0466965_0022493 3300044683 Bacteria 3039
1112 Ga0466965_0171212 3300044683 Bacteria 1142
1113 Ga0466966_0000998 3300044684 Bacteria 18088
1114 Ga0466966_0098998 3300044684 Bacteria 1805
1115 Ga0466966_0115750 3300044684 Bacteria 1650
1116 Ga0466961_0000139 3300044693 Bacteria 48781
1117 Ga0466961_0370884 3300044693 Bacteria 870
1118 Ga0466963_0145567 3300044694 Bacteria 1643
1119 Ga0466963_0146565 3300044694 Bacteria 1638
1120 Ga0466963_0312586 3300044694 Bacteria 1105
1121 Ga0466963_0534976 3300044694 Bacteria 827
1122 Ga0466964_0124287 3300044706 Bacteria 1167
1123 Ga0466964_0127330 3300044706 Bacteria 1155
1124 Ga0466964_0395347 3300044706 Bacteria 721
1125 Ga0466971_0214581 3300044719 Bacteria 911
1126 Ga0466968_0052809 3300044735 Bacteria 1739
1127 Ga0466968_0333765 3300044735 Bacteria 734
1128 Ga0466970_0278495 3300044765 Bacteria 940
1129 Ga0466957_0082946 3300044842 Bacteria 1999
1130 Ga0466957_0256378 3300044842 Bacteria 1164
1131 Ga0466960_0017761 3300044901 Bacteria 3108
1132 Ga0466960_0093599 3300044901 Bacteria 1536
1133 Ga0466959_0006266 3300045049 Bacteria 8218
1134 Ga0466959_0016385 3300045049 Bacteria 5414
1135 Ga0466959_0082247 3300045049 Bacteria 2320
1136 Ga0466958_0101724 3300045836 Bacteria 1787
1137 Ga0466967_0284812 3300045976 Bacteria 1586
1138 Ga0466967_0425668 3300045976 Bacteria 1294
1139 Ga0466967_0447072 3300045976 Bacteria 1263
1140 Ga0466967_1168593 3300045976 Bacteria 767
1141 Ga0466967_1559457 3300045976 Bacteria 658
1142 Ga0495592_0001103 3300046454 Bacteria 18750
1143 Ga0495592_0020485 3300046454 Bacteria 5030
1144 Ga0495592_0102112 3300046454 Bacteria 2042
1145 Ga0495592_0591303 3300046454 Bacteria 678
1146 Ga0495603_0003797 3300046455 Bacteria 8993
1147 Ga0495603_0040505 3300046455 Bacteria 2788
1148 Ga0495603_0042867 3300046455 Bacteria 2704
1149 Ga0495603_0152516 3300046455 Bacteria 1342
1150 Ga0495603_0167722 3300046455 Bacteria 1272
1151 Ga0495603_0213823 3300046455 Bacteria 1113
1152 Ga0495590_0041267 3300046457 Bacteria 1608
1153 Ga0495590_0107515 3300046457 Bacteria 994
1154 Ga0495629_0001972 3300046459 Bacteria 15994
1155 Ga0495629_0011428 3300046459 Bacteria 6449
1156 Ga0495629_0140000 3300046459 Bacteria 1684
1157 Ga0495629_0225584 3300046459 Bacteria 1292
1158 Ga0495629_0655098 3300046459 Bacteria 699
1159 Ga0495638_0014041 3300046460 Bacteria 5427
1160 Ga0495638_0071350 3300046460 Bacteria 2124
1161 Ga0495638_0296014 3300046460 Bacteria 873
1162 Ga0495638_0436978 3300046460 Bacteria 671
1163 Ga0495638_0474605 3300046460 Bacteria 634
1164 Ga0495641_0090146 3300046461 Bacteria 1370
1165 Ga0495641_0224307 3300046461 Bacteria 843
1166 Ga0495641_0361810 3300046461 Bacteria 657
1167 Ga0495651_0003655 3300046462 Bacteria 11783
1168 Ga0495651_0042721 3300046462 Bacteria 3518
1169 Ga0495651_0238033 3300046462 Bacteria 1250
1170 Ga0495653_0002188 3300046463 Bacteria 15461
1171 Ga0495650_0029800 3300046471 Bacteria 2483
1172 Ga0495650_0114187 3300046471 Bacteria 1000
1173 Ga0495580_0220733 3300046472 Bacteria 1303
1174 Ga0495580_0225811 3300046472 Bacteria 1286
1175 Ga0495580_0599310 3300046472 Bacteria 728
1176 Ga0495580_0674341 3300046472 Bacteria 678
1177 Ga0495582_0229784 3300046473 Bacteria 1062
1178 Ga0495582_0608783 3300046473 Bacteria 632
1179 Ga0495605_0036098 3300046474 Bacteria 2494
1180 Ga0495605_0115620 3300046474 Bacteria 1220
1181 Ga0495605_0130208 3300046474 Bacteria 1135
1182 Ga0495605_0200367 3300046474 Bacteria 870
1183 Ga0495605_0305153 3300046474 Bacteria 673
1184 Ga0495639_0061431 3300046475 Bacteria 1723
1185 Ga0495639_0110922 3300046475 Bacteria 1302
1186 Ga0495639_0407549 3300046475 Bacteria 687
1187 Ga0495664_0203070 3300046477 Bacteria 1201
1188 Ga0495664_0506293 3300046477 Bacteria 721
1189 Ga0495584_0080852 3300046491 Bacteria 1635
1190 Ga0495584_0263954 3300046491 Bacteria 875
1191 Ga0495584_0396432 3300046491 Bacteria 701
1192 Ga0495585_0031755 3300046492 Bacteria 2996
1193 Ga0495585_0158712 3300046492 Bacteria 1175
1194 Ga0495585_0252211 3300046492 Bacteria 880
1195 Ga0495594_0050450 3300046499 Bacteria 2288
1196 Ga0495594_0115383 3300046499 Bacteria 1516
1197 Ga0495594_0267482 3300046499 Bacteria 974
1198 Ga0495594_0348421 3300046499 Bacteria 843
1199 Ga0495596_0063967 3300046500 Bacteria 1431
1200 Ga0495596_0165044 3300046500 Bacteria 861
1201 Ga0495607_0126059 3300046501 Bacteria 1338
1202 Ga0495607_0152380 3300046501 Bacteria 1182
1203 Ga0495583_0084082 3300046506 Bacteria 1379
1204 Ga0495583_0102243 3300046506 Bacteria 1222
1205 Ga0495606_0049371 3300046507 Bacteria 2760
1206 Ga0495606_0056331 3300046507 Bacteria 2538
1207 Ga0495606_0110870 3300046507 Bacteria 1655
1208 Ga0495606_0229668 3300046507 Bacteria 1041
1209 Ga0495606_0296794 3300046507 Bacteria 877
1210 Ga0495608_0002745 3300046511 Bacteria 12639
1211 Ga0495608_0024793 3300046511 Bacteria 4098
1212 Ga0495610_0065515 3300046512 Bacteria 1714
1213 Ga0495610_0122259 3300046512 Bacteria 1139
1214 Ga0495610_0161736 3300046512 Bacteria 945
1215 Ga0495616_0017135 3300046513 Bacteria 3998
1216 Ga0495616_0019203 3300046513 Bacteria 3733
1217 Ga0495616_0117012 3300046513 Bacteria 1233
1218 Ga0495616_0237201 3300046513 Bacteria 788
1219 Ga0495618_0134549 3300046514 Bacteria 1581
1220 Ga0495618_0254682 3300046514 Bacteria 1100
1221 Ga0495620_0100838 3300046515 Bacteria 1151
1222 Ga0495620_0148664 3300046515 Bacteria 914
1223 Ga0495620_0173852 3300046515 Bacteria 834
1224 Ga0495620_0240758 3300046515 Bacteria 690
1225 Ga0495620_0246552 3300046515 Bacteria 681
1226 Ga0495628_0006025 3300046516 Bacteria 10598
1227 Ga0495628_0012958 3300046516 Bacteria 7021
1228 Ga0495628_0421963 3300046516 Bacteria 972
1229 Ga0495628_0437648 3300046516 Bacteria 951
1230 Ga0495628_0873225 3300046516 Bacteria 626
1231 Ga0495630_0183056 3300046517 Bacteria 1598
1232 Ga0495630_0412225 3300046517 Bacteria 1035
1233 Ga0495631_0124280 3300046518 Bacteria 1109
1234 Ga0495631_0162133 3300046518 Bacteria 959
1235 Ga0495631_0165143 3300046518 Bacteria 950
1236 Ga0495631_0195942 3300046518 Bacteria 864
1237 Ga0495631_0307274 3300046518 Bacteria 675
1238 Ga0495632_0107263 3300046519 Bacteria 1313
1239 Ga0495632_0211039 3300046519 Bacteria 881
1240 Ga0495632_0315944 3300046519 Bacteria 691
1241 Ga0495637_0035241 3300046520 Bacteria 2187
1242 Ga0495637_0143911 3300046520 Bacteria 903
1243 Ga0495643_0015773 3300046522 Bacteria 4456
1244 Ga0495643_0023375 3300046522 Bacteria 3515
1245 Ga0495643_0050991 3300046522 Bacteria 2227
1246 Ga0495643_0113875 3300046522 Bacteria 1372
1247 Ga0495644_0039086 3300046523 Bacteria 1789
1248 Ga0495644_0070378 3300046523 Bacteria 1314
1249 Ga0495644_0272496 3300046523 Bacteria 659
1250 Ga0495648_0000286 3300046524 Bacteria 57430
1251 Ga0495648_0009724 3300046524 Bacteria 7408
1252 Ga0495648_0025580 3300046524 Bacteria 3992
1253 Ga0495648_0040986 3300046524 Bacteria 2929
1254 Ga0495648_0233599 3300046524 Bacteria 898
1255 Ga0495663_0063637 3300046525 Bacteria 1163
1256 Ga0495642_0059653 3300046528 Bacteria 1581
1257 Ga0495652_0048072 3300046529 Bacteria 3657
1258 Ga0495654_0079212 3300046530 Bacteria 1543
1259 Ga0495654_0331657 3300046530 Bacteria 615
1260 Ga0495665_0166917 3300046531 Bacteria 1147
1261 Ga0495640_0003340 3300046533 Bacteria 12919
1262 Ga0495640_0041884 3300046533 Bacteria 3198
1263 Ga0495640_0121631 3300046533 Bacteria 1696
1264 Ga0495586_0221764 3300046535 Bacteria 1075
1265 Ga0495598_0298125 3300046537 Bacteria 609
1266 Ga0495609_0046262 3300046538 Bacteria 1949
1267 Ga0495609_0075064 3300046538 Bacteria 1482
1268 Ga0495609_0080528 3300046538 Bacteria 1424
1269 Ga0495609_0110034 3300046538 Bacteria 1189
1270 Ga0495621_0094907 3300046539 Bacteria 1129
1271 Ga0495621_0292498 3300046539 Bacteria 673
1272 Ga0495597_0046929 3300046542 Bacteria 1913
1273 Ga0495597_0069278 3300046542 Bacteria 1523
1274 Ga0495597_0139196 3300046542 Bacteria 1002
1275 Ga0495597_0226986 3300046542 Bacteria 740
1276 Ga0495645_0009296 3300046543 Bacteria 6874
1277 Ga0495645_0225489 3300046543 Bacteria 1258
1278 Ga0495622_0019824 3300046557 Bacteria 3130
1279 Ga0495622_0062500 3300046557 Bacteria 1723
1280 Ga0495622_0146290 3300046557 Bacteria 1071
1281 Ga0495633_0165928 3300046558 Bacteria 1018
1282 Ga0495633_0262300 3300046558 Bacteria 787
1283 Ga0495667_0000464 3300046559 Bacteria 25814
1284 Ga0495667_0014536 3300046559 Bacteria 5317
1285 Ga0495667_0035393 3300046559 Bacteria 3337
1286 Ga0495656_0073658 3300046615 Bacteria 1523
1287 Ga0495656_0305399 3300046615 Bacteria 816
1288 Ga0495656_0447419 3300046615 Bacteria 680
1289 Ga0495668_0035561 3300046616 Bacteria 2792
1290 Ga0495668_0045453 3300046616 Bacteria 2441
1291 Ga0495668_0177566 3300046616 Bacteria 1167
1292 Ga0495668_0207963 3300046616 Bacteria 1071
1293 Ga0495634_0025578 3300046642 Bacteria 4127
1294 Ga0495634_0028663 3300046642 Bacteria 3863
1295 Ga0495634_0101233 3300046642 Bacteria 1861
1296 Ga0495611_0043706 3300046648 Bacteria 2003
1297 Ga0495611_0126706 3300046648 Bacteria 1191
1298 Ga0495611_0189376 3300046648 Bacteria 960
1299 Ga0495611_0192686 3300046648 Bacteria 951
1300 Ga0495625_0092654 3300046660 Bacteria 2087
1301 Ga0495625_0113996 3300046660 Bacteria 1845
1302 Ga0495625_0269318 3300046660 Bacteria 1099
1303 Ga0495625_0341693 3300046660 Bacteria 948
1304 Ga0495625_0388839 3300046660 Bacteria 874
1305 Ga0495625_0424653 3300046660 Bacteria 826
1306 Ga0495625_0490759 3300046660 Bacteria 752
1307 Ga0495625_0515509 3300046660 Bacteria 729
1308 Ga0495635_0001078 3300046663 Bacteria 18109
1309 Ga0495635_0017099 3300046663 Bacteria 5064
1310 Ga0495635_0117916 3300046663 Bacteria 1811
1311 Ga0495635_0202287 3300046663 Bacteria 1347
1312 Ga0495659_0105143 3300046664 Bacteria 1097
1313 Ga0495661_0123292 3300046665 Bacteria 1428
1314 Ga0495661_0144061 3300046665 Bacteria 1293
1315 Ga0495661_0162464 3300046665 Bacteria 1198
1316 Ga0495661_0364158 3300046665 Bacteria 709
1317 Ga0495588_0026393 3300046674 Bacteria 2899
1318 Ga0495588_0038023 3300046674 Bacteria 2447
1319 Ga0495588_0114332 3300046674 Bacteria 1422
1320 Ga0495588_0285347 3300046674 Bacteria 870
1321 Ga0495657_0003059 3300046675 Bacteria 13843
1322 Ga0495657_0003417 3300046675 Bacteria 12959
1323 Ga0495657_0016134 3300046675 Bacteria 5446
1324 Ga0495657_0183690 3300046675 Bacteria 1282
1325 Ga0495599_0001153 3300046678 Bacteria 14977
1326 Ga0495599_0025730 3300046678 Bacteria 3686
1327 Ga0495623_0006142 3300046679 Bacteria 7806
1328 Ga0495623_0079516 3300046679 Bacteria 2031
1329 Ga0495623_0262680 3300046679 Bacteria 967
1330 Ga0495646_0018667 3300046680 Bacteria 4392
1331 Ga0495658_0083725 3300046683 Bacteria 1877
1332 Ga0495658_0117411 3300046683 Bacteria 1606
1333 Ga0495669_0002088 3300046684 Bacteria 8182
1334 Ga0495669_0217001 3300046684 Bacteria 916
1335 Ga0495613_0028537 3300046689 Bacteria 4151
1336 Ga0495613_0052589 3300046689 Bacteria 2999
1337 Ga0495613_0129309 3300046689 Bacteria 1809
1338 Ga0495613_0180496 3300046689 Bacteria 1495
1339 Ga0495613_0327641 3300046689 Bacteria 1056
1340 Ga0495624_0341589 3300046690 Bacteria 901
1341 Ga0495670_0024498 3300046691 Bacteria 2983
1342 Ga0495670_0081835 3300046691 Bacteria 1645
1343 Ga0495670_0114546 3300046691 Bacteria 1397
1344 Ga0495670_0179353 3300046691 Bacteria 1118
1345 Ga0495670_0329290 3300046691 Bacteria 820
1346 Ga0495671_0096370 3300046692 Bacteria 1447
1347 Ga0495671_0131743 3300046692 Bacteria 1219
1348 Ga0495671_0229406 3300046692 Bacteria 898
1349 Ga0495671_0259392 3300046692 Bacteria 838
1350 Ga0495649_0027332 3300046694 Bacteria 3166
1351 Ga0495649_0290424 3300046694 Bacteria 834
1352 Ga0495649_0311070 3300046694 Bacteria 801
1353 Ga0495589_0418419 3300046794 Bacteria 614
1354 Ga0495600_0000311 3300046809 Bacteria 25806
1355 Ga0495600_0011575 3300046809 Bacteria 5502
1356 Ga0495600_0016340 3300046809 Bacteria 4708
1357 Ga0495600_0057358 3300046809 Bacteria 2543
1358 Ga0495581_0066536 3300047315 Bacteria 2084
1359 Ga0495581_0097553 3300047315 Bacteria 1707
1360 Ga0495581_0215543 3300047315 Bacteria 1122
1361 Ga0495581_0322802 3300047315 Bacteria 902
1362 Ga0495604_0004906 3300047317 Bacteria 10603
1363 Ga0495604_0019288 3300047317 Bacteria 5458
1364 Ga0495604_0036395 3300047317 Bacteria 3880
1365 Ga0495604_0268749 3300047317 Bacteria 1156
1366 Ga0495604_0412193 3300047317 Bacteria 888
1367 Ga0495636_0098990 3300047318 Bacteria 1273
1368 Ga0495636_0224769 3300047318 Bacteria 862
1369 Ga0495674_0024613 3300047319 Bacteria 5528
1370 Ga0495674_0053448 3300047319 Bacteria 3550
1371 Ga0495674_0058656 3300047319 Bacteria 3364
1372 Ga0495672_0131658 3300047320 Bacteria 1315
1373 Ga0495672_0173210 3300047320 Bacteria 1099
1374 Ga0495672_0294658 3300047320 Bacteria 770
1375 Ga0495672_0314370 3300047320 Bacteria 738
1376 Ga0495676_0058535 3300047321 Bacteria 3031
1377 Ga0495676_0402391 3300047321 Bacteria 908
1378 Ga0495680_0000689 3300047322 Bacteria 37846
1379 Ga0495680_0009513 3300047322 Bacteria 8734
1380 Ga0495680_0066584 3300047322 Bacteria 2756
1381 Ga0495683_0059851 3300047323 Bacteria 1889
1382 Ga0495683_0094838 3300047323 Bacteria 1441
1383 Ga0495683_0196534 3300047323 Bacteria 912
1384 Ga0495687_017157 3300047443 Bacteria 3621
1385 Ga0495675_0010733 3300047444 Bacteria 5735
1386 Ga0495675_0053308 3300047444 Bacteria 2567
1387 Ga0495675_0150248 3300047444 Bacteria 1439
1388 Ga0495677_0078565 3300047445 Bacteria 1235
1389 Ga0495677_0269795 3300047445 Bacteria 667
1390 Ga0495685_120666 3300047447 Bacteria 861
1391 Ga0495673_0052100 3300047469 Bacteria 1790
1392 Ga0495673_0084454 3300047469 Bacteria 1309
1393 Ga0495673_0175042 3300047469 Bacteria 816
1394 Ga0495673_0200433 3300047469 Bacteria 747
1395 Ga0495673_0258688 3300047469 Bacteria 634
1396 Ga0495681_0190175 3300047470 Bacteria 838
1397 Ga0495684_0004560 3300047471 Bacteria 10830
1398 Ga0495684_0012120 3300047471 Bacteria 6650
1399 Ga0495684_0118621 3300047471 Bacteria 1994
1400 Ga0495686_0040166 3300047472 Bacteria 2985
1401 Ga0495686_0131502 3300047472 Bacteria 1483
1402 Ga0495686_0180849 3300047472 Bacteria 1222
1403 Ga0495686_0257889 3300047472 Bacteria 977
1404 Ga0495686_0384584 3300047472 Bacteria 756
1405 Ga0495686_0535710 3300047472 Bacteria 613
1406 Ga0495593_0000693 3300047673 Bacteria 19452
1407 Ga0495593_0121544 3300047673 Bacteria 1329
1408 Ga0495602_0002384 3300048088 Bacteria 19072
1409 Ga0495602_0011209 3300048088 Bacteria 9270
1410 Ga0495602_0062647 3300048088 Bacteria 3226
1411 Ga0495602_0089225 3300048088 Bacteria 2564
1412 Ga0495602_0526658 3300048088 Bacteria 822
1413 Ga0495614_0020718 3300048089 Bacteria 2842
1414 Ga0495626_0108329 3300048091 Bacteria 1205
1415 Ga0495626_0175590 3300048091 Bacteria 891
1416 Ga0496100_0033360 3300048903 Bacteria 3221
1417 Ga0496100_0239878 3300048903 Bacteria 1337
1418 Ga0496100_0455513 3300048903 Bacteria 981
1419 Ga0496100_0753449 3300048903 Bacteria 762
1420 Ga0496101_0014265 3300048904 Bacteria 5339
1421 Ga0496101_0038219 3300048904 Bacteria 3408
1422 Ga0496101_0083304 3300048904 Bacteria 2367
1423 Ga0496101_0106001 3300048904 Bacteria 2110
1424 Ga0496101_0116131 3300048904 Bacteria 2019
1425 Ga0496101_0438988 3300048904 Bacteria 1030
1426 Ga0496101_0517756 3300048904 Bacteria 943
1427 Ga0496101_0571409 3300048904 Bacteria 894
1428 Ga0496101_0638789 3300048904 Bacteria 841
1429 Ga0496102_0010497 3300048905 Bacteria 7974
1430 Ga0496102_0020716 3300048905 Bacteria 5810
1431 Ga0496102_0033921 3300048905 Bacteria 4589
1432 Ga0496102_0166215 3300048905 Bacteria 2076
1433 Ga0496102_0235023 3300048905 Bacteria 1728
1434 Ga0496102_0302510 3300048905 Bacteria 1507
1435 Ga0496102_0368024 3300048905 Bacteria 1353
1436 Ga0496102_0511267 3300048905 Bacteria 1123
1437 Ga0496102_0611396 3300048905 Bacteria 1013
1438 Ga0496102_0732838 3300048905 Bacteria 911
1439 Ga0496103_0029053 3300048906 Bacteria 3359
1440 Ga0496103_0117571 3300048906 Bacteria 1692
1441 Ga0496103_0279938 3300048906 Bacteria 1073
1442 Ga0496103_0342619 3300048906 Bacteria 961
1443 Ga0496103_0499424 3300048906 Bacteria 778
1444 Ga0496103_0641443 3300048906 Bacteria 675
1445 Ga0496103_0653120 3300048906 Bacteria 668
1446 Ga0496104_0007292 3300048907 Bacteria 9757
1447 Ga0496104_0009776 3300048907 Bacteria 8553
1448 Ga0496104_0044346 3300048907 Bacteria 4178
1449 Ga0496104_0122826 3300048907 Bacteria 2493
1450 Ga0496104_0258984 3300048907 Bacteria 1652
1451 Ga0496104_0332438 3300048907 Bacteria 1432
1452 Ga0496104_0395785 3300048907 Bacteria 1294
1453 Ga0496104_0441257 3300048907 Bacteria 1214
1454 Ga0496104_0466279 3300048907 Bacteria 1174
1455 Ga0496105_0028180 3300048908 Bacteria 4593
1456 Ga0496105_0037811 3300048908 Bacteria 3975
1457 Ga0496105_0056596 3300048908 Bacteria 3236
1458 Ga0496105_0120147 3300048908 Bacteria 2167
1459 Ga0496105_0183732 3300048908 Bacteria 1711
1460 Ga0496105_0196572 3300048908 Bacteria 1647
1461 Ga0496105_0252815 3300048908 Bacteria 1427
1462 Ga0496105_0286028 3300048908 Bacteria 1328
1463 Ga0496105_0611367 3300048908 Bacteria 845
1464 Ga0496106_0001014 3300048909 Bacteria 20581
1465 Ga0496106_0001270 3300048909 Bacteria 18908
1466 Ga0496106_0003850 3300048909 Bacteria 11185
1467 Ga0496106_0005534 3300048909 Bacteria 9348
1468 Ga0496106_0075442 3300048909 Bacteria 2583
1469 Ga0496106_0127613 3300048909 Bacteria 1993
1470 Ga0496106_0173412 3300048909 Bacteria 1710
1471 Ga0496106_0191001 3300048909 Bacteria 1628
1472 Ga0496106_0252011 3300048909 Bacteria 1411
1473 Ga0496106_0359706 3300048909 Bacteria 1169
1474 Ga0496106_0579158 3300048909 Bacteria 900
1475 Ga0496106_0581385 3300048909 Bacteria 898
1476 Ga0496106_0754510 3300048909 Bacteria 773
1477 Ga0496107_0001220 3300048910 Bacteria 15676
1478 Ga0496107_0014694 3300048910 Bacteria 5481
1479 Ga0496107_0285561 3300048910 Bacteria 1228
1480 Ga0496107_0303850 3300048910 Bacteria 1188
1481 Ga0496107_0318828 3300048910 Bacteria 1157
1482 Ga0496108_0000274 3300048911 Bacteria 44298
1483 Ga0496108_0007620 3300048911 Bacteria 8767
1484 Ga0496108_0034651 3300048911 Bacteria 4194
1485 Ga0496108_0069200 3300048911 Bacteria 2978
1486 Ga0496108_0087899 3300048911 Bacteria 2640
1487 Ga0496108_0095587 3300048911 Bacteria 2530
1488 Ga0496108_0271954 3300048911 Bacteria 1475
1489 Ga0496108_0381699 3300048911 Bacteria 1230
1490 Ga0496108_0550646 3300048911 Bacteria 1006
1491 Ga0496108_0846867 3300048911 Bacteria 787
1492 Ga0496109_0000224 3300048912 Bacteria 55854
1493 Ga0496109_0010061 3300048912 Bacteria 8071
1494 Ga0496109_0075762 3300048912 Bacteria 3093
1495 Ga0496109_0210642 3300048912 Bacteria 1828
1496 Ga0496109_0241153 3300048912 Bacteria 1701
1497 Ga0496109_0250923 3300048912 Bacteria 1666
1498 Ga0496109_0292625 3300048912 Bacteria 1535
1499 Ga0496109_0968843 3300048912 Bacteria 788
1500 Ga0496110_0030873 3300048913 Bacteria 4621
1501 Ga0496110_0038340 3300048913 Bacteria 4169
1502 Ga0496110_0074835 3300048913 Bacteria 3008
1503 Ga0496110_0118470 3300048913 Bacteria 2384
1504 Ga0496110_0142659 3300048913 Bacteria 2166
1505 Ga0496110_0142953 3300048913 Bacteria 2163
1506 Ga0496110_0217060 3300048913 Bacteria 1739
1507 Ga0496110_0502821 3300048913 Bacteria 1103
1508 Ga0496110_0859809 3300048913 Bacteria 812
1509 Ga0496110_1296981 3300048913 Bacteria 637
1510 Ga0496111_0174942 3300048914 Bacteria 1595
1511 Ga0496111_0216338 3300048914 Bacteria 1423
1512 Ga0496111_0252290 3300048914 Bacteria 1309
1513 Ga0496111_0259287 3300048914 Bacteria 1290
1514 Ga0496111_0261469 3300048914 Bacteria 1284
1515 Ga0496111_0351990 3300048914 Bacteria 1090
1516 Ga0496112_0000020 3300048915 Bacteria 169373
1517 Ga0496112_0005625 3300048915 Bacteria 10873
1518 Ga0496112_0014598 3300048915 Bacteria 7298
1519 Ga0496112_0017956 3300048915 Bacteria 6657
1520 Ga0496112_0031512 3300048915 Bacteria 5144
1521 Ga0496112_0031708 3300048915 Bacteria 5126
1522 Ga0496112_0216568 3300048915 Bacteria 1871
1523 Ga0496112_0246227 3300048915 Bacteria 1739
1524 Ga0496112_0252452 3300048915 Bacteria 1714
1525 Ga0496112_0253603 3300048915 Bacteria 1710
1526 Ga0496112_0336520 3300048915 Bacteria 1453
1527 Ga0496112_0704422 3300048915 Bacteria 937
1528 Ga0496112_1516013 3300048915 Bacteria 584
1529 Ga0496113_0034060 3300048916 Bacteria 3713
1530 Ga0496113_0039510 3300048916 Bacteria 3473
1531 Ga0496113_0046666 3300048916 Bacteria 3216
1532 Ga0496113_0117286 3300048916 Bacteria 2078
1533 Ga0496113_0152956 3300048916 Bacteria 1821
1534 Ga0496113_0231157 3300048916 Bacteria 1474
1535 Ga0496114_0008301 3300048917 Bacteria 8230
1536 Ga0496114_0293562 3300048917 Bacteria 1435
1537 Ga0496114_0367140 3300048917 Bacteria 1274
1538 Ga0496114_0442386 3300048917 Bacteria 1151
1539 Ga0496114_0460044 3300048917 Bacteria 1126
1540 Ga0496114_0514646 3300048917 Bacteria 1058
1541 Ga0496114_0696454 3300048917 Bacteria 891
1542 Ga0496114_0878248 3300048917 Bacteria 777
1543 Ga0496115_0010108 3300048918 Bacteria 7039
1544 Ga0496115_0020999 3300048918 Bacteria 5039
1545 Ga0496115_0043792 3300048918 Bacteria 3569
1546 Ga0496115_0325862 3300048918 Bacteria 1256
1547 Ga0496115_0493760 3300048918 Bacteria 984
1548 Ga0496115_0538341 3300048918 Bacteria 935
1549 Ga0496115_0792493 3300048918 Bacteria 738
1550 Ga0496115_0943387 3300048918 Bacteria 663
1551 Ga0496116_0007249 3300048919 Bacteria 9883
1552 Ga0496116_0029926 3300048919 Bacteria 3918
1553 Ga0496116_0078091 3300048919 Bacteria 2066
1554 Ga0496117_0034639 3300048920 Bacteria 3802
1555 Ga0496117_0073766 3300048920 Bacteria 2275
1556 Ga0496117_0090625 3300048920 Bacteria 1969
1557 Ga0496117_0282825 3300048920 Bacteria 887
1558 Ga0496117_0351439 3300048920 Bacteria 761
1559 Ga0496117_0404529 3300048920 Bacteria 688
1560 Ga0496118_0006290 3300048921 Bacteria 13129
1561 Ga0496118_0030372 3300048921 Bacteria 4511
1562 Ga0496118_0121882 3300048921 Bacteria 1697
1563 Ga0496118_0180939 3300048921 Bacteria 1274
1564 Ga0496118_0187163 3300048921 Bacteria 1243
