F496462

General Info

Members Datasets Scaffolds Average Seq Length
2144 1312 1253 184

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_71667_c1|nmdc:mga03n38_71667_c1_106_777
Length 223
Sequence LKSCVFEAADQRQSASHPCHVGLTVSAPIGFETKEVNKVTVAVSPDGLPALVLNADYRPLSYYPLSLWSWQDAIKAVFLDRVNIVAEYEHAVSSPTFSMKLPSVVSLKAYVKPSRHPAFTRFNVFLRDRFQCQYCSTPDDLTFDHVIPRHRGGATTWENVVAACSPCNLRKGGMMPAHAKMWPLQKPYQPTVHDLHNNGRLFPPNHLHESWMDYLYWDVELEP

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
6 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
7 2509276019 Ensifer aridi TW10 Isolate Nodule
8 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
9 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
13 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
14 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
15 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
16 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
17 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
18 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
19 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
20 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
21 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
22 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
23 2512875024 Mesorhizobium loti R88b Isolate Nodule
24 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
25 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
26 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
27 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
28 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
29 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
30 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
31 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
32 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
33 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
34 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
35 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
36 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
37 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
38 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
39 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
40 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
41 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
42 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
43 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
44 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
45 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
46 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
47 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
48 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
49 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
50 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
51 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
52 2516143018 Ensifer sp. BR816 Isolate Nodule
53 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
54 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
55 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
56 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
57 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
58 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
59 2519899620 Rhizobium sp. Pop5 Isolate Nodule
60 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
61 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
62 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
63 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
64 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
65 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
66 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
67 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
68 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
69 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
70 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
71 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
72 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
73 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
74 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
75 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
76 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
77 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
78 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
79 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
80 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
81 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
82 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
83 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
84 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
85 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
86 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
87 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
88 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
89 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
90 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
91 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
92 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
93 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
94 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
95 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
96 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
97 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
98 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
99 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
100 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
101 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
102 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
103 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
104 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
105 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
106 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
107 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
108 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
109 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
110 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
111 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
112 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
113 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
114 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
115 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
116 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
117 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
118 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
119 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
120 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
121 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
122 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
123 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
124 2643221557 Ensifer sp. Root558 Isolate Unclassified
125 2643221558 Rhizobium sp. Root149 Isolate Unclassified
126 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
127 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
128 2643221580 Devosia sp. Root635 Isolate Unclassified
129 2643221582 Rhizobium sp. Root651 Isolate Unclassified
130 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
131 2643221599 Rhizobium sp. Root708 Isolate Unclassified
132 2643221607 Rhizobium sp. Root73 Isolate Unclassified
133 2643221610 Ensifer sp. Root74 Isolate Unclassified
134 2643221618 Ensifer sp. Root231 Isolate Unclassified
135 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
136 2643221626 Ensifer sp. Root31 Isolate Unclassified
137 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
138 2643221629 Devosia sp. Root105 Isolate Unclassified
139 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
140 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
141 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
142 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
143 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
144 2643221655 Ensifer sp. Root1252 Isolate Unclassified
145 2643221659 Ensifer sp. Root127 Isolate Unclassified
146 2643221662 Devosia sp. Root413D1 Isolate Unclassified
147 2643221668 Ensifer sp. Root423 Isolate Unclassified
148 2643221674 Devosia sp. Root436 Isolate Unclassified
149 2643221675 Ensifer sp. Root1298 Isolate Unclassified
150 2643221680 Ensifer sp. Root1312 Isolate Unclassified
151 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
152 2643221688 Rhizobium sp. Root482 Isolate Unclassified
153 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
154 2643221693 Rhizobium sp. Root491 Isolate Unclassified
155 2643221698 Ensifer sp. Root142 Isolate Unclassified
156 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
157 2643221712 Ensifer sp. Root258 Isolate Unclassified
158 2643221718 Rhizobium sp. Root268 Isolate Unclassified
159 2643221719 Rhizobium sp. Root274 Isolate Unclassified
160 2643221723 Ensifer sp. Root278 Isolate Unclassified
161 2643221726 Ensifer sp. Root954 Isolate Unclassified
162 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
163 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
164 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
165 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
166 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
167 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
168 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
169 2718217882 Rhizobium sp. N741 Isolate Nodule
170 2718217927 Rhizobium sp. N324 Isolate Nodule
171 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
172 2718218009 Rhizobium sp. N561 Isolate Nodule
173 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
174 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
175 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
176 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
177 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
178 2718218363 Rhizobium sp. N113 Isolate Nodule
179 2718218365 Rhizobium sp. N731 Isolate Nodule
180 2718218366 Rhizobium sp. N621 Isolate Nodule
181 2718218423 Rhizobium sp. N941 Isolate Nodule
182 2721755514 Rhizobium sp. N6212 Isolate Nodule
183 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
184 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
185 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
186 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
187 2721755809 Rhizobium sp. N541 Isolate Nodule
188 2721755810 Rhizobium sp. N871 Isolate Nodule
189 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
190 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
191 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
192 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
193 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
194 2728369365 Rhizobium sp. N1341 Isolate Nodule
195 2728369397 Rhizobium sp. N1314 Isolate Nodule
196 2738541293 Rhizobium sp. GV031 Isolate Unclassified
197 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
198 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
199 2738543024 Aminobacter sp. AP02 Isolate Unclassified
200 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
201 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
202 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
203 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
204 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
205 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
206 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
207 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
208 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
209 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
210 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
211 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
212 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
213 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
214 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
215 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
216 2791355256 Rhizobium sp. M10 Isolate Nodule
217 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
218 2791355260 Rhizobium sp. L9 Isolate Nodule
219 2791355261 Rhizobium sp. J15 Isolate Nodule
220 2791355262 Rhizobium sp. M1 Isolate Nodule
221 2791355263 Rhizobium chutanense C5 Isolate Nodule
222 2791355264 Rhizobium sp. S9 Isolate Nodule
223 2791355265 Rhizobium sp. H4 Isolate Nodule
224 2791355266 Rhizobium sp. L43 Isolate Nodule
225 2791355267 Rhizobium sp. L18 Isolate Nodule
226 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
227 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
228 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
229 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
230 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
231 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
232 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
233 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
234 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
235 2802429633 Rhizobium anhuiense J3 Isolate Nodule
236 2802429634 Rhizobium anhuiense S10 Isolate Nodule
237 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
238 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
239 2802429637 Rhizobium anhuiense C15 Isolate Nodule
240 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
241 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
242 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
243 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
244 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
245 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
246 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
247 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
248 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
249 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
250 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
251 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
252 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
253 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
254 2838048938 Rhizobium pisi 27/80 Isolate Nodule
255 2838061910 Rhizobium phaseoli L15 Isolate Nodule
256 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
257 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
258 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
259 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
260 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
261 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
262 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
263 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
264 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
265 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
266 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
267 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
268 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
269 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
270 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
271 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
272 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
273 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
274 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
275 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
276 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
277 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
278 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
279 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
280 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
281 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
282 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
283 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
284 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
285 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
286 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
287 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
288 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
289 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
290 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
291 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
292 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
293 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
294 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
295 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
296 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
297 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
298 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
299 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
300 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
301 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
302 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
303 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
304 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
305 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
306 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
307 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
308 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
309 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
310 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
311 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
312 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
313 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
314 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
315 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
316 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
317 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
318 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
319 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
320 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
321 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
322 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
323 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
324 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
325 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
326 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
327 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
328 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
329 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
330 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
331 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
332 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
333 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
334 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
335 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
336 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
337 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
338 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
339 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
340 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
341 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
342 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
343 2844163670 Ensifer sp. 1H6 Isolate Unclassified
344 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
345 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
346 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
347 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
348 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
349 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
350 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
351 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
352 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
353 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
354 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
355 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
356 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
357 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
358 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
359 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
360 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
361 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
362 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
363 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
364 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
365 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
366 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
367 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
368 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
369 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
370 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
371 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
372 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
373 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
374 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
375 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
376 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
377 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
378 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
379 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
380 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
381 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
382 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
383 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
384 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
385 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
386 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
387 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
388 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
389 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
390 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
391 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
392 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
393 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
394 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
395 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
396 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
397 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
398 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
399 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
400 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
401 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
402 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
403 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
404 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
405 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
406 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
407 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
408 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
409 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
410 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
411 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
412 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
413 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
414 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
415 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
416 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
417 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
418 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
419 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
420 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
421 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
422 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
423 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
424 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
425 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
426 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
427 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
428 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
429 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
430 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
431 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
432 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
433 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