1565 Ga0496118_0304140 3300048921 Bacteria 874
1566 Ga0496118_0375945 3300048921 Bacteria 747
1567 Ga0496119_0020471 3300048922 Bacteria 4828
1568 Ga0496119_0026661 3300048922 Bacteria 3998
1569 Ga0496119_0062834 3300048922 Bacteria 2211
1570 Ga0496119_0069187 3300048922 Bacteria 2075
1571 Ga0496119_0082239 3300048922 Bacteria 1852
1572 Ga0496119_0236807 3300048922 Bacteria 926
1573 Ga0496119_0391187 3300048922 Bacteria 665
1574 Ga0496119_0447255 3300048922 Bacteria 609
1575 Ga0496120_0196634 3300048923 Bacteria 979
1576 Ga0496120_0308520 3300048923 Bacteria 722
1577 Ga0496121_0000370 3300048924 Bacteria 92397
1578 Ga0496121_0024961 3300048924 Bacteria 5693
1579 Ga0496121_0028285 3300048924 Bacteria 5222
1580 Ga0496121_0042453 3300048924 Bacteria 3955
1581 Ga0496121_0058838 3300048924 Bacteria 3173
1582 Ga0496121_0065236 3300048924 Bacteria 2964
1583 Ga0496121_0068084 3300048924 Bacteria 2882
1584 Ga0496121_0076636 3300048924 Bacteria 2666
1585 Ga0496121_0093579 3300048924 Bacteria 2339
1586 Ga0496121_0107510 3300048924 Bacteria 2136
1587 Ga0496121_0136863 3300048924 Bacteria 1823
1588 Ga0496121_0180268 3300048924 Bacteria 1525
1589 Ga0496121_0227101 3300048924 Bacteria 1310
1590 Ga0496121_0258582 3300048924 Bacteria 1203
1591 Ga0496121_0298904 3300048924 Bacteria 1093
1592 Ga0496121_0312197 3300048924 Bacteria 1062
1593 Ga0496121_0355836 3300048924 Bacteria 974
1594 Ga0496121_0402405 3300048924 Bacteria 896
1595 Ga0496121_0520073 3300048924 Bacteria 751
1596 Ga0496122_0144491 3300048925 Bacteria 1481
1597 Ga0496123_0155390 3300048926 Bacteria 1227
1598 Ga0496124_0000235 3300048927 Bacteria 107983
1599 Ga0496124_0025032 3300048927 Bacteria 5412
1600 Ga0496124_0052562 3300048927 Bacteria 3460
1601 Ga0496124_0059769 3300048927 Bacteria 3200
1602 Ga0496124_0208349 3300048927 Bacteria 1481
1603 Ga0496124_0253730 3300048927 Bacteria 1299
1604 Ga0496124_0457135 3300048927 Bacteria 869
1605 Ga0496125_0013776 3300048928 Bacteria 7922
1606 Ga0496125_0028321 3300048928 Bacteria 5063
1607 Ga0496125_0036451 3300048928 Bacteria 4294
1608 Ga0496125_0042674 3300048928 Bacteria 3860
1609 Ga0496125_0043278 3300048928 Bacteria 3825
1610 Ga0496125_0124877 3300048928 Bacteria 1826
1611 Ga0496125_0190556 3300048928 Bacteria 1354
1612 Ga0496125_0237423 3300048928 Bacteria 1160
1613 Ga0496126_0002460 3300048929 Bacteria 24974
1614 Ga0496126_0002944 3300048929 Bacteria 22128
1615 Ga0496126_0005304 3300048929 Bacteria 14797
1616 Ga0496126_0017043 3300048929 Bacteria 7248
1617 Ga0496126_0032373 3300048929 Bacteria 4927
1618 Ga0496126_0033707 3300048929 Bacteria 4816
1619 Ga0496126_0069744 3300048929 Bacteria 3134
1620 Ga0496126_0090215 3300048929 Bacteria 2697
1621 Ga0496126_0144445 3300048929 Bacteria 2045
1622 Ga0496126_0154552 3300048929 Bacteria 1964
1623 Ga0496126_0161406 3300048929 Bacteria 1915
1624 Ga0496126_0210242 3300048929 Bacteria 1638
1625 Ga0496126_0279164 3300048929 Bacteria 1384
1626 Ga0496126_0412755 3300048929 Bacteria 1093
1627 Ga0496126_0475885 3300048929 Bacteria 1001
1628 Ga0496126_0484532 3300048929 Bacteria 990
1629 Ga0496126_0602663 3300048929 Bacteria 865
1630 Ga0496126_0615969 3300048929 Bacteria 853
1631 Ga0496126_0621897 3300048929 Bacteria 848
1632 Ga0496126_0654606 3300048929 Bacteria 821
1633 Ga0495678_029690 3300049459 Bacteria 2294
1634 Ga0495678_035346 3300049459 Bacteria 2049
1635 Ga0495682_0041406 3300049460 Bacteria 1688
1636 Ga0501031_0032907 3300049568 Bacteria 3380
1637 Ga0501031_0042532 3300049568 Bacteria 2965
1638 Ga0501031_0108497 3300049568 Bacteria 1812
1639 Ga0501031_0161913 3300049568 Bacteria 1462
1640 Ga0501032_0005395 3300049569 Bacteria 9512
1641 Ga0501032_0038673 3300049569 Bacteria 3247
1642 Ga0501032_0064218 3300049569 Bacteria 2457
1643 Ga0501032_0091454 3300049569 Bacteria 2018
1644 Ga0501032_0178794 3300049569 Bacteria 1389
1645 Ga0501032_0186078 3300049569 Bacteria 1358
1646 Ga0501032_0413819 3300049569 Bacteria 865
1647 Ga0501033_0000440 3300049570 Bacteria 39822
1648 Ga0501033_0132462 3300049570 Bacteria 1805
1649 Ga0501033_0210893 3300049570 Bacteria 1385
1650 Ga0501033_0354094 3300049570 Bacteria 1028
1651 Ga0501033_0400322 3300049570 Bacteria 957
1652 Ga0501033_1079464 3300049570 Bacteria 534
1653 Ga0501034_0300395 3300049571 Bacteria 1542
1654 Ga0501034_0358129 3300049571 Bacteria 1386
1655 Ga0501034_0363582 3300049571 Bacteria 1374
1656 Ga0501034_0876265 3300049571 Bacteria 787
1657 Ga0501034_1072578 3300049571 Bacteria 687
1658 Ga0501036_0141200 3300049572 Bacteria 2032
1659 Ga0501036_0177892 3300049572 Bacteria 1791
1660 Ga0501036_0212007 3300049572 Bacteria 1627
1661 Ga0501036_1046879 3300049572 Bacteria 667
1662 Ga0501036_1234787 3300049572 Bacteria 608
1663 Ga0501037_0005763 3300049573 Bacteria 9042
1664 Ga0501037_0048807 3300049573 Bacteria 3100
1665 Ga0501037_0060667 3300049573 Bacteria 2758
1666 Ga0501037_0120874 3300049573 Bacteria 1883
1667 Ga0501037_0174733 3300049573 Bacteria 1525
1668 Ga0501037_0413056 3300049573 Bacteria 924
1669 Ga0501038_0005534 3300049574 Bacteria 11731
1670 Ga0501038_0008403 3300049574 Bacteria 9494
1671 Ga0501038_0107385 3300049574 Bacteria 2315
1672 Ga0501038_0155734 3300049574 Bacteria 1860
1673 Ga0501038_0160580 3300049574 Bacteria 1826
1674 Ga0501038_0177173 3300049574 Bacteria 1722
1675 Ga0501038_0895133 3300049574 Bacteria 655
1676 Ga0501039_0011559 3300049575 Bacteria 6720
1677 Ga0501039_0018071 3300049575 Bacteria 5410
1678 Ga0501039_0082161 3300049575 Bacteria 2508
1679 Ga0501039_0085706 3300049575 Bacteria 2453
1680 Ga0501039_0236743 3300049575 Bacteria 1435
1681 Ga0501039_0760831 3300049575 Bacteria 756
1682 Ga0501040_0015092 3300049576 Bacteria 5104
1683 Ga0501040_0248048 3300049576 Bacteria 1270
1684 Ga0501041_0122155 3300049577 Bacteria 1619
1685 Ga0501041_0427838 3300049577 Bacteria 840
1686 Ga0501042_0003037 3300049578 Bacteria 10439
1687 Ga0501042_0296283 3300049578 Bacteria 1168
1688 Ga0501043_0001889 3300049579 Bacteria 17947
1689 Ga0501043_0188141 3300049579 Bacteria 1606
1690 Ga0501043_0319198 3300049579 Bacteria 1184
1691 Ga0501046_0029784 3300049580 Bacteria 4436
1692 Ga0501046_0082303 3300049580 Bacteria 2486
1693 Ga0501046_0193573 3300049580 Bacteria 1516
1694 Ga0501046_0403963 3300049580 Bacteria 986
1695 Ga0501046_0914542 3300049580 Bacteria 611
1696 Ga0501047_0026637 3300049581 Bacteria 5564
1697 Ga0501047_0059149 3300049581 Bacteria 3700
1698 Ga0501047_0066691 3300049581 Bacteria 3469
1699 Ga0501047_0227997 3300049581 Bacteria 1717
1700 Ga0501047_0364924 3300049581 Bacteria 1279
1701 Ga0501047_0570451 3300049581 Bacteria 955
1702 Ga0501047_0677732 3300049581 Bacteria 849
1703 Ga0501048_0043652 3300049582 Bacteria 3208
1704 Ga0501048_0190260 3300049582 Bacteria 1454
1705 Ga0501067_0104427 3300049583 Bacteria 1574
1706 Ga0501067_0196420 3300049583 Bacteria 1124
1707 Ga0501067_0235215 3300049583 Bacteria 1019
1708 Ga0501068_0108762 3300049584 Bacteria 1722
1709 Ga0501069_0509192 3300049585 Bacteria 718
1710 Ga0501070_0003250 3300049586 Bacteria 14106
1711 Ga0501070_0055900 3300049586 Bacteria 3272
1712 Ga0501070_0334531 3300049586 Bacteria 1230
1713 Ga0501070_0355147 3300049586 Bacteria 1189
1714 Ga0501071_0303975 3300049587 Bacteria 1209
1715 Ga0501071_0623983 3300049587 Bacteria 829
1716 Ga0501072_0004304 3300049588 Bacteria 10811
1717 Ga0501072_0628973 3300049588 Bacteria 845
1718 Ga0501073_0056321 3300049589 Bacteria 2750
1719 Ga0501073_0101485 3300049589 Bacteria 1998
1720 Ga0501073_0151453 3300049589 Bacteria 1608
1721 Ga0501073_1132787 3300049589 Bacteria 537
1722 Ga0501074_0051339 3300049590 Bacteria 2976
1723 Ga0501074_0687062 3300049590 Bacteria 722
1724 Ga0501076_0427868 3300049592 Bacteria 1089
1725 Ga0501076_0699486 3300049592 Bacteria 837
1726 Ga0501077_0196081 3300049593 Bacteria 1283
1727 Ga0501079_0165997 3300049741 Bacteria 1722
1728 Ga0501080_0002360 3300049742 Bacteria 16457
1729 Ga0501080_0120561 3300049742 Bacteria 2431
1730 Ga0501080_0172975 3300049742 Bacteria 1991
1731 Ga0501081_0232492 3300049743 Bacteria 1343
1732 Ga0501081_0270328 3300049743 Bacteria 1243
1733 Ga0501083_0026884 3300049744 Bacteria 3975
1734 Ga0501035_0006394 3300049822 Bacteria 11080
1735 Ga0501035_0065941 3300049822 Bacteria 3213
1736 Ga0501035_0073148 3300049822 Bacteria 3032
1737 Ga0501035_0097341 3300049822 Bacteria 2584
1738 Ga0501035_0212974 3300049822 Bacteria 1652
1739 Ga0501035_0303199 3300049822 Bacteria 1345
1740 Ga0501044_0006535 3300049823 Bacteria 12874
1741 Ga0501044_0014838 3300049823 Bacteria 8397
1742 Ga0501044_0028057 3300049823 Bacteria 5941
1743 Ga0501044_0066600 3300049823 Bacteria 3671
1744 Ga0501044_0147528 3300049823 Bacteria 2336
1745 Ga0501044_0211406 3300049823 Bacteria 1894
1746 Ga0501044_0318468 3300049823 Bacteria 1480
1747 Ga0501044_0487211 3300049823 Bacteria 1135
1748 Ga0501045_0057890 3300049824 Bacteria 2836
1749 nmdc:mga03683_125120_c1 3300050489 Bacteria 1146
1750 nmdc:mga03683_283762_c1 3300050489 Bacteria 774
1751 nmdc:mga03683_437047_c1 3300050489 Bacteria 628
1752 nmdc:mga03n38_113787_c1 3300050490 Bacteria 1321
1753 nmdc:mga03n38_143511_c1 3300050490 Bacteria 1195
1754 nmdc:mga03n38_233680_c1 3300050490 Bacteria 965
1755 nmdc:mga03n38_320042_c1 3300050490 Bacteria 837
1756 nmdc:mga03n38_351584_c1 3300050490 Bacteria 802
1757 nmdc:mga03n38_46519_c1 3300050490 Bacteria 1916
1758 nmdc:mga00v17_214511_c1 3300050491 Bacteria 1246
1759 nmdc:mga00v17_304707_c1 3300050491 Bacteria 1035
1760 nmdc:mga00v17_358675_c1 3300050491 Bacteria 948
1761 nmdc:mga00v17_4967_c1 3300050491 Bacteria 6975
1762 nmdc:mga00v17_508325_c1 3300050491 Bacteria 781
1763 nmdc:mga0yw44_155348_c1 3300050492 Bacteria 1495
1764 nmdc:mga0yw44_166632_c1 3300050492 Bacteria 1445
1765 nmdc:mga0yw44_188794_c1 3300050492 Bacteria 1359
1766 nmdc:mga0yw44_19569_c1 3300050492 Bacteria 3736
1767 nmdc:mga0yw44_2162_c1 3300050492 Bacteria 8251
1768 nmdc:mga0yw44_234692_c1 3300050492 Bacteria 1218
1769 nmdc:mga0yw44_317040_c1 3300050492 Bacteria 1046
1770 nmdc:mga0yw44_5000_c1 3300050492 Bacteria 6192
1771 nmdc:mga0yw44_780273_c1 3300050492 Bacteria 649
1772 nmdc:mga0yw44_864411_c1 3300050492 Bacteria 614
1773 nmdc:mga0k408_226700_c1 3300050493 Bacteria 1116
1774 nmdc:mga0k408_233565_c1 3300050493 Bacteria 1098
1775 nmdc:mga0k408_384913_c1 3300050493 Bacteria 835
1776 nmdc:mga0k408_417991_c1 3300050493 Bacteria 797
1777 nmdc:mga0k408_501322_c1 3300050493 Bacteria 719
1778 nmdc:mga0k408_58657_c1 3300050493 Bacteria 2236
1779 nmdc:mga06z11_11930_c1 3300050494 Bacteria 3764
1780 nmdc:mga06z11_121704_c1 3300050494 Bacteria 1456
1781 nmdc:mga06z11_138926_c1 3300050494 Bacteria 1372
1782 nmdc:mga06z11_164154_c1 3300050494 Bacteria 1271
1783 nmdc:mga06z11_237294_c1 3300050494 Bacteria 1070
1784 nmdc:mga06z11_253597_c1 3300050494 Bacteria 1037
1785 nmdc:mga06z11_3651_c1 3300050494 Bacteria 5971
1786 nmdc:mga06z11_429730_c1 3300050494 Bacteria 797
1787 nmdc:mga04h51_12847_c1 3300050495 Bacteria 2359
1788 nmdc:mga04h51_3991_c1 3300050495 Bacteria 3633
1789 nmdc:mga04h51_73214_c1 3300050495 Bacteria 1201
1790 nmdc:mga07m45_103422_c1 3300050496 Bacteria 1637
1791 nmdc:mga07m45_134590_c1 3300050496 Bacteria 1430
1792 nmdc:mga07m45_77268_c1 3300050496 Bacteria 1899
1793 nmdc:mga05p37_1079892_c1 3300050507 Bacteria 843
1794 nmdc:mga05p37_802584_c1 3300050507 Bacteria 1029
1795 nmdc:mga0qj67_979897_c1 3300050509 Bacteria 664
1796 nmdc:mga08y16_102080_c1 3300050511 Bacteria 2986
1797 nmdc:mga08y16_1349643_c1 3300050511 Bacteria 678
1798 nmdc:mga08y16_576622_c1 3300050511 Bacteria 1136
1799 nmdc:mga0n895_24914_c1 3300050512 Bacteria 5645
1800 nmdc:mga0n895_638644_c1 3300050512 Bacteria 1064
1801 nmdc:mga0rr50_58710_c1 3300050513 Bacteria 2884
1802 nmdc:mga0rr50_820519_c1 3300050513 Bacteria 793
1803 nmdc:mga0a205_127781_c1 3300050515 Bacteria 2441
1804 nmdc:mga0sz30_132755_c1 3300050516 Bacteria 1098
1805 nmdc:mga0sz30_167154_c1 3300050516 Bacteria 975
1806 nmdc:mga0sz30_325567_c1 3300050516 Bacteria 686
1807 Ga0495601_0013100 3300053077 Bacteria 4984
1808 Ga0495601_0171771 3300053077 Bacteria 1417
1809 Ga0495612_0023113 3300053078 Bacteria 2493
1810 Ga0495612_0128759 3300053078 Bacteria 1093
1811 Ga0495612_0319175 3300053078 Bacteria 698
1812 Ga0500610_0281487 3300053079 Bacteria 746
1813 Ga0500635_0027474 3300053080 Bacteria 1809
1814 Ga0500635_0034382 3300053080 Bacteria 1660
1815 Ga0495655_0014635 3300053083 Bacteria 1649
1816 Ga0495655_0041351 3300053083 Bacteria 1178
1817 Ga0495655_0311134 3300053083 Bacteria 543
1818 Ga0495595_0003604 3300053084 Bacteria 6151
1819 Ga0495595_0030242 3300053084 Bacteria 2428
1820 Ga0495595_0139254 3300053084 Bacteria 1190
1821 Ga0495595_0208992 3300053084 Bacteria 972
1822 Ga0495595_0400186 3300053084 Bacteria 696
1823 Ga0495619_0000330 3300053085 Bacteria 33168
1824 Ga0495619_0139183 3300053085 Bacteria 1670
1825 Ga0495619_0210428 3300053085 Bacteria 1347
1826 Ga0495619_0329753 3300053085 Bacteria 1056
1827 Ga0500578_0060510 3300053086 Bacteria 2419
1828 Ga0500578_0297883 3300053086 Bacteria 957
1829 Ga0500643_000063 3300053087 Bacteria 122135
1830 Ga0500643_033044 3300053087 Bacteria 1566
1831 Ga0500644_0029965 3300053088 Bacteria 1717
1832 Ga0500644_0146757 3300053088 Bacteria 942
1833 Ga0500581_068110 3300053089 Bacteria 1794
1834 Ga0500646_0196850 3300053090 Bacteria 689
1835 Ga0500647_0011835 3300053091 Bacteria 3911
1836 Ga0500647_0214665 3300053091 Bacteria 865
1837 Ga0500583_0056163 3300053092 Bacteria 1844
1838 Ga0500651_0053527 3300053093 Bacteria 2531
1839 Ga0500651_0208230 3300053093 Bacteria 1151
1840 Ga0500566_0000151 3300053094 Bacteria 35674
1841 Ga0500566_0000236 3300053094 Bacteria 29461
1842 Ga0500566_0000632 3300053094 Bacteria 19665
1843 Ga0500566_0146689 3300053094 Bacteria 1246
1844 Ga0500566_0219992 3300053094 Bacteria 944
1845 Ga0500640_033763 3300053095 Bacteria 2245
1846 Ga0500641_0007070 3300053096 Bacteria 3996
1847 Ga0500641_0008155 3300053096 Bacteria 3733
1848 Ga0500641_0082546 3300053096 Bacteria 1365
1849 Ga0500650_0163517 3300053098 Bacteria 1026
1850 Ga0500650_0267727 3300053098 Bacteria 762
1851 Ga0500554_130359 3300053102 Bacteria 849
1852 Ga0500555_012245 3300053103 Bacteria 2467
1853 Ga0500556_0000006 3300053104 Bacteria 453982
1854 Ga0500556_0057918 3300053104 Bacteria 1420
1855 Ga0500557_000037 3300053105 Bacteria 71114
1856 Ga0500562_006897 3300053108 Bacteria 2866
1857 Ga0500562_062169 3300053108 Bacteria 1003
1858 Ga0500569_008075 3300053109 Bacteria 2393
1859 Ga0500572_009069 3300053111 Bacteria 2341
1860 Ga0500572_188305 3300053111 Bacteria 676
1861 Ga0500582_066260 3300053114 Bacteria 1220
1862 Ga0500591_036543 3300053115 Bacteria 2356
1863 Ga0500592_002364 3300053116 Bacteria 3038
1864 Ga0500594_0052591 3300053118 Bacteria 1151
1865 Ga0500594_0083786 3300053118 Bacteria 958
1866 Ga0500595_000265 3300053119 Bacteria 34660
1867 Ga0500595_022450 3300053119 Bacteria 2234
1868 Ga0500595_040303 3300053119 Bacteria 1507
1869 Ga0500607_019113 3300053121 Bacteria 3882
1870 Ga0500608_000257 3300053122 Bacteria 20734
1871 Ga0500608_044642 3300053122 Bacteria 2128
1872 Ga0500614_024140 3300053123 Bacteria 1434
1873 Ga0500621_145430 3300053126 Bacteria 895
1874 Ga0500628_140142 3300053129 Bacteria 670
1875 Ga0500628_173450 3300053129 Bacteria 613
1876 Ga0500642_0000004 3300053130 Bacteria 433122
1877 Ga0500642_0000062 3300053130 Bacteria 58970
1878 Ga0500642_0062887 3300053130 Bacteria 1671
1879 Ga0500642_0353469 3300053130 Bacteria 651
1880 Ga0500652_165966 3300053131 Bacteria 910
1881 Ga0500658_0090768 3300053134 Bacteria 1320
1882 Ga0500658_0123928 3300053134 Bacteria 1148
1883 Ga0500559_0000426 3300053136 Bacteria 29970
1884 Ga0500559_0018563 3300053136 Bacteria 2938
1885 Ga0500559_0192363 3300053136 Bacteria 961
1886 Ga0500559_0231239 3300053136 Bacteria 871
1887 Ga0500561_0051259 3300053137 Bacteria 1127
1888 Ga0500568_0002340 3300053139 Bacteria 11226
1889 Ga0500568_0080709 3300053139 Bacteria 1235
1890 Ga0500568_0082120 3300053139 Bacteria 1222
1891 Ga0500577_0010120 3300053142 Bacteria 2763
1892 Ga0500577_0196561 3300053142 Bacteria 869
1893 Ga0500579_123963 3300053143 Bacteria 1239
1894 Ga0500586_000605 3300053145 Bacteria 7286
1895 Ga0500588_0130310 3300053146 Bacteria 895
1896 Ga0500589_073187 3300053147 Bacteria 1546
1897 Ga0500589_170211 3300053147 Bacteria 866
1898 Ga0500590_038219 3300053148 Bacteria 2478
1899 Ga0500590_082854 3300053148 Bacteria 1572
1900 Ga0500603_017925 3300053150 Bacteria 1698
1901 Ga0500603_083730 3300053150 Bacteria 927
1902 Ga0500603_110470 3300053150 Bacteria 825
1903 Ga0500604_0009715 3300053151 Bacteria 2563
1904 Ga0500604_0029649 3300053151 Bacteria 1596
1905 Ga0500604_0076519 3300053151 Bacteria 1075
1906 Ga0500604_0107062 3300053151 Bacteria 926
1907 Ga0500616_0000022 3300053153 Bacteria 460463
1908 Ga0500619_008165 3300053154 Bacteria 2526
1909 Ga0500619_030563 3300053154 Bacteria 1637
1910 Ga0500619_031036 3300053154 Bacteria 1628
1911 Ga0500620_000467 3300053155 Bacteria 7193
1912 Ga0500622_0026344 3300053156 Bacteria 3070
1913 Ga0500622_0088090 3300053156 Bacteria 1544
1914 Ga0500622_0106978 3300053156 Bacteria 1371
1915 Ga0500630_022191 3300053159 Bacteria 3135
1916 Ga0500633_0034975 3300053160 Bacteria 1651
1917 Ga0500633_0106711 3300053160 Bacteria 1035
1918 Ga0500633_0205202 3300053160 Bacteria 737
1919 Ga0500634_0137807 3300053161 Bacteria 1160
1920 Ga0500638_000059 3300053162 Bacteria 20593
1921 Ga0500638_013587 3300053162 Bacteria 3689
1922 Ga0500638_204366 3300053162 Bacteria 833
1923 Ga0500638_219832 3300053162 Bacteria 789
1924 Ga0500639_024457 3300053163 Bacteria 3192
1925 Ga0500636_0008608 3300053177 Bacteria 5909
1926 Ga0500636_0009392 3300053177 Bacteria 5682
1927 Ga0500636_0029516 3300053177 Bacteria 3240
1928 Ga0500636_0052209 3300053177 Bacteria 2401
1929 Ga0500637_0002081 3300053178 Bacteria 8764
1930 Ga0500637_0076958 3300053178 Bacteria 1924
1931 Ga0500637_0286355 3300053178 Bacteria 904
1932 Ga0500649_114677 3300053722 Bacteria 1038
1933 Ga0500576_067898 3300053725 Bacteria 1540
1934 Ga0500611_011777 3300053727 Bacteria 1457
1935 Ga0500611_052184 3300053727 Bacteria 941
1936 Ga0500611_083151 3300053727 Bacteria 802
1937 Ga0500645_042081 3300053730 Bacteria 1348
1938 Ga0500645_083376 3300053730 Bacteria 911
1939 Ga0500645_164016 3300053730 Bacteria 608
1940 Ga0500552_006534 3300053733 Bacteria 1313
1941 Ga0500596_002026 3300053735 Bacteria 4050
1942 Ga0500596_004661 3300053735 Bacteria 2496
1943 Ga0500596_058718 3300053735 Bacteria 640
1944 Ga0500599_001321 3300053736 Bacteria 2836
1945 Ga0500601_000544 3300053737 Bacteria 5588
1946 Ga0500601_002697 3300053737 Bacteria 1909
1947 Ga0500661_000282 3300055283 Bacteria 9220
1948 Ga0501082_0569599 3300060353 Bacteria 991
1949 Ga0466962_0143390 3300061719 Bacteria 1157

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053145 Ga0500586_000605 Ga0500586_000605_4995_5525 147
2 iso_pu_bacteria 2893066018 2893067358 147
3 3300050492 nmdc:mga0yw44_5000_c1 nmdc:mga0yw44_5000_c1_1539_1997 148
4 3300031241 Ga0265325_10000229 Ga0265325_1000022913 149
5 3300049580 Ga0501046_0914542 Ga0501046_0914542_142_597 151
6 3300005434 Ga0070709_10374635 Ga0070709_103746352 152
7 3300005577 Ga0068857_100579844 Ga0068857_1005798442 152
8 3300005614 Ga0068856_100483113 Ga0068856_1004831132 152
9 3300009551 Ga0105238_10108677 Ga0105238_101086773 152
10 3300025906 Ga0207699_10090067 Ga0207699_100900672 152
11 3300025914 Ga0207671_10065615 Ga0207671_100656155 152
12 3300025924 Ga0207694_10082295 Ga0207694_100822953 152
13 3300026078 Ga0207702_10954071 Ga0207702_109540712 152
14 3300026116 Ga0207674_10065909 Ga0207674_100659093 152
15 3300031889 Ga0326468_10025449 Ga0326468_100254491 152
16 3300037853 Ga0436364_0900659 Ga0436364_0900659_63_554 152
17 3300039437 Ga0436365_1127077 Ga0436365_1127077_473_964 152
18 3300048924 Ga0496121_0068084 Ga0496121_0068084_1955_2491 152
19 3300048929 Ga0496126_0017043 Ga0496126_0017043_4641_5177 152
20 3300005563 Ga0068855_100824982 Ga0068855_1008249821 153
21 3300009545 Ga0105237_10176911 Ga0105237_101769113 153
22 3300049823 Ga0501044_0318468 Ga0501044_0318468_875_1360 154
23 iso_pu_bacteria 2643221547 2643758009 154
24 3300048920 Ga0496117_0034639 Ga0496117_0034639_2158_2631 155
25 3300006178 Ga0075367_10216183 Ga0075367_102161831 156
26 3300050494 nmdc:mga06z11_121704_c1 nmdc:mga06z11_121704_c1_137_634 156
27 3300044735 Ga0466968_0333765 Ga0466968_0333765_31_561 157
28 3300049570 Ga0501033_1079464 Ga0501033_1079464_18_494 157
29 3300031595 Ga0265313_10000227 Ga0265313_1000022756 158
30 3300035695 Ga0373927_0218716 Ga0373927_0218716_107_640 158
31 3300049569 Ga0501032_0178794 Ga0501032_0178794_39_518 158
32 3300049571 Ga0501034_1072578 Ga0501034_1072578_35_514 158
33 3300049572 Ga0501036_1234787 Ga0501036_1234787_39_518 158
34 3300049576 Ga0501040_0015092 Ga0501040_0015092_38_517 158
35 3300049589 Ga0501073_1132787 Ga0501073_1132787_20_499 158
36 3300044719 Ga0466971_0214581 Ga0466971_0214581_132_653 159
37 3300045049 Ga0466959_0082247 Ga0466959_0082247_1376_1897 159
38 3300025254 Ga0209148_1015201 Ga0209148_10152012 160
39 3300025272 Ga0209455_1008927 Ga0209455_10089272 160
40 3300031730 Ga0307516_10055028 Ga0307516_100550284 160
41 3300045049 Ga0466959_0016385 Ga0466959_0016385_4348_4881 160
42 3300049587 Ga0501071_0623983 Ga0501071_0623983_312_803 160
43 3300061719 Ga0466962_0143390 Ga0466962_0143390_363_896 160
44 3300005981 Ga0081538_10044577 Ga0081538_100445775 161
45 3300006038 Ga0075365_10001379 Ga0075365_1000137912 161
46 3300006042 Ga0075368_10136857 Ga0075368_101368572 161
47 3300006048 Ga0075363_100013057 Ga0075363_1000130577 161
48 3300006051 Ga0075364_10013009 Ga0075364_100130095 161
49 3300006177 Ga0075362_10255967 Ga0075362_102559672 161
50 3300006195 Ga0075366_10485822 Ga0075366_104858222 161
51 3300006353 Ga0075370_10217481 Ga0075370_102174812 161
52 3300026067 Ga0207678_10989896 Ga0207678_109898962 161
53 3300031548 Ga0307408_100196628 Ga0307408_1001966282 161
54 3300044693 Ga0466961_0370884 Ga0466961_0370884_289_807 161
55 3300048929 Ga0496126_0412755 Ga0496126_0412755_378_908 161
56 3300050489 nmdc:mga03683_125120_c1 nmdc:mga03683_125120_c1_391_888 161
57 3300050489 nmdc:mga03683_283762_c1 nmdc:mga03683_283762_c1_224_721 161
58 3300050490 nmdc:mga03n38_46519_c1 nmdc:mga03n38_46519_c1_916_1413 161
59 3300050491 nmdc:mga00v17_4967_c1 nmdc:mga00v17_4967_c1_4400_4897 161
60 3300050494 nmdc:mga06z11_237294_c1 nmdc:mga06z11_237294_c1_326_823 161
61 3300050495 nmdc:mga04h51_12847_c1 nmdc:mga04h51_12847_c1_237_734 161
62 3300050516 nmdc:mga0sz30_325567_c1 nmdc:mga0sz30_325567_c1_104_601 161
63 3300006178 Ga0075367_10065396 Ga0075367_100653962 162
64 3300009148 Ga0105243_11093591 Ga0105243_110935911 162
65 3300050490 nmdc:mga03n38_113787_c1 nmdc:mga03n38_113787_c1_118_618 162
66 3300050492 nmdc:mga0yw44_864411_c1 nmdc:mga0yw44_864411_c1_103_603 162
67 3300050494 nmdc:mga06z11_3651_c1 nmdc:mga06z11_3651_c1_5405_5905 162
68 3300005614 Ga0068856_100006298 Ga0068856_1000062988 163
69 3300025253 Ga0209677_101892 Ga0209677_1018929 163
70 3300026078 Ga0207702_10008573 Ga0207702_100085738 163
71 3300031249 Ga0265339_10286080 Ga0265339_102860801 163
72 3300032133 Ga0316583_10003757 Ga0316583_100037574 163
73 3300035692 Ga0373935_0166115 Ga0373935_0166115_584_1099 163
74 3300036401 Ga0373937_0198151 Ga0373937_0198151_965_1480 163
75 3300044694 Ga0466963_0312586 Ga0466963_0312586_19_555 163
76 3300044694 Ga0466963_0534976 Ga0466963_0534976_184_696 163
77 3300045976 Ga0466967_0284812 Ga0466967_0284812_362_874 163
78 3300046517 Ga0495630_0183056 Ga0495630_0183056_108_623 163
79 3300046692 Ga0495671_0229406 Ga0495671_0229406_107_640 163
80 3300047444 Ga0495675_0150248 Ga0495675_0150248_891_1406 163
81 3300048920 Ga0496117_0282825 Ga0496117_0282825_231_749 163
82 3300048921 Ga0496118_0006290 Ga0496118_0006290_7583_8101 163
83 3300048924 Ga0496121_0024961 Ga0496121_0024961_2032_2550 163
84 3300048924 Ga0496121_0065236 Ga0496121_0065236_542_1060 163
85 3300048928 Ga0496125_0043278 Ga0496125_0043278_2166_2684 163
86 3300048929 Ga0496126_0033707 Ga0496126_0033707_2279_2809 163
87 3300053078 Ga0495612_0319175 Ga0495612_0319175_156_671 163
88 3300007788 Ga0099795_10436876 Ga0099795_104368761 164
89 3300025261 Ga0209233_1014430 Ga0209233_10144302 164
90 3300041512 Ga0451853_1236993 Ga0451853_1236993_338_865 164
91 3300044706 Ga0466964_0124287 Ga0466964_0124287_309_842 164
92 3300045836 Ga0466958_0101724 Ga0466958_0101724_881_1414 164
93 3300046475 Ga0495639_0110922 Ga0495639_0110922_189_722 164
94 3300046524 Ga0495648_0000286 Ga0495648_0000286_14332_14826 164
95 3300005336 Ga0070680_100645346 Ga0070680_1006453462 165
96 3300005435 Ga0070714_100423183 Ga0070714_1004231832 165
97 3300005437 Ga0070710_10425556 Ga0070710_104255561 165
98 3300007265 Ga0099794_10147248 Ga0099794_101472482 165
99 3300025272 Ga0209455_1002070 Ga0209455_10020704 165
100 3300025898 Ga0207692_10283608 Ga0207692_102836082 165
101 3300025917 Ga0207660_10490074 Ga0207660_104900742 165
102 3300025928 Ga0207700_10472860 Ga0207700_104728602 165
103 3300026078 Ga0207702_10500133 Ga0207702_105001332 165
104 3300027671 Ga0209588_1034848 Ga0209588_10348483 165
105 3300031238 Ga0265332_10090317 Ga0265332_100903172 165
106 3300048912 Ga0496109_0210642 Ga0496109_0210642_1215_1748 165
107 3300048913 Ga0496110_0142659 Ga0496110_0142659_609_1142 165
108 3300048915 Ga0496112_0014598 Ga0496112_0014598_5739_6272 165
109 3300048921 Ga0496118_0180939 Ga0496118_0180939_666_1163 165
110 3300048924 Ga0496121_0058838 Ga0496121_0058838_1950_2480 165
111 3300048924 Ga0496121_0312197 Ga0496121_0312197_487_984 165
112 3300048929 Ga0496126_0210242 Ga0496126_0210242_480_977 165
113 3300003203 JGI25406J46586_10050842 JGI25406J46586_100508422 166
114 3300005530 Ga0070679_101524017 Ga0070679_1015240171 166
115 3300005985 Ga0081539_10002259 Ga0081539_100022597 166
116 3300005985 Ga0081539_10135939 Ga0081539_101359392 166
117 3300044684 Ga0466966_0098998 Ga0466966_0098998_182_712 166
118 3300048922 Ga0496119_0447255 Ga0496119_0447255_34_567 166
119 3300006048 Ga0075363_100306340 Ga0075363_1003063402 167
120 3300006177 Ga0075362_10300825 Ga0075362_103008251 167
121 3300041411 Ga0439466_0226261 Ga0439466_0226261_50_556 167
122 3300046459 Ga0495629_0225584 Ga0495629_0225584_20_523 167
123 3300046472 Ga0495580_0674341 Ga0495580_0674341_159_662 167
124 3300046475 Ga0495639_0407549 Ga0495639_0407549_51_554 167
125 3300046477 Ga0495664_0506293 Ga0495664_0506293_16_519 167
126 3300046660 Ga0495625_0388839 Ga0495625_0388839_65_595 167
127 3300048924 Ga0496121_0258582 Ga0496121_0258582_23_529 167
128 3300050489 nmdc:mga03683_437047_c1 nmdc:mga03683_437047_c1_55_585 167
129 3300006038 Ga0075365_10968013 Ga0075365_109680131 168
130 3300039438 Ga0436360_0980864 Ga0436360_0980864_550_1095 168
131 3300044694 Ga0466963_0146565 Ga0466963_0146565_878_1408 168
132 3300048909 Ga0496106_0359706 Ga0496106_0359706_107_637 168
133 3300048913 Ga0496110_0142953 Ga0496110_0142953_846_1376 168
134 3300049568 Ga0501031_0042532 Ga0501031_0042532_570_1079 168
135 3300049568 Ga0501031_0108497 Ga0501031_0108497_226_735 168
136 3300049569 Ga0501032_0038673 Ga0501032_0038673_262_771 168
137 3300049569 Ga0501032_0091454 Ga0501032_0091454_417_926 168
138 3300049570 Ga0501033_0132462 Ga0501033_0132462_537_1046 168
139 3300049572 Ga0501036_0141200 Ga0501036_0141200_670_1179 168
140 3300049572 Ga0501036_0212007 Ga0501036_0212007_975_1484 168
141 3300049573 Ga0501037_0048807 Ga0501037_0048807_1147_1656 168
142 3300049573 Ga0501037_0060667 Ga0501037_0060667_652_1161 168
143 3300049574 Ga0501038_0005534 Ga0501038_0005534_3078_3587 168
144 3300049574 Ga0501038_0107385 Ga0501038_0107385_1397_1906 168
145 3300049575 Ga0501039_0082161 Ga0501039_0082161_1445_1954 168
146 3300049575 Ga0501039_0085706 Ga0501039_0085706_769_1278 168
147 3300049576 Ga0501040_0248048 Ga0501040_0248048_418_927 168
148 3300049579 Ga0501043_0188141 Ga0501043_0188141_442_951 168
149 3300049581 Ga0501047_0059149 Ga0501047_0059149_791_1300 168
150 3300049586 Ga0501070_0334531 Ga0501070_0334531_189_698 168
151 3300049588 Ga0501072_0628973 Ga0501072_0628973_280_789 168
152 3300049589 Ga0501073_0101485 Ga0501073_0101485_802_1311 168
153 3300049822 Ga0501035_0065941 Ga0501035_0065941_749_1258 168
154 3300049823 Ga0501044_0211406 Ga0501044_0211406_727_1236 168
155 3300050492 nmdc:mga0yw44_780273_c1 nmdc:mga0yw44_780273_c1_59_592 168
156 3300053111 Ga0500572_188305 Ga0500572_188305_60_590 168
157 3300001989 JGI24739J22299_10003170 JGI24739J22299_100031706 169
158 3300001990 JGI24737J22298_10011436 JGI24737J22298_100114363 169
159 3300002067 JGI24735J21928_10017184 JGI24735J21928_100171843 169
160 3300002067 JGI24735J21928_10019021 JGI24735J21928_100190212 169
161 3300002067 JGI24735J21928_10027426 JGI24735J21928_100274262 169
162 3300002075 JGI24738J21930_10016718 JGI24738J21930_100167182 169
163 3300005457 Ga0070662_100806271 Ga0070662_1008062711 169
164 3300005539 Ga0068853_100065184 Ga0068853_1000651842 169
165 3300005563 Ga0068855_100138570 Ga0068855_1001385702 169
166 3300005577 Ga0068857_100213611 Ga0068857_1002136112 169
167 3300005578 Ga0068854_100008844 Ga0068854_1000088446 169
168 3300005614 Ga0068856_100108247 Ga0068856_1001082472 169
169 3300005616 Ga0068852_100030996 Ga0068852_1000309962 169
170 3300006871 Ga0075434_100123660 Ga0075434_1001236603 169
171 3300009093 Ga0105240_10006014 Ga0105240_1000601417 169
172 3300009147 Ga0114129_11265320 Ga0114129_112653202 169
173 3300009545 Ga0105237_10109729 Ga0105237_101097294 169
174 3300009551 Ga0105238_10007571 Ga0105238_100075718 169
175 3300010375 Ga0105239_10024639 Ga0105239_100246397 169
176 3300025904 Ga0207647_10038999 Ga0207647_100389993 169
177 3300025913 Ga0207695_10033190 Ga0207695_100331902 169
178 3300025924 Ga0207694_10006429 Ga0207694_100064296 169
179 3300025928 Ga0207700_10839919 Ga0207700_108399192 169
180 3300025944 Ga0207661_11427283 Ga0207661_114272832 169
181 3300025949 Ga0207667_10015590 Ga0207667_100155906 169
182 3300025981 Ga0207640_10075254 Ga0207640_100752543 169
183 3300026041 Ga0207639_10127731 Ga0207639_101277312 169
184 3300026078 Ga0207702_10136551 Ga0207702_101365513 169
185 3300026116 Ga0207674_10000890 Ga0207674_1000089025 169
186 3300026142 Ga0207698_10806075 Ga0207698_108060752 169
187 3300046518 Ga0495631_0307274 Ga0495631_0307274_100_630 169
188 3300049581 Ga0501047_0570451 Ga0501047_0570451_372_908 169
189 3300050507 nmdc:mga05p37_802584_c1 nmdc:mga05p37_802584_c1_281_808 169
190 3300050513 nmdc:mga0rr50_820519_c1 nmdc:mga0rr50_820519_c1_49_576 169
191 3300053104 Ga0500556_0000006 Ga0500556_0000006_353792_354322 169
192 3300003659 JGI25404J52841_10016136 JGI25404J52841_100161362 170
193 3300005340 Ga0070689_100148307 Ga0070689_1001483072 170
194 3300005539 Ga0068853_100005594 Ga0068853_1000055949 170
195 3300005563 Ga0068855_100033421 Ga0068855_1000334214 170
196 3300005577 Ga0068857_100026860 Ga0068857_1000268605 170
197 3300005578 Ga0068854_100003752 Ga0068854_1000037528 170
198 3300005614 Ga0068856_100011349 Ga0068856_1000113495 170
199 3300005617 Ga0068859_100346894 Ga0068859_1003468943 170
200 3300005834 Ga0068851_10000408 Ga0068851_1000040812 170
201 3300005937 Ga0081455_10050365 Ga0081455_100503653 170
202 3300005983 Ga0081540_1064448 Ga0081540_10644483 170
203 3300006871 Ga0075434_101090454 Ga0075434_1010904541 170
204 3300006931 Ga0097620_100346884 Ga0097620_1003468843 170
205 3300009092 Ga0105250_10377382 Ga0105250_103773821 170
206 3300009093 Ga0105240_10070189 Ga0105240_100701894 170
207 3300009098 Ga0105245_11401470 Ga0105245_114014701 170
208 3300009545 Ga0105237_10135650 Ga0105237_101356502 170
209 3300009545 Ga0105237_11751991 Ga0105237_117519911 170
210 3300009545 Ga0105237_11771141 Ga0105237_117711411 170
211 3300009551 Ga0105238_10005022 Ga0105238_100050229 170
212 3300025321 Ga0207656_10000909 Ga0207656_100009095 170
213 3300025900 Ga0207710_10204478 Ga0207710_102044781 170
214 3300025913 Ga0207695_10000453 Ga0207695_1000045362 170
215 3300025914 Ga0207671_10036979 Ga0207671_100369794 170
216 3300025918 Ga0207662_10206376 Ga0207662_102063762 170
217 3300025924 Ga0207694_10001512 Ga0207694_100015129 170
218 3300025929 Ga0207664_10012728 Ga0207664_100127286 170
219 3300025936 Ga0207670_10482923 Ga0207670_104829232 170
220 3300025940 Ga0207691_10439542 Ga0207691_104395422 170
221 3300025949 Ga0207667_10007600 Ga0207667_100076008 170
222 3300025981 Ga0207640_10034701 Ga0207640_100347015 170
223 3300025986 Ga0207658_11398523 Ga0207658_113985231 170
224 3300026041 Ga0207639_10009146 Ga0207639_100091466 170
225 3300026078 Ga0207702_10000004 Ga0207702_10000004260 170
226 3300026088 Ga0207641_11548616 Ga0207641_115486161 170
227 3300026116 Ga0207674_10004798 Ga0207674_1000479816 170
228 3300026142 Ga0207698_10006435 Ga0207698_100064352 170
229 3300028380 Ga0268265_10052133 Ga0268265_100521331 170
230 3300035691 Ga0373931_0410472 Ga0373931_0410472_259_786 170
231 3300038443 Ga0395901_0149822 Ga0395901_0149822_512_1033 170
232 3300048920 Ga0496117_0404529 Ga0496117_0404529_104_637 170
233 3300048924 Ga0496121_0076636 Ga0496121_0076636_1445_1978 170
234 3300048927 Ga0496124_0059769 Ga0496124_0059769_1666_2199 170
235 3300048928 Ga0496125_0124877 Ga0496125_0124877_666_1199 170
236 3300049573 Ga0501037_0413056 Ga0501037_0413056_277_792 170
237 3300049822 Ga0501035_0303199 Ga0501035_0303199_381_896 170
238 3300050512 nmdc:mga0n895_638644_c1 nmdc:mga0n895_638644_c1_199_726 170
239 3300050513 nmdc:mga0rr50_58710_c1 nmdc:mga0rr50_58710_c1_1398_1925 170
240 3300053129 Ga0500628_140142 Ga0500628_140142_80_613 170
241 3300005719 Ga0068861_101278229 Ga0068861_1012782292 171
242 3300005843 Ga0068860_100000835 Ga0068860_10000083524 171
243 3300006941 Ga0099825_1038134 Ga0099825_10381342 171
244 3300006942 Ga0099824_1011583 Ga0099824_101158311 171
245 3300006943 Ga0099822_1000827 Ga0099822_100082724 171
246 3300009101 Ga0105247_10628783 Ga0105247_106287832 171
247 3300009176 Ga0105242_10976035 Ga0105242_109760351 171
248 3300009545 Ga0105237_10194669 Ga0105237_101946692 171
249 3300010375 Ga0105239_10873817 Ga0105239_108738172 171
250 3300013306 Ga0163162_10187470 Ga0163162_101874703 171
251 3300013306 Ga0163162_11173486 Ga0163162_111734862 171
252 3300021361 Ga0213872_10078139 Ga0213872_100781392 171
253 3300025900 Ga0207710_10022169 Ga0207710_100221693 171
254 3300025900 Ga0207710_10400455 Ga0207710_104004551 171
255 3300025914 Ga0207671_10690513 Ga0207671_106905132 171
256 3300026035 Ga0207703_10443924 Ga0207703_104439242 171
257 3300027357 Ga0209589_1000021 Ga0209589_1000021140 171
258 3300027361 Ga0209489_100028 Ga0209489_100028140 171
259 3300027363 Ga0209700_100037 Ga0209700_100037140 171
260 3300028381 Ga0268264_10000157 Ga0268264_10000157134 171
261 3300030521 Ga0307511_10053449 Ga0307511_100534493 171
262 3300031456 Ga0307513_10158328 Ga0307513_101583282 171
263 3300031507 Ga0307509_10052266 Ga0307509_100522664 171
264 3300031507 Ga0307509_10241668 Ga0307509_102416682 171
265 3300031616 Ga0307508_10000002 Ga0307508_1000000265 171
266 3300031711 Ga0265314_10007615 Ga0265314_100076156 171
267 3300031730 Ga0307516_10210294 Ga0307516_102102942 171
268 3300033179 Ga0307507_10103482 Ga0307507_101034824 171
269 3300035111 Ga0373923_0028039 Ga0373923_0028039_677_1192 171
270 3300035117 Ga0373953_0048419 Ga0373953_0048419_240_755 171
271 3300035118 Ga0373954_0004926 Ga0373954_0004926_5058_5573 171
272 3300035119 Ga0373956_0077653 Ga0373956_0077653_598_1113 171
273 3300035172 Ga0373955_0066609 Ga0373955_0066609_748_1263 171
274 3300035695 Ga0373927_0041289 Ga0373927_0041289_660_1181 171
275 3300035695 Ga0373927_0242063 Ga0373927_0242063_441_956 171
276 3300035724 Ga0373933_0136203 Ga0373933_0136203_1009_1524 171
277 3300037068 Ga0373925_0620989 Ga0373925_0620989_110_631 171
278 3300037418 Ga0395900_0010736 Ga0395900_0010736_3394_3936 171
279 3300037466 Ga0395898_0030124 Ga0395898_0030124_990_1532 171
280 3300038443 Ga0395901_0002704 Ga0395901_0002704_14284_14826 171
281 3300039438 Ga0436360_0159422 Ga0436360_0159422_3061_3591 171
282 3300039447 Ga0436361_0440082 Ga0436361_0440082_416_946 171
283 3300039453 Ga0436362_0847603 Ga0436362_0847603_409_939 171
284 3300045976 Ga0466967_1168593 Ga0466967_1168593_224_754 171
285 3300046454 Ga0495592_0020485 Ga0495592_0020485_1154_1669 171
286 3300046462 Ga0495651_0042721 Ga0495651_0042721_2200_2715 171
287 3300046492 Ga0495585_0252211 Ga0495585_0252211_12_530 171
288 3300046511 Ga0495608_0024793 Ga0495608_0024793_2200_2715 171
289 3300046514 Ga0495618_0134549 Ga0495618_0134549_949_1464 171
290 3300046516 Ga0495628_0012958 Ga0495628_0012958_2063_2578 171
291 3300046533 Ga0495640_0121631 Ga0495640_0121631_774_1289 171
292 3300046557 Ga0495622_0146290 Ga0495622_0146290_434_955 171
293 3300046559 Ga0495667_0014536 Ga0495667_0014536_4011_4526 171
294 3300046642 Ga0495634_0025578 Ga0495634_0025578_1571_2086 171
295 3300046660 Ga0495625_0341693 Ga0495625_0341693_34_564 171
296 3300046675 Ga0495657_0016134 Ga0495657_0016134_4272_4787 171
297 3300046678 Ga0495599_0025730 Ga0495599_0025730_2279_2794 171
298 3300046679 Ga0495623_0262680 Ga0495623_0262680_207_737 171
299 3300046689 Ga0495613_0180496 Ga0495613_0180496_126_641 171
300 3300046690 Ga0495624_0341589 Ga0495624_0341589_287_808 171
301 3300046809 Ga0495600_0057358 Ga0495600_0057358_329_844 171
302 3300047317 Ga0495604_0036395 Ga0495604_0036395_1166_1681 171
303 3300047319 Ga0495674_0053448 Ga0495674_0053448_2947_3462 171
304 3300047322 Ga0495680_0066584 Ga0495680_0066584_1150_1665 171
305 3300047471 Ga0495684_0012120 Ga0495684_0012120_5193_5708 171
306 3300048088 Ga0495602_0089225 Ga0495602_0089225_1066_1581 171
307 3300048909 Ga0496106_0001270 Ga0496106_0001270_4395_4916 171
308 3300048911 Ga0496108_0381699 Ga0496108_0381699_14_529 171
309 3300048922 Ga0496119_0391187 Ga0496119_0391187_110_631 171
310 3300048924 Ga0496121_0000370 Ga0496121_0000370_19181_19702 171
311 3300048924 Ga0496121_0180268 Ga0496121_0180268_334_855 171
312 3300048927 Ga0496124_0000235 Ga0496124_0000235_2695_3216 171
313 3300048927 Ga0496124_0208349 Ga0496124_0208349_949_1467 171
314 3300048928 Ga0496125_0036451 Ga0496125_0036451_1139_1660 171
315 3300048929 Ga0496126_0005304 Ga0496126_0005304_7827_8348 171
316 3300048929 Ga0496126_0154552 Ga0496126_0154552_155_676 171
317 3300049569 Ga0501032_0413819 Ga0501032_0413819_160_690 171
318 3300049571 Ga0501034_0300395 Ga0501034_0300395_302_826 171
319 3300049581 Ga0501047_0677732 Ga0501047_0677732_19_537 171
320 3300049823 Ga0501044_0487211 Ga0501044_0487211_268_786 171
321 3300050509 nmdc:mga0qj67_979897_c1 nmdc:mga0qj67_979897_c1_11_529 171
322 3300053077 Ga0495601_0013100 Ga0495601_0013100_2062_2577 171
323 3300053080 Ga0500635_0027474 Ga0500635_0027474_752_1273 171
324 3300053083 Ga0495655_0311134 Ga0495655_0311134_12_530 171
325 3300053084 Ga0495595_0208992 Ga0495595_0208992_49_564 171
326 3300053085 Ga0495619_0139183 Ga0495619_0139183_192_707 171
327 3300053094 Ga0500566_0146689 Ga0500566_0146689_299_820 171
328 3300053098 Ga0500650_0163517 Ga0500650_0163517_13_528 171
329 3300053130 Ga0500642_0353469 Ga0500642_0353469_11_526 171
330 3300053142 Ga0500577_0010120 Ga0500577_0010120_1543_2061 171
331 3300053150 Ga0500603_083730 Ga0500603_083730_233_754 171
332 3300053162 Ga0500638_204366 Ga0500638_204366_304_819 171
333 3300053177 Ga0500636_0029516 Ga0500636_0029516_797_1333 171
334 3300053177 Ga0500636_0052209 Ga0500636_0052209_1343_1864 171
335 3300053727 Ga0500611_083151 Ga0500611_083151_131_661 171
336 3300053733 Ga0500552_006534 Ga0500552_006534_448_963 171
337 3300053735 Ga0500596_002026 Ga0500596_002026_2454_2975 171
338 iso_pu_bacteria 2602042107 2603858506 171
339 iso_pu_bacteria 2824679649 2824684081 171
340 iso_pu_bacteria 2844315083 2844315316 171
341 iso_pu_bacteria 2857524615 2857526372 171
342 iso_pu_bacteria 2903727486 2903732177 171
343 iso_pu_bacteria 2906602504 2906604254 171
344 iso_pu_bacteria 2919073203 2919073780 171
345 iso_pu_bacteria 2922393267 2922394218 171
346 3300005366 Ga0070659_100483820 Ga0070659_1004838202 172
347 3300005530 Ga0070679_100065012 Ga0070679_1000650126 172
348 3300005539 Ga0068853_100494069 Ga0068853_1004940691 172
349 3300005563 Ga0068855_101809260 Ga0068855_1018092602 172
350 3300025904 Ga0207647_10255132 Ga0207647_102551322 172
351 3300025909 Ga0207705_10687886 Ga0207705_106878861 172
352 3300025917 Ga0207660_10801268 Ga0207660_108012682 172
353 3300025919 Ga0207657_10004438 Ga0207657_100044385 172
354 3300041459 Ga0451800_0802753 Ga0451800_0802753_99_629 172
355 3300046462 Ga0495651_0238033 Ga0495651_0238033_386_922 172
356 3300046543 Ga0495645_0225489 Ga0495645_0225489_539_1075 172
357 3300046559 Ga0495667_0035393 Ga0495667_0035393_2636_3172 172
358 3300046675 Ga0495657_0183690 Ga0495657_0183690_330_866 172
359 3300046809 Ga0495600_0011575 Ga0495600_0011575_311_847 172
360 3300049571 Ga0501034_0358129 Ga0501034_0358129_317_844 172
361 3300049571 Ga0501034_0363582 Ga0501034_0363582_209_739 172
362 3300049572 Ga0501036_0177892 Ga0501036_0177892_789_1316 172
363 3300049573 Ga0501037_0120874 Ga0501037_0120874_1006_1533 172
364 3300049574 Ga0501038_0155734 Ga0501038_0155734_344_865 172
365 3300049574 Ga0501038_0177173 Ga0501038_0177173_28_555 172
366 3300049575 Ga0501039_0236743 Ga0501039_0236743_440_961 172
367 3300049578 Ga0501042_0296283 Ga0501042_0296283_427_948 172
368 3300049580 Ga0501046_0403963 Ga0501046_0403963_304_825 172
369 3300049581 Ga0501047_0364924 Ga0501047_0364924_240_767 172
370 3300049582 Ga0501048_0190260 Ga0501048_0190260_432_959 172
371 3300049583 Ga0501067_0196420 Ga0501067_0196420_260_787 172
372 3300049586 Ga0501070_0355147 Ga0501070_0355147_345_872 172
373 3300049742 Ga0501080_0172975 Ga0501080_0172975_280_807 172
374 3300049822 Ga0501035_0212974 Ga0501035_0212974_988_1515 172
375 3300049823 Ga0501044_0147528 Ga0501044_0147528_1415_1942 172
376 3300053084 Ga0495595_0139254 Ga0495595_0139254_455_991 172
377 3300053096 Ga0500641_0007070 Ga0500641_0007070_3256_3789 172
378 3300053147 Ga0500589_073187 Ga0500589_073187_294_827 172
379 iso_pu_bacteria 2507262055 2507505224 172
380 iso_pu_bacteria 2508501009 2508539145 172
381 iso_pu_bacteria 2508501042 2508695386 172
382 iso_pu_bacteria 2508501128 2509152615 172
383 iso_pu_bacteria 2511231028 2511395439 172
384 iso_pu_bacteria 2513237092 2513629058 172
385 iso_pu_bacteria 2513237094 2513644144 172
386 iso_pu_bacteria 2513237095 2513651537 172
387 iso_pu_bacteria 2513237096 2513658792 172
388 iso_pu_bacteria 2513237098 2513674607 172
389 iso_pu_bacteria 2513237101 2513695090 172
390 iso_pu_bacteria 2513237102 2513704411 172
391 iso_pu_bacteria 2513237104 2513720325 172
392 iso_pu_bacteria 2513237137 2513860799 172
393 iso_pu_bacteria 2513237139 2513873549 172
394 iso_pu_bacteria 2513237145 2513921056 172
395 iso_pu_bacteria 2513237161 2514012464 172
396 iso_pu_bacteria 2515154112 2515627421 172
397 iso_pu_bacteria 2517093001 2517107732 172
398 iso_pu_bacteria 2517572143 2517888821 172
399 iso_pu_bacteria 2524023205 2524440911 172
400 iso_pu_bacteria 2524023210 2524467829 172
401 iso_pu_bacteria 2524023228 2524537075 172
402 iso_pu_bacteria 2528768022 2528852916 172
403 iso_pu_bacteria 2617270735 2617352377 172
404 iso_pu_bacteria 2617270741 2617373739 172
405 iso_pu_bacteria 2667528175 2671119965 172
406 iso_pu_bacteria 2721755755 2723841622 172
407 iso_pu_bacteria 2728368998 2728754969 172
408 iso_pu_bacteria 2744054633 2745081668 172
409 iso_pu_bacteria 2791355196 2793062021 172