434 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
435 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
436 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
437 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
438 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
439 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
440 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
441 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
442 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
443 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
444 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
445 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
446 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
447 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
448 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
449 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
450 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
451 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
452 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
453 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
454 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
455 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
456 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
457 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
458 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
459 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
460 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
461 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
462 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
463 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
464 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
465 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
466 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
467 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
468 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
469 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
470 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
471 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
472 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
473 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
474 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
475 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
476 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
477 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
478 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
479 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
480 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
481 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
482 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
483 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
484 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
485 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
486 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
487 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
488 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
489 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
490 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
491 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
492 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
493 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
494 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
495 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
496 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
497 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
498 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
499 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
500 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
501 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
502 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
503 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
504 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
505 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
506 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
507 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
508 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
509 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
510 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
511 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
512 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
513 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
514 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
515 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
516 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
517 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
518 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
519 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
520 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
521 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
522 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
523 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
524 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
525 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
526 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
527 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
528 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
529 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
530 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
531 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
532 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
533 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
534 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
535 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
536 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
537 2932401849 Devosia sp. 2618 Isolate Rhizosphere
538 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
539 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
540 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
541 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
542 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
543 2933599457 Rhizobium phaseoli M3 Isolate Nodule
544 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
545 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
546 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
547 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
548 2936381700 Rhizobium chutanense C16 Isolate Unclassified
549 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
550 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
551 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
552 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
553 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
554 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
555 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
556 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
557 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
558 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
559 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
560 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
561 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
562 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
563 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
564 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
565 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
566 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
567 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
568 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
569 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
570 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
571 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
572 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
573 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
574 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
575 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
576 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
577 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
578 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
579 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
580 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
581 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
582 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
583 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
584 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
585 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
586 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
587 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
588 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
589 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
590 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
591 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
592 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
593 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
594 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
595 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
596 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
597 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
598 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
599 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
600 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
601 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
602 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
603 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
604 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
605 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
606 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
607 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
608 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
609 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
610 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
611 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
612 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
613 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
614 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
615 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
616 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
617 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
618 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
619 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
620 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
621 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
622 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
623 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
624 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
625 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
626 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
627 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
628 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
629 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
630 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
631 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
632 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
633 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
634 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
635 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
636 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
637 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
638 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
639 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
640 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
641 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
642 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
643 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
644 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
645 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
646 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
647 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
648 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
649 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
650 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
651 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
652 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
653 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
654 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
655 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
656 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
657 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
658 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
659 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
660 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
661 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
662 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
663 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
664 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
665 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
666 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
667 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
668 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
669 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
670 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
671 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
672 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
673 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
674 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
675 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
676 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
677 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
678 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
679 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
680 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
681 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
682 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
683 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
684 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
685 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
686 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
687 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
688 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
689 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
690 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
691 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
692 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
693 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
694 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
695 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
696 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
697 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
698 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
699 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
700 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
701 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
702 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
703 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
704 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
705 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
706 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
707 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
708 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
709 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
710 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
711 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
712 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
713 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
714 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
715 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
716 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
717 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
718 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
719 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
720 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
721 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
722 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
723 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
724 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
725 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
726 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
727 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
728 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
729 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
730 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
731 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
732 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
733 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
734 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
735 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
736 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
737 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
738 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
739 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
740 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
741 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
742 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
743 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
744 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
745 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
746 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
747 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
748 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
749 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
750 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
751 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
752 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
753 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
754 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
755 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
756 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
757 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
758 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
759 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
760 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
761 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
762 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
763 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
764 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
765 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
766 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
767 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
768 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
769 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
770 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
771 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
772 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
773 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
774 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
775 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
776 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
777 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
778 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
779 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
780 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
781 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
782 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
783 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
784 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
785 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
786 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
787 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
788 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
789 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
790 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
791 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
792 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
793 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
794 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
795 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
796 2996887358 Rhizobium sp. R711 Isolate Nodule
797 2996893221 Rhizobium sp. R635 Isolate Nodule
798 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
799 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
800 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
801 3004167301 Mesorhizobium loti 582 Isolate Unclassified
802 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
803 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
804 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
805 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
806 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
807 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
808 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
809 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
810 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
811 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
812 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
813 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
814 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
815 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
816 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
817 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
818 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
819 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
820 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
821 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
822 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
823 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
824 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
825 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
826 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
827 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
828 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
829 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
830 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
831 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
832 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
833 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
834 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
835 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
836 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
837 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
838 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
839 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
840 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
841 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
842 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
843 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
844 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
845 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
846 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
847 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
848 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
849 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
850 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
851 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
852 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
853 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
854 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
855 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
856 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
857 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
858 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
859 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
860 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
861 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
862 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
863 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
864 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
865 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
866 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
867 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
868 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
869 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
870 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
871 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
872 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
873 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
874 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
875 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
876 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
877 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
878 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
879 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
880 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
881 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
882 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
883 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
884 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
885 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
886 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
887 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
888 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
889 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
890 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
891 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
892 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
893 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
894 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
895 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
896 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
897 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
898 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
899 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
900 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
901 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
902 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
903 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
904 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
905 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
906 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
907 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
908 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
909 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
910 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
911 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
912 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
913 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
914 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
915 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
916 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
917 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
918 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
919 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
920 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
921 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
922 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
923 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
924 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
925 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
926 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
927 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
928 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
929 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
930 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
931 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
932 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
933 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
934 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
935 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
936 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
937 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
938 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
939 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
940 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
941 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
942 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
943 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
944 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
945 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
946 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
947 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
948 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
949 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
950 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
951 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
952 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
953 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
954 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
955 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
956 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
957 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
958 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
959 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
960 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
961 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
962 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
963 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
964 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
965 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
966 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
967 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
968 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
969 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
970 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
971 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
972 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
973 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
974 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
975 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
976 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
977 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
978 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
979 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
980 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
981 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
982 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
983 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
984 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
985 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
986 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
987 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
988 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
989 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
990 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
991 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
992 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
993 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
994 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
995 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
996 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
997 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
998 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
999 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1000 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1001 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1002 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1003 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1004 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1005 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1006 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1007 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1008 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1009 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1010 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1011 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1012 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1013 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1014 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1015 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1016 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1017 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1018 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1019 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1020 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1021 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1022 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1023 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1024 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1025 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1026 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1027 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1028 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1029 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1030 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
1031 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1032 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1033 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
1034 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1035 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1036 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1037 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
1038 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1039 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1040 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1041 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1042 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1043 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1044 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
1045 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
1046 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1047 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
1048 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1049 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1050 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
1051 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1052 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1053 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1054 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1055 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1056 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1057 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1058 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1059 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
1060 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1061 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1062 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
1063 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1064 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1065 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1066 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1067 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1068 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1069 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1070 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1071 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1072 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1073 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1074 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1075 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1076 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1077 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1078 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1079 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1080 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1081 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1082 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1083 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1084 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1085 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1086 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1087 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1088 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
1089 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1090 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
1091 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
1092 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
1093 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
1094 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
1095 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1096 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
1097 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
1098 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1099 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
1100 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1102 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
1103 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
1104 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
1105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1106 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
1107 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
1108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
1110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
1144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1146 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1191 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
1192 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
1193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1197 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
1198 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1212 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1213 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1215 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1216 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1219 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1220 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1222 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1224 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1225 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1228 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1229 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1230 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1231 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1232 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1234 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1235 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1236 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1237 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1238 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1239 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1240 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1242 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1243 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1244 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1245 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1246 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1247 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1248 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1249 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1250 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1251 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1252 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1253 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1254 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1255 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1256 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1257 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1258 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1259 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1260 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1261 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1262 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1263 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1264 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1265 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1266 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1267 8005258706 Rhizobium sp. R693 Isolate Nodule
1268 8005275841 Rhizobium sp. N4311 Isolate Nodule
1269 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1270 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1271 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1272 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1273 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1274 8005321885 Rhizobium sp. R72 Isolate Nodule
1275 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1276 8005382845 Rhizobium sp. R634 Isolate Nodule
1277 8005395548 Rhizobium sp. R339 Isolate Nodule
1278 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1279 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1280 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1281 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1282 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1283 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1284 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1285 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1286 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1287 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1288 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1289 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1290 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1291 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1292 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1293 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1294 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1295 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1296 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1297 8018176218 Rhizobium sp. N122 Isolate Nodule
1298 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1299 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1300 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1301 8024501048 Rhizobium sp. H4 Isolate Nodule
1302 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1303 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1304 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1305 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1306 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1307 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1308 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1309 8056382006 Rhizobium croatiense 13T Isolate Nodule
1310 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1311 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1312 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.84
Metatranscriptomes 0.65
Isolates 41.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 13.25
Nodule 32.09
Rhizoplane 1.26
Rhizosphere 40.9
Stem 0
Stem Tuber 0
Unclassified 12.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C103 2010549000 Bacteria 1505
2 JGI24740J21852_10019185 3300001979 Bacteria 2413
3 JGI24739J22299_10005006 3300001989 Bacteria 5043
4 JGI24739J22299_10086897 3300001989 Bacteria 955
5 JGI24735J21928_10031234 3300002067 Bacteria 1579
6 JGI25155J39150_1000010 3300002704 Bacteria 207717
7 JGI25156J39149_1000033 3300002705 Bacteria 114688
8 JGI25156J39149_1000186 3300002705 Bacteria 45132
9 JGI25156J39149_1020859 3300002705 Bacteria 1143
10 JGI25162J39368_1000413 3300002737 Bacteria 34872
11 JGI25154J39366_1000187 3300002738 Bacteria 46590
12 JGI25157J39369_1000009 3300002741 Bacteria 207868
13 JGI25157J39369_1001145 3300002741 Bacteria 11504
14 JGI25152J39213_1002996 3300002773 Bacteria 5979
15 JGI25152J39213_1003625 3300002773 Bacteria 5214
16 JGI25150J39212_1000061 3300002774 Bacteria 64691
17 JGI25150J39212_1008264 3300002774 Bacteria 2046
18 JGI25159J45721_1000095 3300002987 Bacteria 41848
19 JGI25159J45721_1001470 3300002987 Bacteria 9709
20 JGI25151J46595_10000081 3300003187 Bacteria 131317
21 JGI25151J46595_10004446 3300003187 Bacteria 7418
22 JGI25151J46595_10006138 3300003187 Bacteria 6093
23 JGI25151J46595_10019526 3300003187 Bacteria 2877
24 JGI25151J46595_10097824 3300003187 Bacteria 798
25 JGI25406J46586_10032295 3300003203 Bacteria 1946
26 JGI25165J46597_1000310 3300003214 Bacteria 59406
27 JGI25165J46597_1000560 3300003214 Bacteria 33696
28 JGI25165J46597_1001161 3300003214 Bacteria 16286
29 JGI25153J46596_10002363 3300003215 Bacteria 10925
30 JGI25153J46596_10002751 3300003215 Bacteria 10011
31 JGI25153J46596_10031226 3300003215 Bacteria 1797
32 JGI25153J46596_10081950 3300003215 Bacteria 802
33 JGI25160J50197_1000085 3300003354 Bacteria 96359
34 JGI25160J50197_1000247 3300003354 Bacteria 41848
35 JGI25160J50197_1003745 3300003354 Bacteria 6702
36 JGI25160J50197_1006221 3300003354 Bacteria 4856
37 JGI25160J50197_1022172 3300003354 Bacteria 1867
38 JGI25161J50226_1000065 3300003374 Bacteria 96359
39 JGI25161J50226_1000136 3300003374 Bacteria 50681
40 JGI25161J50226_1000853 3300003374 Bacteria 11310
41 JGI25161J50226_1003104 3300003374 Bacteria 3957
42 Ga0006562J51391_1055964 3300003578 Bacteria 14900
43 Ga0006562J51391_1055965 3300003578 Bacteria 10100
44 Ga0055542_1000373 3300003762 Bacteria 46236
45 Ga0055529_1003026 3300003763 Bacteria 2944
46 Ga0055526_1006261 3300003771 Bacteria 6519
47 Ga0055526_1007490 3300003771 Bacteria 5657
48 Ga0055526_1008265 3300003771 Bacteria 5222
49 Ga0055526_1010341 3300003771 Bacteria 4356
50 Ga0055526_1012355 3300003771 Bacteria 3737
51 Ga0055524_1001281 3300003775 Bacteria 14737
52 Ga0055524_1003268 3300003775 Bacteria 7936
53 Ga0055524_1009629 3300003775 Bacteria 3906
54 Ga0055524_1025110 3300003775 Bacteria 1873
55 Ga0055536_1001218 3300003781 Bacteria 15948
56 Ga0055536_1001688 3300003781 Bacteria 13068
57 Ga0055536_1003846 3300003781 Bacteria 7901
58 Ga0055528_1002915 3300003790 Bacteria 8890
59 Ga0055528_1010563 3300003790 Bacteria 3744
60 Ga0055528_1023567 3300003790 Bacteria 1873
61 Ga0055530_10016258 3300003791 Bacteria 2387
62 Ga0055540_1000789 3300003792 Bacteria 21439
63 Ga0055540_1009670 3300003792 Bacteria 3299
64 Ga0055540_1009673 3300003792 Bacteria 3298
65 Ga0055540_1037182 3300003792 Bacteria 1075
66 Ga0055540_1048437 3300003792 Bacteria 886
67 Ga0055531_10004531 3300003794 Bacteria 8427
68 Ga0055531_10011999 3300003794 Bacteria 4115
69 Ga0055531_10058681 3300003794 Bacteria 955
70 Ga0058692_1005178 3300003856 Bacteria 3749
71 Ga0058692_1006935 3300003856 Bacteria 3054
72 Ga0055543_1000067 3300004625 Bacteria 96039
73 Ga0055543_1000228 3300004625 Bacteria 44611
74 Ga0055543_1000496 3300004625 Bacteria 22765
75 Ga0055543_1001108 3300004625 Bacteria 11622
76 Ga0065165_1000237 3300005262 Bacteria 96039
77 Ga0065165_1000804 3300005262 Bacteria 41886
78 Ga0065165_1007131 3300005262 Bacteria 5600
79 Ga0065165_1008692 3300005262 Bacteria 4697
80 Ga0065715_10502147 3300005293 Bacteria 779
81 Ga0070658_10028401 3300005327 Bacteria 4490
82 Ga0070658_10073839 3300005327 Bacteria 2797
83 Ga0070670_100000117 3300005331 Bacteria 74455
84 Ga0070670_100501705 3300005331 Bacteria 1079
85 Ga0070666_10302678 3300005335 Bacteria 1139
86 Ga0070680_100029781 3300005336 Bacteria 4382
87 Ga0070682_100157304 3300005337 Bacteria 1566
88 Ga0068868_100115786 3300005338 Bacteria 2182
89 Ga0070660_100016402 3300005339 Bacteria 5375