410 iso_pu_bacteria 2791355197 2793072909 172
411 iso_pu_bacteria 2791355199 2793082772 172
412 iso_pu_bacteria 2802429603 2805915633 172
413 iso_pu_bacteria 2816332527 2818237628 172
414 iso_pu_bacteria 2824600985 2824604606 172
415 iso_pu_bacteria 2824609381 2824612303 172
416 iso_pu_bacteria 2824617872 2824624478 172
417 iso_pu_bacteria 2824626560 2824633393 172
418 iso_pu_bacteria 2824635225 2824640310 172
419 iso_pu_bacteria 2824644064 2824647256 172
420 iso_pu_bacteria 2824653114 2824655168 172
421 iso_pu_bacteria 2824661429 2824669708 172
422 iso_pu_bacteria 2824671348 2824676646 172
423 iso_pu_bacteria 2824687955 2824694744 172
424 iso_pu_bacteria 2824696289 2824702844 172
425 iso_pu_bacteria 2824704595 2824712735 172
426 iso_pu_bacteria 2824714736 2824717428 172
427 iso_pu_bacteria 2824723954 2824727609 172
428 iso_pu_bacteria 2824732956 2824739193 172
429 iso_pu_bacteria 2824746037 2824752565 172
430 iso_pu_bacteria 2824753945 2824757641 172
431 iso_pu_bacteria 2824763712 2824773151 172
432 iso_pu_bacteria 2824773399 2824775543 172
433 iso_pu_bacteria 2838122688 2838124492 172
434 iso_pu_bacteria 2841941048 2841945178 172
435 iso_pu_bacteria 2841949485 2841951960 172
436 iso_pu_bacteria 2841957949 2841965413 172
437 iso_pu_bacteria 2841966195 2841970645 172
438 iso_pu_bacteria 2841974524 2841979994 172
439 iso_pu_bacteria 2841983080 2841985173 172
440 iso_pu_bacteria 2842038055 2842043531 172
441 iso_pu_bacteria 2842045827 2842052479 172
442 iso_pu_bacteria 2847930680 2847931051 172
443 iso_pu_bacteria 2847939898 2847942134 172
444 iso_pu_bacteria 2849076700 2849083015 172
445 iso_pu_bacteria 2857509624 2857511903 172
446 iso_pu_bacteria 2874590934 2874594424 172
447 iso_pu_bacteria 2874604998 2874608084 172
448 iso_pu_bacteria 2874612657 2874613457 172
449 iso_pu_bacteria 2874620515 2874624760 172
450 iso_pu_bacteria 2874628541 2874628816 172
451 iso_pu_bacteria 2874645413 2874649797 172
452 iso_pu_bacteria 2876761206 2876769711 172
453 iso_pu_bacteria 2876771140 2876773916 172
454 iso_pu_bacteria 2876808645 2876810831 172
455 iso_pu_bacteria 2876818435 2876821796 172
456 iso_pu_bacteria 2879074833 2879078360 172
457 iso_pu_bacteria 2879099564 2879108570 172
458 iso_pu_bacteria 2879110137 2879112149 172
459 iso_pu_bacteria 2879127579 2879130621 172
460 iso_pu_bacteria 2879142872 2879147102 172
461 iso_pu_bacteria 2881364244 2881365339 172
462 iso_pu_bacteria 2881665667 2881668206 172
463 iso_pu_bacteria 2885366525 2885371049 172
464 iso_pu_bacteria 2885374607 2885376161 172
465 iso_pu_bacteria 2885383462 2885385083 172
466 iso_pu_bacteria 2888378607 2888379615 172
467 iso_pu_bacteria 2888388044 2888390702 172
468 iso_pu_bacteria 2888419890 2888420328 172
469 iso_pu_bacteria 2889033259 2889035513 172
470 iso_pu_bacteria 2903748898 2903748975 172
471 iso_pu_bacteria 2903768456 2903770781 172
472 iso_pu_bacteria 2904666416 2904670285 172
473 iso_pu_bacteria 2904690495 2904694489 172
474 iso_pu_bacteria 2904699407 2904708803 172
475 iso_pu_bacteria 2904711408 2904713157 172
476 iso_pu_bacteria 2906610324 2906613853 172
477 iso_pu_bacteria 2906626472 2906628978 172
478 iso_pu_bacteria 2906635258 2906642354 172
479 iso_pu_bacteria 2906643746 2906649400 172
480 iso_pu_bacteria 2906660503 2906667382 172
481 iso_pu_bacteria 2908739725 2908747422 172
482 iso_pu_bacteria 2908756301 2908756608 172
483 iso_pu_bacteria 2908775508 2908776256 172
484 iso_pu_bacteria 2922361189 2922364022 172
485 iso_pu_bacteria 2922368715 2922368960 172
486 iso_pu_bacteria 2922386360 2922392545 172
487 iso_pu_bacteria 2922425934 2922434247 172
488 iso_pu_bacteria 2929615660 2929618579 172
489 iso_pu_bacteria 2929624759 2929628736 172
490 iso_pu_bacteria 2932784394 2932792901 172
491 iso_pu_bacteria 2932794094 2932794338 172
492 iso_pu_bacteria 2932801729 2932808068 172
493 iso_pu_bacteria 2932809354 2932812188 172
494 iso_pu_bacteria 2932818245 2932823178 172
495 iso_pu_bacteria 2932828146 2932836094 172
496 iso_pu_bacteria 2933577622 2933580709 172
497 iso_pu_bacteria 2935608549 2935615747 172
498 iso_pu_bacteria 2935616580 2935618499 172
499 iso_pu_bacteria 2935630451 2935636608 172
500 iso_pu_bacteria 2935638405 2935641100 172
501 iso_pu_bacteria 2935648319 2935656121 172
502 iso_pu_bacteria 2935656913 2935664956 172
503 iso_pu_bacteria 2935665750 2935670016 172
504 iso_pu_bacteria 2935675223 2935679133 172
505 iso_pu_bacteria 2935684952 2935690000 172
506 iso_pu_bacteria 2935694250 2935698522 172
507 iso_pu_bacteria 2935703347 2935711458 172
508 iso_pu_bacteria 2935713505 2935717519 172
509 iso_pu_bacteria 2935722832 2935723811 172
510 iso_pu_bacteria 2935732158 2935740020 172
511 iso_pu_bacteria 2935741537 2935749283 172
512 iso_pu_bacteria 2935750917 2935757354 172
513 iso_pu_bacteria 2935760218 2935763558 172
514 iso_pu_bacteria 2935769743 2935773064 172
515 iso_pu_bacteria 2935777560 2935783007 172
516 iso_pu_bacteria 2935785616 2935787947 172
517 iso_pu_bacteria 2935793552 2935796477 172
518 iso_pu_bacteria 2935801545 2935809980 172
519 iso_pu_bacteria 2935810662 2935816286 172
520 iso_pu_bacteria 2935819856 2935825455 172
521 iso_pu_bacteria 2935827899 2935835679 172
522 iso_pu_bacteria 2935837841 2935844630 172
523 iso_pu_bacteria 2935847175 2935853244 172
524 iso_pu_bacteria 2935855204 2935862924 172
525 iso_pu_bacteria 2935864058 2935866666 172
526 iso_pu_bacteria 2935873716 2935874973 172
527 iso_pu_bacteria 2935883170 2935890128 172
528 iso_pu_bacteria 2935908558 2935914716 172
529 iso_pu_bacteria 2935916978 2935918693 172
530 iso_pu_bacteria 2935926038 2935931591 172
531 iso_pu_bacteria 2935934488 2935940188 172
532 iso_pu_bacteria 2935942939 2935947465 172
533 iso_pu_bacteria 2935951376 2935956237 172
534 iso_pu_bacteria 2935959822 2935962616 172
535 iso_pu_bacteria 2935967501 2935973030 172
536 iso_pu_bacteria 2935975950 2935980725 172
537 iso_pu_bacteria 2935984226 2935985044 172
538 iso_pu_bacteria 2935992306 2935999751 172
539 iso_pu_bacteria 2936002035 2936010551 172
540 iso_pu_bacteria 2936011229 2936019014 172
541 iso_pu_bacteria 2936019824 2936027594 172
542 iso_pu_bacteria 2936028420 2936036417 172
543 iso_pu_bacteria 2936037263 2936041291 172
544 iso_pu_bacteria 2936046547 2936054545 172
545 iso_pu_bacteria 2936055302 2936056213 172
546 iso_pu_bacteria 2940556831 2940563267 172
547 iso_pu_bacteria 2941507105 2941513244 172
548 iso_pu_bacteria 2941515067 2941521101 172
549 iso_pu_bacteria 2941523033 2941528962 172
550 iso_pu_bacteria 2941531003 2941535535 172
551 iso_pu_bacteria 2941538514 2941543185 172
552 iso_pu_bacteria 3005474847 3005475040 172
553 iso_pu_bacteria 3005483717 3005486877 172
554 iso_pu_bacteria 3005506211 3005509184 172
555 iso_pu_bacteria 3005587118 3005592232 172
556 iso_pu_bacteria 3005594810 3005595029 172
557 iso_pu_bacteria 3005710791 3005710978 172
558 iso_pu_bacteria 8006926726 8006927869 172
559 iso_pu_bacteria 8006933436 8006936256 172
560 iso_pu_bacteria 8006964411 8006969340 172
561 iso_pu_bacteria 8006973647 8006976201 172
562 iso_pu_bacteria 8006984368 8006990901 172
563 iso_pu_bacteria 8006994254 8006996531 172
564 iso_pu_bacteria 8016511872 8016518206 172
565 iso_pu_bacteria 8016522445 8016526117 172
566 iso_pu_bacteria 8016530956 8016539728 172
567 iso_pu_bacteria 8016539877 8016544032 172
568 iso_pu_bacteria 8016548790 8016549273 172
569 iso_pu_bacteria 8016557553 8016557701 172
570 iso_pu_bacteria 8016583857 8016586399 172
571 iso_pu_bacteria 8016595262 8016595732 172
572 iso_pu_bacteria 8016603502 8016606588 172
573 iso_pu_bacteria 8016613128 8016618489 172
574 iso_pu_bacteria 8016622563 8016623181 172
575 iso_pu_bacteria 8016630954 8016635781 172
576 iso_pu_bacteria 8017057580 8017058443 172
577 iso_pu_bacteria 8019530166 8019531007 172
578 iso_pu_bacteria 8019538911 8019540577 172
579 iso_pu_bacteria 8019547302 8019550197 172
580 iso_pu_bacteria 8019555841 8019562388 172
581 iso_pu_bacteria 8019565922 8019572457 172
582 iso_pu_bacteria 8019576017 8019577253 172
583 iso_pu_bacteria 8019586578 8019595334 172
584 iso_pu_bacteria 8019597564 8019606425 172
585 iso_pu_bacteria 8019608314 8019612103 172
586 iso_pu_bacteria 8019619141 8019622948 172
587 iso_pu_bacteria 8019629233 8019630159 172
588 iso_pu_bacteria 8019638758 8019640453 172
589 iso_pu_bacteria 8019648815 8019652491 172
590 iso_pu_bacteria 8019659431 8019666992 172
591 iso_pu_bacteria 8019668869 8019676748 172
592 iso_pu_bacteria 8019687851 8019696265 172
593 iso_pu_bacteria 8055742211 8055742429 172
594 iso_pu_bacteria 8056673599 8056675722 172
595 iso_pu_bacteria 8056681323 8056687413 172
596 iso_pu_bacteria 8056689827 8056693381 172
597 iso_pu_bacteria 8056967851 8056971268 172
598 3300025913 Ga0207695_10585663 Ga0207695_105856632 173
599 3300037466 Ga0395898_0093688 Ga0395898_0093688_1554_2087 173
600 3300038443 Ga0395901_0295394 Ga0395901_0295394_370_903 173
601 3300044706 Ga0466964_0395347 Ga0466964_0395347_16_537 173
602 3300048917 Ga0496114_0442386 Ga0496114_0442386_340_864 173
603 3300049568 Ga0501031_0032907 Ga0501031_0032907_1980_2504 173
604 3300049568 Ga0501031_0161913 Ga0501031_0161913_607_1131 173
605 3300049569 Ga0501032_0005395 Ga0501032_0005395_8098_8622 173
606 3300049569 Ga0501032_0064218 Ga0501032_0064218_872_1396 173
607 3300049569 Ga0501032_0186078 Ga0501032_0186078_79_612 173
608 3300049570 Ga0501033_0000440 Ga0501033_0000440_3553_4077 173
609 3300049570 Ga0501033_0210893 Ga0501033_0210893_734_1267 173
610 3300049570 Ga0501033_0400322 Ga0501033_0400322_292_816 173
611 3300049572 Ga0501036_1046879 Ga0501036_1046879_93_623 173
612 3300049573 Ga0501037_0005763 Ga0501037_0005763_3369_3893 173
613 3300049573 Ga0501037_0174733 Ga0501037_0174733_20_544 173
614 3300049574 Ga0501038_0008403 Ga0501038_0008403_4432_4956 173
615 3300049574 Ga0501038_0160580 Ga0501038_0160580_782_1306 173
616 3300049574 Ga0501038_0895133 Ga0501038_0895133_103_627 173
617 3300049575 Ga0501039_0011559 Ga0501039_0011559_908_1432 173
618 3300049575 Ga0501039_0018071 Ga0501039_0018071_1062_1586 173
619 3300049575 Ga0501039_0760831 Ga0501039_0760831_116_640 173
620 3300049577 Ga0501041_0122155 Ga0501041_0122155_488_1012 173
621 3300049578 Ga0501042_0003037 Ga0501042_0003037_7796_8320 173
622 3300049579 Ga0501043_0001889 Ga0501043_0001889_10199_10723 173
623 3300049579 Ga0501043_0319198 Ga0501043_0319198_312_845 173
624 3300049580 Ga0501046_0029784 Ga0501046_0029784_3609_4133 173
625 3300049580 Ga0501046_0193573 Ga0501046_0193573_295_828 173
626 3300049581 Ga0501047_0066691 Ga0501047_0066691_164_688 173
627 3300049581 Ga0501047_0227997 Ga0501047_0227997_919_1452 173
628 3300049582 Ga0501048_0043652 Ga0501048_0043652_146_670 173
629 3300049583 Ga0501067_0235215 Ga0501067_0235215_37_561 173
630 3300049584 Ga0501068_0108762 Ga0501068_0108762_1070_1594 173
631 3300049585 Ga0501069_0509192 Ga0501069_0509192_148_672 173
632 3300049586 Ga0501070_0055900 Ga0501070_0055900_1602_2135 173
633 3300049587 Ga0501071_0303975 Ga0501071_0303975_92_616 173
634 3300049588 Ga0501072_0004304 Ga0501072_0004304_1067_1591 173
635 3300049589 Ga0501073_0151453 Ga0501073_0151453_915_1439 173
636 3300049590 Ga0501074_0687062 Ga0501074_0687062_14_538 173
637 3300049592 Ga0501076_0427868 Ga0501076_0427868_179_703 173
638 3300049593 Ga0501077_0196081 Ga0501077_0196081_142_666 173
639 3300049742 Ga0501080_0120561 Ga0501080_0120561_648_1172 173
640 3300049743 Ga0501081_0232492 Ga0501081_0232492_679_1203 173
641 3300049743 Ga0501081_0270328 Ga0501081_0270328_148_672 173
642 3300049744 Ga0501083_0026884 Ga0501083_0026884_599_1123 173
643 3300049822 Ga0501035_0006394 Ga0501035_0006394_4006_4530 173
644 3300049822 Ga0501035_0073148 Ga0501035_0073148_151_675 173
645 3300049822 Ga0501035_0097341 Ga0501035_0097341_725_1258 173
646 3300049823 Ga0501044_0006535 Ga0501044_0006535_6342_6866 173
647 3300049823 Ga0501044_0028057 Ga0501044_0028057_5069_5602 173
648 3300049823 Ga0501044_0066600 Ga0501044_0066600_521_1045 173
649 3300049824 Ga0501045_0057890 Ga0501045_0057890_292_816 173
650 3300005338 Ga0068868_100334897 Ga0068868_1003348972 174
651 3300005366 Ga0070659_100502489 Ga0070659_1005024892 174
652 3300005455 Ga0070663_100072598 Ga0070663_1000725983 174
653 3300005458 Ga0070681_11024242 Ga0070681_110242421 174
654 3300005842 Ga0068858_100097230 Ga0068858_1000972302 174
655 3300006931 Ga0097620_100248051 Ga0097620_1002480513 174
656 3300009093 Ga0105240_10970126 Ga0105240_109701262 174
657 3300009098 Ga0105245_11207519 Ga0105245_112075192 174
658 3300009101 Ga0105247_10064667 Ga0105247_100646674 174
659 3300009177 Ga0105248_10272460 Ga0105248_102724603 174
660 3300009177 Ga0105248_11421682 Ga0105248_114216821 174
661 3300009551 Ga0105238_10073433 Ga0105238_100734333 174
662 3300010375 Ga0105239_10196081 Ga0105239_101960813 174
663 3300014325 Ga0163163_10374002 Ga0163163_103740022 174
664 3300015265 Ga0182005_1075226 Ga0182005_10752262 174
665 3300025924 Ga0207694_10075818 Ga0207694_100758184 174
666 3300025927 Ga0207687_10590826 Ga0207687_105908262 174
667 3300026023 Ga0207677_10137411 Ga0207677_101374112 174
668 3300026067 Ga0207678_10345580 Ga0207678_103455802 174
669 3300032002 Ga0307416_100873816 Ga0307416_1008738162 174
670 3300035091 Ga0373951_0029159 Ga0373951_0029159_590_1114 174
671 3300035724 Ga0373933_0000031 Ga0373933_0000031_28515_29042 174
672 3300037312 Ga0395899_0491063 Ga0395899_0491063_127_651 174
673 3300037418 Ga0395900_0242343 Ga0395900_0242343_823_1347 174
674 3300044842 Ga0466957_0082946 Ga0466957_0082946_1129_1653 174
675 3300045976 Ga0466967_1559457 Ga0466967_1559457_61_585 174
676 3300047472 Ga0495686_0535710 Ga0495686_0535710_31_558 174
677 3300048907 Ga0496104_0122826 Ga0496104_0122826_609_1133 174
678 3300048908 Ga0496105_0196572 Ga0496105_0196572_907_1431 174
679 3300048911 Ga0496108_0095587 Ga0496108_0095587_1066_1590 174
680 3300048912 Ga0496109_0241153 Ga0496109_0241153_1000_1524 174
681 3300048914 Ga0496111_0216338 Ga0496111_0216338_446_970 174
682 3300048915 Ga0496112_0252452 Ga0496112_0252452_953_1477 174
683 3300048927 Ga0496124_0025032 Ga0496124_0025032_655_1179 174
684 3300048927 Ga0496124_0457135 Ga0496124_0457135_282_809 174
685 3300048928 Ga0496125_0028321 Ga0496125_0028321_2683_3207 174
686 3300003215 JGI25153J46596_10031557 JGI25153J46596_100315572 175
687 3300005329 Ga0070683_100008779 Ga0070683_1000087793 175
688 3300005331 Ga0070670_100538610 Ga0070670_1005386102 175
689 3300005336 Ga0070680_100045032 Ga0070680_1000450325 175
690 3300005336 Ga0070680_100137066 Ga0070680_1001370662 175
691 3300005339 Ga0070660_100002843 Ga0070660_10000284315 175
692 3300005339 Ga0070660_100253025 Ga0070660_1002530251 175
693 3300005341 Ga0070691_10018986 Ga0070691_100189862 175
694 3300005344 Ga0070661_100597898 Ga0070661_1005978982 175
695 3300005344 Ga0070661_100869333 Ga0070661_1008693331 175
696 3300005365 Ga0070688_100075203 Ga0070688_1000752034 175
697 3300005366 Ga0070659_100226684 Ga0070659_1002266842 175
698 3300005434 Ga0070709_10000584 Ga0070709_1000058421 175
699 3300005435 Ga0070714_100024145 Ga0070714_1000241457 175
700 3300005435 Ga0070714_100381118 Ga0070714_1003811182 175
701 3300005437 Ga0070710_10097118 Ga0070710_100971183 175
702 3300005439 Ga0070711_100043573 Ga0070711_1000435734 175
703 3300005455 Ga0070663_100125598 Ga0070663_1001255983 175
704 3300005455 Ga0070663_100143614 Ga0070663_1001436142 175
705 3300005455 Ga0070663_100388242 Ga0070663_1003882422 175
706 3300005458 Ga0070681_10038172 Ga0070681_100381723 175
707 3300005458 Ga0070681_10058550 Ga0070681_100585503 175
708 3300005467 Ga0070706_101617190 Ga0070706_1016171901 175
709 3300005518 Ga0070699_100838150 Ga0070699_1008381502 175
710 3300005530 Ga0070679_100032033 Ga0070679_1000320335 175
711 3300005535 Ga0070684_100006680 Ga0070684_1000066803 175
712 3300005536 Ga0070697_100688542 Ga0070697_1006885421 175
713 3300005539 Ga0068853_100002454 Ga0068853_1000024548 175
714 3300005539 Ga0068853_100707080 Ga0068853_1007070802 175
715 3300005548 Ga0070665_100954490 Ga0070665_1009544902 175
716 3300005548 Ga0070665_101737629 Ga0070665_1017376292 175
717 3300005563 Ga0068855_100006336 Ga0068855_1000063365 175
718 3300005577 Ga0068857_100128570 Ga0068857_1001285702 175
719 3300005578 Ga0068854_100530467 Ga0068854_1005304672 175
720 3300005614 Ga0068856_100222198 Ga0068856_1002221983 175
721 3300005834 Ga0068851_10005095 Ga0068851_100050954 175
722 3300005937 Ga0081455_10150940 Ga0081455_101509402 175
723 3300005981 Ga0081538_10067457 Ga0081538_100674572 175
724 3300005983 Ga0081540_1005183 Ga0081540_10051834 175
725 3300005983 Ga0081540_1009347 Ga0081540_10093474 175
726 3300006028 Ga0070717_10157915 Ga0070717_101579152 175
727 3300006028 Ga0070717_10869129 Ga0070717_108691292 175
728 3300006038 Ga0075365_10079812 Ga0075365_100798122 175
729 3300006051 Ga0075364_10091969 Ga0075364_100919692 175
730 3300006173 Ga0070716_100009624 Ga0070716_1000096242 175
731 3300006175 Ga0070712_100264867 Ga0070712_1002648672 175
732 3300006186 Ga0075369_10158937 Ga0075369_101589372 175
733 3300006186 Ga0075369_10221664 Ga0075369_102216642 175
734 3300007788 Ga0099795_10029924 Ga0099795_100299243 175
735 3300007788 Ga0099795_10140751 Ga0099795_101407512 175
736 3300009545 Ga0105237_10008146 Ga0105237_1000814611 175
737 3300009551 Ga0105238_10099826 Ga0105238_100998262 175
738 3300011119 Ga0105246_10171964 Ga0105246_101719643 175
739 3300011119 Ga0105246_10855575 Ga0105246_108555751 175
740 3300013104 Ga0157370_10091836 Ga0157370_100918364 175
741 3300013105 Ga0157369_10001511 Ga0157369_1000151115 175
742 3300013306 Ga0163162_10285884 Ga0163162_102858842 175
743 3300013308 Ga0157375_10998559 Ga0157375_109985592 175
744 3300014325 Ga0163163_11005569 Ga0163163_110055692 175
745 3300014325 Ga0163163_12288185 Ga0163163_122881851 175
746 3300014326 Ga0157380_11234774 Ga0157380_112347742 175
747 3300014326 Ga0157380_11302763 Ga0157380_113027632 175
748 3300014969 Ga0157376_11064650 Ga0157376_110646502 175
749 3300021384 Ga0213876_10095185 Ga0213876_100951852 175
750 3300021384 Ga0213876_10314602 Ga0213876_103146022 175
751 3300021388 Ga0213875_10231759 Ga0213875_102317592 175
752 3300025295 Ga0209564_1004284 Ga0209564_10042845 175
753 3300025297 Ga0209758_1003838 Ga0209758_10038387 175
754 3300025321 Ga0207656_10053979 Ga0207656_100539792 175
755 3300025898 Ga0207692_10005810 Ga0207692_100058106 175
756 3300025906 Ga0207699_10001061 Ga0207699_100010612 175
757 3300025909 Ga0207705_10116536 Ga0207705_101165361 175
758 3300025912 Ga0207707_10004287 Ga0207707_100042874 175
759 3300025912 Ga0207707_10030069 Ga0207707_100300691 175
760 3300025913 Ga0207695_10021123 Ga0207695_100211234 175
761 3300025914 Ga0207671_10009240 Ga0207671_100092409 175
762 3300025915 Ga0207693_10189196 Ga0207693_101891962 175
763 3300025916 Ga0207663_10007470 Ga0207663_100074702 175
764 3300025917 Ga0207660_10001366 Ga0207660_1000136613 175
765 3300025917 Ga0207660_10116745 Ga0207660_101167453 175
766 3300025919 Ga0207657_10001686 Ga0207657_1000168617 175
767 3300025919 Ga0207657_10328892 Ga0207657_103288922 175
768 3300025921 Ga0207652_10001889 Ga0207652_100018899 175
769 3300025921 Ga0207652_10854766 Ga0207652_108547662 175
770 3300025924 Ga0207694_10002704 Ga0207694_1000270410 175
771 3300025924 Ga0207694_10263039 Ga0207694_102630393 175
772 3300025928 Ga0207700_10420041 Ga0207700_104200412 175
773 3300025929 Ga0207664_10019486 Ga0207664_100194867 175
774 3300025939 Ga0207665_10270321 Ga0207665_102703212 175
775 3300025944 Ga0207661_10007064 Ga0207661_100070649 175
776 3300025949 Ga0207667_10002324 Ga0207667_1000232410 175
777 3300025961 Ga0207712_10402756 Ga0207712_104027562 175
778 3300025981 Ga0207640_10359994 Ga0207640_103599942 175
779 3300025981 Ga0207640_10535518 Ga0207640_105355182 175
780 3300026041 Ga0207639_10028554 Ga0207639_100285545 175
781 3300026041 Ga0207639_10899174 Ga0207639_108991742 175
782 3300026067 Ga0207678_10130277 Ga0207678_101302772 175
783 3300026067 Ga0207678_10376964 Ga0207678_103769642 175
784 3300026067 Ga0207678_10519786 Ga0207678_105197862 175
785 3300026116 Ga0207674_10017171 Ga0207674_100171718 175
786 3300026121 Ga0207683_10115944 Ga0207683_101159444 175
787 3300026142 Ga0207698_10969149 Ga0207698_109691491 175
788 3300028379 Ga0268266_10331670 Ga0268266_103316702 175
789 3300028794 Ga0307515_10070966 Ga0307515_100709662 175
790 3300031247 Ga0265340_10021094 Ga0265340_100210944 175
791 3300031249 Ga0265339_10001062 Ga0265339_1000106215 175
792 3300031616 Ga0307508_10097319 Ga0307508_100973194 175
793 3300031901 Ga0307406_10703968 Ga0307406_107039682 175
794 3300031911 Ga0307412_11421641 Ga0307412_114216411 175
795 3300031995 Ga0307409_100629509 Ga0307409_1006295092 175
796 3300035086 Ga0373934_0096519 Ga0373934_0096519_633_1160 175
797 3300035171 Ga0373946_0268724 Ga0373946_0268724_295_822 175
798 3300035695 Ga0373927_0001909 Ga0373927_0001909_5353_5880 175
799 3300035725 Ga0373947_0016858 Ga0373947_0016858_371_898 175
800 3300037068 Ga0373925_0182375 Ga0373925_0182375_343_870 175
801 3300037853 Ga0436364_0933374 Ga0436364_0933374_224_751 175
802 3300039437 Ga0436365_0584651 Ga0436365_0584651_123_650 175
803 3300039437 Ga0436365_0940586 Ga0436365_0940586_2518_3045 175
804 3300039437 Ga0436365_1154205 Ga0436365_1154205_1957_2484 175
805 3300046455 Ga0495603_0003797 Ga0495603_0003797_5281_5808 175
806 3300046455 Ga0495603_0167722 Ga0495603_0167722_385_912 175
807 3300046460 Ga0495638_0071350 Ga0495638_0071350_1497_2027 175
808 3300046461 Ga0495641_0361810 Ga0495641_0361810_20_547 175
809 3300046471 Ga0495650_0114187 Ga0495650_0114187_326_853 175
810 3300046472 Ga0495580_0599310 Ga0495580_0599310_53_580 175
811 3300046473 Ga0495582_0608783 Ga0495582_0608783_57_584 175
812 3300046474 Ga0495605_0200367 Ga0495605_0200367_164_694 175