90 Ga0070660_100038074 3300005339 Bacteria 3649
91 Ga0070660_100166434 3300005339 Bacteria 1779
92 Ga0070660_100526988 3300005339 Bacteria 984
93 Ga0070661_100000296 3300005344 Bacteria 40209
94 Ga0070661_100012968 3300005344 Bacteria 5843
95 Ga0070661_100024245 3300005344 Bacteria 4351
96 Ga0070661_100107162 3300005344 Bacteria 2084
97 Ga0070668_100013003 3300005347 Bacteria 6198
98 Ga0070668_100027637 3300005347 Bacteria 4307
99 Ga0070669_100008498 3300005353 Bacteria 7327
100 Ga0070669_100409453 3300005353 Bacteria 1111
101 Ga0070669_100675388 3300005353 Bacteria 871
102 Ga0070671_100016041 3300005355 Bacteria 6053
103 Ga0070674_100018397 3300005356 Bacteria 4417
104 Ga0070674_100237318 3300005356 Bacteria 1426
105 Ga0070674_101220888 3300005356 Bacteria 668
106 Ga0070673_100057713 3300005364 Bacteria 3067
107 Ga0070659_100035513 3300005366 Bacteria 3881
108 Ga0070659_100197099 3300005366 Bacteria 1657
109 Ga0070659_100256634 3300005366 Bacteria 1450
110 Ga0070667_100033713 3300005367 Bacteria 4283
111 Ga0070709_10017337 3300005434 Bacteria 4129
112 Ga0070709_10084634 3300005434 Bacteria 2077
113 Ga0070709_10235681 3300005434 Bacteria 1312
114 Ga0070714_100033220 3300005435 Bacteria 4313
115 Ga0070714_100386106 3300005435 Bacteria 1321
116 Ga0070714_100966881 3300005435 Bacteria 828
117 Ga0070713_100460638 3300005436 Bacteria 1195
118 Ga0070713_100599204 3300005436 Bacteria 1047
119 Ga0070713_100905204 3300005436 Bacteria 849
120 Ga0070710_10413748 3300005437 Bacteria 906
121 Ga0070711_100576550 3300005439 Bacteria 936
122 Ga0070700_100432498 3300005441 Bacteria 997
123 Ga0070708_101662325 3300005445 Bacteria 594
124 Ga0070663_100112459 3300005455 Bacteria 2048
125 Ga0070663_100142237 3300005455 Bacteria 1833
126 Ga0070663_100193263 3300005455 Bacteria 1585
127 Ga0070663_100219303 3300005455 Bacteria 1492
128 Ga0070678_100274208 3300005456 Bacteria 1424
129 Ga0070678_100857650 3300005456 Bacteria 828
130 Ga0070662_100573401 3300005457 Bacteria 947
131 Ga0070662_100942425 3300005457 Bacteria 738
132 Ga0070681_10174837 3300005458 Bacteria 2069
133 Ga0070681_10293492 3300005458 Bacteria 1536
134 Ga0070681_10466499 3300005458 Bacteria 1175
135 Ga0070698_100007183 3300005471 Bacteria 12067
136 Ga0070698_100118552 3300005471 Bacteria 2608
137 Ga0070698_100571281 3300005471 Bacteria 1070
138 Ga0070679_100027144 3300005530 Bacteria 5631
139 Ga0070679_100280171 3300005530 Bacteria 1620
140 Ga0068853_100001252 3300005539 Bacteria 18139
141 Ga0068853_100005716 3300005539 Bacteria 9787
142 Ga0068853_100031089 3300005539 Bacteria 4514
143 Ga0068853_100563317 3300005539 Bacteria 1080
144 Ga0070672_100076275 3300005543 Bacteria 2678
145 Ga0070693_100089909 3300005547 Bacteria 1849
146 Ga0070665_100005352 3300005548 Bacteria 13259
147 Ga0070665_100015576 3300005548 Bacteria 7638
148 Ga0070665_100032869 3300005548 Bacteria 5220
149 Ga0070665_100177540 3300005548 Bacteria 2130
150 Ga0070665_100300247 3300005548 Bacteria 1609
151 Ga0070665_100336560 3300005548 Bacteria 1514
152 Ga0070665_100457868 3300005548 Bacteria 1286
153 Ga0070704_100407133 3300005549 Bacteria 1162
154 Ga0068855_100060065 3300005563 Bacteria 4447
155 Ga0068855_100108106 3300005563 Bacteria 3194
156 Ga0068855_100257099 3300005563 Bacteria 1947
157 Ga0068855_100264287 3300005563 Bacteria 1916
158 Ga0068855_100389576 3300005563 Bacteria 1529
159 Ga0068857_100346296 3300005577 Bacteria 1375
160 Ga0068854_100005130 3300005578 Bacteria 8256
161 Ga0068854_100043930 3300005578 Bacteria 3170
162 Ga0068854_100241213 3300005578 Bacteria 1439
163 Ga0068854_100440531 3300005578 Bacteria 1086
164 Ga0068856_100026673 3300005614 Bacteria 5634
165 Ga0068856_100162455 3300005614 Bacteria 2244
166 Ga0068856_100246144 3300005614 Bacteria 1803
167 Ga0068856_100348899 3300005614 Bacteria 1498
168 Ga0068856_100639003 3300005614 Bacteria 1085
169 Ga0068856_100723633 3300005614 Bacteria 1015
170 Ga0070702_100499621 3300005615 Bacteria 893
171 Ga0068852_100047717 3300005616 Bacteria 3655
172 Ga0068852_100060673 3300005616 Bacteria 3283
173 Ga0068852_100092597 3300005616 Bacteria 2707
174 Ga0068852_100259378 3300005616 Bacteria 1668
175 Ga0068864_100570136 3300005618 Bacteria 1096
176 Ga0068851_10016887 3300005834 Bacteria 3498
177 Ga0068851_10111015 3300005834 Bacteria 1464
178 Ga0068870_10298444 3300005840 Bacteria 1016
179 Ga0068858_100227085 3300005842 Bacteria 1769
180 Ga0068862_100262437 3300005844 Bacteria 1577
181 Ga0081455_10000455 3300005937 Bacteria 53708
182 Ga0081455_10311331 3300005937 Bacteria 1125
183 Ga0081540_1029085 3300005983 Bacteria 3087
184 Ga0081540_1035798 3300005983 Bacteria 2657
185 Ga0081539_10002004 3300005985 Bacteria 30879
186 Ga0070717_10002293 3300006028 Bacteria 13425
187 Ga0075365_10004176 3300006038 Bacteria 7605
188 Ga0075365_10006633 3300006038 Bacteria 6390
189 Ga0075365_10011265 3300006038 Bacteria 5253
190 Ga0075365_10023551 3300006038 Bacteria 3874
191 Ga0075365_10052752 3300006038 Bacteria 2691
192 Ga0075365_10288533 3300006038 Bacteria 1155
193 Ga0075365_10382480 3300006038 Bacteria 993
194 Ga0075368_10005353 3300006042 Bacteria 4410
195 Ga0075368_10027055 3300006042 Bacteria 2210
196 Ga0075368_10035760 3300006042 Bacteria 1939
197 Ga0075363_100049065 3300006048 Bacteria 2247
198 Ga0075363_100089591 3300006048 Bacteria 1691
199 Ga0075363_100094838 3300006048 Bacteria 1645
200 Ga0075363_100120761 3300006048 Bacteria 1463
201 Ga0075363_100391793 3300006048 Bacteria 815
202 Ga0075364_10000157 3300006051 Bacteria 29932
203 Ga0075364_10003611 3300006051 Bacteria 8817
204 Ga0075364_10010836 3300006051 Bacteria 5520
205 Ga0075364_10047128 3300006051 Bacteria 2807
206 Ga0075364_10149669 3300006051 Bacteria 1573
207 Ga0075364_10447909 3300006051 Bacteria 882
208 Ga0070716_100050646 3300006173 Bacteria 2358
209 Ga0070716_100390035 3300006173 Bacteria 998
210 Ga0070712_100010231 3300006175 Bacteria 5914
211 Ga0070712_100097656 3300006175 Bacteria 2165
212 Ga0075362_10000293 3300006177 Bacteria 14125
213 Ga0075362_10006767 3300006177 Bacteria 4286
214 Ga0075362_10007354 3300006177 Bacteria 4166
215 Ga0075362_10020155 3300006177 Bacteria 2783
216 Ga0075362_10060453 3300006177 Bacteria 1713
217 Ga0075362_10102680 3300006177 Bacteria 1338
218 Ga0075362_10355401 3300006177 Bacteria 734
219 Ga0075367_10001300 3300006178 Bacteria 10583
220 Ga0075367_10001485 3300006178 Bacteria 10122
221 Ga0075367_10031249 3300006178 Bacteria 3057
222 Ga0075367_10074556 3300006178 Bacteria 2046
223 Ga0075367_10087198 3300006178 Bacteria 1895
224 Ga0075367_10183797 3300006178 Bacteria 1304
225 Ga0075367_10248519 3300006178 Bacteria 1115
226 Ga0075367_10302709 3300006178 Bacteria 1006
227 Ga0075367_10307118 3300006178 Bacteria 999
228 Ga0075367_10622784 3300006178 Bacteria 686
229 Ga0075369_10000770 3300006186 Bacteria 10465
230 Ga0075369_10097842 3300006186 Bacteria 1314
231 Ga0075369_10225645 3300006186 Bacteria 867
232 Ga0075366_10053986 3300006195 Bacteria 2387
233 Ga0075366_10067308 3300006195 Bacteria 2131
234 Ga0075366_10084259 3300006195 Bacteria 1900
235 Ga0075366_10245143 3300006195 Bacteria 1093
236 Ga0075370_10011674 3300006353 Bacteria 4623
237 Ga0075370_10018590 3300006353 Bacteria 3773
238 Ga0075370_10038072 3300006353 Bacteria 2706
239 Ga0075370_10085817 3300006353 Bacteria 1813
240 Ga0075370_10112335 3300006353 Bacteria 1583
241 Ga0075370_10437222 3300006353 Bacteria 787
242 Ga0075370_10480422 3300006353 Bacteria 749
243 Ga0075434_100087692 3300006871 Bacteria 3113
244 Ga0075434_100695696 3300006871 Bacteria 1034
245 Ga0068865_100423903 3300006881 Bacteria 1095
246 Ga0079104_1000101 3300006946 Bacteria 125456
247 Ga0079104_1003469 3300006946 Bacteria 7301
248 Ga0099826_10000025 3300006948 Bacteria 146840
249 Ga0099826_10119128 3300006948 Bacteria 1558
250 Ga0099795_10026661 3300007788 Bacteria 1949
251 Ga0105244_10056525 3300009036 Bacteria 1986
252 Ga0105240_10185538 3300009093 Bacteria 2450
253 Ga0105240_10394474 3300009093 Bacteria 1560
254 Ga0105240_10522780 3300009093 Bacteria 1316
255 Ga0105240_10593790 3300009093 Bacteria 1220
256 Ga0105245_10002744 3300009098 Bacteria 15829
257 Ga0105245_11239150 3300009098 Bacteria 794
258 Ga0105245_11874825 3300009098 Bacteria 653
259 Ga0105243_10024593 3300009148 Bacteria 4595
260 Ga0105243_10450830 3300009148 Bacteria 1207
261 Ga0105243_10547021 3300009148 Bacteria 1105
262 Ga0105243_11666717 3300009148 Bacteria 666
263 Ga0105241_10116885 3300009174 Bacteria 2142
264 Ga0105241_10288863 3300009174 Bacteria 1403
265 Ga0105241_10302386 3300009174 Bacteria 1373
266 Ga0105248_10689207 3300009177 Bacteria 1153
267 Ga0105237_10357992 3300009545 Bacteria 1464
268 Ga0105238_10056299 3300009551 Bacteria 3946
269 Ga0105238_10100900 3300009551 Bacteria 2869
270 Ga0105238_10134744 3300009551 Bacteria 2448
271 Ga0105249_10843282 3300009553 Bacteria 982
272 Ga0105249_10909470 3300009553 Bacteria 947
273 Ga0123341_1000187 3300009765 Bacteria 31482
274 Ga0123341_1107456 3300009765 Bacteria 885
275 Ga0123342_1010657 3300009766 Bacteria 10417
276 Ga0123342_1021786 3300009766 Bacteria 4447
277 Ga0099796_10026125 3300010159 Bacteria 1851
278 Ga0105239_10190855 3300010375 Bacteria 2293
279 Ga0105239_10247749 3300010375 Bacteria 2001
280 Ga0105239_11501822 3300010375 Bacteria 779
281 Ga0105239_12099761 3300010375 Bacteria 656
282 Ga0105246_10507415 3300011119 Bacteria 1025
283 Ga0105246_10992854 3300011119 Bacteria 759
284 Ga0105246_11143753 3300011119 Bacteria 713
285 Ga0157314_1003929 3300012500 Bacteria 1074
286 Ga0157313_1001120 3300012503 Bacteria 1392
287 Ga0157373_10000538 3300013100 Bacteria 29637
288 Ga0157373_10315789 3300013100 Bacteria 1111
289 Ga0157373_10414892 3300013100 Bacteria 966
290 Ga0157371_10000002 3300013102 Bacteria 665040
291 Ga0157371_10051193 3300013102 Bacteria 2934
292 Ga0157371_10362901 3300013102 Bacteria 1056
293 Ga0157371_10467772 3300013102 Bacteria 928
294 Ga0157370_10001468 3300013104 Bacteria 29148
295 Ga0157370_10002446 3300013104 Bacteria 22403
296 Ga0157370_10073529 3300013104 Bacteria 3225
297 Ga0157370_10092381 3300013104 Bacteria 2841
298 Ga0157370_10241426 3300013104 Bacteria 1671
299 Ga0157369_10054796 3300013105 Bacteria 4305
300 Ga0157369_10068264 3300013105 Bacteria 3819
301 Ga0157369_10431985 3300013105 Bacteria 1365
302 Ga0157369_10667326 3300013105 Bacteria 1071
303 Ga0157374_10038063 3300013296 Bacteria 4419
304 Ga0163162_10831721 3300013306 Bacteria 1039
305 Ga0157372_10176020 3300013307 Bacteria 2476
306 Ga0157372_10977776 3300013307 Bacteria 981
307 Ga0157372_11201125 3300013307 Bacteria 876
308 Ga0157380_10446605 3300014326 Bacteria 1241
309 Ga0182008_10031185 3300014497 Bacteria 2684
310 Ga0157379_10806308 3300014968 Bacteria 886
311 Ga0157379_11103406 3300014968 Bacteria 760
312 Ga0182006_1070635 3300015261 Bacteria 1296
313 Ga0183363_1270 3300015690 Bacteria 8323
314 Ga0163161_10025594 3300017792 Bacteria 4177
315 Ga0163161_10575580 3300017792 Bacteria 926
316 Ga0163161_10594470 3300017792 Bacteria 912
317 Ga0214544_1000132 3300021320 Bacteria 108681
318 Ga0214542_1004982 3300021321 Bacteria 25735
319 Ga0214542_1027376 3300021321 Bacteria 2620
320 Ga0214543_1000008 3300021327 Bacteria 385680
321 Ga0214543_1000102 3300021327 Bacteria 108906
322 Ga0213873_10119079 3300021358 Bacteria 774
323 Ga0213874_10017735 3300021377 Bacteria 1914
324 Ga0213874_10039805 3300021377 Bacteria 1401
325 Ga0213874_10240690 3300021377 Bacteria 664
326 Ga0213876_10000074 3300021384 Bacteria 120394
327 Ga0213876_10001741 3300021384 Bacteria 13209
328 Ga0228711_1000022 3300022739 Bacteria 107483
329 Ga0228710_1000028 3300022740 Bacteria 102538
330 Ga0209435_100009 3300025206 Bacteria 476614
331 Ga0209760_100811 3300025207 Bacteria 4237
332 Ga0209436_100089 3300025208 Bacteria 45843
333 Ga0209436_100658 3300025208 Bacteria 14733
334 Ga0209436_104215 3300025208 Bacteria 3600
335 Ga0209437_100057 3300025233 Bacteria 362922
336 Ga0209437_100902 3300025233 Bacteria 11804
337 Ga0207425_1000034 3300025245 Bacteria 227886
338 Ga0207425_1001593 3300025245 Bacteria 9200
339 Ga0207425_1004102 3300025245 Bacteria 4457
340 Ga0207425_1019678 3300025245 Bacteria 1450
341 Ga0207425_1043848 3300025245 Bacteria 841
342 Ga0209646_1000018 3300025246 Bacteria 476716
343 Ga0209646_1012231 3300025246 Bacteria 1320
344 Ga0209026_1000068 3300025250 Bacteria 207601
345 Ga0209026_1000228 3300025250 Bacteria 77019
346 Ga0209148_1000069 3300025254 Bacteria 334444
347 Ga0209148_1007004 3300025254 Bacteria 2382
348 Ga0209148_1021821 3300025254 Bacteria 1036
349 Ga0209759_1000007 3300025256 Bacteria 476614
350 Ga0209759_1000183 3300025256 Bacteria 102218
351 Ga0209129_1000094 3300025258 Bacteria 172051
352 Ga0209129_1000290 3300025258 Bacteria 47943
353 Ga0209129_1000519 3300025258 Bacteria 27449
354 Ga0209129_1002114 3300025258 Bacteria 10121
355 Ga0209129_1003585 3300025258 Bacteria 6645
356 Ga0209129_1003749 3300025258 Bacteria 6418
357 Ga0209129_1004237 3300025258 Bacteria 5740
358 Ga0209233_1000030 3300025261 Bacteria 636702
359 Ga0209233_1000134 3300025261 Bacteria 202535
360 Ga0209233_1000343 3300025261 Bacteria 45433
361 Ga0209233_1001986 3300025261 Bacteria 7748
362 Ga0209233_1016673 3300025261 Bacteria 2018
363 Ga0209565_1016275 3300025263 Bacteria 1657
364 Ga0209455_1000317 3300025272 Bacteria 48015
365 Ga0209673_1000158 3300025273 Bacteria 143067
366 Ga0209673_1000283 3300025273 Bacteria 94995
367 Ga0209673_1000771 3300025273 Bacteria 43169
368 Ga0209673_1001504 3300025273 Bacteria 21530
369 Ga0209673_1003477 3300025273 Bacteria 9250
370 Ga0209673_1003564 3300025273 Bacteria 9065
371 Ga0209673_1003775 3300025273 Bacteria 8614
372 Ga0209673_1004667 3300025273 Bacteria 7238
373 Ga0209130_1000009 3300025284 Bacteria 498952
374 Ga0209130_1000265 3300025284 Bacteria 65775
375 Ga0209130_1000465 3300025284 Bacteria 41986
376 Ga0209130_1015015 3300025284 Bacteria 1923
377 Ga0209130_1041671 3300025284 Bacteria 882
378 Ga0209675_1038367 3300025291 Bacteria 1068
379 Ga0209676_1000038 3300025292 Bacteria 449305
380 Ga0209676_1000539 3300025292 Bacteria 58730
381 Ga0209676_1010592 3300025292 Bacteria 3816
382 Ga0209676_1021463 3300025292 Bacteria 2168
383 Ga0209676_1024037 3300025292 Bacteria 1982
384 Ga0209676_1035340 3300025292 Bacteria 1466
385 Ga0209025_1000184 3300025294 Bacteria 155611
386 Ga0209025_1000245 3300025294 Bacteria 127801
387 Ga0209025_1000581 3300025294 Bacteria 66321
388 Ga0209025_1000725 3300025294 Bacteria 55900
389 Ga0209025_1002093 3300025294 Bacteria 22567
390 Ga0209025_1003260 3300025294 Bacteria 15630
391 Ga0209025_1012441 3300025294 Bacteria 5451
392 Ga0209025_1057164 3300025294 Bacteria 1493
393 Ga0209564_1000381 3300025295 Bacteria 81150
394 Ga0209564_1000960 3300025295 Bacteria 36623
395 Ga0209564_1003061 3300025295 Bacteria 11875
396 Ga0209564_1003163 3300025295 Bacteria 11588
397 Ga0209564_1010609 3300025295 Bacteria 4219
398 Ga0209758_1000159 3300025297 Bacteria 155588
399 Ga0209758_1000265 3300025297 Bacteria 104078
400 Ga0209758_1000462 3300025297 Bacteria 67358
401 Ga0209758_1001526 3300025297 Bacteria 26781
402 Ga0209758_1002391 3300025297 Bacteria 19295
403 Ga0209758_1002525 3300025297 Bacteria 18509
404 Ga0209758_1002933 3300025297 Bacteria 16417
405 Ga0209758_1008637 3300025297 Bacteria 6541
406 Ga0209758_1028509 3300025297 Bacteria 2358
407 Ga0209050_1004927 3300025298 Bacteria 8718
408 Ga0209050_1006083 3300025298 Bacteria 7294
409 Ga0209050_1007118 3300025298 Bacteria 6390
410 Ga0209050_1008284 3300025298 Bacteria 5598
411 Ga0209256_1000440 3300025299 Bacteria 63735
412 Ga0209256_1000892 3300025299 Bacteria 36721
413 Ga0209256_1001107 3300025299 Bacteria 30848
414 Ga0209256_1006273 3300025299 Bacteria 6381
415 Ga0209256_1014284 3300025299 Bacteria 2868
416 Ga0207426_1000041 3300025302 Bacteria 433536
417 Ga0207426_1000048 3300025302 Bacteria 409127
418 Ga0207426_1000309 3300025302 Bacteria 96053
419 Ga0207426_1000646 3300025302 Bacteria 43187
420 Ga0207426_1003476 3300025302 Bacteria 8516
421 Ga0209051_1001304 3300025303 Bacteria 21914
422 Ga0209051_1002360 3300025303 Bacteria 13662
423 Ga0209051_1002835 3300025303 Bacteria 11944
424 Ga0209051_1004388 3300025303 Bacteria 8723
425 Ga0209051_1004410 3300025303 Bacteria 8691
426 Ga0209051_1054500 3300025303 Bacteria 1304
427 Ga0209051_1101445 3300025303 Bacteria 773
428 Ga0209257_1000060 3300025304 Bacteria 372267
429 Ga0209257_1001125 3300025304 Bacteria 34448
430 Ga0209257_1006305 3300025304 Bacteria 7736
431 Ga0209257_1007702 3300025304 Bacteria 6426
432 Ga0209257_1031615 3300025304 Bacteria 1690
433 Ga0209257_1063100 3300025304 Bacteria 1000
434 Ga0207713_1071064 3300025735 Bacteria 1285
435 Ga0207692_10631129 3300025898 Bacteria 691
436 Ga0207710_10154357 3300025900 Bacteria 1115
437 Ga0207688_10279851 3300025901 Bacteria 1016
438 Ga0207680_10281379 3300025903 Bacteria 1156
439 Ga0207647_10032473 3300025904 Bacteria 3352
440 Ga0207647_10053199 3300025904 Bacteria 2496
441 Ga0207647_10118430 3300025904 Bacteria 1562
442 Ga0207647_10201441 3300025904 Bacteria 1151
443 Ga0207699_10046469 3300025906 Bacteria 2540
444 Ga0207699_10061156 3300025906 Bacteria 2265
445 Ga0207699_10423327 3300025906 Bacteria 951
446 Ga0207645_10027448 3300025907 Bacteria 3676
447 Ga0207705_10001133 3300025909 Bacteria 21689
448 Ga0207705_10079479 3300025909 Bacteria 2388
449 Ga0207705_10085130 3300025909 Bacteria 2309
450 Ga0207705_10143375 3300025909 Bacteria 1785
451 Ga0207705_10222022 3300025909 Bacteria 1436
452 Ga0207684_10055486 3300025910 Bacteria 3361
453 Ga0207684_10534251 3300025910 Bacteria 1004
454 Ga0207654_10227493 3300025911 Bacteria 1240
455 Ga0207654_10608385 3300025911 Bacteria 780
456 Ga0207707_10067233 3300025912 Bacteria 3122
457 Ga0207707_10256007 3300025912 Bacteria 1520
458 Ga0207707_10471559 3300025912 Bacteria 1073
459 Ga0207707_10483369 3300025912 Bacteria 1058
460 Ga0207695_10409873 3300025913 Bacteria 1240
461 Ga0207695_10414699 3300025913 Bacteria 1231
462 Ga0207695_10543581 3300025913 Bacteria 1043
463 Ga0207695_10854070 3300025913 Bacteria 790
464 Ga0207671_10000177 3300025914 Bacteria 97072
465 Ga0207671_10095065 3300025914 Bacteria 2250
466 Ga0207671_10133677 3300025914 Bacteria 1906
467 Ga0207671_10206144 3300025914 Bacteria 1537
468 Ga0207693_10339374 3300025915 Bacteria 1176
469 Ga0207663_10194392 3300025916 Bacteria 1459
470 Ga0207663_10349901 3300025916 Bacteria 1118
471 Ga0207660_10018910 3300025917 Bacteria 4600
472 Ga0207657_10006597 3300025919 Bacteria 12018
473 Ga0207657_10012909 3300025919 Bacteria 8215
474 Ga0207657_10125620 3300025919 Bacteria 2107
475 Ga0207657_10131743 3300025919 Bacteria 2048
476 Ga0207649_10001157 3300025920 Bacteria 15886
477 Ga0207649_10100278 3300025920 Bacteria 1915
478 Ga0207649_10210782 3300025920 Bacteria 1378
479 Ga0207652_10477491 3300025921 Bacteria 1123
480 Ga0207652_10911058 3300025921 Bacteria 776
481 Ga0207681_10117602 3300025923 Bacteria 1944
482 Ga0207681_10419238 3300025923 Bacteria 1084
483 Ga0207694_10351430 3300025924 Bacteria 1220
484 Ga0207694_10885412 3300025924 Bacteria 755
485 Ga0207650_10000206 3300025925 Bacteria 67660
486 Ga0207659_10392284 3300025926 Bacteria 1159
487 Ga0207687_10051378 3300025927 Bacteria 2874
488 Ga0207687_10417212 3300025927 Bacteria 1107
489 Ga0207687_10563238 3300025927 Bacteria 957
490 Ga0207687_10719552 3300025927 Bacteria 848
491 Ga0207700_10485354 3300025928 Bacteria 1092
492 Ga0207700_10896745 3300025928 Bacteria 793
493 Ga0207664_10169360 3300025929 Bacteria 1868
494 Ga0207664_10377512 3300025929 Bacteria 1258
495 Ga0207664_10707083 3300025929 Bacteria 906
496 Ga0207644_10060751 3300025931 Bacteria 2735
497 Ga0207690_10079684 3300025932 Bacteria 2283
498 Ga0207690_10133448 3300025932 Bacteria 1820
499 Ga0207690_10150289 3300025932 Bacteria 1726
500 Ga0207690_10258408 3300025932 Bacteria 1348
501 Ga0207706_10019600 3300025933 Bacteria 6085
502 Ga0207709_10466523 3300025935 Bacteria 979
503 Ga0207670_10919524 3300025936 Bacteria 733
504 Ga0207669_10065440 3300025937 Bacteria 2255
505 Ga0207704_10652192 3300025938 Bacteria 867
506 Ga0207704_11141340 3300025938 Bacteria 663
507 Ga0207665_10058456 3300025939 Bacteria 2607
508 Ga0207665_10275933 3300025939 Bacteria 1250
509 Ga0207691_10081034 3300025940 Bacteria 2918
510 Ga0207711_10048402 3300025941 Bacteria 3637
511 Ga0207661_10267073 3300025944 Bacteria 1526
512 Ga0207667_10016808 3300025949 Bacteria 8254
513 Ga0207667_10071271 3300025949 Bacteria 3614
514 Ga0207667_10134484 3300025949 Bacteria 2546
515 Ga0207667_10203312 3300025949 Bacteria 2031
516 Ga0207667_10380655 3300025949 Bacteria 1438
517 Ga0207712_10475390 3300025961 Bacteria 1064
518 Ga0207668_10007643 3300025972 Bacteria 6434
519 Ga0207668_10197804 3300025972 Bacteria 1598
520 Ga0207640_10082243 3300025981 Bacteria 2204
521 Ga0207640_10517991 3300025981 Bacteria 996
522 Ga0207640_10562269 3300025981 Bacteria 960
523 Ga0207640_10898440 3300025981 Bacteria 773
524 Ga0207658_10349383 3300025986 Bacteria 1287
525 Ga0207658_10353083 3300025986 Bacteria 1281
526 Ga0207658_11176451 3300025986 Bacteria 701
527 Ga0207677_10329860 3300026023 Bacteria 1271
528 Ga0207677_10643058 3300026023 Bacteria 935
529 Ga0207639_10000849 3300026041 Bacteria 20766
530 Ga0207639_10001693 3300026041 Bacteria 14889
531 Ga0207639_10215902 3300026041 Bacteria 1654
532 Ga0207639_10405333 3300026041 Bacteria 1229
533 Ga0207678_10020346 3300026067 Bacteria 5823
534 Ga0207678_10095428 3300026067 Bacteria 2542
535 Ga0207678_10126030 3300026067 Bacteria 2184
536 Ga0207678_10214409 3300026067 Bacteria 1647
537 Ga0207702_10012990 3300026078 Bacteria 6926
538 Ga0207702_10100471 3300026078 Bacteria 2552
539 Ga0207702_10118579 3300026078 Bacteria 2365
540 Ga0207702_10220251 3300026078 Bacteria 1768
541 Ga0207702_10541531 3300026078 Bacteria 1138
542 Ga0207702_10704290 3300026078 Bacteria 995
543 Ga0207648_10128230 3300026089 Bacteria 2232
544 Ga0207676_10355690 3300026095 Bacteria 1356
545 Ga0207676_10575492 3300026095 Bacteria 1079
546 Ga0207674_10097480 3300026116 Bacteria 2924
547 Ga0207674_10586338 3300026116 Bacteria 1077
548 Ga0207675_100443710 3300026118 Bacteria 1285
549 Ga0207683_10061765 3300026121 Bacteria 3298
550 Ga0207683_10458199 3300026121 Bacteria 1176
551 Ga0207698_10039501 3300026142 Bacteria 3497
552 Ga0207698_10094689 3300026142 Bacteria 2456
553 Ga0207698_10168960 3300026142 Bacteria 1923
554 Ga0207698_10391489 3300026142 Bacteria 1325
555 Ga0209281_1000028 3300027111 Bacteria 440027
556 Ga0209281_1000247 3300027111 Bacteria 107495
557 Ga0209281_1000628 3300027111 Bacteria 39061
558 Ga0209371_1000003 3300027312 Bacteria 1122971
559 Ga0209371_1000340 3300027312 Bacteria 51178
560 Ga0209371_1001537 3300027312 Bacteria 15275
561 Ga0209371_1036922 3300027312 Bacteria 1018
562 Ga0209983_1012619 3300027665 Bacteria 1735
563 Ga0209282_1000037 3300027666 Bacteria 130160
564 Ga0209282_1000130 3300027666 Bacteria 46001
565 Ga0209282_1111015 3300027666 Bacteria 1392
566 Ga0209813_10001200 3300027866 Bacteria 5787
567 Ga0209974_10310239 3300027876 Bacteria 605
568 Ga0207428_10196817 3300027907 Bacteria 1517
569 Ga0268266_10002019 3300028379 Bacteria 22623
570 Ga0268266_10003518 3300028379 Bacteria 15546
571 Ga0268266_10006863 3300028379 Bacteria 10364
572 Ga0268266_10272937 3300028379 Bacteria 1570
573 Ga0268266_10527024 3300028379 Bacteria 1130
574 Ga0268266_10536901 3300028379 Bacteria 1119
575 Ga0268266_11188042 3300028379 Bacteria 738
576 Ga0268266_11412693 3300028379 Bacteria 671
577 Ga0268265_10129874 3300028380 Bacteria 2092
578 Ga0265318_10000737 3300028577 Bacteria 21809
579 Ga0265318_10066028 3300028577 Bacteria 1345
580 Ga0265318_10066634 3300028577 Bacteria 1337
581 Ga0307515_10000017 3300028794 Bacteria 550465
582 Ga0307515_10046556 3300028794 Bacteria 6625
583 Ga0307515_10071980 3300028794 Bacteria 4675
584 Ga0265338_10063693 3300028800 Bacteria 3213
585 Ga0265338_10165595 3300028800 Bacteria 1702
586 Ga0268256_1000004 3300030500 Bacteria 1122967
587 Ga0268256_1000728 3300030500 Bacteria 24256
588 Ga0268256_1041783 3300030500 Bacteria 1022
589 Ga0316181_1064299 3300030744 Bacteria 2497
590 Ga0265330_10077890 3300031235 Bacteria 1430
591 Ga0265330_10129050 3300031235 Bacteria 1076
592 Ga0265332_10054513 3300031238 Bacteria 1715
593 Ga0265332_10081345 3300031238 Bacteria 1374
594 Ga0265332_10096593 3300031238 Bacteria 1248
595 Ga0265328_10000008 3300031239 Bacteria 208282
596 Ga0265328_10000392 3300031239 Bacteria 20467
597 Ga0265328_10002235 3300031239 Bacteria 8729
598 Ga0265328_10003144 3300031239 Bacteria 7352
599 Ga0265328_10005367 3300031239 Bacteria 5490
600 Ga0265328_10064041 3300031239 Bacteria 1350
601 Ga0265328_10109261 3300031239 Bacteria 1027
602 Ga0265320_10126179 3300031240 Bacteria 1164
603 Ga0265325_10010419 3300031241 Bacteria 5385
604 Ga0265325_10020012 3300031241 Bacteria 3694
605 Ga0265325_10072621 3300031241 Bacteria 1724
606 Ga0265325_10174123 3300031241 Bacteria 1005
607 Ga0265325_10268296 3300031241 Bacteria 768
608 Ga0265329_10021873 3300031242 Bacteria 2144
609 Ga0265329_10023459 3300031242 Bacteria 2055
610 Ga0265329_10033763 3300031242 Bacteria 1654
611 Ga0265340_10015941 3300031247 Bacteria 3897
612 Ga0265340_10063001 3300031247 Bacteria 1770
613 Ga0265340_10070684 3300031247 Bacteria 1655
614 Ga0265340_10090555 3300031247 Bacteria 1430
615 Ga0265339_10001557 3300031249 Bacteria 16946
616 Ga0265339_10043834 3300031249 Bacteria 2471
617 Ga0265339_10045047 3300031249 Bacteria 2429
618 Ga0265331_10000087 3300031250 Bacteria 125673
619 Ga0265331_10001355 3300031250 Bacteria 17996
620 Ga0265331_10001484 3300031250 Bacteria 17311
621 Ga0265331_10302478 3300031250 Bacteria 716
622 Ga0265327_10007959 3300031251 Bacteria 8018
623 Ga0265327_10039122 3300031251 Bacteria 2579
624 Ga0265316_10015136 3300031344 Bacteria 6756
625 Ga0265316_10033919 3300031344 Bacteria 4151
626 Ga0265316_10035031 3300031344 Bacteria 4074
627 Ga0265316_10119542 3300031344 Bacteria 1991
628 Ga0265316_10485333 3300031344 Bacteria 884
629 Ga0307513_10020102 3300031456 Bacteria 7926
630 Ga0307513_10070744 3300031456 Bacteria 3645
631 Ga0307513_10426558 3300031456 Bacteria 1055
632 Ga0307408_100225213 3300031548 Bacteria 1532
633 Ga0307408_100231278 3300031548 Bacteria 1514
634 Ga0307408_100698162 3300031548 Bacteria 912
635 Ga0307408_101038673 3300031548 Bacteria 757
636 Ga0265313_10000070 3300031595 Bacteria 99384
637 Ga0265313_10000338 3300031595 Bacteria 50856
638 Ga0265313_10000674 3300031595 Bacteria 35158
639 Ga0265313_10000869 3300031595 Bacteria 30503
640 Ga0265313_10015451 3300031595 Bacteria 4441
641 Ga0265313_10033239 3300031595 Bacteria 2624
642 Ga0265313_10060026 3300031595 Bacteria 1785
643 Ga0265314_10004909 3300031711 Bacteria 12222
644 Ga0265314_10006102 3300031711 Bacteria 10709
645 Ga0265314_10019522 3300031711 Bacteria 5251
646 Ga0265314_10041875 3300031711 Bacteria 3273
647 Ga0265314_10123433 3300031711 Bacteria 1626
648 Ga0265314_10163664 3300031711 Bacteria 1351
649 Ga0265314_10182865 3300031711 Bacteria 1254
650 Ga0265342_10027030 3300031712 Bacteria 3592
651 Ga0265342_10090293 3300031712 Bacteria 1757
652 Ga0265342_10156815 3300031712 Bacteria 1260
653 Ga0307405_10000088 3300031731 Bacteria 39053
654 Ga0307405_10352710 3300031731 Bacteria 1135
655 Ga0307413_10024596 3300031824 Bacteria 3286
656 Ga0307413_10035838 3300031824 Bacteria 2851
657 Ga0307413_10255722 3300031824 Bacteria 1302
658 Ga0307410_10181904 3300031852 Bacteria 1592
659 Ga0307410_10487774 3300031852 Bacteria 1012
660 Ga0307406_10003431 3300031901 Bacteria 8624
661 Ga0307406_10005469 3300031901 Bacteria 6954
662 Ga0307406_10012491 3300031901 Bacteria 4841
663 Ga0307406_10077862 3300031901 Bacteria 2195
664 Ga0307407_10463425 3300031903 Bacteria 922
665 Ga0307412_10002438 3300031911 Bacteria 10344
666 Ga0307412_10003535 3300031911 Bacteria 8678
667 Ga0307412_10035030 3300031911 Bacteria 3204
668 Ga0307412_10062171 3300031911 Bacteria 2513
669 Ga0307412_10074549 3300031911 Bacteria 2325
670 Ga0307412_10209352 3300031911 Bacteria 1487
671 Ga0307412_10791937 3300031911 Bacteria 822
672 Ga0307412_11398152 3300031911 Bacteria 633
673 Ga0315914_1000002 3300031967 Bacteria 365357
674 Ga0307409_100038419 3300031995 Bacteria 3541
675 Ga0307409_100281060 3300031995 Bacteria 1538
676 Ga0307409_100677931 3300031995 Bacteria 1028
677 Ga0307416_100143536 3300032002 Bacteria 2175
678 Ga0307416_100908663 3300032002 Bacteria 981
679 Ga0307416_101130629 3300032002 Bacteria 888
680 Ga0307416_101468116 3300032002 Bacteria 788
681 Ga0307414_10010459 3300032004 Bacteria 5384
682 Ga0307414_10025261 3300032004 Bacteria 3802
683 Ga0307414_10043277 3300032004 Bacteria 3066
684 Ga0307414_10043568 3300032004 Bacteria 3058
685 Ga0307414_10198675 3300032004 Bacteria 1629
686 Ga0307414_10224309 3300032004 Bacteria 1545
687 Ga0307414_10231311 3300032004 Bacteria 1524
688 Ga0307414_10272794 3300032004 Bacteria 1417
689 Ga0307414_10368039 3300032004 Bacteria 1239
690 Ga0307414_10622486 3300032004 Bacteria 970
691 Ga0307414_10647136 3300032004 Bacteria 952
692 Ga0307414_10707404 3300032004 Bacteria 912
693 Ga0307414_10742428 3300032004 Bacteria 891
694 Ga0307414_11005447 3300032004 Bacteria 768
695 Ga0307414_11005870 3300032004 Bacteria 767
696 Ga0307415_100954884 3300032126 Bacteria 794
697 Ga0307415_101107621 3300032126 Bacteria 742
698 Ga0316593_10043353 3300032168 Bacteria 1503
699 Ga0315913_1000018 3300033430 Bacteria 102535
700 Ga0315915_1000005 3300033464 Bacteria 397591
701 Ga0373961_0292471 3300035241 Bacteria 600
702 Ga0316574_0001388 3300035398 Bacteria 11446
703 Ga0373931_0066210 3300035691 Bacteria 1960
704 Ga0373925_0001010 3300037068 Bacteria 25444
705 Ga0395899_0000107 3300037312 Bacteria 144087
706 Ga0395899_0161351 3300037312 Bacteria 1583
707 Ga0395899_0228539 3300037312 Bacteria 1286
708 Ga0395900_0000101 3300037418 Bacteria 153550
709 Ga0395900_0027014 3300037418 Bacteria 5876
710 Ga0395900_0085364 3300037418 Bacteria 3244
711 Ga0395900_0235140 3300037418 Bacteria 1841
712 Ga0395900_0320341 3300037418 Bacteria 1531
713 Ga0395900_0999442 3300037418 Bacteria 756
714 Ga0395900_1281839 3300037418 Bacteria 647
715 Ga0395898_0000043 3300037466 Bacteria 301783
716 Ga0395898_0080973 3300037466 Bacteria 3131
717 Ga0395898_0111816 3300037466 Bacteria 2618
718 Ga0395898_0359141 3300037466 Bacteria 1389
719 Ga0395898_0952062 3300037466 Bacteria 795
720 Ga0395905_0000101 3300037471 Bacteria 144115
721 Ga0395905_0009560 3300037471 Bacteria 9467
722 Ga0395905_0020046 3300037471 Bacteria 6336
723 Ga0395905_0031687 3300037471 Bacteria 4974
724 Ga0395905_0080404 3300037471 Bacteria 3054
725 Ga0395905_0096247 3300037471 Bacteria 2779
726 Ga0436364_0281196 3300037853 Bacteria 892
727 Ga0436364_0920022 3300037853 Bacteria 1620
728 Ga0436364_0949431 3300037853 Bacteria 1108
729 Ga0395901_0000068 3300038443 Bacteria 144095
730 Ga0395901_0007729 3300038443 Bacteria 10846
731 Ga0395901_0017499 3300038443 Bacteria 7316
732 Ga0395901_0073030 3300038443 Bacteria 3577
733 Ga0395901_0178429 3300038443 Bacteria 2227
734 Ga0395901_0720200 3300038443 Bacteria 993
735 Ga0400483_117096 3300039062 Bacteria 1211
736 Ga0436365_0669703 3300039437 Bacteria 2144
737 Ga0436365_1373922 3300039437 Bacteria 27022
738 Ga0436365_1797099 3300039437 Bacteria 84930
739 Ga0436360_0774037 3300039438 Bacteria 1175
740 Ga0436361_0311057 3300039447 Bacteria 2508
741 Ga0436361_0596215 3300039447 Bacteria 778
742 Ga0436361_0774089 3300039447 Bacteria 890
743 Ga0436361_0782552 3300039447 Bacteria 1258
744 Ga0436361_1068522 3300039447 Bacteria 640
745 Ga0436363_0577421 3300039450 Bacteria 899
746 Ga0436363_0693641 3300039450 Bacteria 10508
747 Ga0436363_1325730 3300039450 Bacteria 2427
748 Ga0436363_1447886 3300039450 Bacteria 1689
749 Ga0436363_1639159 3300039450 Bacteria 3358
750 Ga0436362_0302411 3300039453 Bacteria 648
751 Ga0436362_1053283 3300039453 Bacteria 2337
752 Ga0439466_0080708 3300041411 Bacteria 1026
753 Ga0439465_0012626 3300041413 Bacteria 2641
754 Ga0451791_0541240 3300041451 Bacteria 788
755 Ga0451798_0152628 3300041458 Bacteria 724
756 Ga0451798_0312749 3300041458 Bacteria 3086
757 Ga0451835_0706473 3300041492 Bacteria 3677
758 Ga0451837_1013830 3300041494 Bacteria 890
759 Ga0451839_0431211 3300041496 Bacteria 2781
760 Ga0451841_1367572 3300041498 Bacteria 1206
761 Ga0451846_65127 3300041502 Bacteria 725
762 Ga0451847_0708780 3300041503 Bacteria 1882
763 Ga0451849_0224148 3300041505 Bacteria 903
764 Ga0451850_39042 3300041506 Bacteria 909
765 Ga0451851_0590795 3300041507 Bacteria 2463
766 Ga0451853_0990214 3300041512 Bacteria 992
767 Ga0452268_17051 3300041907 Bacteria 766
768 Ga0452271_20105 3300041916 Bacteria 855
769 Ga0439431_0028270 3300041997 Bacteria 1381
770 Ga0439449_0006212 3300042007 Bacteria 4565
771 Ga0439449_0021428 3300042007 Bacteria 2420
772 Ga0439456_079755 3300042013 Bacteria 730
773 Ga0450918_065565 3300042531 Bacteria 676
774 Ga0466972_0126642 3300044658 Bacteria 1203
775 Ga0453683_0004944 3300044673 Bacteria 9364
776 Ga0466965_0126003 3300044683 Bacteria 1325
777 Ga0466963_0298316 3300044694 Bacteria 1133
778 Ga0466963_0320928 3300044694 Bacteria 1090
779 Ga0466970_0056180 3300044765 Bacteria 2104
780 Ga0451576_0001612 3300045051 Bacteria 37855
781 Ga0466967_0585332 3300045976 Bacteria 1100
782 Ga0466967_0735427 3300045976 Bacteria 978
783 Ga0495629_0070349 3300046459 Bacteria 2441
784 Ga0495629_0461864 3300046459 Bacteria 859
785 Ga0495638_0000397 3300046460 Bacteria 53684
786 Ga0495638_0032069 3300046460 Bacteria 3371
787 Ga0495638_0204001 3300046460 Bacteria 1114
788 Ga0495651_0170179 3300046462 Bacteria 1552
789 Ga0495650_0059547 3300046471 Bacteria 1538
790 Ga0495662_0067394 3300046476 Bacteria 1732
791 Ga0495585_0035006 3300046492 Bacteria 2840
792 Ga0495585_0071516 3300046492 Bacteria 1891
793 Ga0495607_0166062 3300046501 Bacteria 1118
794 Ga0495583_0007197 3300046506 Bacteria 7062
795 Ga0495606_0027869 3300046507 Bacteria 3996
796 Ga0495606_0036482 3300046507 Bacteria 3348
797 Ga0495606_0125600 3300046507 Bacteria 1530
798 Ga0495606_0188043 3300046507 Bacteria 1186
799 Ga0495606_0310109 3300046507 Bacteria 852
800 Ga0495610_0024722 3300046512 Bacteria 3236
801 Ga0495631_0010602 3300046518 Bacteria 4557
802 Ga0495632_0003737 3300046519 Bacteria 10652
803 Ga0495632_0090148 3300046519 Bacteria 1454
804 Ga0495637_0103229 3300046520 Bacteria 1112
805 Ga0495643_0011844 3300046522 Bacteria 5288
806 Ga0495643_0013228 3300046522 Bacteria 4948
807 Ga0495643_0070443 3300046522 Bacteria 1836
808 Ga0495643_0265724 3300046522 Bacteria 795
809 Ga0495648_0228828 3300046524 Bacteria 912
810 Ga0495663_0006433 3300046525 Bacteria 3246
811 Ga0495652_0306511 3300046529 Bacteria 1152
812 Ga0495654_0000571 3300046530 Bacteria 29572
813 Ga0495633_0000438 3300046558 Bacteria 43059
814 Ga0495633_0016621 3300046558 Bacteria 3787
815 Ga0495633_0102668 3300046558 Bacteria 1327
816 Ga0495668_0010444 3300046616 Bacteria 5618
817 Ga0495668_0274987 3300046616 Bacteria 923
818 Ga0495611_0036513 3300046648 Bacteria 2181
819 Ga0495625_0002547 3300046660 Bacteria 19601
820 Ga0495625_0020782 3300046660 Bacteria 5061
821 Ga0495625_0251332 3300046660 Bacteria 1147
822 Ga0495625_0292968 3300046660 Bacteria 1044
823 Ga0495661_0047783 3300046665 Bacteria 2604
824 Ga0495661_0185115 3300046665 Bacteria 1101
825 Ga0495624_0105980 3300046690 Bacteria 1730
826 Ga0495649_0000134 3300046694 Bacteria 64953
827 Ga0495660_0025628 3300046810 Bacteria 3348
828 Ga0495636_0045367 3300047318 Bacteria 1832
829 Ga0495672_0009559 3300047320 Bacteria 7009
830 Ga0495672_0295943 3300047320 Bacteria 768
831 Ga0495685_194225 3300047447 Bacteria 652
832 Ga0495686_0046483 3300047472 Bacteria 2743
833 Ga0495686_0152390 3300047472 Bacteria 1356
834 Ga0495602_0190888 3300048088 Bacteria 1571
835 Ga0495602_0627029 3300048088 Bacteria 737
836 Ga0495626_0040279 3300048091 Bacteria 2208
837 Ga0495626_0083378 3300048091 Bacteria 1416
838 Ga0496103_0397870 3300048906 Bacteria 885
839 Ga0496104_0777668 3300048907 Bacteria 864
840 Ga0496106_0001794 3300048909 Bacteria 16032
841 Ga0496110_0453094 3300048913 Bacteria 1169
842 Ga0496110_0688861 3300048913 Bacteria 923
843 Ga0496111_0002868 3300048914 Bacteria 10521
844 Ga0496111_0465641 3300048914 Bacteria 932
845 Ga0496112_0063240 3300048915 Bacteria 3650
846 Ga0496114_0233894 3300048917 Bacteria 1615
847 Ga0496114_0879510 3300048917 Bacteria 777
848 Ga0496115_0006857 3300048918 Bacteria 8363
849 Ga0496115_0323360 3300048918 Bacteria 1261
850 Ga0496116_0024906 3300048919 Bacteria 4412
851 Ga0496116_0037404 3300048919 Bacteria 3385
852 Ga0496116_0043619 3300048919 Bacteria 3054
853 Ga0496116_0044656 3300048919 Bacteria 3008
854 Ga0496116_0292637 3300048919 Bacteria 780
855 Ga0496117_0000016 3300048920 Bacteria 523642
856 Ga0496117_0005852 3300048920 Bacteria 12727
857 Ga0496117_0014948 3300048920 Bacteria 6652
858 Ga0496117_0050674 3300048920 Bacteria 2942
859 Ga0496118_0005627 3300048921 Bacteria 14144
860 Ga0496118_0016278 3300048921 Bacteria 6829
861 Ga0496118_0056054 3300048921 Bacteria 2966
862 Ga0496118_0323745 3300048921 Bacteria 835
863 Ga0496119_0023848 3300048922 Bacteria 4324
864 Ga0496119_0026449 3300048922 Bacteria 4023
865 Ga0496119_0040525 3300048922 Bacteria 2977
866 Ga0496119_0111375 3300048922 Bacteria 1519
867 Ga0496119_0172451 3300048922 Bacteria 1141
868 Ga0496120_0000164 3300048923 Bacteria 111959
869 Ga0496120_0000550 3300048923 Bacteria 57310
870 Ga0496120_0069810 3300048923 Bacteria 1934
871 Ga0496120_0077183 3300048923 Bacteria 1814
872 Ga0496121_0002925 3300048924 Bacteria 25017
873 Ga0496121_0044960 3300048924 Bacteria 3801
874 Ga0496121_0080370 3300048924 Bacteria 2584
875 Ga0496121_0178702 3300048924 Bacteria 1534
876 Ga0496121_0212190 3300048924 Bacteria 1370
877 Ga0496121_0220874 3300048924 Bacteria 1335
878 Ga0496121_0569806 3300048924 Bacteria 705
879 Ga0496122_0000002 3300048925 Bacteria 905834
880 Ga0496122_0001100 3300048925 Bacteria 46751
881 Ga0496122_0001424 3300048925 Bacteria 38740
882 Ga0496122_0026493 3300048925 Bacteria 4995
883 Ga0496122_0027392 3300048925 Bacteria 4875
884 Ga0496122_0047818 3300048925 Bacteria 3297
885 Ga0496123_0000002 3300048926 Bacteria 1811682
886 Ga0496123_0001129 3300048926 Bacteria 39855
887 Ga0496123_0001147 3300048926 Bacteria 39513
888 Ga0496123_0003982 3300048926 Bacteria 15997
889 Ga0496123_0006102 3300048926 Bacteria 11813
890 Ga0496123_0022124 3300048926 Bacteria 4911
891 Ga0496123_0031999 3300048926 Bacteria 3817
892 Ga0496123_0350005 3300048926 Bacteria 687
893 Ga0496124_0000094 3300048927 Bacteria 189147
894 Ga0496124_0030277 3300048927 Bacteria 4806
895 Ga0496124_0041684 3300048927 Bacteria 3958
896 Ga0496124_0066058 3300048927 Bacteria 3014
897 Ga0496124_0113690 3300048927 Bacteria 2175
898 Ga0496124_0144534 3300048927 Bacteria 1873
899 Ga0496124_0231818 3300048927 Bacteria 1380
900 Ga0496124_0239659 3300048927 Bacteria 1350
901 Ga0496125_0000374 3300048928 Bacteria 83816
902 Ga0496125_0000564 3300048928 Bacteria 63635
903 Ga0496125_0000585 3300048928 Bacteria 62191
904 Ga0496125_0005990 3300048928 Bacteria 13306
905 Ga0496125_0014364 3300048928 Bacteria 7715
906 Ga0496125_0016356 3300048928 Bacteria 7128
907 Ga0496125_0026192 3300048928 Bacteria 5320
908 Ga0496125_0154752 3300048928 Bacteria 1568
909 Ga0496125_0234678 3300048928 Bacteria 1170
910 Ga0496126_0034256 3300048929 Bacteria 4771
911 Ga0496126_0034848 3300048929 Bacteria 4722
912 Ga0496126_0062938 3300048929 Bacteria 3327
913 Ga0496126_0119146 3300048929 Bacteria 2291
914 Ga0496126_0125604 3300048929 Bacteria 2220
915 Ga0496126_0233414 3300048929 Bacteria 1540
916 Ga0496126_0284144 3300048929 Bacteria 1370
917 Ga0495678_022706 3300049459 Bacteria 2739
918 Ga0501031_0000016 3300049568 Bacteria 110858
919 Ga0501031_0009606 3300049568 Bacteria 6298
920 Ga0501031_0020950 3300049568 Bacteria 4262
921 Ga0501031_0170597 3300049568 Bacteria 1422
922 Ga0501031_0179041 3300049568 Bacteria 1385
923 Ga0501031_0441093 3300049568 Bacteria 841
924 Ga0501031_0447758 3300049568 Bacteria 834
925 Ga0501032_0000029 3300049569 Bacteria 130865
926 Ga0501032_0000044 3300049569 Bacteria 110899
927 Ga0501032_0000435 3300049569 Bacteria 34412
928 Ga0501032_0009080 3300049569 Bacteria 7218
929 Ga0501032_0031986 3300049569 Bacteria 3607
930 Ga0501032_0035913 3300049569 Bacteria 3386
931 Ga0501032_0084070 3300049569 Bacteria 2116
932 Ga0501032_0085875 3300049569 Bacteria 2091
933 Ga0501032_0107664 3300049569 Bacteria 1846
934 Ga0501032_0189147 3300049569 Bacteria 1346
935 Ga0501032_0239270 3300049569 Bacteria 1179
936 Ga0501032_0324968 3300049569 Bacteria 992
937 Ga0501032_0610462 3300049569 Bacteria 694
938 Ga0501033_0000052 3300049570 Bacteria 110545
939 Ga0501033_0000168 3300049570 Bacteria 62921
940 Ga0501033_0011017 3300049570 Bacteria 6924
941 Ga0501033_0026324 3300049570 Bacteria 4379
942 Ga0501033_0032234 3300049570 Bacteria 3935
943 Ga0501033_0053399 3300049570 Bacteria 2993
944 Ga0501033_0109660 3300049570 Bacteria 2009
945 Ga0501033_0456584 3300049570 Bacteria 887
946 Ga0501033_0648971 3300049570 Bacteria 721
947 Ga0501034_0000212 3300049571 Bacteria 110795
948 Ga0501034_0000434 3300049571 Bacteria 69367
949 Ga0501034_0000675 3300049571 Bacteria 51860
950 Ga0501034_0001360 3300049571 Bacteria 33027
951 Ga0501034_0026045 3300049571 Bacteria 5957
952 Ga0501034_0050235 3300049571 Bacteria 4206
953 Ga0501034_0062180 3300049571 Bacteria 3749
954 Ga0501034_0067777 3300049571 Bacteria 3580
955 Ga0501034_0073976 3300049571 Bacteria 3416
956 Ga0501034_0098011 3300049571 Bacteria 2927
957 Ga0501034_0118813 3300049571 Bacteria 2630
958 Ga0501034_0145726 3300049571 Bacteria 2345
959 Ga0501034_0189933 3300049571 Bacteria 2017
960 Ga0501034_0285744 3300049571 Bacteria 1589
961 Ga0501034_0303946 3300049571 Bacteria 1531
962 Ga0501034_0361940 3300049571 Bacteria 1378
963 Ga0501034_0394511 3300049571 Bacteria 1307
964 Ga0501034_0431702 3300049571 Bacteria 1237
965 Ga0501034_0447037 3300049571 Bacteria 1210
966 Ga0501034_0470139 3300049571 Bacteria 1173
967 Ga0501034_0526515 3300049571 Bacteria 1093
968 Ga0501034_0574674 3300049571 Bacteria 1034
969 Ga0501034_0652964 3300049571 Bacteria 953
970 Ga0501034_0754298 3300049571 Bacteria 868
971 Ga0501034_0876318 3300049571 Bacteria 787
972 Ga0501034_0942601 3300049571 Bacteria 749
973 Ga0501034_0960610 3300049571 Bacteria 740
974 Ga0501034_0999344 3300049571 Bacteria 721
975 Ga0501036_0000022 3300049572 Bacteria 111251
976 Ga0501036_0000533 3300049572 Bacteria 27318
977 Ga0501036_0049068 3300049572 Bacteria 3574
978 Ga0501036_0290662 3300049572 Bacteria 1367
979 Ga0501036_0508579 3300049572 Bacteria 1002
980 Ga0501037_0000049 3300049573 Bacteria 113246
981 Ga0501037_0000052 3300049573 Bacteria 110932
982 Ga0501037_0000335 3300049573 Bacteria 39826
983 Ga0501037_0044673 3300049573 Bacteria 3253
984 Ga0501037_0074156 3300049573 Bacteria 2473
985 Ga0501037_0101319 3300049573 Bacteria 2078
986 Ga0501037_0133986 3300049573 Bacteria 1775
987 Ga0501037_0157477 3300049573 Bacteria 1620
988 Ga0501037_0191340 3300049573 Bacteria 1448
989 Ga0501037_0286244 3300049573 Bacteria 1147
990 Ga0501037_0295876 3300049573 Bacteria 1125
991 Ga0501037_0322396 3300049573 Bacteria 1069
992 Ga0501037_0402663 3300049573 Bacteria 938
993 Ga0501038_0000044 3300049574 Bacteria 110876
994 Ga0501038_0000275 3300049574 Bacteria 43504
995 Ga0501038_0084357 3300049574 Bacteria 2673
996 Ga0501038_0190158 3300049574 Bacteria 1652
997 Ga0501038_0212096 3300049574 Bacteria 1548
998 Ga0501038_0291543 3300049574 Bacteria 1282
999 Ga0501038_0309624 3300049574 Bacteria 1238
1000 Ga0501039_0000040 3300049575 Bacteria 115567
1001 Ga0501039_0000042 3300049575 Bacteria 113008
1002 Ga0501039_0143435 3300049575 Bacteria 1876
1003 Ga0501039_0237677 3300049575 Bacteria 1432
1004 Ga0501039_0439392 3300049575 Bacteria 1025
1005 Ga0501039_0482240 3300049575 Bacteria 974
1006 Ga0501040_0103312 3300049576 Bacteria 1989
1007 Ga0501040_0141414 3300049576 Bacteria 1696
1008 Ga0501042_0129112 3300049578 Bacteria 1821
1009 Ga0501043_0000006 3300049579 Bacteria 234413
1010 Ga0501043_0000054 3300049579 Bacteria 105924
1011 Ga0501043_0000236 3300049579 Bacteria 49931
1012 Ga0501043_0013995 3300049579 Bacteria 6278
1013 Ga0501043_0054340 3300049579 Bacteria 3145
1014 Ga0501043_0131977 3300049579 Bacteria 1957
1015 Ga0501043_0138189 3300049579 Bacteria 1909
1016 Ga0501043_0270670 3300049579 Bacteria 1304
1017 Ga0501043_0298880 3300049579 Bacteria 1230
1018 Ga0501043_0321123 3300049579 Bacteria 1180
1019 Ga0501043_0354325 3300049579 Bacteria 1114
1020 Ga0501043_0398511 3300049579 Bacteria 1040
1021 Ga0501043_0782297 3300049579 Bacteria 691
1022 Ga0501043_0825108 3300049579 Bacteria 669
1023 Ga0501046_0019865 3300049580 Bacteria 5564
1024 Ga0501046_0135926 3300049580 Bacteria 1862
1025 Ga0501046_0380901 3300049580 Bacteria 1021
1026 Ga0501047_0000838 3300049581 Bacteria 31753
1027 Ga0501047_0009345 3300049581 Bacteria 9257
1028 Ga0501047_0039981 3300049581 Bacteria 4535
1029 Ga0501047_0045832 3300049581 Bacteria 4227
1030 Ga0501047_0070750 3300049581 Bacteria 3359
1031 Ga0501047_0081264 3300049581 Bacteria 3115
1032 Ga0501047_0096030 3300049581 Bacteria 2842
1033 Ga0501047_0123404 3300049581 Bacteria 2470
1034 Ga0501047_0139999 3300049581 Bacteria 2298
1035 Ga0501047_0143198 3300049581 Bacteria 2268
1036 Ga0501047_0183726 3300049581 Bacteria 1957
1037 Ga0501047_0302382 3300049581 Bacteria 1442
1038 Ga0501047_0335137 3300049581 Bacteria 1351
1039 Ga0501048_0202630 3300049582 Bacteria 1407
1040 Ga0501048_0431877 3300049582 Bacteria 943
1041 Ga0501067_0001248 3300049583 Bacteria 13824
1042 Ga0501067_0003119 3300049583 Bacteria 9153
1043 Ga0501067_0004746 3300049583 Bacteria 7525
1044 Ga0501067_0055009 3300049583 Bacteria 2205
1045 Ga0501067_0069494 3300049583 Bacteria 1950
1046 Ga0501067_0214054 3300049583 Bacteria 1073
1047 Ga0501067_0307199 3300049583 Bacteria 883
1048 Ga0501067_0325059 3300049583 Bacteria 856
1049 Ga0501067_0361412 3300049583 Bacteria 809
1050 Ga0501068_0007310 3300049584 Bacteria 6118
1051 Ga0501068_0216057 3300049584 Bacteria 1218
1052 Ga0501068_0344231 3300049584 Bacteria 958
1053 Ga0501069_0000141 3300049585 Bacteria 31844
1054 Ga0501069_0013189 3300049585 Bacteria 4404
1055 Ga0501069_0084971 3300049585 Bacteria 1785
1056 Ga0501069_0112182 3300049585 Bacteria 1553
1057 Ga0501069_0217062 3300049585 Bacteria 1111
1058 Ga0501070_0000081 3300049586 Bacteria 81543
1059 Ga0501070_0000254 3300049586 Bacteria 50216
1060 Ga0501070_0005587 3300049586 Bacteria 10729
1061 Ga0501070_0064518 3300049586 Bacteria 3032
1062 Ga0501070_0069657 3300049586 Bacteria 2912
1063 Ga0501070_0088763 3300049586 Bacteria 2559
1064 Ga0501070_0108673 3300049586 Bacteria 2291
1065 Ga0501070_0126634 3300049586 Bacteria 2110
1066 Ga0501070_0159445 3300049586 Bacteria 1860
1067 Ga0501070_0207403 3300049586 Bacteria 1609
1068 Ga0501070_0213963 3300049586 Bacteria 1581
1069 Ga0501070_0224883 3300049586 Bacteria 1538
1070 Ga0501070_0405989 3300049586 Bacteria 1101
1071 Ga0501070_0639216 3300049586 Bacteria 845
1072 Ga0501071_0043325 3300049587 Bacteria 3226
1073 Ga0501071_0134976 3300049587 Bacteria 1836
1074 Ga0501071_0889993 3300049587 Bacteria 687
1075 Ga0501072_0121254 3300049588 Bacteria 2083
1076 Ga0501072_0429892 3300049588 Bacteria 1046
1077 Ga0501072_0624195 3300049588 Bacteria 849
1078 Ga0501073_0000019 3300049589 Bacteria 144300
1079 Ga0501073_0015418 3300049589 Bacteria 5544
1080 Ga0501073_0019232 3300049589 Bacteria 4934
1081 Ga0501073_0026648 3300049589 Bacteria 4139
1082 Ga0501073_0071790 3300049589 Bacteria 2411
1083 Ga0501073_0128800 3300049589 Bacteria 1754
1084 Ga0501073_0157634 3300049589 Bacteria 1573
1085 Ga0501073_0362758 3300049589 Bacteria 1000
1086 Ga0501074_0000011 3300049590 Bacteria 93181
1087 Ga0501074_0029334 3300049590 Bacteria 3985
1088 Ga0501074_0199990 3300049590 Bacteria 1424
1089 Ga0501074_0409747 3300049590 Bacteria 961
1090 Ga0501074_0444228 3300049590 Bacteria 920
1091 Ga0501074_0541464 3300049590 Bacteria 824
1092 Ga0501076_0126748 3300049592 Bacteria 2069
1093 Ga0501077_0000035 3300049593 Bacteria 68535
1094 Ga0501077_0041346 3300049593 Bacteria 2935
1095 Ga0501077_0057700 3300049593 Bacteria 2465
1096 Ga0501077_0616935 3300049593 Bacteria 697
1097 Ga0501238_005423 3300049671 Bacteria 1617
1098 Ga0501252_005771 3300049682 Bacteria 1357
1099 Ga0501079_0142963 3300049741 Bacteria 1864
1100 Ga0501079_0700156 3300049741 Bacteria 797
1101 Ga0501080_0000582 3300049742 Bacteria 28889
1102 Ga0501080_0005452 3300049742 Bacteria 11348
1103 Ga0501080_0025036 3300049742 Bacteria 5537
1104 Ga0501080_0029481 3300049742 Bacteria 5109
1105 Ga0501080_0051297 3300049742 Bacteria 3839
1106 Ga0501080_0099925 3300049742 Bacteria 2692
1107 Ga0501080_0107954 3300049742 Bacteria 2580
1108 Ga0501080_0126220 3300049742 Bacteria 2370
1109 Ga0501080_0145057 3300049742 Bacteria 2194
1110 Ga0501080_0146315 3300049742 Bacteria 2184
1111 Ga0501080_0186994 3300049742 Bacteria 1904
1112 Ga0501080_0480481 3300049742 Bacteria 1111
1113 Ga0501080_0621599 3300049742 Bacteria 958
1114 Ga0501080_0674999 3300049742 Bacteria 913
1115 Ga0501081_1013335 3300049743 Bacteria 628
1116 Ga0501083_0002722 3300049744 Bacteria 12205
1117 Ga0501083_0002864 3300049744 Bacteria 11933
1118 Ga0501083_0003672 3300049744 Bacteria 10773
1119 Ga0501083_0004693 3300049744 Bacteria 9654
1120 Ga0501083_0048536 3300049744 Bacteria 2865
1121 Ga0501083_0060795 3300049744 Bacteria 2523
1122 Ga0501083_0077252 3300049744 Bacteria 2210
1123 Ga0501083_0223140 3300049744 Bacteria 1228
1124 Ga0501083_0254278 3300049744 Bacteria 1143
1125 Ga0501083_0298190 3300049744 Bacteria 1048