813 3300046475 Ga0495639_0061431 Ga0495639_0061431_772_1299 175
814 3300046500 Ga0495596_0165044 Ga0495596_0165044_65_592 175
815 3300046501 Ga0495607_0126059 Ga0495607_0126059_582_1112 175
816 3300046506 Ga0495583_0102243 Ga0495583_0102243_313_843 175
817 3300046507 Ga0495606_0110870 Ga0495606_0110870_60_590 175
818 3300046507 Ga0495606_0229668 Ga0495606_0229668_314_841 175
819 3300046512 Ga0495610_0122259 Ga0495610_0122259_582_1112 175
820 3300046513 Ga0495616_0019203 Ga0495616_0019203_2612_3142 175
821 3300046517 Ga0495630_0412225 Ga0495630_0412225_156_683 175
822 3300046519 Ga0495632_0107263 Ga0495632_0107263_395_925 175
823 3300046519 Ga0495632_0211039 Ga0495632_0211039_197_724 175
824 3300046519 Ga0495632_0315944 Ga0495632_0315944_41_568 175
825 3300046520 Ga0495637_0035241 Ga0495637_0035241_234_764 175
826 3300046522 Ga0495643_0023375 Ga0495643_0023375_2219_2749 175
827 3300046524 Ga0495648_0025580 Ga0495648_0025580_642_1172 175
828 3300046524 Ga0495648_0040986 Ga0495648_0040986_2149_2679 175
829 3300046530 Ga0495654_0079212 Ga0495654_0079212_26_556 175
830 3300046538 Ga0495609_0080528 Ga0495609_0080528_384_914 175
831 3300046558 Ga0495633_0165928 Ga0495633_0165928_132_662 175
832 3300046648 Ga0495611_0126706 Ga0495611_0126706_113_643 175
833 3300046660 Ga0495625_0113996 Ga0495625_0113996_582_1112 175
834 3300046665 Ga0495661_0123292 Ga0495661_0123292_42_572 175
835 3300046689 Ga0495613_0327641 Ga0495613_0327641_493_1023 175
836 3300046691 Ga0495670_0081835 Ga0495670_0081835_510_1040 175
837 3300046692 Ga0495671_0096370 Ga0495671_0096370_357_887 175
838 3300046694 Ga0495649_0311070 Ga0495649_0311070_101_628 175
839 3300047315 Ga0495581_0215543 Ga0495581_0215543_154_681 175
840 3300047317 Ga0495604_0412193 Ga0495604_0412193_19_549 175
841 3300047320 Ga0495672_0314370 Ga0495672_0314370_69_596 175
842 3300047321 Ga0495676_0402391 Ga0495676_0402391_320_847 175
843 3300047323 Ga0495683_0196534 Ga0495683_0196534_201_731 175
844 3300047445 Ga0495677_0269795 Ga0495677_0269795_47_577 175
845 3300047469 Ga0495673_0052100 Ga0495673_0052100_856_1386 175
846 3300047469 Ga0495673_0175042 Ga0495673_0175042_170_700 175
847 3300047470 Ga0495681_0190175 Ga0495681_0190175_96_626 175
848 3300047472 Ga0495686_0040166 Ga0495686_0040166_338_868 175
849 3300048091 Ga0495626_0108329 Ga0495626_0108329_568_1098 175
850 3300048903 Ga0496100_0239878 Ga0496100_0239878_438_968 175
851 3300048904 Ga0496101_0438988 Ga0496101_0438988_241_768 175
852 3300048905 Ga0496102_0368024 Ga0496102_0368024_753_1283 175
853 3300048906 Ga0496103_0279938 Ga0496103_0279938_284_814 175
854 3300048909 Ga0496106_0127613 Ga0496106_0127613_1019_1546 175
855 3300048918 Ga0496115_0325862 Ga0496115_0325862_391_918 175
856 3300048919 Ga0496116_0007249 Ga0496116_0007249_1288_1818 175
857 3300048921 Ga0496118_0121882 Ga0496118_0121882_576_1106 175
858 3300048922 Ga0496119_0082239 Ga0496119_0082239_299_829 175
859 3300048923 Ga0496120_0308520 Ga0496120_0308520_73_603 175
860 3300048924 Ga0496121_0042453 Ga0496121_0042453_895_1425 175
861 3300048924 Ga0496121_0355836 Ga0496121_0355836_63_590 175
862 3300048926 Ga0496123_0155390 Ga0496123_0155390_374_904 175
863 3300048927 Ga0496124_0052562 Ga0496124_0052562_991_1521 175
864 3300048928 Ga0496125_0013776 Ga0496125_0013776_1218_1748 175
865 3300048928 Ga0496125_0190556 Ga0496125_0190556_140_670 175
866 3300048929 Ga0496126_0069744 Ga0496126_0069744_1167_1694 175
867 3300049459 Ga0495678_029690 Ga0495678_029690_85_615 175
868 3300049570 Ga0501033_0354094 Ga0501033_0354094_103_630 175
869 3300049583 Ga0501067_0104427 Ga0501067_0104427_409_939 175
870 3300050492 nmdc:mga0yw44_166632_c1 nmdc:mga0yw44_166632_c1_610_1140 175
871 3300050492 nmdc:mga0yw44_2162_c1 nmdc:mga0yw44_2162_c1_2564_3094 175
872 3300050507 nmdc:mga05p37_1079892_c1 nmdc:mga05p37_1079892_c1_292_819 175
873 3300053087 Ga0500643_033044 Ga0500643_033044_990_1520 175
874 3300053089 Ga0500581_068110 Ga0500581_068110_118_648 175
875 3300053093 Ga0500651_0208230 Ga0500651_0208230_491_1021 175
876 3300053094 Ga0500566_0000632 Ga0500566_0000632_1631_2161 175
877 3300053096 Ga0500641_0008155 Ga0500641_0008155_1079_1609 175
878 3300053109 Ga0500569_008075 Ga0500569_008075_65_595 175
879 3300053116 Ga0500592_002364 Ga0500592_002364_529_1059 175
880 3300053118 Ga0500594_0052591 Ga0500594_0052591_472_1002 175
881 3300053122 Ga0500608_000257 Ga0500608_000257_18213_18743 175
882 3300053126 Ga0500621_145430 Ga0500621_145430_158_688 175
883 3300053129 Ga0500628_173450 Ga0500628_173450_44_574 175
884 3300053130 Ga0500642_0000004 Ga0500642_0000004_133191_133721 175
885 3300053131 Ga0500652_165966 Ga0500652_165966_357_887 175
886 3300053136 Ga0500559_0000426 Ga0500559_0000426_22341_22871 175
887 3300053139 Ga0500568_0002340 Ga0500568_0002340_3134_3664 175
888 3300053148 Ga0500590_082854 Ga0500590_082854_804_1334 175
889 3300053151 Ga0500604_0029649 Ga0500604_0029649_149_679 175
890 3300053153 Ga0500616_0000022 Ga0500616_0000022_349575_350105 175
891 3300053154 Ga0500619_008165 Ga0500619_008165_1630_2160 175
892 3300053156 Ga0500622_0026344 Ga0500622_0026344_374_904 175
893 3300053160 Ga0500633_0034975 Ga0500633_0034975_1091_1621 175
894 3300053177 Ga0500636_0008608 Ga0500636_0008608_1968_2498 175
895 3300053727 Ga0500611_011777 Ga0500611_011777_606_1136 175
896 3300053730 Ga0500645_083376 Ga0500645_083376_63_593 175
897 3300053735 Ga0500596_058718 Ga0500596_058718_86_616 175
898 2010549000 RicEn_C8699 RicEn_152740 176
899 3300003215 JGI25153J46596_10082937 JGI25153J46596_100829372 176
900 3300003354 JGI25160J50197_1001121 JGI25160J50197_10011212 176
901 3300003354 JGI25160J50197_1002067 JGI25160J50197_100206710 176
902 3300003354 JGI25160J50197_1032040 JGI25160J50197_10320402 176
903 3300003752 Ga0055539_1002659 Ga0055539_10026593 176
904 3300003794 Ga0055531_10011367 Ga0055531_100113675 176
905 3300005262 Ga0065165_1003932 Ga0065165_10039323 176
906 3300005262 Ga0065165_1045156 Ga0065165_10451562 176
907 3300005327 Ga0070658_10126929 Ga0070658_101269292 176
908 3300005328 Ga0070676_10290060 Ga0070676_102900602 176
909 3300005329 Ga0070683_100082583 Ga0070683_1000825832 176
910 3300005329 Ga0070683_100677158 Ga0070683_1006771582 176
911 3300005331 Ga0070670_100317610 Ga0070670_1003176101 176
912 3300005331 Ga0070670_100437679 Ga0070670_1004376791 176
913 3300005331 Ga0070670_100820204 Ga0070670_1008202041 176
914 3300005334 Ga0068869_100071759 Ga0068869_1000717593 176
915 3300005334 Ga0068869_100215603 Ga0068869_1002156032 176
916 3300005334 Ga0068869_100358232 Ga0068869_1003582322 176
917 3300005335 Ga0070666_10438190 Ga0070666_104381901 176
918 3300005336 Ga0070680_100021893 Ga0070680_1000218932 176
919 3300005336 Ga0070680_100234873 Ga0070680_1002348732 176
920 3300005336 Ga0070680_100315981 Ga0070680_1003159811 176
921 3300005336 Ga0070680_100703107 Ga0070680_1007031071 176
922 3300005337 Ga0070682_100034028 Ga0070682_1000340282 176
923 3300005337 Ga0070682_100229762 Ga0070682_1002297622 176
924 3300005338 Ga0068868_100154727 Ga0068868_1001547272 176
925 3300005338 Ga0068868_100193578 Ga0068868_1001935782 176
926 3300005338 Ga0068868_100221909 Ga0068868_1002219092 176
927 3300005338 Ga0068868_100398833 Ga0068868_1003988332 176
928 3300005338 Ga0068868_100901414 Ga0068868_1009014142 176
929 3300005339 Ga0070660_100093403 Ga0070660_1000934033 176
930 3300005339 Ga0070660_100122651 Ga0070660_1001226512 176
931 3300005339 Ga0070660_100434657 Ga0070660_1004346572 176
932 3300005339 Ga0070660_100844866 Ga0070660_1008448661 176
933 3300005340 Ga0070689_101422936 Ga0070689_1014229361 176
934 3300005344 Ga0070661_100219198 Ga0070661_1002191982 176
935 3300005344 Ga0070661_100728504 Ga0070661_1007285042 176
936 3300005345 Ga0070692_10299990 Ga0070692_102999902 176
937 3300005347 Ga0070668_100261828 Ga0070668_1002618282 176
938 3300005347 Ga0070668_100316534 Ga0070668_1003165343 176
939 3300005347 Ga0070668_100340197 Ga0070668_1003401972 176
940 3300005347 Ga0070668_100659971 Ga0070668_1006599711 176
941 3300005347 Ga0070668_100731660 Ga0070668_1007316601 176
942 3300005354 Ga0070675_100069705 Ga0070675_1000697054 176
943 3300005354 Ga0070675_100154841 Ga0070675_1001548412 176
944 3300005355 Ga0070671_100169969 Ga0070671_1001699693 176
945 3300005355 Ga0070671_100188801 Ga0070671_1001888012 176
946 3300005355 Ga0070671_100447165 Ga0070671_1004471652 176
947 3300005355 Ga0070671_100846478 Ga0070671_1008464781 176
948 3300005356 Ga0070674_100148301 Ga0070674_1001483012 176
949 3300005356 Ga0070674_100194091 Ga0070674_1001940912 176
950 3300005356 Ga0070674_100284213 Ga0070674_1002842132 176
951 3300005356 Ga0070674_100954471 Ga0070674_1009544711 176
952 3300005364 Ga0070673_100176883 Ga0070673_1001768833 176
953 3300005364 Ga0070673_100192895 Ga0070673_1001928953 176
954 3300005365 Ga0070688_100589312 Ga0070688_1005893121 176
955 3300005366 Ga0070659_100028298 Ga0070659_1000282986 176
956 3300005366 Ga0070659_100379331 Ga0070659_1003793312 176
957 3300005366 Ga0070659_100406124 Ga0070659_1004061242 176
958 3300005366 Ga0070659_100412394 Ga0070659_1004123942 176
959 3300005366 Ga0070659_100556001 Ga0070659_1005560011 176
960 3300005367 Ga0070667_100126588 Ga0070667_1001265882 176
961 3300005367 Ga0070667_100131176 Ga0070667_1001311762 176
962 3300005367 Ga0070667_101421751 Ga0070667_1014217511 176
963 3300005434 Ga0070709_10001183 Ga0070709_100011839 176
964 3300005434 Ga0070709_10002047 Ga0070709_100020471 176
965 3300005434 Ga0070709_10255174 Ga0070709_102551742 176
966 3300005434 Ga0070709_10523707 Ga0070709_105237072 176
967 3300005434 Ga0070709_10542558 Ga0070709_105425581 176
968 3300005434 Ga0070709_10792458 Ga0070709_107924581 176
969 3300005435 Ga0070714_100014031 Ga0070714_1000140318 176
970 3300005435 Ga0070714_100025356 Ga0070714_1000253567 176
971 3300005435 Ga0070714_100037866 Ga0070714_1000378666 176
972 3300005435 Ga0070714_100482390 Ga0070714_1004823902 176
973 3300005435 Ga0070714_100484883 Ga0070714_1004848832 176
974 3300005435 Ga0070714_100723580 Ga0070714_1007235801 176
975 3300005435 Ga0070714_100770573 Ga0070714_1007705732 176
976 3300005436 Ga0070713_100002056 Ga0070713_1000020566 176
977 3300005436 Ga0070713_100002424 Ga0070713_1000024246 176
978 3300005436 Ga0070713_100078945 Ga0070713_1000789453 176
979 3300005436 Ga0070713_100159180 Ga0070713_1001591802 176
980 3300005436 Ga0070713_100412843 Ga0070713_1004128432 176
981 3300005437 Ga0070710_10002631 Ga0070710_100026314 176
982 3300005437 Ga0070710_10007182 Ga0070710_100071827 176
983 3300005438 Ga0070701_10362392 Ga0070701_103623922 176
984 3300005439 Ga0070711_100004532 Ga0070711_1000045322 176
985 3300005439 Ga0070711_100034277 Ga0070711_1000342772 176
986 3300005439 Ga0070711_100223617 Ga0070711_1002236172 176
987 3300005455 Ga0070663_100007267 Ga0070663_1000072677 176
988 3300005455 Ga0070663_100103273 Ga0070663_1001032733 176
989 3300005455 Ga0070663_100116311 Ga0070663_1001163113 176
990 3300005455 Ga0070663_100157500 Ga0070663_1001575002 176
991 3300005455 Ga0070663_100238764 Ga0070663_1002387642 176
992 3300005455 Ga0070663_100393225 Ga0070663_1003932252 176
993 3300005455 Ga0070663_100787490 Ga0070663_1007874901 176
994 3300005456 Ga0070678_100038830 Ga0070678_1000388305 176
995 3300005456 Ga0070678_100040252 Ga0070678_1000402522 176
996 3300005456 Ga0070678_100079882 Ga0070678_1000798824 176
997 3300005456 Ga0070678_100147751 Ga0070678_1001477512 176
998 3300005456 Ga0070678_100654292 Ga0070678_1006542922 176
999 3300005456 Ga0070678_100690689 Ga0070678_1006906891 176
1000 3300005456 Ga0070678_100814552 Ga0070678_1008145522 176
1001 3300005457 Ga0070662_100184042 Ga0070662_1001840422 176
1002 3300005458 Ga0070681_10046167 Ga0070681_100461675 176
1003 3300005459 Ga0068867_100084004 Ga0068867_1000840043 176
1004 3300005467 Ga0070706_100168553 Ga0070706_1001685532 176
1005 3300005467 Ga0070706_100652987 Ga0070706_1006529872 176
1006 3300005467 Ga0070706_101621706 Ga0070706_1016217061 176
1007 3300005471 Ga0070698_100155406 Ga0070698_1001554064 176
1008 3300005471 Ga0070698_100442819 Ga0070698_1004428191 176
1009 3300005471 Ga0070698_101049498 Ga0070698_1010494981 176
1010 3300005518 Ga0070699_101133094 Ga0070699_1011330941 176
1011 3300005530 Ga0070679_100356179 Ga0070679_1003561791 176
1012 3300005530 Ga0070679_100638598 Ga0070679_1006385982 176
1013 3300005530 Ga0070679_101255947 Ga0070679_1012559472 176
1014 3300005535 Ga0070684_100030415 Ga0070684_1000304156 176
1015 3300005535 Ga0070684_100543653 Ga0070684_1005436531 176
1016 3300005536 Ga0070697_100209173 Ga0070697_1002091732 176
1017 3300005536 Ga0070697_101359073 Ga0070697_1013590731 176
1018 3300005539 Ga0068853_100135742 Ga0068853_1001357423 176
1019 3300005539 Ga0068853_100188534 Ga0068853_1001885342 176
1020 3300005539 Ga0068853_100250980 Ga0068853_1002509803 176
1021 3300005539 Ga0068853_100270085 Ga0068853_1002700852 176
1022 3300005539 Ga0068853_100294942 Ga0068853_1002949422 176
1023 3300005539 Ga0068853_100438892 Ga0068853_1004388922 176
1024 3300005543 Ga0070672_100258979 Ga0070672_1002589792 176
1025 3300005544 Ga0070686_100091124 Ga0070686_1000911243 176
1026 3300005544 Ga0070686_101453318 Ga0070686_1014533181 176
1027 3300005545 Ga0070695_100328597 Ga0070695_1003285971 176
1028 3300005547 Ga0070693_100164323 Ga0070693_1001643232 176
1029 3300005548 Ga0070665_100123487 Ga0070665_1001234874 176
1030 3300005548 Ga0070665_100182052 Ga0070665_1001820523 176
1031 3300005548 Ga0070665_100218270 Ga0070665_1002182703 176
1032 3300005548 Ga0070665_100280103 Ga0070665_1002801032 176
1033 3300005548 Ga0070665_100364948 Ga0070665_1003649482 176
1034 3300005548 Ga0070665_100578935 Ga0070665_1005789352 176
1035 3300005548 Ga0070665_100684506 Ga0070665_1006845062 176
1036 3300005548 Ga0070665_100759521 Ga0070665_1007595212 176
1037 3300005548 Ga0070665_100833159 Ga0070665_1008331592 176
1038 3300005548 Ga0070665_100870754 Ga0070665_1008707541 176
1039 3300005548 Ga0070665_100938932 Ga0070665_1009389321 176
1040 3300005548 Ga0070665_101613057 Ga0070665_1016130571 176
1041 3300005563 Ga0068855_100129932 Ga0068855_1001299322 176
1042 3300005563 Ga0068855_100167826 Ga0068855_1001678263 176
1043 3300005564 Ga0070664_100250334 Ga0070664_1002503343 176
1044 3300005564 Ga0070664_101196088 Ga0070664_1011960882 176
1045 3300005577 Ga0068857_100168714 Ga0068857_1001687143 176
1046 3300005577 Ga0068857_100291983 Ga0068857_1002919832 176
1047 3300005578 Ga0068854_100292675 Ga0068854_1002926752 176
1048 3300005578 Ga0068854_100460796 Ga0068854_1004607962 176
1049 3300005578 Ga0068854_100999619 Ga0068854_1009996192 176
1050 3300005578 Ga0068854_101016365 Ga0068854_1010163651 176
1051 3300005578 Ga0068854_101098080 Ga0068854_1010980802 176
1052 3300005614 Ga0068856_100060014 Ga0068856_1000600142 176
1053 3300005614 Ga0068856_100281482 Ga0068856_1002814823 176
1054 3300005614 Ga0068856_100498396 Ga0068856_1004983962 176
1055 3300005615 Ga0070702_100196428 Ga0070702_1001964282 176
1056 3300005616 Ga0068852_100060856 Ga0068852_1000608563 176
1057 3300005616 Ga0068852_100119230 Ga0068852_1001192302 176
1058 3300005616 Ga0068852_100257643 Ga0068852_1002576432 176
1059 3300005616 Ga0068852_100467050 Ga0068852_1004670501 176
1060 3300005616 Ga0068852_100854894 Ga0068852_1008548942 176
1061 3300005616 Ga0068852_100924867 Ga0068852_1009248672 176
1062 3300005617 Ga0068859_101665179 Ga0068859_1016651791 176
1063 3300005618 Ga0068864_100044295 Ga0068864_1000442952 176
1064 3300005618 Ga0068864_100222851 Ga0068864_1002228512 176
1065 3300005618 Ga0068864_100236672 Ga0068864_1002366722 176
1066 3300005618 Ga0068864_100317442 Ga0068864_1003174423 176
1067 3300005618 Ga0068864_100636986 Ga0068864_1006369862 176
1068 3300005618 Ga0068864_100764402 Ga0068864_1007644022 176
1069 3300005719 Ga0068861_100220611 Ga0068861_1002206113 176
1070 3300005719 Ga0068861_100262398 Ga0068861_1002623981 176
1071 3300005719 Ga0068861_100996437 Ga0068861_1009964371 176
1072 3300005834 Ga0068851_10254032 Ga0068851_102540322 176
1073 3300005841 Ga0068863_100812718 Ga0068863_1008127182 176
1074 3300005841 Ga0068863_101586255 Ga0068863_1015862552 176
1075 3300005842 Ga0068858_100144409 Ga0068858_1001444093 176
1076 3300005842 Ga0068858_100256252 Ga0068858_1002562523 176
1077 3300005842 Ga0068858_100306658 Ga0068858_1003066583 176
1078 3300005842 Ga0068858_100395939 Ga0068858_1003959392 176
1079 3300005843 Ga0068860_100280720 Ga0068860_1002807202 176
1080 3300005843 Ga0068860_100465397 Ga0068860_1004653971 176
1081 3300005843 Ga0068860_100670455 Ga0068860_1006704552 176
1082 3300005843 Ga0068860_100786476 Ga0068860_1007864762 176
1083 3300005843 Ga0068860_101087981 Ga0068860_1010879812 176
1084 3300005844 Ga0068862_100317800 Ga0068862_1003178003 176
1085 3300005844 Ga0068862_100466676 Ga0068862_1004666762 176
1086 3300005844 Ga0068862_100996217 Ga0068862_1009962172 176
1087 3300005937 Ga0081455_10007101 Ga0081455_100071014 176
1088 3300005983 Ga0081540_1003522 Ga0081540_100352211 176
1089 3300005983 Ga0081540_1012550 Ga0081540_10125506 176
1090 3300005983 Ga0081540_1015783 Ga0081540_10157836 176
1091 3300005983 Ga0081540_1075387 Ga0081540_10753872 176
1092 3300005985 Ga0081539_10081468 Ga0081539_100814682 176
1093 3300006028 Ga0070717_10000598 Ga0070717_1000059818 176
1094 3300006028 Ga0070717_10023337 Ga0070717_100233373 176
1095 3300006028 Ga0070717_10169579 Ga0070717_101695793 176
1096 3300006038 Ga0075365_10027661 Ga0075365_100276614 176
1097 3300006038 Ga0075365_10063183 Ga0075365_100631832 176
1098 3300006038 Ga0075365_10087003 Ga0075365_100870032 176
1099 3300006038 Ga0075365_10264180 Ga0075365_102641802 176
1100 3300006042 Ga0075368_10005988 Ga0075368_100059882 176
1101 3300006042 Ga0075368_10183007 Ga0075368_101830071 176
1102 3300006042 Ga0075368_10193902 Ga0075368_101939022 176
1103 3300006042 Ga0075368_10194840 Ga0075368_101948401 176
1104 3300006048 Ga0075363_100008692 Ga0075363_1000086927 176
1105 3300006048 Ga0075363_100050670 Ga0075363_1000506703 176
1106 3300006048 Ga0075363_100348554 Ga0075363_1003485542 176
1107 3300006048 Ga0075363_100468350 Ga0075363_1004683501 176
1108 3300006051 Ga0075364_10471996 Ga0075364_104719962 176
1109 3300006051 Ga0075364_10573121 Ga0075364_105731211 176
1110 3300006051 Ga0075364_10752970 Ga0075364_107529701 176
1111 3300006058 Ga0075432_10079793 Ga0075432_100797932 176
1112 3300006163 Ga0070715_10001673 Ga0070715_100016735 176
1113 3300006163 Ga0070715_10037875 Ga0070715_100378752 176
1114 3300006173 Ga0070716_100011397 Ga0070716_1000113973 176
1115 3300006173 Ga0070716_100077216 Ga0070716_1000772162 176
1116 3300006173 Ga0070716_100793012 Ga0070716_1007930121 176
1117 3300006173 Ga0070716_101122963 Ga0070716_1011229632 176
1118 3300006175 Ga0070712_100017822 Ga0070712_1000178226 176
1119 3300006175 Ga0070712_100034599 Ga0070712_1000345993 176
1120 3300006175 Ga0070712_100043417 Ga0070712_1000434174 176
1121 3300006175 Ga0070712_100182425 Ga0070712_1001824252 176
1122 3300006175 Ga0070712_100367116 Ga0070712_1003671162 176
1123 3300006177 Ga0075362_10063945 Ga0075362_100639452 176
1124 3300006177 Ga0075362_10363798 Ga0075362_103637981 176
1125 3300006178 Ga0075367_10003520 Ga0075367_100035208 176
1126 3300006178 Ga0075367_10039183 Ga0075367_100391832 176
1127 3300006178 Ga0075367_10092705 Ga0075367_100927053 176
1128 3300006178 Ga0075367_10183832 Ga0075367_101838322 176
1129 3300006178 Ga0075367_10281965 Ga0075367_102819652 176
1130 3300006178 Ga0075367_10312573 Ga0075367_103125732 176
1131 3300006186 Ga0075369_10115792 Ga0075369_101157922 176
1132 3300006186 Ga0075369_10122647 Ga0075369_101226472 176
1133 3300006195 Ga0075366_10403288 Ga0075366_104032881 176
1134 3300006195 Ga0075366_10556171 Ga0075366_105561712 176
1135 3300006237 Ga0097621_100736626 Ga0097621_1007366261 176
1136 3300006353 Ga0075370_10138880 Ga0075370_101388802 176
1137 3300006353 Ga0075370_10418014 Ga0075370_104180141 176
1138 3300006353 Ga0075370_10505514 Ga0075370_105055141 176
1139 3300006358 Ga0068871_100068569 Ga0068871_1000685692 176
1140 3300006358 Ga0068871_100578052 Ga0068871_1005780522 176
1141 3300006844 Ga0075428_100508019 Ga0075428_1005080191 176
1142 3300006844 Ga0075428_100835098 Ga0075428_1008350981 176
1143 3300006881 Ga0068865_100168927 Ga0068865_1001689272 176
1144 3300006881 Ga0068865_100186076 Ga0068865_1001860762 176
1145 3300006881 Ga0068865_100349374 Ga0068865_1003493742 176
1146 3300006881 Ga0068865_100725039 Ga0068865_1007250392 176
1147 3300006931 Ga0097620_101665284 Ga0097620_1016652841 176
1148 3300006941 Ga0099825_1041705 Ga0099825_10417052 176
1149 3300006942 Ga0099824_1014421 Ga0099824_10144216 176
1150 3300006943 Ga0099822_1066359 Ga0099822_10663592 176
1151 3300006944 Ga0099823_1033731 Ga0099823_10337312 176
1152 3300007076 Ga0075435_100354073 Ga0075435_1003540732 176
1153 3300007265 Ga0099794_10061710 Ga0099794_100617102 176
1154 3300007788 Ga0099795_10077633 Ga0099795_100776332 176
1155 3300007788 Ga0099795_10200946 Ga0099795_102009462 176
1156 3300007788 Ga0099795_10322464 Ga0099795_103224641 176
1157 3300009092 Ga0105250_10091468 Ga0105250_100914682 176
1158 3300009093 Ga0105240_10003692 Ga0105240_1000369211 176
1159 3300009093 Ga0105240_10058527 Ga0105240_100585272 176
1160 3300009093 Ga0105240_10109244 Ga0105240_101092443 176
1161 3300009093 Ga0105240_10232402 Ga0105240_102324022 176
1162 3300009093 Ga0105240_10245972 Ga0105240_102459724 176
1163 3300009093 Ga0105240_10397198 Ga0105240_103971982 176
1164 3300009093 Ga0105240_10749915 Ga0105240_107499152 176
1165 3300009093 Ga0105240_10930736 Ga0105240_109307362 176
1166 3300009093 Ga0105240_11551465 Ga0105240_115514651 176
1167 3300009094 Ga0111539_10509565 Ga0111539_105095652 176