1126 Ga0501241_025024 3300049758 Bacteria 1110
1127 Ga0501280_001991 3300049776 Bacteria 3552
1128 Ga0501035_0000068 3300049822 Bacteria 128392
1129 Ga0501035_0000095 3300049822 Bacteria 110735
1130 Ga0501035_0000557 3300049822 Bacteria 41380
1131 Ga0501035_0004674 3300049822 Bacteria 12998
1132 Ga0501035_0010601 3300049822 Bacteria 8535
1133 Ga0501035_0024027 3300049822 Bacteria 5592
1134 Ga0501035_0036936 3300049822 Bacteria 4426
1135 Ga0501035_0078780 3300049822 Bacteria 2910
1136 Ga0501035_0122679 3300049822 Bacteria 2270
1137 Ga0501035_0331737 3300049822 Bacteria 1276
1138 Ga0501035_0559839 3300049822 Bacteria 935
1139 Ga0501044_0000082 3300049823 Bacteria 115127
1140 Ga0501044_0000091 3300049823 Bacteria 111251
1141 Ga0501044_0002199 3300049823 Bacteria 22360
1142 Ga0501044_0020085 3300049823 Bacteria 7132
1143 Ga0501044_0020231 3300049823 Bacteria 7103
1144 Ga0501044_0031213 3300049823 Bacteria 5609
1145 Ga0501044_0032766 3300049823 Bacteria 5461
1146 Ga0501044_0049026 3300049823 Bacteria 4359
1147 Ga0501044_0073302 3300049823 Bacteria 3480
1148 Ga0501044_0083450 3300049823 Bacteria 3231
1149 Ga0501044_0211824 3300049823 Bacteria 1892
1150 Ga0501044_0229990 3300049823 Bacteria 1802
1151 Ga0501044_0359888 3300049823 Bacteria 1373
1152 Ga0501044_0964401 3300049823 Bacteria 725
1153 Ga0501045_0024565 3300049824 Bacteria 4327
1154 Ga0501045_0176570 3300049824 Bacteria 1591
1155 nmdc:mga03683_111492_c1 3300050489 Bacteria 1210
1156 nmdc:mga03683_42799_c1 3300050489 Bacteria 1865
1157 nmdc:mga03683_5389_c1 3300050489 Bacteria 2592
1158 nmdc:mga03683_59901_c1 3300050489 Bacteria 1607
1159 nmdc:mga03683_75411_c1 3300050489 Bacteria 1448
1160 nmdc:mga03n38_168036_c1 3300050490 Bacteria 1115
1161 nmdc:mga03n38_2162_c1 3300050490 Bacteria 5984
1162 nmdc:mga03n38_71667_c1 3300050490 Bacteria 1605
1163 nmdc:mga03n38_98276_c1 3300050490 Bacteria 1408
1164 nmdc:mga00v17_13_c1 3300050491 Bacteria 128511
1165 nmdc:mga00v17_268670_c1 3300050491 Bacteria 1107
1166 nmdc:mga00v17_27_c2 3300050491 Bacteria 60228
1167 nmdc:mga00v17_362934_c1 3300050491 Bacteria 942
1168 nmdc:mga00v17_50366_c1 3300050491 Bacteria 2530
1169 nmdc:mga00v17_588903_c1 3300050491 Bacteria 718
1170 nmdc:mga00v17_70873_c1 3300050491 Bacteria 2160
1171 nmdc:mga0yw44_147119_c1 3300050492 Bacteria 1535
1172 nmdc:mga0yw44_19066_c1 3300050492 Bacteria 3775
1173 nmdc:mga0yw44_3221_c1 3300050492 Bacteria 7188
1174 nmdc:mga0yw44_44476_c1 3300050492 Bacteria 2656
1175 nmdc:mga0yw44_570844_c1 3300050492 Bacteria 768
1176 nmdc:mga0yw44_76857_c1 3300050492 Bacteria 2085
1177 nmdc:mga0k408_134222_c2 3300050493 Bacteria 1147
1178 nmdc:mga0k408_29119_c1 3300050493 Bacteria 3142
1179 nmdc:mga0k408_4447_c1 3300050493 Bacteria 7438
1180 nmdc:mga06z11_1915_c1 3300050494 Bacteria 7845
1181 nmdc:mga06z11_206948_c1 3300050494 Bacteria 1142
1182 nmdc:mga06z11_272774_c1 3300050494 Bacteria 1000
1183 nmdc:mga06z11_326017_c1 3300050494 Bacteria 917
1184 nmdc:mga06z11_43138_c1 3300050494 Bacteria 2267
1185 nmdc:mga06z11_46794_c1 3300050494 Bacteria 2194
1186 nmdc:mga06z11_597420_c1 3300050494 Bacteria 671
1187 nmdc:mga06z11_82691_c1 3300050494 Bacteria 1727
1188 nmdc:mga04h51_161881_c1 3300050495 Bacteria 862
1189 nmdc:mga07m45_145356_c1 3300050496 Bacteria 1374
1190 nmdc:mga07m45_26378_c1 3300050496 Bacteria 3194
1191 nmdc:mga07m45_353596_c1 3300050496 Bacteria 854
1192 nmdc:mga07m45_7795_c1 3300050496 Bacteria 5480
1193 nmdc:mga0n895_633833_c1 3300050512 Bacteria 1069
1194 nmdc:mga0sz30_144_c1 3300050516 Bacteria 26567
1195 nmdc:mga0sz30_16819_c1 3300050516 Bacteria 2909
1196 nmdc:mga0sz30_3454_c1 3300050516 Bacteria 5690
1197 nmdc:mga0sz30_72679_c2 3300050516 Bacteria 949
1198 Ga0500610_0019125 3300053079 Bacteria 3324
1199 Ga0495655_0142832 3300053083 Bacteria 747
1200 Ga0495619_0643357 3300053085 Bacteria 724
1201 Ga0500643_023639 3300053087 Bacteria 1961
1202 Ga0500644_0004259 3300053088 Bacteria 3574
1203 Ga0500644_0104460 3300053088 Bacteria 1081
1204 Ga0500651_0004289 3300053093 Bacteria 7967
1205 Ga0500651_0043132 3300053093 Bacteria 2841
1206 Ga0500562_041029 3300053108 Bacteria 1230
1207 Ga0500594_0001379 3300053118 Bacteria 5268
1208 Ga0500595_043033 3300053119 Bacteria 1441
1209 Ga0500595_104570 3300053119 Bacteria 809
1210 Ga0500658_0000770 3300053134 Bacteria 13199
1211 Ga0500561_0000316 3300053137 Bacteria 8163
1212 Ga0500568_0000232 3300053139 Bacteria 47704
1213 Ga0500568_0002531 3300053139 Bacteria 10680
1214 Ga0500568_0004124 3300053139 Bacteria 7865
1215 Ga0500573_0114773 3300053140 Bacteria 1504
1216 Ga0500604_0000343 3300053151 Bacteria 12861
1217 Ga0500604_0027954 3300053151 Bacteria 1635
1218 Ga0500616_0002417 3300053153 Bacteria 15555
1219 Ga0500616_0003618 3300053153 Bacteria 11657
1220 Ga0500616_0016515 3300053153 Bacteria 4200
1221 Ga0500616_0033355 3300053153 Bacteria 2810
1222 Ga0500616_0040621 3300053153 Bacteria 2501
1223 Ga0500622_0001821 3300053156 Bacteria 16201
1224 Ga0500624_000169 3300053157 Bacteria 26446
1225 Ga0500627_0067430 3300053158 Bacteria 1581
1226 Ga0500633_0001269 3300053160 Bacteria 4655
1227 Ga0500634_0000017 3300053161 Bacteria 111983
1228 Ga0500611_004585 3300053727 Bacteria 1875
1229 Ga0501084_0011010 3300054114 Bacteria 7492
1230 Ga0501084_0126094 3300054114 Bacteria 2154
1231 Ga0501084_0296332 3300054114 Bacteria 1366
1232 Ga0501084_0419458 3300054114 Bacteria 1131
1233 Ga0501084_0450168 3300054114 Bacteria 1088
1234 Ga0501084_0822704 3300054114 Bacteria 782
1235 Ga0501084_0840652 3300054114 Bacteria 773
1236 Ga0501084_0847638 3300054114 Bacteria 769
1237 Ga0587090_026817 3300059510 Bacteria 939
1238 Ga0587062_021177 3300059639 Bacteria 923
1239 Ga0587067_105934 3300059640 Bacteria 657
1240 Ga0587068_007676 3300059641 Bacteria 1544
1241 Ga0587072_001125 3300059643 Bacteria 3166
1242 Ga0587107_069084 3300059652 Bacteria 641
1243 Ga0587114_026655 3300059655 Bacteria 856
1244 Ga0501082_0001935 3300060353 Bacteria 18229
1245 Ga0501082_0008096 3300060353 Bacteria 9068
1246 Ga0501082_0012643 3300060353 Bacteria 7257
1247 Ga0501082_0025508 3300060353 Bacteria 5093
1248 Ga0501082_0050904 3300060353 Bacteria 3571
1249 Ga0501082_0237644 3300060353 Bacteria 1586
1250 Ga0501082_0284231 3300060353 Bacteria 1440
1251 Ga0501082_0616415 3300060353 Bacteria 950
1252 Ga0501082_0661721 3300060353 Bacteria 914
1253 Ga0501082_1193747 3300060353 Bacteria 665

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_0541240 Ga0451791_0541240_110_589 154
2 3300048088 Ga0495602_0190888 Ga0495602_0190888_55_567 166
3 3300021377 Ga0213874_10039805 Ga0213874_100398052 172
4 3300027907 Ga0207428_10196817 Ga0207428_101968171 173
5 3300037853 Ga0436364_0281196 Ga0436364_0281196_322_855 173
6 3300039450 Ga0436363_0577421 Ga0436363_0577421_324_857 173
7 3300039453 Ga0436362_1053283 Ga0436362_1053283_310_843 173
8 3300050512 nmdc:mga0n895_633833_c1 nmdc:mga0n895_633833_c1_228_761 173
9 3300031241 Ga0265325_10268296 Ga0265325_102682962 179
10 3300046616 Ga0495668_0274987 Ga0495668_0274987_206_748 180
11 3300059655 Ga0587114_026655 Ga0587114_026655_94_654 180
12 3300005336 Ga0070680_100029781 Ga0070680_1000297814 181
13 3300005434 Ga0070709_10235681 Ga0070709_102356812 181
14 3300005439 Ga0070711_100576550 Ga0070711_1005765501 181
15 3300005530 Ga0070679_100027144 Ga0070679_1000271446 181
16 3300005563 Ga0068855_100257099 Ga0068855_1002570992 181
17 3300006173 Ga0070716_100050646 Ga0070716_1000506464 181
18 3300009098 Ga0105245_10002744 Ga0105245_100027442 181
19 3300013104 Ga0157370_10092381 Ga0157370_100923812 181
20 3300013105 Ga0157369_10667326 Ga0157369_106673261 181
21 3300025906 Ga0207699_10061156 Ga0207699_100611562 181
22 3300025912 Ga0207707_10067233 Ga0207707_100672334 181
23 3300025915 Ga0207693_10339374 Ga0207693_103393741 181
24 3300025917 Ga0207660_10018910 Ga0207660_100189102 181
25 3300025921 Ga0207652_10911058 Ga0207652_109110582 181
26 3300025939 Ga0207665_10058456 Ga0207665_100584564 181
27 3300037312 Ga0395899_0228539 Ga0395899_0228539_467_1012 181
28 3300037466 Ga0395898_0359141 Ga0395898_0359141_339_884 181
29 3300037471 Ga0395905_0020046 Ga0395905_0020046_4598_5143 181
30 3300039437 Ga0436365_1373922 Ga0436365_1373922_19218_19763 181
31 3300039447 Ga0436361_0311057 Ga0436361_0311057_205_771 181
32 3300039447 Ga0436361_0596215 Ga0436361_0596215_59_616 181
33 3300039447 Ga0436361_1068522 Ga0436361_1068522_30_587 181
34 3300044694 Ga0466963_0298316 Ga0466963_0298316_423_986 181
35 3300048917 Ga0496114_0879510 Ga0496114_0879510_16_561 181
36 3300048918 Ga0496115_0006857 Ga0496115_0006857_4189_4734 181
37 3300048924 Ga0496121_0220874 Ga0496121_0220874_646_1203 181
38 3300048929 Ga0496126_0119146 Ga0496126_0119146_1310_1867 181
39 3300048929 Ga0496126_0284144 Ga0496126_0284144_112_657 181
40 3300049568 Ga0501031_0447758 Ga0501031_0447758_49_594 181
41 3300049571 Ga0501034_0098011 Ga0501034_0098011_1872_2417 181
42 3300049571 Ga0501034_0189933 Ga0501034_0189933_892_1437 181
43 3300049571 Ga0501034_0285744 Ga0501034_0285744_104_649 181
44 3300049571 Ga0501034_0361940 Ga0501034_0361940_715_1260 181
45 3300049571 Ga0501034_0447037 Ga0501034_0447037_488_1033 181
46 3300049571 Ga0501034_0526515 Ga0501034_0526515_434_979 181
47 3300049571 Ga0501034_0942601 Ga0501034_0942601_53_598 181
48 3300049671 Ga0501238_005423 Ga0501238_005423_500_1045 181
49 3300049682 Ga0501252_005771 Ga0501252_005771_386_931 181
50 3300049822 Ga0501035_0078780 Ga0501035_0078780_113_658 181
51 3300050489 nmdc:mga03683_5389_c1 nmdc:mga03683_5389_c1_1354_1899 181
52 3300050489 nmdc:mga03683_75411_c1 nmdc:mga03683_75411_c1_380_925 181
53 3300050491 nmdc:mga00v17_362934_c1 nmdc:mga00v17_362934_c1_186_731 181
54 3300050491 nmdc:mga00v17_588903_c1 nmdc:mga00v17_588903_c1_26_571 181
55 3300050492 nmdc:mga0yw44_570844_c1 nmdc:mga0yw44_570844_c1_82_627 181
56 3300050493 nmdc:mga0k408_29119_c1 nmdc:mga0k408_29119_c1_2376_2921 181
57 3300050494 nmdc:mga06z11_46794_c1 nmdc:mga06z11_46794_c1_610_1155 181
58 3300050496 nmdc:mga07m45_7795_c1 nmdc:mga07m45_7795_c1_233_778 181
59 3300053108 Ga0500562_041029 Ga0500562_041029_599_1144 181
60 3300053727 Ga0500611_004585 Ga0500611_004585_568_1113 181
61 3300059652 Ga0587107_069084 Ga0587107_069084_57_614 181
62 iso_pu_bacteria 2503198000 2503199646 181
63 iso_pu_bacteria 2508501122 2509112457 181
64 iso_pu_bacteria 2508501123 2509115159 181
65 iso_pu_bacteria 2508501127 2509142726 181
66 iso_pu_bacteria 2509276018 2509371086 181
67 iso_pu_bacteria 2509276019 2509379109 181
68 iso_pu_bacteria 2509276021 2509389621 181
69 iso_pu_bacteria 2509276022 2509394572 181
70 iso_pu_bacteria 2509276033 2509445963 181
71 iso_pu_bacteria 2510065019 2510135037 181
72 iso_pu_bacteria 2510065057 2510306687 181
73 iso_pu_bacteria 2510065059 2510319200 181
74 iso_pu_bacteria 2510461076 2510896463 181
75 iso_pu_bacteria 2510917022 2511133817 181
76 iso_pu_bacteria 2510917026 2511173583 181
77 iso_pu_bacteria 2510917028 2511182859 181
78 iso_pu_bacteria 2510917030 2511199721 181
79 iso_pu_bacteria 2511231027 2511392237 181
80 iso_pu_bacteria 2511231052 2511502720 181
81 iso_pu_bacteria 2512047086 2512534020 181
82 iso_pu_bacteria 2512875016 2512932952 181
83 iso_pu_bacteria 2512875024 2512960973 181
84 iso_pu_bacteria 2512875026 2512974258 181
85 iso_pu_bacteria 2513237084 2513571408 181
86 iso_pu_bacteria 2513237085 2513581335 181
87 iso_pu_bacteria 2513237086 2513586633 181
88 iso_pu_bacteria 2513237088 2513600958 181
89 iso_pu_bacteria 2513237089 2513602136 181
90 iso_pu_bacteria 2513237090 2513611158 181
91 iso_pu_bacteria 2513237091 2513618438 181
92 iso_pu_bacteria 2513237093 2513630427 181
93 iso_pu_bacteria 2513237103 2513713950 181
94 iso_pu_bacteria 2513237138 2513869405 181
95 iso_pu_bacteria 2513237140 2513886572 181
96 iso_pu_bacteria 2513237143 2513906064 181
97 iso_pu_bacteria 2513237144 2513912968 181
98 iso_pu_bacteria 2513237146 2513929915 181
99 iso_pu_bacteria 2513237156 2513986407 181
100 iso_pu_bacteria 2513237159 2513997873 181
101 iso_pu_bacteria 2513237160 2514003723 181
102 iso_pu_bacteria 2513237162 2514024247 181
103 iso_pu_bacteria 2513237164 2514038507 181
104 iso_pu_bacteria 2513237305 2514416908 181
105 iso_pu_bacteria 2513237351 2514587215 181
106 iso_pu_bacteria 2515075009 2515114124 181
107 iso_pu_bacteria 2515154107 2515610561 181
108 iso_pu_bacteria 2515154113 2515636346 181
109 iso_pu_bacteria 2515154114 2515646270 181
110 iso_pu_bacteria 2515154116 2515660547 181
111 iso_pu_bacteria 2515154134 2515741356 181
112 iso_pu_bacteria 2516143018 2516205000 181
113 iso_pu_bacteria 2516653046 2516894095 181
114 iso_pu_bacteria 2516653077 2517037760 181
115 iso_pu_bacteria 2516653085 2517078075 181
116 iso_pu_bacteria 2517093000 2517096846 181
117 iso_pu_bacteria 2517287029 2517408743 181
118 iso_pu_bacteria 2517487022 2517570788 181
119 iso_pu_bacteria 2519899620 2520376322 181
120 iso_pu_bacteria 2523231067 2523467780 181
121 iso_pu_bacteria 2524023207 2524454025 181
122 iso_pu_bacteria 2524023209 2524462354 181
123 iso_pu_bacteria 2529292951 2530647536 181
124 iso_pu_bacteria 2534681796 2535518763 181
125 iso_pu_bacteria 2537561587 2537874236 181
126 iso_pu_bacteria 2551306084 2551679057 181
127 iso_pu_bacteria 2551306084 2551681848 181
128 iso_pu_bacteria 2551306085 2551686696 181
129 iso_pu_bacteria 2551306086 2551693631 181
130 iso_pu_bacteria 2551306087 2551699067 181
131 iso_pu_bacteria 2551306089 2551710116 181
132 iso_pu_bacteria 2551306090 2551719631 181
133 iso_pu_bacteria 2551306091 2551725347 181
134 iso_pu_bacteria 2551306092 2551734239 181
135 iso_pu_bacteria 2551306093 2551740615 181
136 iso_pu_bacteria 2554235003 2554245365 181
137 iso_pu_bacteria 2558860100 2558860211 181
138 iso_pu_bacteria 2558860242 2559296806 181
139 iso_pu_bacteria 2558860983 2561466951 181
140 iso_pu_bacteria 2582581283 2585167792 181
141 iso_pu_bacteria 2582581294 2585205552 181
142 iso_pu_bacteria 2582581298 2585223748 181
143 iso_pu_bacteria 2582581299 2585228872 181
144 iso_pu_bacteria 2582581304 2585257535 181
145 iso_pu_bacteria 2582581306 2585270328 181
146 iso_pu_bacteria 2582581307 2585271479 181
147 iso_pu_bacteria 2582581308 2585280546 181
148 iso_pu_bacteria 2582581315 2585327911 181
149 iso_pu_bacteria 2582581316 2585334338 181
150 iso_pu_bacteria 2582581865 2585391500 181
151 iso_pu_bacteria 2582581866 2585394735 181
152 iso_pu_bacteria 2582581867 2585403619 181
153 iso_pu_bacteria 2585427526 2585530123 181
154 iso_pu_bacteria 2585427527 2585531484 181
155 iso_pu_bacteria 2585427528 2585543768 181
156 iso_pu_bacteria 2585427529 2585548971 181
157 iso_pu_bacteria 2585427530 2585557731 181
158 iso_pu_bacteria 2585427531 2585563281 181
159 iso_pu_bacteria 2585427590 2585824187 181
160 iso_pu_bacteria 2585427593 2585842092 181
161 iso_pu_bacteria 2585427594 2585844764 181
162 iso_pu_bacteria 2585427608 2585902666 181
163 iso_pu_bacteria 2585427609 2585907499 181
164 iso_pu_bacteria 2585427633 2585997612 181
165 iso_pu_bacteria 2585427634 2586002200 181
166 iso_pu_bacteria 2585428125 2587982507 181
167 iso_pu_bacteria 2588253730 2588519005 181
168 iso_pu_bacteria 2597489875 2597811319 181
169 iso_pu_bacteria 2599185156 2599334958 181
170 iso_pu_bacteria 2599185170 2599420370 181
171 iso_pu_bacteria 2599185210 2599604498 181
172 iso_pu_bacteria 2599185236 2599720158 181
173 iso_pu_bacteria 2599185301 2599939011 181
174 iso_pu_bacteria 2599185352 2600197458 181
175 iso_pu_bacteria 2600254933 2600373388 181
176 iso_pu_bacteria 2600255279 2601610314 181
177 iso_pu_bacteria 2600255308 2601747356 181
178 iso_pu_bacteria 2615840624 2616297933 181
179 iso_pu_bacteria 2615840626 2616306908 181
180 iso_pu_bacteria 2615840698 2616557768 181
181 iso_pu_bacteria 2617270742 2617385016 181
182 iso_pu_bacteria 2643221550 2643770044 181
183 iso_pu_bacteria 2643221551 2643776821 181
184 iso_pu_bacteria 2643221555 2643795269 181
185 iso_pu_bacteria 2643221557 2643806803 181
186 iso_pu_bacteria 2643221558 2643813586 181
187 iso_pu_bacteria 2643221564 2643840224 181
188 iso_pu_bacteria 2643221580 2643911743 181
189 iso_pu_bacteria 2643221582 2643917110 181
190 iso_pu_bacteria 2643221595 2643986039 181
191 iso_pu_bacteria 2643221599 2644002337 181
192 iso_pu_bacteria 2643221607 2644050850 181
193 iso_pu_bacteria 2643221610 2644064753 181
194 iso_pu_bacteria 2643221618 2644108723 181
195 iso_pu_bacteria 2643221623 2644130782 181
196 iso_pu_bacteria 2643221626 2644149778 181
197 iso_pu_bacteria 2643221627 2644153605 181
198 iso_pu_bacteria 2643221629 2644169411 181
199 iso_pu_bacteria 2643221634 2644194059 181
200 iso_pu_bacteria 2643221636 2644205353 181
201 iso_pu_bacteria 2643221637 2644208431 181
202 iso_pu_bacteria 2643221643 2644240722 181
203 iso_pu_bacteria 2643221653 2644300055 181
204 iso_pu_bacteria 2643221655 2644311139 181
205 iso_pu_bacteria 2643221659 2644335046 181
206 iso_pu_bacteria 2643221662 2644350808 181
207 iso_pu_bacteria 2643221668 2644376310 181
208 iso_pu_bacteria 2643221674 2644413110 181
209 iso_pu_bacteria 2643221675 2644416426 181
210 iso_pu_bacteria 2643221680 2644449466 181
211 iso_pu_bacteria 2643221686 2644483754 181
212 iso_pu_bacteria 2643221688 2644496063 181
213 iso_pu_bacteria 2643221689 2644500430 181
214 iso_pu_bacteria 2643221693 2644520933 181
215 iso_pu_bacteria 2643221698 2644544532 181
216 iso_pu_bacteria 2643221712 2644616969 181
217 iso_pu_bacteria 2643221718 2644651682 181
218 iso_pu_bacteria 2643221719 2644658281 181
219 iso_pu_bacteria 2643221723 2644676964 181
220 iso_pu_bacteria 2643221726 2644688040 181
221 iso_pu_bacteria 2657244999 2657685273 181
222 iso_pu_bacteria 2667528174 2671113652 181
223 iso_pu_bacteria 2671180139 2671693434 181
224 iso_pu_bacteria 2687453392 2688596894 181
225 iso_pu_bacteria 2690316117 2692314822 181
226 iso_pu_bacteria 2693429783 2694629221 181
227 iso_pu_bacteria 2693429784 2694637913 181
228 iso_pu_bacteria 2718217882 2719182780 181
229 iso_pu_bacteria 2718217927 2719387471 181
230 iso_pu_bacteria 2718217997 2719667117 181
231 iso_pu_bacteria 2718218009 2719733497 181
232 iso_pu_bacteria 2718218199 2720493537 181
233 iso_pu_bacteria 2718218232 2720614995 181
234 iso_pu_bacteria 2718218233 2720621767 181
235 iso_pu_bacteria 2718218235 2720633101 181
236 iso_pu_bacteria 2718218269 2720776820 181
237 iso_pu_bacteria 2718218363 2721148892 181
238 iso_pu_bacteria 2718218365 2721160290 181
239 iso_pu_bacteria 2718218366 2721165705 181
240 iso_pu_bacteria 2718218423 2721401105 181
241 iso_pu_bacteria 2721755514 2722841875 181
242 iso_pu_bacteria 2721755556 2723028410 181
243 iso_pu_bacteria 2721755684 2723562036 181
244 iso_pu_bacteria 2721755685 2723568668 181
245 iso_pu_bacteria 2721755686 2723574016 181
246 iso_pu_bacteria 2721755809 2724039919 181
247 iso_pu_bacteria 2721755810 2724046253 181
248 iso_pu_bacteria 2721755819 2724091427 181
249 iso_pu_bacteria 2721755822 2724105933 181
250 iso_pu_bacteria 2721755823 2724111758 181
251 iso_pu_bacteria 2724679232 2725947288 181
252 iso_pu_bacteria 2728369352 2730109346 181
253 iso_pu_bacteria 2728369365 2730166015 181
254 iso_pu_bacteria 2728369397 2730299922 181
255 iso_pu_bacteria 2738541293 2738803832 181
256 iso_pu_bacteria 2738541317 2738947472 181
257 iso_pu_bacteria 2738541333 2739038946 181
258 iso_pu_bacteria 2738543024 2739310356 181
259 iso_pu_bacteria 2738543031 2739349230 181
260 iso_pu_bacteria 2756170246 2756670836 181
261 iso_pu_bacteria 2757320392 2757570571 181
262 iso_pu_bacteria 2765235802 2765467932 181
263 iso_pu_bacteria 2765235942 2766062428 181
264 iso_pu_bacteria 2767802442 2770198569 181
265 iso_pu_bacteria 2775506902 2776270113 181
266 iso_pu_bacteria 2775506904 2776281224 181
267 iso_pu_bacteria 2775507049 2776915290 181
268 iso_pu_bacteria 2775507266 2778176211 181
269 iso_pu_bacteria 2791355082 2792582756 181
270 iso_pu_bacteria 2791355091 2792624700 181
271 iso_pu_bacteria 2791355092 2792630774 181
272 iso_pu_bacteria 2791355094 2792643624 181
273 iso_pu_bacteria 2791355123 2792748353 181
274 iso_pu_bacteria 2791355253 2793282673 181
275 iso_pu_bacteria 2791355256 2793299517 181
276 iso_pu_bacteria 2791355259 2793318254 181
277 iso_pu_bacteria 2791355260 2793325129 181
278 iso_pu_bacteria 2791355261 2793330889 181
279 iso_pu_bacteria 2791355262 2793337727 181
280 iso_pu_bacteria 2791355263 2793338607 181
281 iso_pu_bacteria 2791355264 2793346417 181
282 iso_pu_bacteria 2791355265 2793357268 181
283 iso_pu_bacteria 2791355266 2793363981 181
284 iso_pu_bacteria 2791355267 2793370913 181
285 iso_pu_bacteria 2802428858 2802718120 181
286 iso_pu_bacteria 2802428859 2802725028 181
287 iso_pu_bacteria 2802428860 2802730848 181
288 iso_pu_bacteria 2802428861 2802738196 181
289 iso_pu_bacteria 2802428862 2802743936 181
290 iso_pu_bacteria 2802428863 2802750814 181
291 iso_pu_bacteria 2802429268 2804753116 181
292 iso_pu_bacteria 2802429605 2805931594 181
293 iso_pu_bacteria 2802429606 2805937617 181
294 iso_pu_bacteria 2802429633 2806049336 181
295 iso_pu_bacteria 2802429634 2806056294 181
296 iso_pu_bacteria 2802429635 2806063432 181
297 iso_pu_bacteria 2802429636 2806071005 181
298 iso_pu_bacteria 2802429637 2806077964 181
299 iso_pu_bacteria 2808606387 2808987262 181
300 iso_pu_bacteria 2818991272 2819243612 181
301 iso_pu_bacteria 2818991439 2819557354 181
302 iso_pu_bacteria 2818991448 2819611070 181
303 iso_pu_bacteria 2818991453 2819639001 181
304 iso_pu_bacteria 2818991461 2819687178 181
305 iso_pu_bacteria 2821123053 2821128555 181
306 iso_pu_bacteria 2837651117 2837653980 181
307 iso_pu_bacteria 2837678835 2837680397 181
308 iso_pu_bacteria 2838016132 2838021959 181
309 iso_pu_bacteria 2838022645 2838028649 181
310 iso_pu_bacteria 2838029111 2838030756 181
311 iso_pu_bacteria 2838035591 2838042291 181
312 iso_pu_bacteria 2838042994 2838048219 181
313 iso_pu_bacteria 2838048938 2838053623 181
314 iso_pu_bacteria 2838061910 2838067584 181
315 iso_pu_bacteria 2838068647 2838073897 181
316 iso_pu_bacteria 2838074704 2838077225 181
317 iso_pu_bacteria 2838661181 2838668303 181
318 iso_pu_bacteria 2838668709 2838674794 181
319 iso_pu_bacteria 2838675328 2838678089 181
320 iso_pu_bacteria 2838680041 2838684083 181
321 iso_pu_bacteria 2838686498 2838694020 181
322 iso_pu_bacteria 2838694306 2838698612 181
323 iso_pu_bacteria 2838701080 2838707097 181
324 iso_pu_bacteria 2838707686 2838711727 181
325 iso_pu_bacteria 2838714209 2838717004 181
326 iso_pu_bacteria 2838719591 2838722385 181
327 iso_pu_bacteria 2838724970 2838727754 181
328 iso_pu_bacteria 2838729681 2838731816 181
329 iso_pu_bacteria 2838736955 2838741572 181
330 iso_pu_bacteria 2838742623 2838749410 181
331 iso_pu_bacteria 2839993093 2839997880 181
332 iso_pu_bacteria 2840764183 2840765518 181
333 iso_pu_bacteria 2841734538 2841737387 181
334 iso_pu_bacteria 2841840854 2841845593 181
335 iso_pu_bacteria 2841846520 2841849410 181
336 iso_pu_bacteria 2841851746 2841858799 181
337 iso_pu_bacteria 2841859092 2841861547 181
338 iso_pu_bacteria 2841864319 2841867961 181
339 iso_pu_bacteria 2842077413 2842081528 181
340 iso_pu_bacteria 2842110456 2842116212 181
341 iso_pu_bacteria 2842118031 2842124888 181
342 iso_pu_bacteria 2842124991 2842127841 181
343 iso_pu_bacteria 2842130223 2842132982 181
344 iso_pu_bacteria 2842140634 2842145297 181
345 iso_pu_bacteria 2842146304 2842149842 181
346 iso_pu_bacteria 2842152218 2842154976 181
347 iso_pu_bacteria 2842156927 2842163443 181
348 iso_pu_bacteria 2842163707 2842166457 181
349 iso_pu_bacteria 2842170452 2842173475 181
350 iso_pu_bacteria 2842175837 2842178596 181
351 iso_pu_bacteria 2842180545 2842187053 181
352 iso_pu_bacteria 2842187318 2842190112 181
353 iso_pu_bacteria 2842192696 2842198678 181
354 iso_pu_bacteria 2842198810 2842204702 181
355 iso_pu_bacteria 2842205361 2842207215 181
356 iso_pu_bacteria 2842211629 2842214426 181
357 iso_pu_bacteria 2842217011 2842224147 181
358 iso_pu_bacteria 2842224351 2842227145 181
359 iso_pu_bacteria 2842229732 2842235814 181
360 iso_pu_bacteria 2842237096 2842240710 181
361 iso_pu_bacteria 2842243621 2842250383 181
362 iso_pu_bacteria 2842250916 2842256935 181
363 iso_pu_bacteria 2842257432 2842264319 181
364 iso_pu_bacteria 2842264693 2842269104 181
365 iso_pu_bacteria 2842271015 2842278502 181
366 iso_pu_bacteria 2842278818 2842281074 181
367 iso_pu_bacteria 2842285085 2842288312 181
368 iso_pu_bacteria 2842291075 2842295185 181
369 iso_pu_bacteria 2842298080 2842300460 181
370 iso_pu_bacteria 2842304105 2842306080 181
371 iso_pu_bacteria 2842311132 2842311164 181
372 iso_pu_bacteria 2842317721 2842320915 181
373 iso_pu_bacteria 2842341865 2842348045 181
374 iso_pu_bacteria 2842357229 2842362241 181
375 iso_pu_bacteria 2842363717 2842366467 181
376 iso_pu_bacteria 2842370503 2842374797 181
377 iso_pu_bacteria 2842377471 2842381584 181
378 iso_pu_bacteria 2842384541 2842388654 181