1168 3300009094 Ga0111539_10723090 Ga0111539_107230902 176
1169 3300009098 Ga0105245_10214346 Ga0105245_102143463 176
1170 3300009098 Ga0105245_10526512 Ga0105245_105265122 176
1171 3300009098 Ga0105245_10803147 Ga0105245_108031472 176
1172 3300009098 Ga0105245_11396820 Ga0105245_113968201 176
1173 3300009098 Ga0105245_11499279 Ga0105245_114992791 176
1174 3300009101 Ga0105247_10048692 Ga0105247_100486923 176
1175 3300009101 Ga0105247_10191981 Ga0105247_101919812 176
1176 3300009101 Ga0105247_10297795 Ga0105247_102977952 176
1177 3300009101 Ga0105247_10708285 Ga0105247_107082852 176
1178 3300009148 Ga0105243_10918277 Ga0105243_109182771 176
1179 3300009174 Ga0105241_10031270 Ga0105241_100312702 176
1180 3300009174 Ga0105241_10073022 Ga0105241_100730222 176
1181 3300009174 Ga0105241_10129938 Ga0105241_101299383 176
1182 3300009174 Ga0105241_10295700 Ga0105241_102957002 176
1183 3300009174 Ga0105241_10503033 Ga0105241_105030332 176
1184 3300009174 Ga0105241_10508630 Ga0105241_105086302 176
1185 3300009174 Ga0105241_10670301 Ga0105241_106703011 176
1186 3300009174 Ga0105241_10926027 Ga0105241_109260272 176
1187 3300009176 Ga0105242_10272548 Ga0105242_102725482 176
1188 3300009176 Ga0105242_10563659 Ga0105242_105636592 176
1189 3300009176 Ga0105242_10620734 Ga0105242_106207342 176
1190 3300009176 Ga0105242_11119497 Ga0105242_111194972 176
1191 3300009176 Ga0105242_11796028 Ga0105242_117960281 176
1192 3300009177 Ga0105248_10548045 Ga0105248_105480452 176
1193 3300009177 Ga0105248_10711207 Ga0105248_107112072 176
1194 3300009177 Ga0105248_10722682 Ga0105248_107226822 176
1195 3300009545 Ga0105237_10013371 Ga0105237_100133719 176
1196 3300009545 Ga0105237_10075926 Ga0105237_100759262 176
1197 3300009545 Ga0105237_10260777 Ga0105237_102607772 176
1198 3300009545 Ga0105237_10303036 Ga0105237_103030362 176
1199 3300009545 Ga0105237_10396698 Ga0105237_103966982 176
1200 3300009545 Ga0105237_10801653 Ga0105237_108016532 176
1201 3300009545 Ga0105237_10813756 Ga0105237_108137562 176
1202 3300009545 Ga0105237_11106715 Ga0105237_111067151 176
1203 3300009551 Ga0105238_10499759 Ga0105238_104997592 176
1204 3300009551 Ga0105238_10521658 Ga0105238_105216582 176
1205 3300009551 Ga0105238_10663803 Ga0105238_106638032 176
1206 3300009551 Ga0105238_10944742 Ga0105238_109447422 176
1207 3300009551 Ga0105238_11103452 Ga0105238_111034521 176
1208 3300009553 Ga0105249_10439689 Ga0105249_104396892 176
1209 3300009553 Ga0105249_11456771 Ga0105249_114567712 176
1210 3300010159 Ga0099796_10097202 Ga0099796_100972022 176
1211 3300010375 Ga0105239_10016720 Ga0105239_100167209 176
1212 3300010375 Ga0105239_10041875 Ga0105239_100418753 176
1213 3300010375 Ga0105239_10081881 Ga0105239_100818815 176
1214 3300010375 Ga0105239_10185080 Ga0105239_101850803 176
1215 3300010375 Ga0105239_10456220 Ga0105239_104562202 176
1216 3300010375 Ga0105239_10695614 Ga0105239_106956142 176
1217 3300010375 Ga0105239_10928893 Ga0105239_109288932 176
1218 3300010375 Ga0105239_10983870 Ga0105239_109838702 176
1219 3300010375 Ga0105239_11087202 Ga0105239_110872022 176
1220 3300011119 Ga0105246_10136861 Ga0105246_101368613 176
1221 3300011119 Ga0105246_10415732 Ga0105246_104157322 176
1222 3300013104 Ga0157370_11008524 Ga0157370_110085242 176
1223 3300013105 Ga0157369_10095205 Ga0157369_100952052 176
1224 3300013105 Ga0157369_10141449 Ga0157369_101414493 176
1225 3300013105 Ga0157369_10856238 Ga0157369_108562382 176
1226 3300013105 Ga0157369_11407354 Ga0157369_114073542 176
1227 3300013296 Ga0157374_10082621 Ga0157374_100826213 176
1228 3300013296 Ga0157374_10085571 Ga0157374_100855713 176
1229 3300013296 Ga0157374_10314610 Ga0157374_103146102 176
1230 3300013296 Ga0157374_10505801 Ga0157374_105058012 176
1231 3300013296 Ga0157374_11319380 Ga0157374_113193802 176
1232 3300013296 Ga0157374_11512048 Ga0157374_115120481 176
1233 3300013297 Ga0157378_10026970 Ga0157378_100269706 176
1234 3300013297 Ga0157378_10204429 Ga0157378_102044293 176
1235 3300013297 Ga0157378_10411100 Ga0157378_104111003 176
1236 3300013297 Ga0157378_10790993 Ga0157378_107909932 176
1237 3300013297 Ga0157378_11511763 Ga0157378_115117631 176
1238 3300013306 Ga0163162_10280970 Ga0163162_102809702 176
1239 3300013306 Ga0163162_10409825 Ga0163162_104098252 176
1240 3300013306 Ga0163162_10561147 Ga0163162_105611472 176
1241 3300013306 Ga0163162_10675928 Ga0163162_106759282 176
1242 3300013306 Ga0163162_10724638 Ga0163162_107246382 176
1243 3300013306 Ga0163162_11316289 Ga0163162_113162892 176
1244 3300013307 Ga0157372_10493587 Ga0157372_104935873 176
1245 3300013308 Ga0157375_10087610 Ga0157375_100876102 176
1246 3300013308 Ga0157375_10344595 Ga0157375_103445953 176
1247 3300013308 Ga0157375_10470136 Ga0157375_104701362 176
1248 3300013308 Ga0157375_10874533 Ga0157375_108745332 176
1249 3300013308 Ga0157375_11073115 Ga0157375_110731152 176
1250 3300013308 Ga0157375_11389419 Ga0157375_113894192 176
1251 3300013308 Ga0157375_12057344 Ga0157375_120573441 176
1252 3300013308 Ga0157375_12232766 Ga0157375_122327661 176
1253 3300014325 Ga0163163_10023630 Ga0163163_100236304 176
1254 3300014325 Ga0163163_10103930 Ga0163163_101039301 176
1255 3300014325 Ga0163163_10344325 Ga0163163_103443252 176
1256 3300014325 Ga0163163_10405781 Ga0163163_104057812 176
1257 3300014325 Ga0163163_10441437 Ga0163163_104414372 176
1258 3300014325 Ga0163163_11914759 Ga0163163_119147591 176
1259 3300014326 Ga0157380_11189124 Ga0157380_111891242 176
1260 3300014745 Ga0157377_10529884 Ga0157377_105298841 176
1261 3300014968 Ga0157379_10130611 Ga0157379_101306112 176
1262 3300014968 Ga0157379_10231253 Ga0157379_102312532 176
1263 3300014968 Ga0157379_10267297 Ga0157379_102672973 176
1264 3300014968 Ga0157379_10483823 Ga0157379_104838232 176
1265 3300014969 Ga0157376_10033090 Ga0157376_100330903 176
1266 3300014969 Ga0157376_10074426 Ga0157376_100744262 176
1267 3300014969 Ga0157376_10236899 Ga0157376_102368992 176
1268 3300014969 Ga0157376_10360595 Ga0157376_103605952 176
1269 3300014969 Ga0157376_10787087 Ga0157376_107870872 176
1270 3300015261 Ga0182006_1068530 Ga0182006_10685302 176
1271 3300017792 Ga0163161_10272271 Ga0163161_102722712 176
1272 3300017792 Ga0163161_10538920 Ga0163161_105389202 176
1273 3300020070 Ga0206356_10700491 Ga0206356_107004912 176
1274 3300021320 Ga0214544_1000016 Ga0214544_1000016190 176
1275 3300021321 Ga0214542_1000016 Ga0214542_100001612 176
1276 3300021324 Ga0214545_1000008 Ga0214545_100000818 176
1277 3300021327 Ga0214543_1001466 Ga0214543_100146612 176
1278 3300021327 Ga0214543_1046469 Ga0214543_10464692 176
1279 3300021327 Ga0214543_1047539 Ga0214543_10475392 176
1280 3300021384 Ga0213876_10238427 Ga0213876_102384272 176
1281 3300021384 Ga0213876_10528082 Ga0213876_105280821 176
1282 3300025253 Ga0209677_107016 Ga0209677_1070164 176
1283 3300025254 Ga0209148_1000275 Ga0209148_100027579 176
1284 3300025261 Ga0209233_1006675 Ga0209233_10066752 176
1285 3300025261 Ga0209233_1007954 Ga0209233_10079543 176
1286 3300025261 Ga0209233_1016327 Ga0209233_10163272 176
1287 3300025272 Ga0209455_1033392 Ga0209455_10333922 176
1288 3300025273 Ga0209673_1081895 Ga0209673_10818952 176
1289 3300025295 Ga0209564_1032782 Ga0209564_10327822 176
1290 3300025297 Ga0209758_1000069 Ga0209758_100006932 176
1291 3300025297 Ga0209758_1000635 Ga0209758_100063520 176
1292 3300025297 Ga0209758_1000695 Ga0209758_100069548 176
1293 3300025297 Ga0209758_1002443 Ga0209758_100244319 176
1294 3300025297 Ga0209758_1006620 Ga0209758_10066208 176
1295 3300025297 Ga0209758_1017993 Ga0209758_10179932 176
1296 3300025297 Ga0209758_1021052 Ga0209758_10210522 176
1297 3300025297 Ga0209758_1062932 Ga0209758_10629322 176
1298 3300025297 Ga0209758_1109110 Ga0209758_11091102 176
1299 3300025299 Ga0209256_1006920 Ga0209256_10069203 176
1300 3300025299 Ga0209256_1056111 Ga0209256_10561112 176
1301 3300025302 Ga0207426_1000826 Ga0207426_100082620 176
1302 3300025302 Ga0207426_1002297 Ga0207426_100229710 176
1303 3300025302 Ga0207426_1005144 Ga0207426_10051446 176
1304 3300025304 Ga0209257_1000473 Ga0209257_100047321 176
1305 3300025304 Ga0209257_1012596 Ga0209257_10125962 176
1306 3300025315 Ga0207697_10019378 Ga0207697_100193783 176
1307 3300025321 Ga0207656_10328059 Ga0207656_103280592 176
1308 3300025898 Ga0207692_10001284 Ga0207692_100012849 176
1309 3300025898 Ga0207692_10030706 Ga0207692_100307062 176
1310 3300025898 Ga0207692_10403762 Ga0207692_104037621 176
1311 3300025899 Ga0207642_10286154 Ga0207642_102861542 176
1312 3300025900 Ga0207710_10105965 Ga0207710_101059652 176
1313 3300025900 Ga0207710_10166524 Ga0207710_101665242 176
1314 3300025900 Ga0207710_10172977 Ga0207710_101729772 176
1315 3300025900 Ga0207710_10181296 Ga0207710_101812962 176
1316 3300025901 Ga0207688_10066663 Ga0207688_100666632 176
1317 3300025901 Ga0207688_10138071 Ga0207688_101380712 176
1318 3300025903 Ga0207680_10278587 Ga0207680_102785872 176
1319 3300025903 Ga0207680_10361762 Ga0207680_103617622 176
1320 3300025904 Ga0207647_10002277 Ga0207647_100022773 176
1321 3300025904 Ga0207647_10160831 Ga0207647_101608312 176
1322 3300025904 Ga0207647_10182548 Ga0207647_101825482 176
1323 3300025905 Ga0207685_10035202 Ga0207685_100352022 176
1324 3300025905 Ga0207685_10064982 Ga0207685_100649822 176
1325 3300025906 Ga0207699_10020586 Ga0207699_100205862 176
1326 3300025907 Ga0207645_10100805 Ga0207645_101008052 176
1327 3300025908 Ga0207643_10444546 Ga0207643_104445462 176
1328 3300025908 Ga0207643_10509910 Ga0207643_105099101 176
1329 3300025908 Ga0207643_10548726 Ga0207643_105487261 176
1330 3300025909 Ga0207705_10213923 Ga0207705_102139231 176
1331 3300025909 Ga0207705_10452548 Ga0207705_104525482 176
1332 3300025909 Ga0207705_10866062 Ga0207705_108660621 176
1333 3300025910 Ga0207684_10072422 Ga0207684_100724222 176
1334 3300025910 Ga0207684_10417161 Ga0207684_104171612 176
1335 3300025911 Ga0207654_10351545 Ga0207654_103515451 176
1336 3300025911 Ga0207654_10378327 Ga0207654_103783272 176
1337 3300025911 Ga0207654_10550830 Ga0207654_105508302 176
1338 3300025912 Ga0207707_10204133 Ga0207707_102041332 176
1339 3300025912 Ga0207707_10663222 Ga0207707_106632222 176
1340 3300025913 Ga0207695_10000107 Ga0207695_10000107204 176
1341 3300025913 Ga0207695_10165664 Ga0207695_101656642 176
1342 3300025913 Ga0207695_10255092 Ga0207695_102550922 176
1343 3300025913 Ga0207695_10364668 Ga0207695_103646683 176
1344 3300025913 Ga0207695_10535680 Ga0207695_105356802 176
1345 3300025913 Ga0207695_11199309 Ga0207695_111993091 176
1346 3300025914 Ga0207671_10043131 Ga0207671_100431315 176
1347 3300025914 Ga0207671_10113801 Ga0207671_101138012 176
1348 3300025914 Ga0207671_10220763 Ga0207671_102207632 176
1349 3300025914 Ga0207671_10300641 Ga0207671_103006412 176
1350 3300025914 Ga0207671_10345483 Ga0207671_103454832 176
1351 3300025915 Ga0207693_10003195 Ga0207693_1000319511 176
1352 3300025915 Ga0207693_10006870 Ga0207693_1000687010 176
1353 3300025915 Ga0207693_10151462 Ga0207693_101514623 176
1354 3300025916 Ga0207663_10000404 Ga0207663_1000040412 176
1355 3300025916 Ga0207663_10110362 Ga0207663_101103622 176
1356 3300025916 Ga0207663_10401266 Ga0207663_104012662 176
1357 3300025917 Ga0207660_10038196 Ga0207660_100381964 176
1358 3300025917 Ga0207660_10224414 Ga0207660_102244142 176
1359 3300025917 Ga0207660_10260726 Ga0207660_102607262 176
1360 3300025919 Ga0207657_10071982 Ga0207657_100719824 176
1361 3300025919 Ga0207657_10115685 Ga0207657_101156854 176
1362 3300025919 Ga0207657_10171286 Ga0207657_101712863 176
1363 3300025919 Ga0207657_10305927 Ga0207657_103059272 176
1364 3300025920 Ga0207649_10189714 Ga0207649_101897142 176
1365 3300025920 Ga0207649_10283976 Ga0207649_102839762 176
1366 3300025920 Ga0207649_10379840 Ga0207649_103798401 176
1367 3300025920 Ga0207649_10400369 Ga0207649_104003692 176
1368 3300025921 Ga0207652_10240986 Ga0207652_102409862 176
1369 3300025921 Ga0207652_10619669 Ga0207652_106196692 176
1370 3300025922 Ga0207646_10140083 Ga0207646_101400833 176
1371 3300025923 Ga0207681_10065884 Ga0207681_100658844 176
1372 3300025924 Ga0207694_10308236 Ga0207694_103082362 176
1373 3300025924 Ga0207694_10434138 Ga0207694_104341382 176
1374 3300025925 Ga0207650_10164909 Ga0207650_101649092 176
1375 3300025925 Ga0207650_10303465 Ga0207650_103034652 176
1376 3300025925 Ga0207650_11238850 Ga0207650_112388502 176
1377 3300025926 Ga0207659_10234781 Ga0207659_102347813 176
1378 3300025928 Ga0207700_10001725 Ga0207700_100017259 176
1379 3300025928 Ga0207700_10028048 Ga0207700_100280485 176
1380 3300025928 Ga0207700_10059459 Ga0207700_100594592 176
1381 3300025928 Ga0207700_10120590 Ga0207700_101205903 176
1382 3300025928 Ga0207700_10565168 Ga0207700_105651681 176
1383 3300025929 Ga0207664_10017118 Ga0207664_100171186 176
1384 3300025929 Ga0207664_10028923 Ga0207664_100289232 176
1385 3300025929 Ga0207664_10738060 Ga0207664_107380602 176
1386 3300025931 Ga0207644_10020869 Ga0207644_100208696 176
1387 3300025931 Ga0207644_10130097 Ga0207644_101300972 176
1388 3300025931 Ga0207644_10254632 Ga0207644_102546322 176
1389 3300025932 Ga0207690_10043581 Ga0207690_100435814 176
1390 3300025932 Ga0207690_10325776 Ga0207690_103257762 176
1391 3300025932 Ga0207690_10606226 Ga0207690_106062262 176
1392 3300025933 Ga0207706_10012728 Ga0207706_100127286 176
1393 3300025933 Ga0207706_10260866 Ga0207706_102608663 176
1394 3300025933 Ga0207706_10642640 Ga0207706_106426402 176
1395 3300025934 Ga0207686_10065084 Ga0207686_100650843 176
1396 3300025934 Ga0207686_10338464 Ga0207686_103384642 176
1397 3300025934 Ga0207686_10393038 Ga0207686_103930382 176
1398 3300025934 Ga0207686_10522343 Ga0207686_105223432 176
1399 3300025934 Ga0207686_10888562 Ga0207686_108885621 176
1400 3300025935 Ga0207709_10032140 Ga0207709_100321404 176
1401 3300025935 Ga0207709_10772856 Ga0207709_107728562 176
1402 3300025935 Ga0207709_11046077 Ga0207709_110460771 176
1403 3300025936 Ga0207670_10422494 Ga0207670_104224942 176
1404 3300025936 Ga0207670_10472956 Ga0207670_104729562 176
1405 3300025936 Ga0207670_10610462 Ga0207670_106104622 176
1406 3300025936 Ga0207670_10762209 Ga0207670_107622091 176
1407 3300025937 Ga0207669_10080009 Ga0207669_100800092 176
1408 3300025937 Ga0207669_10149175 Ga0207669_101491753 176
1409 3300025937 Ga0207669_10764853 Ga0207669_107648532 176
1410 3300025937 Ga0207669_11178749 Ga0207669_111787491 176
1411 3300025938 Ga0207704_10199416 Ga0207704_101994162 176
1412 3300025938 Ga0207704_10407965 Ga0207704_104079652 176
1413 3300025938 Ga0207704_11115897 Ga0207704_111158971 176
1414 3300025938 Ga0207704_11403343 Ga0207704_114033431 176
1415 3300025939 Ga0207665_10001034 Ga0207665_1000103411 176
1416 3300025939 Ga0207665_10051444 Ga0207665_100514443 176
1417 3300025939 Ga0207665_10078086 Ga0207665_100780862 176
1418 3300025940 Ga0207691_10219174 Ga0207691_102191742 176
1419 3300025940 Ga0207691_10259215 Ga0207691_102592152 176
1420 3300025940 Ga0207691_11211659 Ga0207691_112116591 176
1421 3300025941 Ga0207711_10293948 Ga0207711_102939482 176
1422 3300025941 Ga0207711_10361441 Ga0207711_103614412 176
1423 3300025941 Ga0207711_10580103 Ga0207711_105801031 176
1424 3300025942 Ga0207689_10262663 Ga0207689_102626632 176
1425 3300025944 Ga0207661_10006554 Ga0207661_100065547 176
1426 3300025944 Ga0207661_10433655 Ga0207661_104336552 176
1427 3300025945 Ga0207679_10653419 Ga0207679_106534191 176
1428 3300025949 Ga0207667_10126419 Ga0207667_101264192 176
1429 3300025949 Ga0207667_10657710 Ga0207667_106577101 176
1430 3300025960 Ga0207651_10129801 Ga0207651_101298012 176
1431 3300025960 Ga0207651_10131015 Ga0207651_101310153 176
1432 3300025960 Ga0207651_10152310 Ga0207651_101523102 176
1433 3300025960 Ga0207651_10464890 Ga0207651_104648902 176
1434 3300025960 Ga0207651_10717877 Ga0207651_107178772 176
1435 3300025961 Ga0207712_10191767 Ga0207712_101917671 176
1436 3300025961 Ga0207712_10340140 Ga0207712_103401402 176
1437 3300025961 Ga0207712_10392560 Ga0207712_103925602 176
1438 3300025961 Ga0207712_11158644 Ga0207712_111586442 176
1439 3300025972 Ga0207668_10068903 Ga0207668_100689034 176
1440 3300025972 Ga0207668_10145429 Ga0207668_101454293 176
1441 3300025972 Ga0207668_10193823 Ga0207668_101938233 176
1442 3300025972 Ga0207668_10200311 Ga0207668_102003112 176
1443 3300025972 Ga0207668_10217042 Ga0207668_102170422 176
1444 3300025972 Ga0207668_10926065 Ga0207668_109260652 176
1445 3300025981 Ga0207640_10578119 Ga0207640_105781192 176
1446 3300025981 Ga0207640_10596066 Ga0207640_105960662 176
1447 3300025981 Ga0207640_11506810 Ga0207640_115068101 176
1448 3300025986 Ga0207658_10082355 Ga0207658_100823554 176
1449 3300025986 Ga0207658_10114391 Ga0207658_101143913 176
1450 3300025986 Ga0207658_10358568 Ga0207658_103585682 176
1451 3300025986 Ga0207658_10431012 Ga0207658_104310122 176
1452 3300025986 Ga0207658_10954256 Ga0207658_109542562 176
1453 3300026023 Ga0207677_10270948 Ga0207677_102709482 176
1454 3300026023 Ga0207677_10331515 Ga0207677_103315152 176
1455 3300026023 Ga0207677_10675194 Ga0207677_106751942 176
1456 3300026035 Ga0207703_10078142 Ga0207703_100781423 176
1457 3300026035 Ga0207703_10139500 Ga0207703_101395002 176
1458 3300026035 Ga0207703_10337963 Ga0207703_103379632 176
1459 3300026035 Ga0207703_10731748 Ga0207703_107317482 176
1460 3300026041 Ga0207639_10033329 Ga0207639_100333294 176
1461 3300026041 Ga0207639_10058662 Ga0207639_100586623 176
1462 3300026041 Ga0207639_10210960 Ga0207639_102109602 176
1463 3300026041 Ga0207639_10242186 Ga0207639_102421863 176
1464 3300026041 Ga0207639_10283630 Ga0207639_102836302 176
1465 3300026041 Ga0207639_10635570 Ga0207639_106355702 176
1466 3300026041 Ga0207639_10892389 Ga0207639_108923891 176
1467 3300026067 Ga0207678_10069768 Ga0207678_100697684 176
1468 3300026067 Ga0207678_10121226 Ga0207678_101212263 176
1469 3300026067 Ga0207678_10182812 Ga0207678_101828122 176
1470 3300026067 Ga0207678_10236693 Ga0207678_102366933 176
1471 3300026067 Ga0207678_10262057 Ga0207678_102620572 176
1472 3300026067 Ga0207678_10383939 Ga0207678_103839392 176
1473 3300026067 Ga0207678_10607215 Ga0207678_106072152 176
1474 3300026067 Ga0207678_10788587 Ga0207678_107885871 176
1475 3300026067 Ga0207678_10938216 Ga0207678_109382162 176
1476 3300026075 Ga0207708_10072730 Ga0207708_100727305 176
1477 3300026075 Ga0207708_10448670 Ga0207708_104486702 176
1478 3300026075 Ga0207708_10885026 Ga0207708_108850262 176
1479 3300026078 Ga0207702_10466731 Ga0207702_104667312 176
1480 3300026078 Ga0207702_10646627 Ga0207702_106466272 176
1481 3300026078 Ga0207702_10719843 Ga0207702_107198432 176
1482 3300026078 Ga0207702_11034036 Ga0207702_110340362 176
1483 3300026088 Ga0207641_10491308 Ga0207641_104913082 176
1484 3300026088 Ga0207641_10971664 Ga0207641_109716642 176
1485 3300026088 Ga0207641_11031423 Ga0207641_110314232 176
1486 3300026089 Ga0207648_10043824 Ga0207648_100438243 176
1487 3300026089 Ga0207648_10061595 Ga0207648_100615954 176
1488 3300026095 Ga0207676_10147248 Ga0207676_101472483 176
1489 3300026095 Ga0207676_10181723 Ga0207676_101817233 176
1490 3300026095 Ga0207676_10323232 Ga0207676_103232322 176
1491 3300026095 Ga0207676_10533731 Ga0207676_105337312 176
1492 3300026095 Ga0207676_10577306 Ga0207676_105773062 176
1493 3300026095 Ga0207676_10952136 Ga0207676_109521362 176
1494 3300026116 Ga0207674_10177088 Ga0207674_101770883 176
1495 3300026116 Ga0207674_10258150 Ga0207674_102581502 176
1496 3300026116 Ga0207674_10305663 Ga0207674_103056632 176
1497 3300026118 Ga0207675_100145742 Ga0207675_1001457423 176
1498 3300026118 Ga0207675_100330734 Ga0207675_1003307342 176
1499 3300026118 Ga0207675_100400940 Ga0207675_1004009402 176
1500 3300026121 Ga0207683_10128189 Ga0207683_101281893 176
1501 3300026121 Ga0207683_10244893 Ga0207683_102448932 176
1502 3300026121 Ga0207683_10280143 Ga0207683_102801434 176
1503 3300026121 Ga0207683_10336618 Ga0207683_103366182 176
1504 3300026121 Ga0207683_10338476 Ga0207683_103384762 176
1505 3300026121 Ga0207683_10413822 Ga0207683_104138222 176
1506 3300026121 Ga0207683_10735653 Ga0207683_107356532 176
1507 3300026142 Ga0207698_10017851 Ga0207698_100178512 176
1508 3300026142 Ga0207698_10144192 Ga0207698_101441923 176
1509 3300026142 Ga0207698_10169371 Ga0207698_101693712 176
1510 3300026142 Ga0207698_10229818 Ga0207698_102298182 176
1511 3300026142 Ga0207698_10634019 Ga0207698_106340192 176
1512 3300026142 Ga0207698_10671936 Ga0207698_106719362 176
1513 3300026142 Ga0207698_10798598 Ga0207698_107985982 176
1514 3300027296 Ga0209389_1000033 Ga0209389_100003310 176
1515 3300027296 Ga0209389_1000182 Ga0209389_100018224 176
1516 3300027357 Ga0209589_1000040 Ga0209589_100004010 176
1517 3300027361 Ga0209489_100045 Ga0209489_10004522 176
1518 3300027361 Ga0209489_100209 Ga0209489_10020924 176
1519 3300027363 Ga0209700_100011 Ga0209700_100011177 176
1520 3300027512 Ga0209179_1029476 Ga0209179_10294762 176
1521 3300027671 Ga0209588_1017691 Ga0209588_10176913 176
1522 3300027866 Ga0209813_10039420 Ga0209813_100394202 176
1523 3300027907 Ga0207428_10068381 Ga0207428_100683815 176
1524 3300028379 Ga0268266_10003966 Ga0268266_100039662 176
1525 3300028379 Ga0268266_10006104 Ga0268266_100061042 176
1526 3300028379 Ga0268266_10040428 Ga0268266_100404282 176
1527 3300028379 Ga0268266_10099347 Ga0268266_100993472 176
1528 3300028379 Ga0268266_10180127 Ga0268266_101801273 176
1529 3300028379 Ga0268266_10212183 Ga0268266_102121832 176
1530 3300028379 Ga0268266_10298409 Ga0268266_102984091 176
1531 3300028379 Ga0268266_10560392 Ga0268266_105603922 176
1532 3300028379 Ga0268266_10560569 Ga0268266_105605691 176
1533 3300028379 Ga0268266_10727120 Ga0268266_107271202 176
1534 3300028379 Ga0268266_10801874 Ga0268266_108018742 176
1535 3300028379 Ga0268266_11368562 Ga0268266_113685621 176
1536 3300028380 Ga0268265_10028336 Ga0268265_100283366 176
1537 3300028380 Ga0268265_10110006 Ga0268265_101100061 176
1538 3300028380 Ga0268265_10142082 Ga0268265_101420822 176
1539 3300028380 Ga0268265_10694420 Ga0268265_106944202 176
1540 3300028380 Ga0268265_10741620 Ga0268265_107416201 176
1541 3300028380 Ga0268265_11081305 Ga0268265_110813051 176
1542 3300028380 Ga0268265_11199603 Ga0268265_111996031 176
1543 3300028381 Ga0268264_10107873 Ga0268264_101078733 176
1544 3300028381 Ga0268264_10117569 Ga0268264_101175692 176
1545 3300028381 Ga0268264_10176788 Ga0268264_101767882 176
1546 3300028381 Ga0268264_10339235 Ga0268264_103392352 176
1547 3300028381 Ga0268264_10502262 Ga0268264_105022622 176
1548 3300028381 Ga0268264_10805540 Ga0268264_108055402 176
1549 3300028381 Ga0268264_11156318 Ga0268264_111563181 176
1550 3300028786 Ga0307517_10001338 Ga0307517_1000133814 176
1551 3300028786 Ga0307517_10204742 Ga0307517_102047422 176
1552 3300028786 Ga0307517_10302602 Ga0307517_103026021 176
1553 3300028794 Ga0307515_10036525 Ga0307515_100365252 176
1554 3300030521 Ga0307511_10221685 Ga0307511_102216852 176
1555 3300030522 Ga0307512_10301480 Ga0307512_103014801 176
1556 3300031235 Ga0265330_10015338 Ga0265330_100153385 176
1557 3300031235 Ga0265330_10016402 Ga0265330_100164022 176
1558 3300031235 Ga0265330_10217564 Ga0265330_102175642 176
1559 3300031238 Ga0265332_10002811 Ga0265332_100028116 176
1560 3300031239 Ga0265328_10043979 Ga0265328_100439793 176
1561 3300031241 Ga0265325_10007580 Ga0265325_100075808 176
1562 3300031247 Ga0265340_10003064 Ga0265340_100030646 176
1563 3300031249 Ga0265339_10053849 Ga0265339_100538494 176
1564 3300031250 Ga0265331_10010008 Ga0265331_100100087 176
1565 3300031250 Ga0265331_10024962 Ga0265331_100249623 176
1566 3300031344 Ga0265316_10127547 Ga0265316_101275472 176
1567 3300031344 Ga0265316_10273040 Ga0265316_102730402 176
1568 3300031507 Ga0307509_10132253 Ga0307509_101322534 176
1569 3300031548 Ga0307408_100147996 Ga0307408_1001479962 176
1570 3300031595 Ga0265313_10055192 Ga0265313_100551923 176
1571 3300031616 Ga0307508_10128550 Ga0307508_101285502 176
1572 3300031711 Ga0265314_10015101 Ga0265314_100151015 176
1573 3300031711 Ga0265314_10037169 Ga0265314_100371695 176
1574 3300031712 Ga0265342_10003978 Ga0265342_1000397812 176
1575 3300031712 Ga0265342_10034285 Ga0265342_100342854 176
1576 3300031712 Ga0265342_10164508 Ga0265342_101645082 176
1577 3300031730 Ga0307516_10008231 Ga0307516_100082313 176
1578 3300031730 Ga0307516_10189841 Ga0307516_101898412 176
1579 3300031730 Ga0307516_10291589 Ga0307516_102915891 176
1580 3300031730 Ga0307516_10304144 Ga0307516_103041442 176
1581 3300031730 Ga0307516_10335353 Ga0307516_103353532 176
1582 3300031731 Ga0307405_10561578 Ga0307405_105615782 176
1583 3300031731 Ga0307405_10684375 Ga0307405_106843751 176
1584 3300031824 Ga0307413_10231929 Ga0307413_102319292 176
1585 3300031838 Ga0307518_10281146 Ga0307518_102811462 176
1586 3300031852 Ga0307410_10164480 Ga0307410_101644803 176
1587 3300031901 Ga0307406_10637418 Ga0307406_106374182 176
1588 3300031903 Ga0307407_10085386 Ga0307407_100853862 176
1589 3300031995 Ga0307409_100199241 Ga0307409_1001992412 176
1590 3300031995 Ga0307409_100446016 Ga0307409_1004460162 176
1591 3300031995 Ga0307409_100759825 Ga0307409_1007598252 176
1592 3300032002 Ga0307416_100142560 Ga0307416_1001425603 176
1593 3300032002 Ga0307416_100645711 Ga0307416_1006457112 176
1594 3300032002 Ga0307416_101447950 Ga0307416_1014479501 176
1595 3300032004 Ga0307414_11455193 Ga0307414_114551931 176
1596 3300032005 Ga0307411_10080393 Ga0307411_100803933 176
1597 3300032005 Ga0307411_10197863 Ga0307411_101978632 176
1598 3300032005 Ga0307411_10394839 Ga0307411_103948392 176
1599 3300032126 Ga0307415_100211262 Ga0307415_1002112622 176
1600 3300032126 Ga0307415_100792694 Ga0307415_1007926942 176
1601 3300032126 Ga0307415_101134748 Ga0307415_1011347481 176
1602 3300033180 Ga0307510_10001271 Ga0307510_1000127116 176
1603 3300033180 Ga0307510_10014252 Ga0307510_100142527 176
1604 3300033180 Ga0307510_10084067 Ga0307510_100840672 176
1605 3300033180 Ga0307510_10195997 Ga0307510_101959972 176
1606 3300033442 Ga0315911_1000008 Ga0315911_1000008330 176
1607 3300034816 Ga0373930_0009343 Ga0373930_0009343_1181_1711 176
1608 3300035086 Ga0373934_0004104 Ga0373934_0004104_4782_5312 176
1609 3300035088 Ga0373940_0216275 Ga0373940_0216275_89_619 176
1610 3300035089 Ga0373944_0029559 Ga0373944_0029559_210_740 176
1611 3300035091 Ga0373951_0038861 Ga0373951_0038861_140_748 176
1612 3300035111 Ga0373923_0019315 Ga0373923_0019315_374_904 176
1613 3300035113 Ga0373936_0446549 Ga0373936_0446549_46_576 176
1614 3300035114 Ga0373939_0065518 Ga0373939_0065518_620_1153 176
1615 3300035115 Ga0373941_0024123 Ga0373941_0024123_760_1368 176
1616 3300035116 Ga0373945_0112711 Ga0373945_0112711_526_1056 176
1617 3300035117 Ga0373953_0005344 Ga0373953_0005344_276_806 176
1618 3300035118 Ga0373954_0001748 Ga0373954_0001748_1293_1823 176
1619 3300035118 Ga0373954_0148160 Ga0373954_0148160_151_681 176
1620 3300035119 Ga0373956_0011231 Ga0373956_0011231_1793_2323 176
1621 3300035120 Ga0373957_0003256 Ga0373957_0003256_1259_1789 176
1622 3300035170 Ga0373943_0237792 Ga0373943_0237792_192_800 176
1623 3300035171 Ga0373946_0120080 Ga0373946_0120080_314_844 176
1624 3300035172 Ga0373955_0026378 Ga0373955_0026378_2101_2631 176
1625 3300035172 Ga0373955_0200951 Ga0373955_0200951_246_776 176
1626 3300035242 Ga0373962_0042358 Ga0373962_0042358_613_1221 176
1627 3300035410 Ga0373924_0021110 Ga0373924_0021110_1559_2089 176
1628 3300035691 Ga0373931_0006849 Ga0373931_0006849_2405_3013 176
1629 3300035692 Ga0373935_0153765 Ga0373935_0153765_705_1235 176
1630 3300035692 Ga0373935_0344718 Ga0373935_0344718_89_619 176
1631 3300035692 Ga0373935_0499847 Ga0373935_0499847_80_688 176
1632 3300035695 Ga0373927_0008042 Ga0373927_0008042_5821_6351 176
1633 3300035695 Ga0373927_0139313 Ga0373927_0139313_875_1405 176
1634 3300035695 Ga0373927_0224591 Ga0373927_0224591_261_794 176
1635 3300035695 Ga0373927_0231863 Ga0373927_0231863_452_982 176
1636 3300035724 Ga0373933_0091526 Ga0373933_0091526_1135_1665 176
1637 3300035724 Ga0373933_0475211 Ga0373933_0475211_271_801 176
1638 3300035725 Ga0373947_0165513 Ga0373947_0165513_791_1321 176
1639 3300035725 Ga0373947_0422611 Ga0373947_0422611_145_675 176
1640 3300036401 Ga0373937_0024272 Ga0373937_0024272_3754_4284 176
1641 3300036401 Ga0373937_0056247 Ga0373937_0056247_77_607 176
1642 3300036401 Ga0373937_0310717 Ga0373937_0310717_312_842 176
1643 3300036459 Ga0372808_004913 Ga0372808_004913_618_1151 176
1644 3300037068 Ga0373925_0039040 Ga0373925_0039040_1748_2278 176
1645 3300037068 Ga0373925_0057142 Ga0373925_0057142_508_1038 176
1646 3300037068 Ga0373925_0081420 Ga0373925_0081420_1478_2008 176
1647 3300037068 Ga0373925_0405967 Ga0373925_0405967_545_1075 176
1648 3300037068 Ga0373925_0488827 Ga0373925_0488827_375_983 176
1649 3300037068 Ga0373925_0585644 Ga0373925_0585644_203_733 176
1650 3300037312 Ga0395899_0251903 Ga0395899_0251903_455_985 176
1651 3300037418 Ga0395900_0271956 Ga0395900_0271956_489_1019 176
1652 3300037418 Ga0395900_0878214 Ga0395900_0878214_161_691 176
1653 3300037466 Ga0395898_0044161 Ga0395898_0044161_3051_3581 176
1654 3300037466 Ga0395898_0050822 Ga0395898_0050822_849_1379 176
1655 3300037466 Ga0395898_0165387 Ga0395898_0165387_1375_1905 176
1656 3300037466 Ga0395898_0165902 Ga0395898_0165902_251_781 176
1657 3300037471 Ga0395905_0005054 Ga0395905_0005054_1169_1699 176
1658 3300037471 Ga0395905_0318740 Ga0395905_0318740_413_946 176
1659 3300037853 Ga0436364_1276004 Ga0436364_1276004_6857_7387 176
1660 3300038443 Ga0395901_0304099 Ga0395901_0304099_998_1531 176
1661 3300039437 Ga0436365_0451378 Ga0436365_0451378_121_729 176
1662 3300039437 Ga0436365_0996589 Ga0436365_0996589_96_626 176
1663 3300039437 Ga0436365_1287579 Ga0436365_1287579_58_591 176
1664 3300039437 Ga0436365_1477089 Ga0436365_1477089_3843_4373 176
1665 3300039437 Ga0436365_1779987 Ga0436365_1779987_232_762 176
1666 3300039447 Ga0436361_0087261 Ga0436361_0087261_96_626 176
1667 3300039450 Ga0436363_1005833 Ga0436363_1005833_567_1100 176
1668 3300039450 Ga0436363_1066283 Ga0436363_1066283_270_803 176
1669 3300041413 Ga0439465_0036993 Ga0439465_0036993_853_1383 176
1670 3300041441 Ga0451787_838027 Ga0451787_838027_317_850 176
1671 3300041443 Ga0451789_0848106 Ga0451789_0848106_972_1502 176
1672 3300041505 Ga0451849_0793750 Ga0451849_0793750_501_1031 176
1673 3300041997 Ga0439431_0074365 Ga0439431_0074365_348_878 176
1674 3300042012 Ga0439455_0097756 Ga0439455_0097756_74_604 176
1675 3300044658 Ga0466972_0062029 Ga0466972_0062029_1065_1595 176
1676 3300044658 Ga0466972_0148210 Ga0466972_0148210_319_849 176
1677 3300044683 Ga0466965_0022493 Ga0466965_0022493_527_1093 176
1678 3300044683 Ga0466965_0171212 Ga0466965_0171212_142_672 176
1679 3300044684 Ga0466966_0000998 Ga0466966_0000998_867_1397 176
1680 3300044684 Ga0466966_0115750 Ga0466966_0115750_996_1526 176
1681 3300044693 Ga0466961_0000139 Ga0466961_0000139_731_1261 176
1682 3300044694 Ga0466963_0145567 Ga0466963_0145567_372_980 176
1683 3300044706 Ga0466964_0127330 Ga0466964_0127330_300_830 176
1684 3300044735 Ga0466968_0052809 Ga0466968_0052809_541_1071 176
1685 3300044765 Ga0466970_0278495 Ga0466970_0278495_350_916 176
1686 3300044842 Ga0466957_0256378 Ga0466957_0256378_335_943 176
1687 3300044901 Ga0466960_0017761 Ga0466960_0017761_646_1176 176
1688 3300044901 Ga0466960_0093599 Ga0466960_0093599_778_1308 176
1689 3300045049 Ga0466959_0006266 Ga0466959_0006266_319_849 176
1690 3300045976 Ga0466967_0425668 Ga0466967_0425668_574_1182 176
1691 3300045976 Ga0466967_0447072 Ga0466967_0447072_208_738 176
1692 3300046454 Ga0495592_0001103 Ga0495592_0001103_2907_3437 176
1693 3300046454 Ga0495592_0102112 Ga0495592_0102112_855_1385 176
1694 3300046454 Ga0495592_0591303 Ga0495592_0591303_15_545 176
1695 3300046455 Ga0495603_0040505 Ga0495603_0040505_604_1137 176
1696 3300046455 Ga0495603_0042867 Ga0495603_0042867_1748_2278 176
1697 3300046455 Ga0495603_0152516 Ga0495603_0152516_398_928 176
1698 3300046455 Ga0495603_0213823 Ga0495603_0213823_299_832 176
1699 3300046457 Ga0495590_0041267 Ga0495590_0041267_758_1291 176
1700 3300046457 Ga0495590_0107515 Ga0495590_0107515_165_695 176
1701 3300046459 Ga0495629_0001972 Ga0495629_0001972_13574_14104 176
1702 3300046459 Ga0495629_0011428 Ga0495629_0011428_4660_5190 176
1703 3300046459 Ga0495629_0140000 Ga0495629_0140000_115_645 176
1704 3300046459 Ga0495629_0655098 Ga0495629_0655098_120_653 176
1705 3300046460 Ga0495638_0014041 Ga0495638_0014041_3345_3875 176
1706 3300046460 Ga0495638_0296014 Ga0495638_0296014_277_810 176
1707 3300046460 Ga0495638_0436978 Ga0495638_0436978_129_659 176
1708 3300046460 Ga0495638_0474605 Ga0495638_0474605_32_562 176
1709 3300046461 Ga0495641_0090146 Ga0495641_0090146_203_733 176
1710 3300046461 Ga0495641_0224307 Ga0495641_0224307_47_580 176
1711 3300046462 Ga0495651_0003655 Ga0495651_0003655_8229_8759 176
1712 3300046463 Ga0495653_0002188 Ga0495653_0002188_13840_14370 176
1713 3300046471 Ga0495650_0029800 Ga0495650_0029800_1343_1876 176
1714 3300046472 Ga0495580_0220733 Ga0495580_0220733_540_1073 176
1715 3300046472 Ga0495580_0225811 Ga0495580_0225811_537_1067 176
1716 3300046473 Ga0495582_0229784 Ga0495582_0229784_507_1040 176
1717 3300046474 Ga0495605_0036098 Ga0495605_0036098_312_845 176
1718 3300046474 Ga0495605_0115620 Ga0495605_0115620_452_982 176
1719 3300046474 Ga0495605_0130208 Ga0495605_0130208_143_676 176
1720 3300046474 Ga0495605_0305153 Ga0495605_0305153_102_632 176
1721 3300046477 Ga0495664_0203070 Ga0495664_0203070_489_1019 176
1722 3300046491 Ga0495584_0080852 Ga0495584_0080852_315_848 176
1723 3300046491 Ga0495584_0263954 Ga0495584_0263954_232_762 176
1724 3300046491 Ga0495584_0396432 Ga0495584_0396432_82_615 176
1725 3300046492 Ga0495585_0031755 Ga0495585_0031755_635_1168 176
1726 3300046492 Ga0495585_0158712 Ga0495585_0158712_308_838 176
1727 3300046499 Ga0495594_0050450 Ga0495594_0050450_356_889 176
1728 3300046499 Ga0495594_0115383 Ga0495594_0115383_177_707 176
1729 3300046499 Ga0495594_0267482 Ga0495594_0267482_106_636 176
1730 3300046499 Ga0495594_0348421 Ga0495594_0348421_78_611 176
1731 3300046500 Ga0495596_0063967 Ga0495596_0063967_749_1282 176
1732 3300046501 Ga0495607_0152380 Ga0495607_0152380_388_918 176
1733 3300046506 Ga0495583_0084082 Ga0495583_0084082_471_1004 176
1734 3300046507 Ga0495606_0049371 Ga0495606_0049371_1335_1865 176
1735 3300046507 Ga0495606_0056331 Ga0495606_0056331_570_1100 176
1736 3300046507 Ga0495606_0296794 Ga0495606_0296794_274_804 176
1737 3300046511 Ga0495608_0002745 Ga0495608_0002745_3045_3575 176
1738 3300046512 Ga0495610_0065515 Ga0495610_0065515_1174_1704 176
1739 3300046512 Ga0495610_0161736 Ga0495610_0161736_400_930 176
1740 3300046513 Ga0495616_0017135 Ga0495616_0017135_1095_1625 176
1741 3300046513 Ga0495616_0117012 Ga0495616_0117012_528_1061 176
1742 3300046513 Ga0495616_0237201 Ga0495616_0237201_235_768 176
1743 3300046514 Ga0495618_0254682 Ga0495618_0254682_548_1078 176
1744 3300046515 Ga0495620_0100838 Ga0495620_0100838_490_1020 176
1745 3300046515 Ga0495620_0148664 Ga0495620_0148664_337_867 176
1746 3300046515 Ga0495620_0173852 Ga0495620_0173852_249_779 176
1747 3300046515 Ga0495620_0240758 Ga0495620_0240758_52_585 176
1748 3300046515 Ga0495620_0246552 Ga0495620_0246552_59_592 176
1749 3300046516 Ga0495628_0006025 Ga0495628_0006025_213_743 176
1750 3300046516 Ga0495628_0421963 Ga0495628_0421963_129_659 176
1751 3300046516 Ga0495628_0437648 Ga0495628_0437648_290_829 176
1752 3300046516 Ga0495628_0873225 Ga0495628_0873225_50_583 176
1753 3300046518 Ga0495631_0124280 Ga0495631_0124280_513_1046 176
1754 3300046518 Ga0495631_0162133 Ga0495631_0162133_217_747 176
1755 3300046518 Ga0495631_0165143 Ga0495631_0165143_202_732 176
1756 3300046518 Ga0495631_0195942 Ga0495631_0195942_106_636 176
1757 3300046520 Ga0495637_0143911 Ga0495637_0143911_141_674 176
1758 3300046522 Ga0495643_0015773 Ga0495643_0015773_1841_2371 176
1759 3300046522 Ga0495643_0050991 Ga0495643_0050991_452_982 176
1760 3300046522 Ga0495643_0113875 Ga0495643_0113875_389_919 176
1761 3300046523 Ga0495644_0039086 Ga0495644_0039086_393_926 176
1762 3300046523 Ga0495644_0070378 Ga0495644_0070378_40_573 176
1763 3300046523 Ga0495644_0272496 Ga0495644_0272496_69_602 176
1764 3300046524 Ga0495648_0009724 Ga0495648_0009724_3452_3982 176
1765 3300046524 Ga0495648_0233599 Ga0495648_0233599_231_761 176
1766 3300046525 Ga0495663_0063637 Ga0495663_0063637_68_601 176
1767 3300046528 Ga0495642_0059653 Ga0495642_0059653_461_994 176
1768 3300046529 Ga0495652_0048072 Ga0495652_0048072_2766_3296 176
1769 3300046530 Ga0495654_0331657 Ga0495654_0331657_61_594 176
1770 3300046531 Ga0495665_0166917 Ga0495665_0166917_81_611 176
1771 3300046533 Ga0495640_0003340 Ga0495640_0003340_11363_11893 176
1772 3300046533 Ga0495640_0041884 Ga0495640_0041884_2272_2802 176
1773 3300046535 Ga0495586_0221764 Ga0495586_0221764_58_588 176
1774 3300046537 Ga0495598_0298125 Ga0495598_0298125_29_559 176
1775 3300046538 Ga0495609_0046262 Ga0495609_0046262_693_1277 176
1776 3300046538 Ga0495609_0075064 Ga0495609_0075064_415_945 176
1777 3300046538 Ga0495609_0110034 Ga0495609_0110034_593_1126 176
1778 3300046539 Ga0495621_0094907 Ga0495621_0094907_211_741 176
1779 3300046539 Ga0495621_0292498 Ga0495621_0292498_72_605 176
1780 3300046542 Ga0495597_0046929 Ga0495597_0046929_109_639 176
1781 3300046542 Ga0495597_0069278 Ga0495597_0069278_768_1298 176
1782 3300046542 Ga0495597_0139196 Ga0495597_0139196_210_740 176
1783 3300046542 Ga0495597_0226986 Ga0495597_0226986_58_591 176
1784 3300046543 Ga0495645_0009296 Ga0495645_0009296_4951_5481 176
1785 3300046557 Ga0495622_0019824 Ga0495622_0019824_74_604 176
1786 3300046557 Ga0495622_0062500 Ga0495622_0062500_531_1061 176
1787 3300046558 Ga0495633_0262300 Ga0495633_0262300_29_562 176
1788 3300046559 Ga0495667_0000464 Ga0495667_0000464_22250_22780 176
1789 3300046615 Ga0495656_0073658 Ga0495656_0073658_735_1265 176
1790 3300046615 Ga0495656_0305399 Ga0495656_0305399_210_743 176
1791 3300046615 Ga0495656_0447419 Ga0495656_0447419_60_593 176
1792 3300046616 Ga0495668_0035561 Ga0495668_0035561_1320_1850 176
1793 3300046616 Ga0495668_0045453 Ga0495668_0045453_1152_1685 176
1794 3300046616 Ga0495668_0177566 Ga0495668_0177566_466_996 176
1795 3300046616 Ga0495668_0207963 Ga0495668_0207963_473_1006 176
1796 3300046642 Ga0495634_0028663 Ga0495634_0028663_1584_2114 176
1797 3300046642 Ga0495634_0101233 Ga0495634_0101233_194_724 176
1798 3300046648 Ga0495611_0043706 Ga0495611_0043706_377_907 176
1799 3300046648 Ga0495611_0189376 Ga0495611_0189376_306_839 176
1800 3300046648 Ga0495611_0192686 Ga0495611_0192686_218_751 176
1801 3300046660 Ga0495625_0092654 Ga0495625_0092654_836_1366 176
1802 3300046660 Ga0495625_0269318 Ga0495625_0269318_267_800 176
1803 3300046660 Ga0495625_0424653 Ga0495625_0424653_237_767 176
1804 3300046660 Ga0495625_0490759 Ga0495625_0490759_106_639 176
1805 3300046660 Ga0495625_0515509 Ga0495625_0515509_84_614 176
1806 3300046663 Ga0495635_0001078 Ga0495635_0001078_15174_15704 176
1807 3300046663 Ga0495635_0017099 Ga0495635_0017099_3471_4001 176
1808 3300046663 Ga0495635_0117916 Ga0495635_0117916_947_1477 176
1809 3300046663 Ga0495635_0202287 Ga0495635_0202287_632_1165 176
1810 3300046664 Ga0495659_0105143 Ga0495659_0105143_182_715 176
1811 3300046665 Ga0495661_0144061 Ga0495661_0144061_683_1213 176
1812 3300046665 Ga0495661_0162464 Ga0495661_0162464_398_931 176
1813 3300046665 Ga0495661_0364158 Ga0495661_0364158_20_553 176
1814 3300046674 Ga0495588_0026393 Ga0495588_0026393_2330_2863 176
1815 3300046674 Ga0495588_0038023 Ga0495588_0038023_1313_1843 176
1816 3300046674 Ga0495588_0114332 Ga0495588_0114332_502_1032 176
1817 3300046674 Ga0495588_0285347 Ga0495588_0285347_157_687 176
1818 3300046675 Ga0495657_0003059 Ga0495657_0003059_7247_7777 176
1819 3300046675 Ga0495657_0003417 Ga0495657_0003417_4150_4680 176
1820 3300046678 Ga0495599_0001153 Ga0495599_0001153_12533_13063 176
1821 3300046679 Ga0495623_0006142 Ga0495623_0006142_2590_3120 176
1822 3300046679 Ga0495623_0079516 Ga0495623_0079516_1131_1661 176
1823 3300046680 Ga0495646_0018667 Ga0495646_0018667_616_1146 176
1824 3300046683 Ga0495658_0083725 Ga0495658_0083725_989_1519 176
1825 3300046683 Ga0495658_0117411 Ga0495658_0117411_568_1098 176
1826 3300046684 Ga0495669_0002088 Ga0495669_0002088_5457_5987 176
1827 3300046684 Ga0495669_0217001 Ga0495669_0217001_307_840 176
1828 3300046689 Ga0495613_0028537 Ga0495613_0028537_1572_2102 176
1829 3300046689 Ga0495613_0052589 Ga0495613_0052589_1454_1984 176
1830 3300046689 Ga0495613_0129309 Ga0495613_0129309_1190_1720 176
1831 3300046691 Ga0495670_0024498 Ga0495670_0024498_248_781 176
1832 3300046691 Ga0495670_0114546 Ga0495670_0114546_717_1250 176
1833 3300046691 Ga0495670_0179353 Ga0495670_0179353_64_594 176
1834 3300046691 Ga0495670_0329290 Ga0495670_0329290_55_588 176
1835 3300046692 Ga0495671_0131743 Ga0495671_0131743_410_940 176
1836 3300046692 Ga0495671_0259392 Ga0495671_0259392_71_604 176
1837 3300046694 Ga0495649_0027332 Ga0495649_0027332_963_1493 176
1838 3300046694 Ga0495649_0290424 Ga0495649_0290424_264_794 176
1839 3300046794 Ga0495589_0418419 Ga0495589_0418419_48_578 176
1840 3300046809 Ga0495600_0000311 Ga0495600_0000311_10772_11302 176
1841 3300046809 Ga0495600_0016340 Ga0495600_0016340_3591_4121 176
1842 3300047315 Ga0495581_0066536 Ga0495581_0066536_815_1345 176
1843 3300047315 Ga0495581_0097553 Ga0495581_0097553_207_737 176
1844 3300047315 Ga0495581_0322802 Ga0495581_0322802_347_880 176
1845 3300047317 Ga0495604_0004906 Ga0495604_0004906_8280_8810 176
1846 3300047317 Ga0495604_0019288 Ga0495604_0019288_4603_5133 176
1847 3300047317 Ga0495604_0268749 Ga0495604_0268749_390_923 176
1848 3300047318 Ga0495636_0098990 Ga0495636_0098990_353_883 176
1849 3300047318 Ga0495636_0224769 Ga0495636_0224769_174_707 176
1850 3300047319 Ga0495674_0024613 Ga0495674_0024613_4074_4604 176
1851 3300047319 Ga0495674_0058656 Ga0495674_0058656_2821_3351 176
1852 3300047320 Ga0495672_0131658 Ga0495672_0131658_462_992 176
1853 3300047320 Ga0495672_0173210 Ga0495672_0173210_11_541 176
1854 3300047320 Ga0495672_0294658 Ga0495672_0294658_99_632 176
1855 3300047321 Ga0495676_0058535 Ga0495676_0058535_1354_1884 176
1856 3300047322 Ga0495680_0000689 Ga0495680_0000689_31591_32121 176
1857 3300047322 Ga0495680_0009513 Ga0495680_0009513_44_574 176
1858 3300047323 Ga0495683_0059851 Ga0495683_0059851_261_791 176
1859 3300047323 Ga0495683_0094838 Ga0495683_0094838_671_1204 176
1860 3300047443 Ga0495687_017157 Ga0495687_017157_1018_1548 176
1861 3300047444 Ga0495675_0010733 Ga0495675_0010733_4916_5446 176
1862 3300047444 Ga0495675_0053308 Ga0495675_0053308_1887_2417 176
1863 3300047445 Ga0495677_0078565 Ga0495677_0078565_656_1189 176
1864 3300047447 Ga0495685_120666 Ga0495685_120666_303_836 176
1865 3300047469 Ga0495673_0084454 Ga0495673_0084454_152_682 176
1866 3300047469 Ga0495673_0200433 Ga0495673_0200433_20_550 176
1867 3300047469 Ga0495673_0258688 Ga0495673_0258688_59_589 176
1868 3300047471 Ga0495684_0004560 Ga0495684_0004560_6042_6572 176
1869 3300047471 Ga0495684_0118621 Ga0495684_0118621_998_1528 176
1870 3300047472 Ga0495686_0131502 Ga0495686_0131502_766_1296 176
1871 3300047472 Ga0495686_0180849 Ga0495686_0180849_99_629 176
1872 3300047472 Ga0495686_0257889 Ga0495686_0257889_107_637 176
1873 3300047472 Ga0495686_0384584 Ga0495686_0384584_123_656 176
1874 3300047673 Ga0495593_0000693 Ga0495593_0000693_6712_7242 176
1875 3300047673 Ga0495593_0121544 Ga0495593_0121544_498_1031 176
1876 3300048088 Ga0495602_0002384 Ga0495602_0002384_13712_14242 176
1877 3300048088 Ga0495602_0011209 Ga0495602_0011209_5444_5974 176