379 iso_pu_bacteria 2842395702 2842396252 181
380 iso_pu_bacteria 2842402390 2842408617 181
381 iso_pu_bacteria 2842409023 2842415270 181
382 iso_pu_bacteria 2842415677 2842421889 181
383 iso_pu_bacteria 2842422224 2842427764 181
384 iso_pu_bacteria 2842428310 2842433203 181
385 iso_pu_bacteria 2842434925 2842439629 181
386 iso_pu_bacteria 2842441272 2842446292 181
387 iso_pu_bacteria 2842447887 2842448972 181
388 iso_pu_bacteria 2842462802 2842467487 181
389 iso_pu_bacteria 2842469257 2842474000 181
390 iso_pu_bacteria 2842475841 2842477488 181
391 iso_pu_bacteria 2842482326 2842488054 181
392 iso_pu_bacteria 2842489311 2842490966 181
393 iso_pu_bacteria 2842495871 2842498305 181
394 iso_pu_bacteria 2842502639 2842504639 181
395 iso_pu_bacteria 2842509118 2842511892 181
396 iso_pu_bacteria 2842515876 2842518187 181
397 iso_pu_bacteria 2842521101 2842522978 181
398 iso_pu_bacteria 2842871566 2842875884 181
399 iso_pu_bacteria 2842922631 2842926139 181
400 iso_pu_bacteria 2844002411 2844009078 181
401 iso_pu_bacteria 2844009547 2844012241 181
402 iso_pu_bacteria 2844163670 2844168873 181
403 iso_pu_bacteria 2844454524 2844457261 181
404 iso_pu_bacteria 2847417321 2847420123 181
405 iso_pu_bacteria 2847670302 2847674653 181
406 iso_pu_bacteria 2847686936 2847690777 181
407 iso_pu_bacteria 2848992105 2848995001 181
408 iso_pu_bacteria 2850079185 2850082105 181
409 iso_pu_bacteria 2852387548 2852391508 181
410 iso_pu_bacteria 2854896431 2854896955 181
411 iso_pu_bacteria 2854916844 2854917106 181
412 iso_pu_bacteria 2855825444 2855826813 181
413 iso_pu_bacteria 2855839649 2855842211 181
414 iso_pu_bacteria 2855872281 2855874691 181
415 iso_pu_bacteria 2856314179 2856317461 181
416 iso_pu_bacteria 2856328259 2856328804 181
417 iso_pu_bacteria 2856334872 2856336778 181
418 iso_pu_bacteria 2856342000 2856346056 181
419 iso_pu_bacteria 2856364286 2856366765 181
420 iso_pu_bacteria 2857349434 2857356552 181
421 iso_pu_bacteria 2857367948 2857374742 181
422 iso_pu_bacteria 2857516855 2857521209 181
423 iso_pu_bacteria 2857531043 2857534292 181
424 iso_pu_bacteria 2858800743 2858801874 181
425 iso_pu_bacteria 2869162929 2869165203 181
426 iso_pu_bacteria 2869169390 2869174281 181
427 iso_pu_bacteria 2869234852 2869237251 181
428 iso_pu_bacteria 2869242130 2869247142 181
429 iso_pu_bacteria 2869249662 2869250851 181
430 iso_pu_bacteria 2869256925 2869258888 181
431 iso_pu_bacteria 2869264136 2869264459 181
432 iso_pu_bacteria 2869271264 2869276804 181
433 iso_pu_bacteria 2869278585 2869285753 181
434 iso_pu_bacteria 2869285874 2869287824 181
435 iso_pu_bacteria 2871429161 2871435772 181
436 iso_pu_bacteria 2871435913 2871443143 181
437 iso_pu_bacteria 2871444079 2871445204 181
438 iso_pu_bacteria 2871451962 2871454586 181
439 iso_pu_bacteria 2871459585 2871460160 181
440 iso_pu_bacteria 2871466892 2871474233 181
441 iso_pu_bacteria 2871474448 2871478866 181
442 iso_pu_bacteria 2871481445 2871487855 181
443 iso_pu_bacteria 2871495908 2871498074 181
444 iso_pu_bacteria 2874102143 2874104569 181
445 iso_pu_bacteria 2874109183 2874110476 181
446 iso_pu_bacteria 2874116593 2874120416 181
447 iso_pu_bacteria 2874123672 2874128867 181
448 iso_pu_bacteria 2874139085 2874141933 181
449 iso_pu_bacteria 2874146452 2874151456 181
450 iso_pu_bacteria 2874155637 2874159089 181
451 iso_pu_bacteria 2874162495 2874167650 181
452 iso_pu_bacteria 2874168670 2874175642 181
453 iso_pu_bacteria 2876363079 2876364802 181
454 iso_pu_bacteria 2876369609 2876371391 181
455 iso_pu_bacteria 2876377896 2876385296 181
456 iso_pu_bacteria 2876386047 2876387710 181
457 iso_pu_bacteria 2876392853 2876396141 181
458 iso_pu_bacteria 2876399893 2876404743 181
459 iso_pu_bacteria 2876406927 2876412398 181
460 iso_pu_bacteria 2876413966 2876417508 181
461 iso_pu_bacteria 2876420981 2876423455 181
462 iso_pu_bacteria 2878035449 2878038499 181
463 iso_pu_bacteria 2878730984 2878733847 181
464 iso_pu_bacteria 2878738818 2878739328 181
465 iso_pu_bacteria 2878745973 2878749335 181
466 iso_pu_bacteria 2878760144 2878762296 181
467 iso_pu_bacteria 2878767105 2878769263 181
468 iso_pu_bacteria 2878774303 2878774888 181
469 iso_pu_bacteria 2878781027 2878786337 181
470 iso_pu_bacteria 2878788777 2878796716 181
471 iso_pu_bacteria 2881147464 2881149477 181
472 iso_pu_bacteria 2881161766 2881166368 181
473 iso_pu_bacteria 2882632389 2882634141 181
474 iso_pu_bacteria 2885305155 2885307805 181
475 iso_pu_bacteria 2885312484 2885313201 181
476 iso_pu_bacteria 2885326080 2885334029 181
477 iso_pu_bacteria 2885334103 2885340263 181
478 iso_pu_bacteria 2888337043 2888338019 181
479 iso_pu_bacteria 2888343758 2888345318 181
480 iso_pu_bacteria 2888350351 2888354608 181
481 iso_pu_bacteria 2889010040 2889016217 181
482 iso_pu_bacteria 2889016732 2889018747 181
483 iso_pu_bacteria 2889914905 2889917645 181
484 iso_pu_bacteria 2891048133 2891049380 181
485 iso_pu_bacteria 2891373044 2891373788 181
486 iso_pu_bacteria 2894652903 2894654197 181
487 iso_pu_bacteria 2894817345 2894817963 181
488 iso_pu_bacteria 2896384573 2896387854 181
489 iso_pu_bacteria 2899792073 2899792669 181
490 iso_pu_bacteria 2899803654 2899808206 181
491 iso_pu_bacteria 2899845264 2899850114 181
492 iso_pu_bacteria 2903448605 2903449212 181
493 iso_pu_bacteria 2903492973 2903504197 181
494 iso_pu_bacteria 2903513507 2903518102 181
495 iso_pu_bacteria 2903521522 2903522462 181
496 iso_pu_bacteria 2903528002 2903528841 181
497 iso_pu_bacteria 2903540706 2903542872 181
498 iso_pu_bacteria 2904578770 2904580458 181
499 iso_pu_bacteria 2904659560 2904662917 181
500 iso_pu_bacteria 2906308376 2906310373 181
501 iso_pu_bacteria 2906321335 2906324438 181
502 iso_pu_bacteria 2906328253 2906333239 181
503 iso_pu_bacteria 2906354277 2906356848 181
504 iso_pu_bacteria 2906363423 2906370345 181
505 iso_pu_bacteria 2906370794 2906377945 181
506 iso_pu_bacteria 2906378014 2906379222 181
507 iso_pu_bacteria 2906386501 2906386870 181
508 iso_pu_bacteria 2906393657 2906399058 181
509 iso_pu_bacteria 2906401398 2906405706 181
510 iso_pu_bacteria 2906408224 2906412905 181
511 iso_pu_bacteria 2906414383 2906417526 181
512 iso_pu_bacteria 2906427513 2906435879 181
513 iso_pu_bacteria 2913295892 2913299627 181
514 iso_pu_bacteria 2913308742 2913312379 181
515 iso_pu_bacteria 2915980308 2915980336 181
516 iso_pu_bacteria 2915986958 2915992074 181
517 iso_pu_bacteria 2915993759 2915994548 181
518 iso_pu_bacteria 2916000859 2916007613 181
519 iso_pu_bacteria 2916007675 2916012878 181
520 iso_pu_bacteria 2916014648 2916019376 181
521 iso_pu_bacteria 2916021584 2916026008 181
522 iso_pu_bacteria 2916028427 2916032945 181
523 iso_pu_bacteria 2916035215 2916040142 181
524 iso_pu_bacteria 2916041962 2916048001 181
525 iso_pu_bacteria 2916048683 2916049964 181
526 iso_pu_bacteria 2916055098 2916060212 181
527 iso_pu_bacteria 2916061851 2916066687 181
528 iso_pu_bacteria 2916068649 2916069616 181
529 iso_pu_bacteria 2916076590 2916083076 181
530 iso_pu_bacteria 2917554339 2917554496 181
531 iso_pu_bacteria 2919100787 2919105205 181
532 iso_pu_bacteria 2919114240 2919117262 181
533 iso_pu_bacteria 2919119836 2919119865 181
534 iso_pu_bacteria 2919171160 2919175961 181
535 iso_pu_bacteria 2919408235 2919410888 181
536 iso_pu_bacteria 2920760137 2920760986 181
537 iso_pu_bacteria 2920822456 2920828736 181
538 iso_pu_bacteria 2921201388 2921203700 181
539 iso_pu_bacteria 2921208531 2921213349 181
540 iso_pu_bacteria 2921237296 2921240674 181
541 iso_pu_bacteria 2921244191 2921249341 181
542 iso_pu_bacteria 2921250672 2921252153 181
543 iso_pu_bacteria 2921257292 2921258045 181
544 iso_pu_bacteria 2921263974 2921268521 181
545 iso_pu_bacteria 2921282425 2921287475 181
546 iso_pu_bacteria 2921289301 2921295175 181
547 iso_pu_bacteria 2921296804 2921301569 181
548 iso_pu_bacteria 2922130491 2922132205 181
549 iso_pu_bacteria 2922151315 2922154018 181
550 iso_pu_bacteria 2922158528 2922161684 181
551 iso_pu_bacteria 2922172374 2922173371 181
552 iso_pu_bacteria 2922178524 2922183913 181
553 iso_pu_bacteria 2922185730 2922192104 181
554 iso_pu_bacteria 2923556063 2923561784 181
555 iso_pu_bacteria 2924144063 2924149617 181
556 iso_pu_bacteria 2924150972 2924152690 181
557 iso_pu_bacteria 2924158325 2924163623 181
558 iso_pu_bacteria 2924165586 2924167672 181
559 iso_pu_bacteria 2924172951 2924178293 181
560 iso_pu_bacteria 2924179722 2924185175 181
561 iso_pu_bacteria 2924186466 2924191730 181
562 iso_pu_bacteria 2924193448 2924198747 181
563 iso_pu_bacteria 2924200457 2924205327 181
564 iso_pu_bacteria 2924207177 2924212233 181
565 iso_pu_bacteria 2924214083 2924216488 181
566 iso_pu_bacteria 2924221636 2924227265 181
567 iso_pu_bacteria 2924228884 2924233968 181
568 iso_pu_bacteria 2924710171 2924716462 181
569 iso_pu_bacteria 2924726620 2924729312 181
570 iso_pu_bacteria 2924733363 2924734008 181
571 iso_pu_bacteria 2924741084 2924748271 181
572 iso_pu_bacteria 2924748358 2924748463 181
573 iso_pu_bacteria 2924754689 2924756344 181
574 iso_pu_bacteria 2924762789 2924769239 181
575 iso_pu_bacteria 2924776078 2924776849 181
576 iso_pu_bacteria 2926754445 2926758709 181
577 iso_pu_bacteria 2926760298 2926763761 181
578 iso_pu_bacteria 2928521798 2928526645 181
579 iso_pu_bacteria 2929138655 2929141669 181
580 iso_pu_bacteria 2932401849 2932406050 181
581 iso_pu_bacteria 2933006813 2933009642 181
582 iso_pu_bacteria 2933011516 2933013815 181
583 iso_pu_bacteria 2933570622 2933572583 181
584 iso_pu_bacteria 2933586486 2933592430 181
585 iso_pu_bacteria 2933594066 2933595619 181
586 iso_pu_bacteria 2933599457 2933604282 181
587 iso_pu_bacteria 2935894831 2935897739 181
588 iso_pu_bacteria 2935901341 2935903871 181
589 iso_pu_bacteria 2936367885 2936370180 181
590 iso_pu_bacteria 2936375103 2936379331 181
591 iso_pu_bacteria 2936381700 2936385918 181
592 iso_pu_bacteria 2936996657 2936999825 181
593 iso_pu_bacteria 2937002841 2937007849 181
594 iso_pu_bacteria 2937009748 2937013858 181
595 iso_pu_bacteria 2937016420 2937021515 181
596 iso_pu_bacteria 2937023124 2937027672 181
597 iso_pu_bacteria 2937029754 2937032443 181
598 iso_pu_bacteria 2937036028 2937039818 181
599 iso_pu_bacteria 2937042894 2937047885 181
600 iso_pu_bacteria 2937049772 2937054760 181
601 iso_pu_bacteria 2937056579 2937058767 181
602 iso_pu_bacteria 2937063883 2937070159 181
603 iso_pu_bacteria 2937071275 2937076857 181
604 iso_pu_bacteria 2937078374 2937078402 181
605 iso_pu_bacteria 2937084907 2937088189 181
606 iso_pu_bacteria 2937091812 2937093976 181
607 iso_pu_bacteria 2937098957 2937104889 181
608 iso_pu_bacteria 2937106411 2937112712 181
609 iso_pu_bacteria 2937113482 2937117965 181
610 iso_pu_bacteria 2937119839 2937124694 181
611 iso_pu_bacteria 2937126314 2937131280 181
612 iso_pu_bacteria 2937813078 2937817201 181
613 iso_pu_bacteria 2937822353 2937826864 181
614 iso_pu_bacteria 2937836603 2937840683 181
615 iso_pu_bacteria 2937848649 2937855391 181
616 iso_pu_bacteria 2937861824 2937862314 181
617 iso_pu_bacteria 2937877337 2937883550 181
618 iso_pu_bacteria 2937891427 2937897843 181
619 iso_pu_bacteria 2937972304 2937973471 181
620 iso_pu_bacteria 2937980651 2937987440 181
621 iso_pu_bacteria 2937994558 2937996722 181
622 iso_pu_bacteria 2938014810 2938014938 181
623 iso_pu_bacteria 2941499720 2941501934 181
624 iso_pu_bacteria 2954011201 2954013365 181
625 iso_pu_bacteria 2957375807 2957378338 181
626 iso_pu_bacteria 2957382221 2957387327 181
627 iso_pu_bacteria 2957388812 2957393674 181
628 iso_pu_bacteria 2957395598 2957400209 181
629 iso_pu_bacteria 2957402308 2957407276 181
630 iso_pu_bacteria 2957408893 2957413039 181
631 iso_pu_bacteria 2957415311 2957420888 181
632 iso_pu_bacteria 2957422303 2957425050 181
633 iso_pu_bacteria 2957430029 2957435775 181
634 iso_pu_bacteria 2957437181 2957440274 181
635 iso_pu_bacteria 2957443900 2957449139 181
636 iso_pu_bacteria 2957450854 2957455195 181
637 iso_pu_bacteria 2957457609 2957463290 181
638 iso_pu_bacteria 2957464669 2957469791 181
639 iso_pu_bacteria 2957471148 2957476533 181
640 iso_pu_bacteria 2957478035 2957483015 181
641 iso_pu_bacteria 2957484790 2957486245 181
642 iso_pu_bacteria 2957491536 2957496332 181
643 iso_pu_bacteria 2957498199 2957504040 181
644 iso_pu_bacteria 2957505466 2957507751 181
645 iso_pu_bacteria 2958034702 2958041768 181
646 iso_pu_bacteria 2958041894 2958050299 181
647 iso_pu_bacteria 2958064165 2958065874 181
648 iso_pu_bacteria 2958071322 2958073683 181
649 iso_pu_bacteria 2958084443 2958090718 181
650 iso_pu_bacteria 2958092219 2958098634 181
651 iso_pu_bacteria 2958100919 2958106412 181
652 iso_pu_bacteria 2958108152 2958110685 181
653 iso_pu_bacteria 2958115193 2958120830 181
654 iso_pu_bacteria 2958122699 2958124260 181
655 iso_pu_bacteria 2958130278 2958132228 181
656 iso_pu_bacteria 2958137437 2958138737 181
657 iso_pu_bacteria 2958144490 2958144990 181
658 iso_pu_bacteria 2958158011 2958160939 181
659 iso_pu_bacteria 2958165035 2958167194 181
660 iso_pu_bacteria 2958172287 2958176549 181
661 iso_pu_bacteria 2958179912 2958182042 181
662 iso_pu_bacteria 2960584000 2960585592 181
663 iso_pu_bacteria 2960591022 2960591050 181
664 iso_pu_bacteria 2960597568 2960602898 181
665 iso_pu_bacteria 2960603979 2960609801 181
666 iso_pu_bacteria 2960610863 2960612970 181
667 iso_pu_bacteria 2960617483 2960622119 181
668 iso_pu_bacteria 2960624210 2960629685 181
669 iso_pu_bacteria 2960631154 2960634912 181
670 iso_pu_bacteria 2960637947 2960638398 181
671 iso_pu_bacteria 2960645483 2960650994 181
672 iso_pu_bacteria 2960652885 2960658196 181
673 iso_pu_bacteria 2960660292 2960666198 181
674 iso_pu_bacteria 2960667422 2960672596 181
675 iso_pu_bacteria 2960674078 2960677913 181
676 iso_pu_bacteria 2960680706 2960685393 181
677 iso_pu_bacteria 2960687367 2960692292 181
678 iso_pu_bacteria 2960693952 2960694421 181
679 iso_pu_bacteria 2961077736 2961079886 181
680 iso_pu_bacteria 2961114664 2961117943 181
681 iso_pu_bacteria 2961136820 2961144440 181
682 iso_pu_bacteria 2961163497 2961165663 181
683 iso_pu_bacteria 2961183825 2961189554 181
684 iso_pu_bacteria 2963644680 2963646258 181
685 iso_pu_bacteria 2964607997 2964610640 181
686 iso_pu_bacteria 2964615318 2964620159 181
687 iso_pu_bacteria 2964621998 2964627076 181
688 iso_pu_bacteria 2964628898 2964634507 181
689 iso_pu_bacteria 2964636051 2964641096 181
690 iso_pu_bacteria 2964643177 2964648086 181
691 iso_pu_bacteria 2964649959 2964654951 181
692 iso_pu_bacteria 2964656573 2964662444 181
693 iso_pu_bacteria 2964663802 2964669134 181
694 iso_pu_bacteria 2964670856 2964674045 181
695 iso_pu_bacteria 2964678106 2964678734 181
696 iso_pu_bacteria 2964685014 2964690022 181
697 iso_pu_bacteria 2964691889 2964697176 181
698 iso_pu_bacteria 2964698721 2964703192 181
699 iso_pu_bacteria 2964705432 2964711323 181
700 iso_pu_bacteria 2964712639 2964717503 181
701 iso_pu_bacteria 2964719344 2964719677 181
702 iso_pu_bacteria 2965018300 2965020486 181
703 iso_pu_bacteria 2965025482 2965025722 181
704 iso_pu_bacteria 2965032056 2965039871 181
705 iso_pu_bacteria 2965040258 2965042137 181
706 iso_pu_bacteria 2965047637 2965049572 181
707 iso_pu_bacteria 2965062239 2965064839 181
708 iso_pu_bacteria 2965089291 2965089707 181
709 iso_pu_bacteria 2965102966 2965109125 181
710 iso_pu_bacteria 2965110997 2965115108 181
711 iso_pu_bacteria 2965119406 2965124273 181
712 iso_pu_bacteria 2967664464 2967669875 181
713 iso_pu_bacteria 2967671571 2967677271 181
714 iso_pu_bacteria 2967678726 2967684348 181
715 iso_pu_bacteria 2967686174 2967687699 181
716 iso_pu_bacteria 2967693043 2967698255 181
717 iso_pu_bacteria 2967699805 2967706762 181
718 iso_pu_bacteria 2967706974 2967712557 181
719 iso_pu_bacteria 2967714385 2967719591 181
720 iso_pu_bacteria 2967721400 2967726539 181
721 iso_pu_bacteria 2967728569 2967729517 181
722 iso_pu_bacteria 2967735183 2967740126 181
723 iso_pu_bacteria 2967742019 2967743872 181
724 iso_pu_bacteria 2967748971 2967754245 181
725 iso_pu_bacteria 2967755722 2967760756 181
726 iso_pu_bacteria 2967762386 2967767570 181
727 iso_pu_bacteria 2967769361 2967774264 181
728 iso_pu_bacteria 2967775926 2967781874 181
729 iso_pu_bacteria 2968016561 2968016734 181
730 iso_pu_bacteria 2968083720 2968085275 181
731 iso_pu_bacteria 2968091066 2968091393 181
732 iso_pu_bacteria 2968097103 2968099072 181
733 iso_pu_bacteria 2968110612 2968114004 181
734 iso_pu_bacteria 2968117919 2968123194 181
735 iso_pu_bacteria 2968128360 2968129015 181
736 iso_pu_bacteria 2968138860 2968143671 181
737 iso_pu_bacteria 2968171901 2968174065 181
738 iso_pu_bacteria 2970019648 2970025388 181
739 iso_pu_bacteria 2970026789 2970033463 181
740 iso_pu_bacteria 2970033650 2970039484 181
741 iso_pu_bacteria 2970040964 2970046281 181
742 iso_pu_bacteria 2970047711 2970054800 181
743 iso_pu_bacteria 2970054988 2970059982 181
744 iso_pu_bacteria 2970061556 2970067522 181
745 iso_pu_bacteria 2970068827 2970074583 181
746 iso_pu_bacteria 2970076120 2970081028 181
747 iso_pu_bacteria 2970082768 2970083223 181
748 iso_pu_bacteria 2970088815 2970094376 181
749 iso_pu_bacteria 2970095765 2970097252 181
750 iso_pu_bacteria 2970102677 2970107051 181
751 iso_pu_bacteria 2970109326 2970115115 181
752 iso_pu_bacteria 2970116247 2970121114 181
753 iso_pu_bacteria 2970122695 2970128787 181
754 iso_pu_bacteria 2970129317 2970134449 181
755 iso_pu_bacteria 2970136068 2970137194 181
756 iso_pu_bacteria 2970143518 2970146405 181
757 iso_pu_bacteria 2970149975 2970155435 181
758 iso_pu_bacteria 2970156795 2970163585 181
759 iso_pu_bacteria 2970164137 2970169389 181
760 iso_pu_bacteria 2970170962 2970171591 181
761 iso_pu_bacteria 2970177841 2970183237 181
762 iso_pu_bacteria 2970184632 2970191780 181
763 iso_pu_bacteria 2970191845 2970197348 181
764 iso_pu_bacteria 2970469710 2970470076 181
765 iso_pu_bacteria 2970489779 2970490504 181
766 iso_pu_bacteria 2970510686 2970515131 181
767 iso_pu_bacteria 2970524798 2970527026 181
768 iso_pu_bacteria 2970532167 2970535580 181
769 iso_pu_bacteria 2970540015 2970545712 181
770 iso_pu_bacteria 2970547951 2970554739 181
771 iso_pu_bacteria 2970554993 2970557151 181
772 iso_pu_bacteria 2970593180 2970600369 181
773 iso_pu_bacteria 2970619444 2970623056 181
774 iso_pu_bacteria 2970627176 2970630709 181
775 iso_pu_bacteria 2977516862 2977521532 181
776 iso_pu_bacteria 2977523885 2977529255 181
777 iso_pu_bacteria 2977530762 2977534127 181
778 iso_pu_bacteria 2977537788 2977542959 181
779 iso_pu_bacteria 2977544691 2977547398 181
780 iso_pu_bacteria 2977551784 2977557174 181
781 iso_pu_bacteria 2977558990 2977565379 181
782 iso_pu_bacteria 2977565890 2977571381 181
783 iso_pu_bacteria 2977572785 2977578132 181
784 iso_pu_bacteria 2977579622 2977584876 181
785 iso_pu_bacteria 2977843712 2977847490 181
786 iso_pu_bacteria 2977851361 2977852071 181
787 iso_pu_bacteria 2977858184 2977864842 181
788 iso_pu_bacteria 2977872689 2977878845 181
789 iso_pu_bacteria 2977898635 2977899153 181
790 iso_pu_bacteria 2977907340 2977909546 181
791 iso_pu_bacteria 2977915119 2977922593 181
792 iso_pu_bacteria 2977922695 2977928903 181
793 iso_pu_bacteria 2977935797 2977940569 181
794 iso_pu_bacteria 2977942078 2977943122 181
795 iso_pu_bacteria 2977950692 2977956609 181
796 iso_pu_bacteria 2977957713 2977959865 181
797 iso_pu_bacteria 2977971508 2977979571 181
798 iso_pu_bacteria 2977986579 2977990186 181
799 iso_pu_bacteria 2979089926 2979091197 181
800 iso_pu_bacteria 2979095461 2979096722 181
801 iso_pu_bacteria 2979100975 2979102389 181
802 iso_pu_bacteria 2979710463 2979712314 181
803 iso_pu_bacteria 2979742915 2979744254 181
804 iso_pu_bacteria 2979764755 2979769138 181
805 iso_pu_bacteria 2979772303 2979777738 181
806 iso_pu_bacteria 2979779861 2979783997 181
807 iso_pu_bacteria 2979793036 2979799757 181
808 iso_pu_bacteria 2984509177 2984509674 181
809 iso_pu_bacteria 2984518228 2984519627 181
810 iso_pu_bacteria 2984537506 2984538012 181
811 iso_pu_bacteria 2984601300 2984604751 181
812 iso_pu_bacteria 2987636660 2987643832 181
813 iso_pu_bacteria 2987645492 2987647003 181
814 iso_pu_bacteria 2987652177 2987659081 181
815 iso_pu_bacteria 2987659509 2987661671 181
816 iso_pu_bacteria 2987666974 2987672415 181
817 iso_pu_bacteria 2987673487 2987674768 181
818 iso_pu_bacteria 2989349275 2989352175 181
819 iso_pu_bacteria 2989771324 2989771361 181
820 iso_pu_bacteria 2989776772 2989779885 181
821 iso_pu_bacteria 2995392953 2995395358 181
822 iso_pu_bacteria 2996310559 2996313428 181
823 iso_pu_bacteria 2996336353 2996341272 181
824 iso_pu_bacteria 2996341866 2996347871 181
825 iso_pu_bacteria 2996348954 2996352995 181
826 iso_pu_bacteria 2996386984 2996391822 181
827 iso_pu_bacteria 2996887358 2996890764 181
828 iso_pu_bacteria 2996893221 2996895985 181
829 iso_pu_bacteria 3000135777 3000141286 181
830 iso_pu_bacteria 3003930520 3003930858 181
831 iso_pu_bacteria 3004167301 3004174409 181
832 iso_pu_bacteria 3004188549 3004190720 181
833 iso_pu_bacteria 3004195979 3004199970 181
834 iso_pu_bacteria 3004203850 3004207981 181
835 iso_pu_bacteria 3004211236 3004211549 181
836 iso_pu_bacteria 3004218560 3004224902 181
837 iso_pu_bacteria 3004232784 3004233474 181
838 iso_pu_bacteria 3004239961 3004247381 181
839 iso_pu_bacteria 3004248173 3004251778 181
840 iso_pu_bacteria 3004268573 3004270005 181
841 iso_pu_bacteria 3004275668 3004279677 181
842 iso_pu_bacteria 3004289098 3004293684 181
843 iso_pu_bacteria 3004334049 3004336160 181
844 iso_pu_bacteria 3005409236 3005409459 181
845 iso_pu_bacteria 3005416602 3005421810 181
846 iso_pu_bacteria 3005445848 3005449480 181
847 iso_pu_bacteria 3005452660 3005455808 181
848 iso_pu_bacteria 637000159 637076032 181
849 iso_pu_bacteria 639633055 639650196 181
850 iso_pu_bacteria 643692032 643826876 181
851 iso_pu_bacteria 648276728 648741072 181
852 iso_pu_bacteria 649633066 649871453 181
853 iso_pu_bacteria 650716007 650843227 181
854 iso_pu_bacteria 8002285264 8002290158 181
855 iso_pu_bacteria 8003570095 8003572806 181
856 iso_pu_bacteria 8003992118 8003994721 181
857 iso_pu_bacteria 8003999396 8004002391 181
858 iso_pu_bacteria 8004300914 8004302880 181
859 iso_pu_bacteria 8004312739 8004315481 181
860 iso_pu_bacteria 8004361976 8004366181 181
861 iso_pu_bacteria 8004387939 8004389612 181
862 iso_pu_bacteria 8004395343 8004398626 181
863 iso_pu_bacteria 8004445564 8004449990 181
864 iso_pu_bacteria 8004633249 8004636773 181
865 iso_pu_bacteria 8004640170 8004645464 181
866 iso_pu_bacteria 8004695233 8004697597 181
867 iso_pu_bacteria 8004703790 8004705623 181
868 iso_pu_bacteria 8004714634 8004718009 181
869 iso_pu_bacteria 8004727605 8004730718 181
870 iso_pu_bacteria 8005246636 8005249046 181
871 iso_pu_bacteria 8005258706 8005262831 181
872 iso_pu_bacteria 8005275841 8005282221 181
873 iso_pu_bacteria 8005282627 8005286347 181
874 iso_pu_bacteria 8005289223 8005292182 181
875 iso_pu_bacteria 8005301065 8005302440 181
876 iso_pu_bacteria 8005307578 8005313463 181
877 iso_pu_bacteria 8005314921 8005319490 181
878 iso_pu_bacteria 8005321885 8005325291 181
879 iso_pu_bacteria 8005376324 8005381781 181
880 iso_pu_bacteria 8005382845 8005387964 181
881 iso_pu_bacteria 8005395548 8005401002 181
882 iso_pu_bacteria 8005430974 8005435277 181
883 iso_pu_bacteria 8005460587 8005464814 181
884 iso_pu_bacteria 8005484373 8005490121 181
885 iso_pu_bacteria 8005497431 8005497467 181
886 iso_pu_bacteria 8005542996 8005546469 181
887 iso_pu_bacteria 8005556819 8005560881 181
888 iso_pu_bacteria 8005563573 8005565081 181
889 iso_pu_bacteria 8005570704 8005576743 181
890 iso_pu_bacteria 8005619151 8005623210 181
891 iso_pu_bacteria 8005626139 8005627672 181
892 iso_pu_bacteria 8005645114 8005646778 181
893 iso_pu_bacteria 8005658619 8005660636 181
894 iso_pu_bacteria 8005668836 8005668872 181
895 iso_pu_bacteria 8005682033 8005687639 181
896 iso_pu_bacteria 8005688590 8005691338 181
897 iso_pu_bacteria 8005695170 8005695520 181
898 iso_pu_bacteria 8018127388 8018130726 181
899 iso_pu_bacteria 8018150411 8018154558 181
900 iso_pu_bacteria 8018163183 8018169556 181
901 iso_pu_bacteria 8018176218 8018178295 181
902 iso_pu_bacteria 8023680758 8023686301 181
903 iso_pu_bacteria 8024479707 8024482478 181
904 iso_pu_bacteria 8024486573 8024490661 181
905 iso_pu_bacteria 8024501048 8024504766 181
906 iso_pu_bacteria 8045864390 8045869091 181
907 iso_pu_bacteria 8046767195 8046772769 181
908 iso_pu_bacteria 8049293176 8049295729 181
909 iso_pu_bacteria 8054558443 8054561374 181
910 iso_pu_bacteria 8055431914 8055435745 181
911 iso_pu_bacteria 8056375014 8056379587 181
912 iso_pu_bacteria 8056382006 8056384003 181
913 iso_pu_bacteria 8056875544 8056878084 181
914 iso_pu_bacteria 8057575449 8057581764 181
915 iso_pu_bacteria 8057874678 8057879957 181
916 3300010375 Ga0105239_10247749 Ga0105239_102477493 182