1878 3300048088 Ga0495602_0062647 Ga0495602_0062647_1533_2063 176
1879 3300048088 Ga0495602_0526658 Ga0495602_0526658_85_615 176
1880 3300048089 Ga0495614_0020718 Ga0495614_0020718_1259_1789 176
1881 3300048091 Ga0495626_0175590 Ga0495626_0175590_119_649 176
1882 3300048903 Ga0496100_0033360 Ga0496100_0033360_2306_2836 176
1883 3300048903 Ga0496100_0455513 Ga0496100_0455513_223_756 176
1884 3300048903 Ga0496100_0753449 Ga0496100_0753449_138_668 176
1885 3300048904 Ga0496101_0014265 Ga0496101_0014265_186_716 176
1886 3300048904 Ga0496101_0038219 Ga0496101_0038219_2007_2537 176
1887 3300048904 Ga0496101_0083304 Ga0496101_0083304_1317_1847 176
1888 3300048904 Ga0496101_0106001 Ga0496101_0106001_757_1287 176
1889 3300048904 Ga0496101_0116131 Ga0496101_0116131_1275_1805 176
1890 3300048904 Ga0496101_0517756 Ga0496101_0517756_202_735 176
1891 3300048904 Ga0496101_0571409 Ga0496101_0571409_202_732 176
1892 3300048904 Ga0496101_0638789 Ga0496101_0638789_203_733 176
1893 3300048905 Ga0496102_0010497 Ga0496102_0010497_5004_5534 176
1894 3300048905 Ga0496102_0020716 Ga0496102_0020716_3104_3634 176
1895 3300048905 Ga0496102_0033921 Ga0496102_0033921_1194_1802 176
1896 3300048905 Ga0496102_0166215 Ga0496102_0166215_1349_1879 176
1897 3300048905 Ga0496102_0235023 Ga0496102_0235023_1052_1582 176
1898 3300048905 Ga0496102_0302510 Ga0496102_0302510_409_939 176
1899 3300048905 Ga0496102_0511267 Ga0496102_0511267_162_695 176
1900 3300048905 Ga0496102_0611396 Ga0496102_0611396_67_597 176
1901 3300048905 Ga0496102_0732838 Ga0496102_0732838_308_838 176
1902 3300048906 Ga0496103_0029053 Ga0496103_0029053_2613_3143 176
1903 3300048906 Ga0496103_0117571 Ga0496103_0117571_592_1122 176
1904 3300048906 Ga0496103_0342619 Ga0496103_0342619_105_635 176
1905 3300048906 Ga0496103_0499424 Ga0496103_0499424_79_612 176
1906 3300048906 Ga0496103_0641443 Ga0496103_0641443_29_562 176
1907 3300048906 Ga0496103_0653120 Ga0496103_0653120_22_552 176
1908 3300048907 Ga0496104_0007292 Ga0496104_0007292_4957_5487 176
1909 3300048907 Ga0496104_0009776 Ga0496104_0009776_4455_4985 176
1910 3300048907 Ga0496104_0044346 Ga0496104_0044346_2414_2944 176
1911 3300048907 Ga0496104_0258984 Ga0496104_0258984_122_730 176
1912 3300048907 Ga0496104_0332438 Ga0496104_0332438_312_842 176
1913 3300048907 Ga0496104_0395785 Ga0496104_0395785_498_1031 176
1914 3300048907 Ga0496104_0441257 Ga0496104_0441257_449_979 176
1915 3300048907 Ga0496104_0466279 Ga0496104_0466279_299_829 176
1916 3300048908 Ga0496105_0028180 Ga0496105_0028180_2264_2794 176
1917 3300048908 Ga0496105_0037811 Ga0496105_0037811_1169_1777 176
1918 3300048908 Ga0496105_0056596 Ga0496105_0056596_1533_2063 176
1919 3300048908 Ga0496105_0120147 Ga0496105_0120147_677_1207 176
1920 3300048908 Ga0496105_0183732 Ga0496105_0183732_444_974 176
1921 3300048908 Ga0496105_0252815 Ga0496105_0252815_83_616 176
1922 3300048908 Ga0496105_0286028 Ga0496105_0286028_263_793 176
1923 3300048908 Ga0496105_0611367 Ga0496105_0611367_260_793 176
1924 3300048909 Ga0496106_0001014 Ga0496106_0001014_7042_7572 176
1925 3300048909 Ga0496106_0003850 Ga0496106_0003850_3210_3740 176
1926 3300048909 Ga0496106_0005534 Ga0496106_0005534_8050_8580 176
1927 3300048909 Ga0496106_0075442 Ga0496106_0075442_1082_1612 176
1928 3300048909 Ga0496106_0173412 Ga0496106_0173412_361_891 176
1929 3300048909 Ga0496106_0191001 Ga0496106_0191001_987_1520 176
1930 3300048909 Ga0496106_0252011 Ga0496106_0252011_329_859 176
1931 3300048909 Ga0496106_0579158 Ga0496106_0579158_262_792 176
1932 3300048909 Ga0496106_0581385 Ga0496106_0581385_268_798 176
1933 3300048909 Ga0496106_0754510 Ga0496106_0754510_16_624 176
1934 3300048910 Ga0496107_0001220 Ga0496107_0001220_6289_6819 176
1935 3300048910 Ga0496107_0014694 Ga0496107_0014694_961_1491 176
1936 3300048910 Ga0496107_0285561 Ga0496107_0285561_287_817 176
1937 3300048910 Ga0496107_0303850 Ga0496107_0303850_472_1002 176
1938 3300048910 Ga0496107_0318828 Ga0496107_0318828_553_1083 176
1939 3300048911 Ga0496108_0000274 Ga0496108_0000274_43002_43532 176
1940 3300048911 Ga0496108_0007620 Ga0496108_0007620_5001_5531 176
1941 3300048911 Ga0496108_0034651 Ga0496108_0034651_2516_3046 176
1942 3300048911 Ga0496108_0069200 Ga0496108_0069200_1174_1704 176
1943 3300048911 Ga0496108_0087899 Ga0496108_0087899_1716_2249 176
1944 3300048911 Ga0496108_0271954 Ga0496108_0271954_760_1290 176
1945 3300048911 Ga0496108_0550646 Ga0496108_0550646_410_940 176
1946 3300048911 Ga0496108_0846867 Ga0496108_0846867_157_690 176
1947 3300048912 Ga0496109_0000224 Ga0496109_0000224_633_1163 176
1948 3300048912 Ga0496109_0010061 Ga0496109_0010061_1078_1608 176
1949 3300048912 Ga0496109_0075762 Ga0496109_0075762_139_747 176
1950 3300048912 Ga0496109_0250923 Ga0496109_0250923_920_1453 176
1951 3300048912 Ga0496109_0292625 Ga0496109_0292625_902_1435 176
1952 3300048912 Ga0496109_0968843 Ga0496109_0968843_150_680 176
1953 3300048913 Ga0496110_0030873 Ga0496110_0030873_388_996 176
1954 3300048913 Ga0496110_0038340 Ga0496110_0038340_951_1481 176
1955 3300048913 Ga0496110_0074835 Ga0496110_0074835_2334_2864 176
1956 3300048913 Ga0496110_0118470 Ga0496110_0118470_1083_1613 176
1957 3300048913 Ga0496110_0217060 Ga0496110_0217060_435_965 176
1958 3300048913 Ga0496110_0502821 Ga0496110_0502821_318_851 176
1959 3300048913 Ga0496110_0859809 Ga0496110_0859809_242_775 176
1960 3300048913 Ga0496110_1296981 Ga0496110_1296981_17_547 176
1961 3300048914 Ga0496111_0174942 Ga0496111_0174942_348_956 176
1962 3300048914 Ga0496111_0252290 Ga0496111_0252290_70_600 176
1963 3300048914 Ga0496111_0259287 Ga0496111_0259287_79_612 176
1964 3300048914 Ga0496111_0261469 Ga0496111_0261469_177_707 176
1965 3300048914 Ga0496111_0351990 Ga0496111_0351990_249_779 176
1966 3300048915 Ga0496112_0000020 Ga0496112_0000020_74961_75494 176
1967 3300048915 Ga0496112_0005625 Ga0496112_0005625_6652_7182 176
1968 3300048915 Ga0496112_0017956 Ga0496112_0017956_5664_6194 176
1969 3300048915 Ga0496112_0031512 Ga0496112_0031512_3024_3554 176
1970 3300048915 Ga0496112_0031708 Ga0496112_0031708_3030_3638 176
1971 3300048915 Ga0496112_0216568 Ga0496112_0216568_765_1298 176
1972 3300048915 Ga0496112_0246227 Ga0496112_0246227_619_1149 176
1973 3300048915 Ga0496112_0253603 Ga0496112_0253603_1127_1657 176
1974 3300048915 Ga0496112_0336520 Ga0496112_0336520_155_688 176
1975 3300048915 Ga0496112_0704422 Ga0496112_0704422_62_592 176
1976 3300048915 Ga0496112_1516013 Ga0496112_1516013_33_563 176
1977 3300048916 Ga0496113_0034060 Ga0496113_0034060_2323_2853 176
1978 3300048916 Ga0496113_0039510 Ga0496113_0039510_2003_2533 176
1979 3300048916 Ga0496113_0046666 Ga0496113_0046666_1395_2003 176
1980 3300048916 Ga0496113_0117286 Ga0496113_0117286_515_1045 176
1981 3300048916 Ga0496113_0152956 Ga0496113_0152956_292_822 176
1982 3300048916 Ga0496113_0231157 Ga0496113_0231157_285_815 176
1983 3300048917 Ga0496114_0008301 Ga0496114_0008301_79_609 176
1984 3300048917 Ga0496114_0293562 Ga0496114_0293562_536_1066 176
1985 3300048917 Ga0496114_0367140 Ga0496114_0367140_363_893 176
1986 3300048917 Ga0496114_0460044 Ga0496114_0460044_193_723 176
1987 3300048917 Ga0496114_0514646 Ga0496114_0514646_376_909 176
1988 3300048917 Ga0496114_0696454 Ga0496114_0696454_149_679 176
1989 3300048917 Ga0496114_0878248 Ga0496114_0878248_223_753 176
1990 3300048918 Ga0496115_0010108 Ga0496115_0010108_2033_2563 176
1991 3300048918 Ga0496115_0020999 Ga0496115_0020999_391_921 176
1992 3300048918 Ga0496115_0043792 Ga0496115_0043792_2511_3041 176
1993 3300048918 Ga0496115_0493760 Ga0496115_0493760_439_972 176
1994 3300048918 Ga0496115_0538341 Ga0496115_0538341_241_771 176
1995 3300048918 Ga0496115_0792493 Ga0496115_0792493_37_567 176
1996 3300048918 Ga0496115_0943387 Ga0496115_0943387_72_602 176
1997 3300048919 Ga0496116_0029926 Ga0496116_0029926_725_1255 176
1998 3300048919 Ga0496116_0078091 Ga0496116_0078091_938_1468 176
1999 3300048920 Ga0496117_0073766 Ga0496117_0073766_58_588 176
2000 3300048920 Ga0496117_0090625 Ga0496117_0090625_302_832 176
2001 3300048920 Ga0496117_0351439 Ga0496117_0351439_97_627 176
2002 3300048921 Ga0496118_0030372 Ga0496118_0030372_1503_2033 176
2003 3300048921 Ga0496118_0187163 Ga0496118_0187163_77_610 176
2004 3300048921 Ga0496118_0304140 Ga0496118_0304140_46_576 176
2005 3300048921 Ga0496118_0375945 Ga0496118_0375945_148_681 176
2006 3300048922 Ga0496119_0020471 Ga0496119_0020471_1879_2409 176
2007 3300048922 Ga0496119_0026661 Ga0496119_0026661_1497_2027 176
2008 3300048922 Ga0496119_0062834 Ga0496119_0062834_1638_2168 176
2009 3300048922 Ga0496119_0069187 Ga0496119_0069187_1157_1687 176
2010 3300048922 Ga0496119_0236807 Ga0496119_0236807_67_597 176
2011 3300048923 Ga0496120_0196634 Ga0496120_0196634_350_883 176
2012 3300048924 Ga0496121_0028285 Ga0496121_0028285_1905_2435 176
2013 3300048924 Ga0496121_0093579 Ga0496121_0093579_256_786 176
2014 3300048924 Ga0496121_0107510 Ga0496121_0107510_961_1494 176
2015 3300048924 Ga0496121_0136863 Ga0496121_0136863_901_1431 176
2016 3300048924 Ga0496121_0227101 Ga0496121_0227101_408_938 176
2017 3300048924 Ga0496121_0298904 Ga0496121_0298904_86_619 176
2018 3300048924 Ga0496121_0402405 Ga0496121_0402405_186_716 176
2019 3300048924 Ga0496121_0520073 Ga0496121_0520073_203_733 176
2020 3300048925 Ga0496122_0144491 Ga0496122_0144491_73_603 176
2021 3300048927 Ga0496124_0253730 Ga0496124_0253730_518_1048 176
2022 3300048928 Ga0496125_0042674 Ga0496125_0042674_416_946 176
2023 3300048928 Ga0496125_0237423 Ga0496125_0237423_222_752 176
2024 3300048929 Ga0496126_0002460 Ga0496126_0002460_9539_10072 176
2025 3300048929 Ga0496126_0002944 Ga0496126_0002944_11975_12505 176
2026 3300048929 Ga0496126_0032373 Ga0496126_0032373_417_947 176
2027 3300048929 Ga0496126_0090215 Ga0496126_0090215_1253_1786 176
2028 3300048929 Ga0496126_0144445 Ga0496126_0144445_822_1352 176
2029 3300048929 Ga0496126_0161406 Ga0496126_0161406_683_1213 176
2030 3300048929 Ga0496126_0279164 Ga0496126_0279164_610_1143 176
2031 3300048929 Ga0496126_0475885 Ga0496126_0475885_419_952 176
2032 3300048929 Ga0496126_0484532 Ga0496126_0484532_426_956 176
2033 3300048929 Ga0496126_0602663 Ga0496126_0602663_203_733 176
2034 3300048929 Ga0496126_0615969 Ga0496126_0615969_257_790 176
2035 3300048929 Ga0496126_0621897 Ga0496126_0621897_284_817 176
2036 3300048929 Ga0496126_0654606 Ga0496126_0654606_251_781 176
2037 3300049459 Ga0495678_035346 Ga0495678_035346_1069_1602 176
2038 3300049460 Ga0495682_0041406 Ga0495682_0041406_48_578 176
2039 3300049571 Ga0501034_0876265 Ga0501034_0876265_47_577 176
2040 3300049577 Ga0501041_0427838 Ga0501041_0427838_117_650 176
2041 3300049580 Ga0501046_0082303 Ga0501046_0082303_547_1077 176
2042 3300049581 Ga0501047_0026637 Ga0501047_0026637_869_1399 176
2043 3300049586 Ga0501070_0003250 Ga0501070_0003250_1916_2446 176
2044 3300049589 Ga0501073_0056321 Ga0501073_0056321_516_1046 176
2045 3300049590 Ga0501074_0051339 Ga0501074_0051339_1044_1574 176
2046 3300049592 Ga0501076_0699486 Ga0501076_0699486_85_618 176
2047 3300049741 Ga0501079_0165997 Ga0501079_0165997_284_817 176
2048 3300049742 Ga0501080_0002360 Ga0501080_0002360_6492_7022 176
2049 3300049823 Ga0501044_0014838 Ga0501044_0014838_3555_4085 176
2050 3300050490 nmdc:mga03n38_143511_c1 nmdc:mga03n38_143511_c1_624_1157 176
2051 3300050490 nmdc:mga03n38_233680_c1 nmdc:mga03n38_233680_c1_237_767 176
2052 3300050490 nmdc:mga03n38_320042_c1 nmdc:mga03n38_320042_c1_258_788 176
2053 3300050490 nmdc:mga03n38_351584_c1 nmdc:mga03n38_351584_c1_261_791 176
2054 3300050491 nmdc:mga00v17_214511_c1 nmdc:mga00v17_214511_c1_365_895 176
2055 3300050491 nmdc:mga00v17_304707_c1 nmdc:mga00v17_304707_c1_60_590 176
2056 3300050491 nmdc:mga00v17_358675_c1 nmdc:mga00v17_358675_c1_223_756 176
2057 3300050491 nmdc:mga00v17_508325_c1 nmdc:mga00v17_508325_c1_29_559 176
2058 3300050492 nmdc:mga0yw44_155348_c1 nmdc:mga0yw44_155348_c1_486_1016 176
2059 3300050492 nmdc:mga0yw44_188794_c1 nmdc:mga0yw44_188794_c1_451_981 176
2060 3300050492 nmdc:mga0yw44_19569_c1 nmdc:mga0yw44_19569_c1_2989_3522 176
2061 3300050492 nmdc:mga0yw44_234692_c1 nmdc:mga0yw44_234692_c1_321_854 176
2062 3300050492 nmdc:mga0yw44_317040_c1 nmdc:mga0yw44_317040_c1_255_785 176
2063 3300050493 nmdc:mga0k408_226700_c1 nmdc:mga0k408_226700_c1_490_1023 176
2064 3300050493 nmdc:mga0k408_233565_c1 nmdc:mga0k408_233565_c1_224_754 176
2065 3300050493 nmdc:mga0k408_384913_c1 nmdc:mga0k408_384913_c1_69_602 176
2066 3300050493 nmdc:mga0k408_417991_c1 nmdc:mga0k408_417991_c1_203_733 176
2067 3300050493 nmdc:mga0k408_501322_c1 nmdc:mga0k408_501322_c1_29_559 176
2068 3300050493 nmdc:mga0k408_58657_c1 nmdc:mga0k408_58657_c1_1150_1680 176
2069 3300050494 nmdc:mga06z11_11930_c1 nmdc:mga06z11_11930_c1_3147_3680 176
2070 3300050494 nmdc:mga06z11_138926_c1 nmdc:mga06z11_138926_c1_359_892 176
2071 3300050494 nmdc:mga06z11_164154_c1 nmdc:mga06z11_164154_c1_545_1078 176
2072 3300050494 nmdc:mga06z11_253597_c1 nmdc:mga06z11_253597_c1_180_710 176
2073 3300050494 nmdc:mga06z11_429730_c1 nmdc:mga06z11_429730_c1_131_661 176
2074 3300050495 nmdc:mga04h51_3991_c1 nmdc:mga04h51_3991_c1_534_1064 176
2075 3300050495 nmdc:mga04h51_73214_c1 nmdc:mga04h51_73214_c1_399_932 176
2076 3300050496 nmdc:mga07m45_103422_c1 nmdc:mga07m45_103422_c1_973_1503 176
2077 3300050496 nmdc:mga07m45_134590_c1 nmdc:mga07m45_134590_c1_589_1122 176
2078 3300050496 nmdc:mga07m45_77268_c1 nmdc:mga07m45_77268_c1_1234_1764 176
2079 3300050511 nmdc:mga08y16_102080_c1 nmdc:mga08y16_102080_c1_1316_1846 176
2080 3300050511 nmdc:mga08y16_1349643_c1 nmdc:mga08y16_1349643_c1_123_653 176
2081 3300050511 nmdc:mga08y16_576622_c1 nmdc:mga08y16_576622_c1_470_1003 176
2082 3300050512 nmdc:mga0n895_24914_c1 nmdc:mga0n895_24914_c1_235_768 176
2083 3300050515 nmdc:mga0a205_127781_c1 nmdc:mga0a205_127781_c1_1604_2137 176
2084 3300050516 nmdc:mga0sz30_132755_c1 nmdc:mga0sz30_132755_c1_266_796 176
2085 3300050516 nmdc:mga0sz30_167154_c1 nmdc:mga0sz30_167154_c1_160_690 176
2086 3300053077 Ga0495601_0171771 Ga0495601_0171771_271_801 176
2087 3300053078 Ga0495612_0023113 Ga0495612_0023113_1290_1820 176
2088 3300053078 Ga0495612_0128759 Ga0495612_0128759_45_653 176
2089 3300053079 Ga0500610_0281487 Ga0500610_0281487_189_722 176
2090 3300053080 Ga0500635_0034382 Ga0500635_0034382_594_1127 176
2091 3300053083 Ga0495655_0014635 Ga0495655_0014635_137_667 176
2092 3300053083 Ga0495655_0041351 Ga0495655_0041351_385_915 176
2093 3300053084 Ga0495595_0003604 Ga0495595_0003604_1733_2263 176
2094 3300053084 Ga0495595_0030242 Ga0495595_0030242_1673_2281 176
2095 3300053084 Ga0495595_0400186 Ga0495595_0400186_133_663 176
2096 3300053085 Ga0495619_0000330 Ga0495619_0000330_21153_21683 176
2097 3300053085 Ga0495619_0210428 Ga0495619_0210428_666_1196 176
2098 3300053085 Ga0495619_0329753 Ga0495619_0329753_296_904 176
2099 3300053086 Ga0500578_0060510 Ga0500578_0060510_941_1471 176
2100 3300053086 Ga0500578_0297883 Ga0500578_0297883_191_721 176
2101 3300053087 Ga0500643_000063 Ga0500643_000063_31551_32081 176
2102 3300053088 Ga0500644_0029965 Ga0500644_0029965_271_801 176
2103 3300053088 Ga0500644_0146757 Ga0500644_0146757_144_677 176
2104 3300053090 Ga0500646_0196850 Ga0500646_0196850_100_633 176
2105 3300053091 Ga0500647_0011835 Ga0500647_0011835_1987_2520 176
2106 3300053091 Ga0500647_0214665 Ga0500647_0214665_186_716 176
2107 3300053092 Ga0500583_0056163 Ga0500583_0056163_983_1513 176
2108 3300053093 Ga0500651_0053527 Ga0500651_0053527_1478_2008 176
2109 3300053094 Ga0500566_0000151 Ga0500566_0000151_21713_22246 176
2110 3300053094 Ga0500566_0000236 Ga0500566_0000236_13128_13658 176
2111 3300053094 Ga0500566_0219992 Ga0500566_0219992_131_664 176
2112 3300053095 Ga0500640_033763 Ga0500640_033763_988_1521 176
2113 3300053096 Ga0500641_0082546 Ga0500641_0082546_57_590 176
2114 3300053098 Ga0500650_0267727 Ga0500650_0267727_149_682 176
2115 3300053102 Ga0500554_130359 Ga0500554_130359_14_547 176
2116 3300053103 Ga0500555_012245 Ga0500555_012245_1007_1537 176
2117 3300053104 Ga0500556_0057918 Ga0500556_0057918_639_1172 176
2118 3300053105 Ga0500557_000037 Ga0500557_000037_68125_68655 176
2119 3300053108 Ga0500562_006897 Ga0500562_006897_917_1447 176
2120 3300053108 Ga0500562_062169 Ga0500562_062169_88_621 176
2121 3300053111 Ga0500572_009069 Ga0500572_009069_234_767 176
2122 3300053114 Ga0500582_066260 Ga0500582_066260_259_792 176
2123 3300053115 Ga0500591_036543 Ga0500591_036543_1587_2120 176
2124 3300053118 Ga0500594_0083786 Ga0500594_0083786_10_543 176
2125 3300053119 Ga0500595_000265 Ga0500595_000265_10319_10852 176
2126 3300053119 Ga0500595_022450 Ga0500595_022450_970_1503 176
2127 3300053119 Ga0500595_040303 Ga0500595_040303_378_908 176
2128 3300053121 Ga0500607_019113 Ga0500607_019113_2877_3407 176
2129 3300053122 Ga0500608_044642 Ga0500608_044642_738_1271 176
2130 3300053123 Ga0500614_024140 Ga0500614_024140_847_1380 176
2131 3300053130 Ga0500642_0000062 Ga0500642_0000062_27417_27947 176
2132 3300053130 Ga0500642_0062887 Ga0500642_0062887_1083_1613 176
2133 3300053134 Ga0500658_0090768 Ga0500658_0090768_516_1049 176
2134 3300053134 Ga0500658_0123928 Ga0500658_0123928_468_998 176
2135 3300053136 Ga0500559_0018563 Ga0500559_0018563_1316_1849 176
2136 3300053136 Ga0500559_0192363 Ga0500559_0192363_221_751 176
2137 3300053136 Ga0500559_0231239 Ga0500559_0231239_177_707 176
2138 3300053137 Ga0500561_0051259 Ga0500561_0051259_352_885 176
2139 3300053139 Ga0500568_0080709 Ga0500568_0080709_300_833 176
2140 3300053139 Ga0500568_0082120 Ga0500568_0082120_619_1149 176
2141 3300053142 Ga0500577_0196561 Ga0500577_0196561_74_604 176
2142 3300053143 Ga0500579_123963 Ga0500579_123963_150_683 176
2143 3300053146 Ga0500588_0130310 Ga0500588_0130310_132_662 176
2144 3300053147 Ga0500589_170211 Ga0500589_170211_150_683 176
2145 3300053148 Ga0500590_038219 Ga0500590_038219_1480_2013 176
2146 3300053150 Ga0500603_017925 Ga0500603_017925_125_658 176
2147 3300053150 Ga0500603_110470 Ga0500603_110470_143_676 176
2148 3300053151 Ga0500604_0009715 Ga0500604_0009715_74_604 176
2149 3300053151 Ga0500604_0076519 Ga0500604_0076519_233_766 176
2150 3300053151 Ga0500604_0107062 Ga0500604_0107062_235_765 176
2151 3300053154 Ga0500619_030563 Ga0500619_030563_387_917 176
2152 3300053154 Ga0500619_031036 Ga0500619_031036_570_1103 176
2153 3300053155 Ga0500620_000467 Ga0500620_000467_5693_6223 176
2154 3300053156 Ga0500622_0088090 Ga0500622_0088090_434_964 176
2155 3300053156 Ga0500622_0106978 Ga0500622_0106978_563_1096 176
2156 3300053159 Ga0500630_022191 Ga0500630_022191_1310_1843 176
2157 3300053160 Ga0500633_0106711 Ga0500633_0106711_75_608 176
2158 3300053160 Ga0500633_0205202 Ga0500633_0205202_154_684 176
2159 3300053161 Ga0500634_0137807 Ga0500634_0137807_80_613 176
2160 3300053162 Ga0500638_000059 Ga0500638_000059_17375_17908 176
2161 3300053162 Ga0500638_013587 Ga0500638_013587_2985_3518 176
2162 3300053162 Ga0500638_219832 Ga0500638_219832_177_710 176
2163 3300053163 Ga0500639_024457 Ga0500639_024457_2214_2747 176
2164 3300053177 Ga0500636_0009392 Ga0500636_0009392_4668_5198 176
2165 3300053178 Ga0500637_0002081 Ga0500637_0002081_6639_7172 176
2166 3300053178 Ga0500637_0076958 Ga0500637_0076958_306_839 176
2167 3300053178 Ga0500637_0286355 Ga0500637_0286355_126_659 176
2168 3300053722 Ga0500649_114677 Ga0500649_114677_145_675 176
2169 3300053725 Ga0500576_067898 Ga0500576_067898_697_1230 176
2170 3300053727 Ga0500611_052184 Ga0500611_052184_245_778 176
2171 3300053730 Ga0500645_042081 Ga0500645_042081_714_1244 176
2172 3300053730 Ga0500645_164016 Ga0500645_164016_18_551 176
2173 3300053735 Ga0500596_004661 Ga0500596_004661_1443_1976 176
2174 3300053736 Ga0500599_001321 Ga0500599_001321_1395_1925 176
2175 3300053737 Ga0500601_000544 Ga0500601_000544_1473_2003 176
2176 3300053737 Ga0500601_002697 Ga0500601_002697_257_790 176
2177 3300055283 Ga0500661_000282 Ga0500661_000282_3883_4416 176
2178 3300060353 Ga0501082_0569599 Ga0501082_0569599_291_824 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10947

DUF2628

Protein of unknown function (DUF2628)

18

125

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z4b-assembly1.cif.gz_A estrogen receptor beta ligand-binding domain complexed to a benzopyran ligand 0.429 41 99
7y8r-assembly1.cif.gz_M the nucleosome-bound human pbaf complex 0.3774 57 134
6fbv-assembly1.cif.gz_D single particle cryo em structure of mycobacterium tuberculosis rna polymerase in complex with fidaxomicin 0.3635 3 125
6kop-assembly1.cif.gz_D mycobacterium tuberculosis initial transcription complex comprising sigma h and 5'-oh rna of 9 nt 0.3561 6 126
6rah-assembly1.cif.gz_B heterodimeric abc exporter tmrab in atp-bound outward-facing open conformation 0.3251 32 97
ID Description Score Start End Superfamily
af_P27842_7_119_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7291 29 96 1.20.140.150
af_A0A0B4K6Z6_1114_1216_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.603 1 26 2.60.40.10
af_K7LBJ4_23_159_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5649 48 99 1.50.40.10
af_Q2FUW6_607_786_1.10.3060.10 Mainly Alpha;Orthogonal Bundle;Helical scaffold and wing domains of SecA;Helical scaffold and wing domains of SecA 0.5046 44 92 1.10.3060.10
3fwcL00 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;ENY2/SUS1 0.4972 32 99 1.10.246.140
ID Description Score Start End GO Terms
AF-A0A411WGK8-F1-model_v4 DUF2628 domain-containing protein 0.9359 29 99 GO:0016020
AF-A0A2T5NMT9-F1-model_v4 DUF2628 domain-containing protein 0.9181 29 92 GO:0016020
AF-A0A285E1W7-F1-model_v4 deleted 0.9175 29 92
AF-A0A2R7QRH8-F1-model_v4 DUF2628 domain-containing protein 0.9162 27 99 GO:0016020
AF-J5HV99-F1-model_v4 PF10947 family protein 0.9134 29 90 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.83 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map