917 iso_pu_bacteria 2643221574 2643883910 182
918 iso_pu_bacteria 2643221699 2644551171 182
919 iso_pu_bacteria 2643221699 2644552434 182
920 iso_pu_bacteria 2891088606 2891089698 182
921 iso_pu_bacteria 2928972540 2928974236 182
922 iso_pu_bacteria 2941485952 2941486342 182
923 iso_pu_bacteria 2977240413 2977243168 182
924 iso_pu_bacteria 8002060224 8002063788 182
925 3300005353 Ga0070669_100409453 Ga0070669_1004094531 183
926 3300005434 Ga0070709_10017337 Ga0070709_100173374 183
927 3300005434 Ga0070709_10084634 Ga0070709_100846342 183
928 3300005435 Ga0070714_100033220 Ga0070714_1000332204 183
929 3300005435 Ga0070714_100386106 Ga0070714_1003861062 183
930 3300005436 Ga0070713_100460638 Ga0070713_1004606382 183
931 3300005436 Ga0070713_100599204 Ga0070713_1005992042 183
932 3300005436 Ga0070713_100905204 Ga0070713_1009052041 183
933 3300005437 Ga0070710_10413748 Ga0070710_104137481 183
934 3300005445 Ga0070708_101662325 Ga0070708_1016623251 183
935 3300005471 Ga0070698_100007183 Ga0070698_10000718313 183
936 3300005471 Ga0070698_100118552 Ga0070698_1001185524 183
937 3300005471 Ga0070698_100571281 Ga0070698_1005712812 183
938 3300005614 Ga0068856_100246144 Ga0068856_1002461442 183
939 3300005844 Ga0068862_100262437 Ga0068862_1002624371 183
940 3300005937 Ga0081455_10000455 Ga0081455_1000045535 183
941 3300005983 Ga0081540_1035798 Ga0081540_10357982 183
942 3300006028 Ga0070717_10002293 Ga0070717_100022933 183
943 3300006048 Ga0075363_100391793 Ga0075363_1003917932 183
944 3300006173 Ga0070716_100390035 Ga0070716_1003900351 183
945 3300006175 Ga0070712_100010231 Ga0070712_1000102312 183
946 3300006175 Ga0070712_100097656 Ga0070712_1000976562 183
947 3300006177 Ga0075362_10102680 Ga0075362_101026802 183
948 3300006871 Ga0075434_100695696 Ga0075434_1006956962 183
949 3300007788 Ga0099795_10026661 Ga0099795_100266612 183
950 3300009093 Ga0105240_10185538 Ga0105240_101855383 183
951 3300009148 Ga0105243_11666717 Ga0105243_116667171 183
952 3300010159 Ga0099796_10026125 Ga0099796_100261252 183
953 3300014497 Ga0182008_10031185 Ga0182008_100311854 183
954 3300021358 Ga0213873_10119079 Ga0213873_101190791 183
955 3300021377 Ga0213874_10240690 Ga0213874_102406901 183
956 3300021384 Ga0213876_10001741 Ga0213876_100017414 183
957 3300025898 Ga0207692_10631129 Ga0207692_106311291 183
958 3300025906 Ga0207699_10046469 Ga0207699_100464692 183
959 3300025906 Ga0207699_10423327 Ga0207699_104233272 183
960 3300025910 Ga0207684_10055486 Ga0207684_100554863 183
961 3300025910 Ga0207684_10534251 Ga0207684_105342511 183
962 3300025913 Ga0207695_10414699 Ga0207695_104146992 183
963 3300025916 Ga0207663_10194392 Ga0207663_101943922 183
964 3300025916 Ga0207663_10349901 Ga0207663_103499012 183
965 3300025927 Ga0207687_10051378 Ga0207687_100513786 183
966 3300025928 Ga0207700_10485354 Ga0207700_104853542 183
967 3300025928 Ga0207700_10896745 Ga0207700_108967451 183
968 3300025929 Ga0207664_10169360 Ga0207664_101693602 183
969 3300025929 Ga0207664_10377512 Ga0207664_103775122 183
970 3300025929 Ga0207664_10707083 Ga0207664_107070831 183
971 3300025939 Ga0207665_10275933 Ga0207665_102759332 183
972 3300028380 Ga0268265_10129874 Ga0268265_101298741 183
973 3300028577 Ga0265318_10000737 Ga0265318_1000073716 183
974 3300028577 Ga0265318_10066028 Ga0265318_100660282 183
975 3300028800 Ga0265338_10165595 Ga0265338_101655951 183
976 3300031238 Ga0265332_10096593 Ga0265332_100965932 183
977 3300031241 Ga0265325_10020012 Ga0265325_100200124 183
978 3300031250 Ga0265331_10302478 Ga0265331_103024781 183
979 3300031344 Ga0265316_10119542 Ga0265316_101195422 183
980 3300031595 Ga0265313_10000338 Ga0265313_1000033841 183
981 3300031595 Ga0265313_10000674 Ga0265313_1000067412 183
982 3300031711 Ga0265314_10004909 Ga0265314_100049092 183
983 3300031711 Ga0265314_10006102 Ga0265314_100061027 183
984 3300031711 Ga0265314_10041875 Ga0265314_100418756 183
985 3300032126 Ga0307415_101107621 Ga0307415_1011076211 183
986 3300037853 Ga0436364_0949431 Ga0436364_0949431_509_1072 183
987 3300039438 Ga0436360_0774037 Ga0436360_0774037_388_951 183
988 3300039447 Ga0436361_0782552 Ga0436361_0782552_390_953 183
989 3300039450 Ga0436363_1639159 Ga0436363_1639159_1427_1990 183
990 3300044673 Ga0453683_0004944 Ga0453683_0004944_7386_7952 183
991 3300044694 Ga0466963_0320928 Ga0466963_0320928_80_643 183
992 3300045051 Ga0451576_0001612 Ga0451576_0001612_19173_19739 183
993 3300049742 Ga0501080_0126220 Ga0501080_0126220_458_1018 183
994 3300050489 nmdc:mga03683_111492_c1 nmdc:mga03683_111492_c1_513_1073 183
995 3300050489 nmdc:mga03683_42799_c1 nmdc:mga03683_42799_c1_683_1243 183
996 iso_pu_bacteria 2937843397 2937845344 183
997 3300005327 Ga0070658_10028401 Ga0070658_100284013 184
998 3300005327 Ga0070658_10073839 Ga0070658_100738394 184
999 3300005335 Ga0070666_10302678 Ga0070666_103026782 184
1000 3300005338 Ga0068868_100115786 Ga0068868_1001157863 184
1001 3300005339 Ga0070660_100016402 Ga0070660_1000164021 184
1002 3300005339 Ga0070660_100038074 Ga0070660_1000380745 184
1003 3300005339 Ga0070660_100166434 Ga0070660_1001664342 184
1004 3300005344 Ga0070661_100000296 Ga0070661_10000029617 184
1005 3300005344 Ga0070661_100012968 Ga0070661_1000129682 184
1006 3300005344 Ga0070661_100024245 Ga0070661_1000242454 184
1007 3300005344 Ga0070661_100107162 Ga0070661_1001071622 184
1008 3300005347 Ga0070668_100013003 Ga0070668_1000130036 184
1009 3300005356 Ga0070674_100018397 Ga0070674_1000183972 184
1010 3300005364 Ga0070673_100057713 Ga0070673_1000577132 184
1011 3300005366 Ga0070659_100035513 Ga0070659_1000355135 184
1012 3300005367 Ga0070667_100033713 Ga0070667_1000337137 184
1013 3300005455 Ga0070663_100112459 Ga0070663_1001124593 184
1014 3300005455 Ga0070663_100142237 Ga0070663_1001422374 184
1015 3300005455 Ga0070663_100219303 Ga0070663_1002193033 184
1016 3300005456 Ga0070678_100274208 Ga0070678_1002742081 184
1017 3300005458 Ga0070681_10174837 Ga0070681_101748373 184
1018 3300005458 Ga0070681_10293492 Ga0070681_102934922 184
1019 3300005458 Ga0070681_10466499 Ga0070681_104664992 184
1020 3300005530 Ga0070679_100280171 Ga0070679_1002801713 184
1021 3300005539 Ga0068853_100001252 Ga0068853_1000012524 184
1022 3300005539 Ga0068853_100005716 Ga0068853_1000057167 184
1023 3300005539 Ga0068853_100031089 Ga0068853_1000310896 184
1024 3300005543 Ga0070672_100076275 Ga0070672_1000762753 184
1025 3300005547 Ga0070693_100089909 Ga0070693_1000899093 184
1026 3300005548 Ga0070665_100032869 Ga0070665_1000328691 184
1027 3300005563 Ga0068855_100060065 Ga0068855_1000600658 184
1028 3300005563 Ga0068855_100108106 Ga0068855_1001081064 184
1029 3300005563 Ga0068855_100389576 Ga0068855_1003895762 184
1030 3300005578 Ga0068854_100005130 Ga0068854_1000051306 184
1031 3300005578 Ga0068854_100043930 Ga0068854_1000439303 184
1032 3300005578 Ga0068854_100440531 Ga0068854_1004405311 184
1033 3300005614 Ga0068856_100026673 Ga0068856_1000266732 184
1034 3300005614 Ga0068856_100162455 Ga0068856_1001624554 184
1035 3300005614 Ga0068856_100348899 Ga0068856_1003488992 184
1036 3300005616 Ga0068852_100047717 Ga0068852_1000477172 184
1037 3300005616 Ga0068852_100092597 Ga0068852_1000925975 184
1038 3300005616 Ga0068852_100259378 Ga0068852_1002593784 184
1039 3300005618 Ga0068864_100570136 Ga0068864_1005701362 184
1040 3300005834 Ga0068851_10016887 Ga0068851_100168873 184
1041 3300005842 Ga0068858_100227085 Ga0068858_1002270852 184
1042 3300006038 Ga0075365_10382480 Ga0075365_103824802 184
1043 3300006042 Ga0075368_10027055 Ga0075368_100270552 184
1044 3300006048 Ga0075363_100049065 Ga0075363_1000490652 184
1045 3300006051 Ga0075364_10047128 Ga0075364_100471283 184
1046 3300006051 Ga0075364_10447909 Ga0075364_104479091 184
1047 3300006177 Ga0075362_10020155 Ga0075362_100201552 184
1048 3300006178 Ga0075367_10087198 Ga0075367_100871982 184
1049 3300006195 Ga0075366_10053986 Ga0075366_100539863 184
1050 3300006353 Ga0075370_10038072 Ga0075370_100380722 184
1051 3300006871 Ga0075434_100087692 Ga0075434_1000876924 184
1052 3300006881 Ga0068865_100423903 Ga0068865_1004239032 184
1053 3300009148 Ga0105243_10450830 Ga0105243_104508302 184
1054 3300009174 Ga0105241_10116885 Ga0105241_101168853 184
1055 3300009174 Ga0105241_10302386 Ga0105241_103023862 184
1056 3300009551 Ga0105238_10056299 Ga0105238_100562997 184
1057 3300009551 Ga0105238_10100900 Ga0105238_101009003 184
1058 3300009551 Ga0105238_10134744 Ga0105238_101347443 184
1059 3300010375 Ga0105239_10190855 Ga0105239_101908553 184
1060 3300013100 Ga0157373_10315789 Ga0157373_103157892 184
1061 3300013102 Ga0157371_10362901 Ga0157371_103629011 184
1062 3300013102 Ga0157371_10467772 Ga0157371_104677722 184
1063 3300013104 Ga0157370_10073529 Ga0157370_100735292 184
1064 3300013104 Ga0157370_10241426 Ga0157370_102414262 184
1065 3300013105 Ga0157369_10068264 Ga0157369_100682644 184
1066 3300013296 Ga0157374_10038063 Ga0157374_100380635 184
1067 3300013307 Ga0157372_10176020 Ga0157372_101760204 184
1068 3300013307 Ga0157372_11201125 Ga0157372_112011252 184
1069 3300025261 Ga0209233_1001986 Ga0209233_10019868 184
1070 3300025297 Ga0209758_1002933 Ga0209758_10029338 184
1071 3300025904 Ga0207647_10032473 Ga0207647_100324734 184
1072 3300025904 Ga0207647_10201441 Ga0207647_102014412 184
1073 3300025907 Ga0207645_10027448 Ga0207645_100274484 184
1074 3300025909 Ga0207705_10001133 Ga0207705_1000113315 184
1075 3300025909 Ga0207705_10079479 Ga0207705_100794794 184
1076 3300025909 Ga0207705_10143375 Ga0207705_101433752 184
1077 3300025909 Ga0207705_10222022 Ga0207705_102220223 184
1078 3300025911 Ga0207654_10227493 Ga0207654_102274932 184
1079 3300025912 Ga0207707_10256007 Ga0207707_102560072 184
1080 3300025912 Ga0207707_10471559 Ga0207707_104715591 184
1081 3300025912 Ga0207707_10483369 Ga0207707_104833692 184
1082 3300025913 Ga0207695_10409873 Ga0207695_104098732 184
1083 3300025914 Ga0207671_10000177 Ga0207671_1000017772 184
1084 3300025914 Ga0207671_10133677 Ga0207671_101336773 184
1085 3300025919 Ga0207657_10006597 Ga0207657_1000659715 184
1086 3300025919 Ga0207657_10012909 Ga0207657_1001290911 184
1087 3300025919 Ga0207657_10125620 Ga0207657_101256203 184
1088 3300025920 Ga0207649_10001157 Ga0207649_1000115721 184
1089 3300025920 Ga0207649_10100278 Ga0207649_101002782 184
1090 3300025920 Ga0207649_10210782 Ga0207649_102107822 184
1091 3300025921 Ga0207652_10477491 Ga0207652_104774911 184
1092 3300025924 Ga0207694_10351430 Ga0207694_103514301 184
1093 3300025924 Ga0207694_10885412 Ga0207694_108854121 184
1094 3300025926 Ga0207659_10392284 Ga0207659_103922842 184
1095 3300025927 Ga0207687_10563238 Ga0207687_105632382 184
1096 3300025927 Ga0207687_10719552 Ga0207687_107195521 184
1097 3300025932 Ga0207690_10079684 Ga0207690_100796843 184
1098 3300025932 Ga0207690_10258408 Ga0207690_102584082 184
1099 3300025933 Ga0207706_10019600 Ga0207706_100196009 184
1100 3300025935 Ga0207709_10466523 Ga0207709_104665232 184
1101 3300025937 Ga0207669_10065440 Ga0207669_100654403 184
1102 3300025938 Ga0207704_10652192 Ga0207704_106521922 184
1103 3300025940 Ga0207691_10081034 Ga0207691_100810342 184
1104 3300025944 Ga0207661_10267073 Ga0207661_102670732 184
1105 3300025949 Ga0207667_10016808 Ga0207667_1001680812 184
1106 3300025949 Ga0207667_10071271 Ga0207667_100712713 184
1107 3300025949 Ga0207667_10134484 Ga0207667_101344842 184
1108 3300025949 Ga0207667_10380655 Ga0207667_103806553 184
1109 3300025972 Ga0207668_10007643 Ga0207668_100076435 184
1110 3300025981 Ga0207640_10082243 Ga0207640_100822432 184
1111 3300025981 Ga0207640_10562269 Ga0207640_105622692 184
1112 3300025986 Ga0207658_10349383 Ga0207658_103493832 184
1113 3300026023 Ga0207677_10329860 Ga0207677_103298602 184
1114 3300026023 Ga0207677_10643058 Ga0207677_106430581 184
1115 3300026041 Ga0207639_10000849 Ga0207639_1000084920 184
1116 3300026041 Ga0207639_10001693 Ga0207639_1000169315 184
1117 3300026041 Ga0207639_10215902 Ga0207639_102159022 184
1118 3300026067 Ga0207678_10126030 Ga0207678_101260303 184
1119 3300026067 Ga0207678_10214409 Ga0207678_102144093 184
1120 3300026078 Ga0207702_10012990 Ga0207702_100129907 184
1121 3300026078 Ga0207702_10100471 Ga0207702_101004714 184
1122 3300026078 Ga0207702_10220251 Ga0207702_102202513 184
1123 3300026078 Ga0207702_10704290 Ga0207702_107042901 184
1124 3300026089 Ga0207648_10128230 Ga0207648_101282303 184
1125 3300026095 Ga0207676_10575492 Ga0207676_105754921 184
1126 3300026116 Ga0207674_10097480 Ga0207674_100974802 184
1127 3300026116 Ga0207674_10586338 Ga0207674_105863381 184
1128 3300026142 Ga0207698_10094689 Ga0207698_100946892 184
1129 3300026142 Ga0207698_10168960 Ga0207698_101689602 184
1130 3300026142 Ga0207698_10391489 Ga0207698_103914892 184
1131 3300027665 Ga0209983_1012619 Ga0209983_10126192 184
1132 3300028379 Ga0268266_10002019 Ga0268266_1000201914 184
1133 3300028379 Ga0268266_10272937 Ga0268266_102729371 184
1134 3300028577 Ga0265318_10066634 Ga0265318_100666342 184
1135 3300028800 Ga0265338_10063693 Ga0265338_100636931 184
1136 3300031235 Ga0265330_10077890 Ga0265330_100778902 184
1137 3300031238 Ga0265332_10054513 Ga0265332_100545132 184
1138 3300031238 Ga0265332_10081345 Ga0265332_100813452 184
1139 3300031240 Ga0265320_10126179 Ga0265320_101261792 184
1140 3300031242 Ga0265329_10021873 Ga0265329_100218732 184
1141 3300031249 Ga0265339_10001557 Ga0265339_1000155719 184
1142 3300031251 Ga0265327_10039122 Ga0265327_100391223 184
1143 3300031344 Ga0265316_10035031 Ga0265316_100350316 184
1144 3300031548 Ga0307408_101038673 Ga0307408_1010386731 184
1145 3300031595 Ga0265313_10000070 Ga0265313_1000007010 184
1146 3300031711 Ga0265314_10163664 Ga0265314_101636642 184
1147 3300031711 Ga0265314_10182865 Ga0265314_101828652 184
1148 3300031712 Ga0265342_10027030 Ga0265342_100270304 184
1149 3300031731 Ga0307405_10352710 Ga0307405_103527102 184
1150 3300031824 Ga0307413_10255722 Ga0307413_102557222 184
1151 3300031852 Ga0307410_10181904 Ga0307410_101819042 184
1152 3300031901 Ga0307406_10077862 Ga0307406_100778624 184
1153 3300031903 Ga0307407_10463425 Ga0307407_104634252 184
1154 3300031911 Ga0307412_10074549 Ga0307412_100745492 184
1155 3300031911 Ga0307412_10209352 Ga0307412_102093523 184
1156 3300031911 Ga0307412_10791937 Ga0307412_107919371 184
1157 3300031995 Ga0307409_100281060 Ga0307409_1002810602 184
1158 3300031995 Ga0307409_100677931 Ga0307409_1006779312 184
1159 3300032002 Ga0307416_100908663 Ga0307416_1009086632 184
1160 3300032004 Ga0307414_10010459 Ga0307414_100104595 184
1161 3300032004 Ga0307414_10043568 Ga0307414_100435684 184
1162 3300032004 Ga0307414_10224309 Ga0307414_102243091 184
1163 3300032004 Ga0307414_10707404 Ga0307414_107074042 184
1164 3300032004 Ga0307414_11005870 Ga0307414_110058701 184
1165 3300035241 Ga0373961_0292471 Ga0373961_0292471_26_583 184
1166 3300035398 Ga0316574_0001388 Ga0316574_0001388_7695_8255 184
1167 3300035691 Ga0373931_0066210 Ga0373931_0066210_20_577 184
1168 3300037312 Ga0395899_0161351 Ga0395899_0161351_279_836 184
1169 3300037418 Ga0395900_0027014 Ga0395900_0027014_2434_2991 184
1170 3300037418 Ga0395900_0999442 Ga0395900_0999442_157_714 184
1171 3300037466 Ga0395898_0080973 Ga0395898_0080973_1916_2473 184
1172 3300037466 Ga0395898_0952062 Ga0395898_0952062_68_625 184
1173 3300038443 Ga0395901_0007729 Ga0395901_0007729_3749_4306 184
1174 3300038443 Ga0395901_0178429 Ga0395901_0178429_68_625 184
1175 3300041512 Ga0451853_0990214 Ga0451853_0990214_306_863 184
1176 3300042531 Ga0450918_065565 Ga0450918_065565_13_570 184
1177 3300045976 Ga0466967_0585332 Ga0466967_0585332_451_1008 184
1178 3300046462 Ga0495651_0170179 Ga0495651_0170179_358_963 184
1179 3300046529 Ga0495652_0306511 Ga0495652_0306511_266_844 184
1180 3300048913 Ga0496110_0453094 Ga0496110_0453094_297_854 184
1181 3300048919 Ga0496116_0043619 Ga0496116_0043619_2371_2928 184
1182 3300048926 Ga0496123_0350005 Ga0496123_0350005_84_641 184
1183 3300048927 Ga0496124_0066058 Ga0496124_0066058_763_1320 184
1184 3300048928 Ga0496125_0000585 Ga0496125_0000585_59745_60302 184
1185 3300048929 Ga0496126_0034256 Ga0496126_0034256_263_820 184
1186 3300048929 Ga0496126_0034848 Ga0496126_0034848_3033_3590 184
1187 3300049568 Ga0501031_0441093 Ga0501031_0441093_113_670 184
1188 3300049569 Ga0501032_0239270 Ga0501032_0239270_545_1117 184
1189 3300049570 Ga0501033_0032234 Ga0501033_0032234_3296_3868 184
1190 3300049570 Ga0501033_0456584 Ga0501033_0456584_294_851 184
1191 3300049571 Ga0501034_0001360 Ga0501034_0001360_18638_19195 184
1192 3300049571 Ga0501034_0960610 Ga0501034_0960610_103_660 184
1193 3300049572 Ga0501036_0290662 Ga0501036_0290662_214_786 184
1194 3300049573 Ga0501037_0322396 Ga0501037_0322396_308_880 184
1195 3300049573 Ga0501037_0402663 Ga0501037_0402663_170_727 184
1196 3300049575 Ga0501039_0143435 Ga0501039_0143435_805_1377 184
1197 3300049579 Ga0501043_0354325 Ga0501043_0354325_308_880 184
1198 3300049581 Ga0501047_0139999 Ga0501047_0139999_933_1505 184
1199 3300049582 Ga0501048_0202630 Ga0501048_0202630_129_701 184
1200 3300049590 Ga0501074_0444228 Ga0501074_0444228_272_844 184
1201 3300049742 Ga0501080_0051297 Ga0501080_0051297_2875_3447 184
1202 3300049822 Ga0501035_0559839 Ga0501035_0559839_56_628 184
1203 3300053083 Ga0495655_0142832 Ga0495655_0142832_38_595 184
1204 3300053119 Ga0500595_043033 Ga0500595_043033_58_615 184
1205 3300053151 Ga0500604_0000343 Ga0500604_0000343_9912_10469 184
1206 3300053153 Ga0500616_0033355 Ga0500616_0033355_702_1259 184
1207 3300053161 Ga0500634_0000017 Ga0500634_0000017_87226_87783 184
1208 3300059640 Ga0587067_105934 Ga0587067_105934_13_570 184
1209 2010549000 RicEn_C103 RicEn_01990 185
1210 3300001979 JGI24740J21852_10019185 JGI24740J21852_100191853 185
1211 3300001989 JGI24739J22299_10005006 JGI24739J22299_100050066 185
1212 3300001989 JGI24739J22299_10086897 JGI24739J22299_100868971 185
1213 3300002067 JGI24735J21928_10031234 JGI24735J21928_100312342 185
1214 3300002704 JGI25155J39150_1000010 JGI25155J39150_1000010174 185
1215 3300002705 JGI25156J39149_1000033 JGI25156J39149_10000339 185
1216 3300002705 JGI25156J39149_1000186 JGI25156J39149_100018635 185
1217 3300002705 JGI25156J39149_1020859 JGI25156J39149_10208591 185
1218 3300002737 JGI25162J39368_1000413 JGI25162J39368_10004138 185
1219 3300002738 JGI25154J39366_1000187 JGI25154J39366_100018711 185
1220 3300002741 JGI25157J39369_1000009 JGI25157J39369_1000009173 185
1221 3300002741 JGI25157J39369_1001145 JGI25157J39369_10011452 185
1222 3300002773 JGI25152J39213_1002996 JGI25152J39213_10029967 185
1223 3300002773 JGI25152J39213_1003625 JGI25152J39213_10036252 185
1224 3300002774 JGI25150J39212_1000061 JGI25150J39212_100006144 185
1225 3300002774 JGI25150J39212_1008264 JGI25150J39212_10082641 185
1226 3300002987 JGI25159J45721_1000095 JGI25159J45721_100009534 185
1227 3300002987 JGI25159J45721_1001470 JGI25159J45721_10014709 185
1228 3300003187 JGI25151J46595_10000081 JGI25151J46595_1000008191 185
1229 3300003187 JGI25151J46595_10004446 JGI25151J46595_1000444610 185
1230 3300003187 JGI25151J46595_10006138 JGI25151J46595_100061382 185
1231 3300003187 JGI25151J46595_10019526 JGI25151J46595_100195263 185
1232 3300003187 JGI25151J46595_10097824 JGI25151J46595_100978241 185
1233 3300003203 JGI25406J46586_10032295 JGI25406J46586_100322952 185
1234 3300003214 JGI25165J46597_1000310 JGI25165J46597_100031051 185
1235 3300003214 JGI25165J46597_1000560 JGI25165J46597_100056033 185
1236 3300003214 JGI25165J46597_1001161 JGI25165J46597_10011612 185
1237 3300003215 JGI25153J46596_10002363 JGI25153J46596_100023639 185
1238 3300003215 JGI25153J46596_10002751 JGI25153J46596_100027517 185
1239 3300003215 JGI25153J46596_10031226 JGI25153J46596_100312262 185
1240 3300003215 JGI25153J46596_10081950 JGI25153J46596_100819501 185
1241 3300003354 JGI25160J50197_1000085 JGI25160J50197_100008547 185
1242 3300003354 JGI25160J50197_1000247 JGI25160J50197_100024734 185
1243 3300003354 JGI25160J50197_1003745 JGI25160J50197_10037458 185
1244 3300003354 JGI25160J50197_1006221 JGI25160J50197_10062216 185
1245 3300003354 JGI25160J50197_1022172 JGI25160J50197_10221722 185
1246 3300003374 JGI25161J50226_1000065 JGI25161J50226_100006547 185
1247 3300003374 JGI25161J50226_1000136 JGI25161J50226_100013628 185
1248 3300003374 JGI25161J50226_1000853 JGI25161J50226_10008536 185
1249 3300003374 JGI25161J50226_1003104 JGI25161J50226_10031045 185
1250 3300003578 Ga0006562J51391_1055964 Ga0006562J51391_10559648 185
1251 3300003578 Ga0006562J51391_1055965 Ga0006562J51391_10559654 185
1252 3300003762 Ga0055542_1000373 Ga0055542_10003736 185
1253 3300003763 Ga0055529_1003026 Ga0055529_10030264 185
1254 3300003771 Ga0055526_1006261 Ga0055526_10062611 185
1255 3300003771 Ga0055526_1007490 Ga0055526_10074904 185
1256 3300003771 Ga0055526_1008265 Ga0055526_10082657 185
1257 3300003771 Ga0055526_1010341 Ga0055526_10103411 185
1258 3300003771 Ga0055526_1012355 Ga0055526_10123553 185
1259 3300003775 Ga0055524_1001281 Ga0055524_10012812 185
1260 3300003775 Ga0055524_1003268 Ga0055524_10032688 185
1261 3300003775 Ga0055524_1009629 Ga0055524_10096292 185
1262 3300003775 Ga0055524_1025110 Ga0055524_10251103 185
1263 3300003781 Ga0055536_1001218 Ga0055536_100121811 185
1264 3300003781 Ga0055536_1001688 Ga0055536_100168811 185
1265 3300003781 Ga0055536_1003846 Ga0055536_10038464 185
1266 3300003790 Ga0055528_1002915 Ga0055528_100291510 185
1267 3300003790 Ga0055528_1010563 Ga0055528_10105634 185
1268 3300003790 Ga0055528_1023567 Ga0055528_10235673 185
1269 3300003791 Ga0055530_10016258 Ga0055530_100162582 185
1270 3300003792 Ga0055540_1000789 Ga0055540_100078915 185
1271 3300003792 Ga0055540_1009670 Ga0055540_10096703 185
1272 3300003792 Ga0055540_1009673 Ga0055540_10096733 185
1273 3300003792 Ga0055540_1037182 Ga0055540_10371821 185
1274 3300003792 Ga0055540_1048437 Ga0055540_10484372 185
1275 3300003794 Ga0055531_10004531 Ga0055531_100045314 185
1276 3300003794 Ga0055531_10011999 Ga0055531_100119995 185
1277 3300003794 Ga0055531_10058681 Ga0055531_100586812 185
1278 3300003856 Ga0058692_1005178 Ga0058692_10051782 185
1279 3300003856 Ga0058692_1006935 Ga0058692_10069352 185
1280 3300004625 Ga0055543_1000067 Ga0055543_100006746 185
1281 3300004625 Ga0055543_1000228 Ga0055543_100022837 185
1282 3300004625 Ga0055543_1000496 Ga0055543_100049619 185
1283 3300004625 Ga0055543_1001108 Ga0055543_10011089 185
1284 3300005262 Ga0065165_1000237 Ga0065165_100023758 185
1285 3300005262 Ga0065165_1000804 Ga0065165_100080434 185
1286 3300005262 Ga0065165_1007131 Ga0065165_10071315 185
1287 3300005262 Ga0065165_1008692 Ga0065165_10086926 185
1288 3300005293 Ga0065715_10502147 Ga0065715_105021471 185
1289 3300005331 Ga0070670_100000117 Ga0070670_10000011741 185
1290 3300005331 Ga0070670_100501705 Ga0070670_1005017052 185
1291 3300005337 Ga0070682_100157304 Ga0070682_1001573042 185
1292 3300005339 Ga0070660_100526988 Ga0070660_1005269881 185
1293 3300005347 Ga0070668_100027637 Ga0070668_1000276372 185
1294 3300005353 Ga0070669_100008498 Ga0070669_1000084985 185
1295 3300005353 Ga0070669_100675388 Ga0070669_1006753881 185
1296 3300005355 Ga0070671_100016041 Ga0070671_1000160416 185
1297 3300005356 Ga0070674_100237318 Ga0070674_1002373182 185
1298 3300005356 Ga0070674_101220888 Ga0070674_1012208881 185
1299 3300005366 Ga0070659_100197099 Ga0070659_1001970991 185
1300 3300005366 Ga0070659_100256634 Ga0070659_1002566341 185
1301 3300005435 Ga0070714_100966881 Ga0070714_1009668812 185
1302 3300005441 Ga0070700_100432498 Ga0070700_1004324981 185
1303 3300005455 Ga0070663_100193263 Ga0070663_1001932632 185
1304 3300005456 Ga0070678_100857650 Ga0070678_1008576501 185
1305 3300005457 Ga0070662_100573401 Ga0070662_1005734011 185
1306 3300005457 Ga0070662_100942425 Ga0070662_1009424251 185
1307 3300005539 Ga0068853_100563317 Ga0068853_1005633172 185
1308 3300005548 Ga0070665_100005352 Ga0070665_1000053526 185
1309 3300005548 Ga0070665_100015576 Ga0070665_1000155767 185
1310 3300005548 Ga0070665_100177540 Ga0070665_1001775401 185
1311 3300005548 Ga0070665_100300247 Ga0070665_1003002472 185
1312 3300005548 Ga0070665_100336560 Ga0070665_1003365602 185
1313 3300005548 Ga0070665_100457868 Ga0070665_1004578682 185
1314 3300005549 Ga0070704_100407133 Ga0070704_1004071332 185
1315 3300005563 Ga0068855_100264287 Ga0068855_1002642872 185
1316 3300005577 Ga0068857_100346296 Ga0068857_1003462961 185
1317 3300005578 Ga0068854_100241213 Ga0068854_1002412132 185
1318 3300005614 Ga0068856_100639003 Ga0068856_1006390032 185
1319 3300005614 Ga0068856_100723633 Ga0068856_1007236331 185
1320 3300005615 Ga0070702_100499621 Ga0070702_1004996212 185
1321 3300005616 Ga0068852_100060673 Ga0068852_1000606733 185
1322 3300005834 Ga0068851_10111015 Ga0068851_101110152 185
1323 3300005840 Ga0068870_10298444 Ga0068870_102984442 185
1324 3300005937 Ga0081455_10311331 Ga0081455_103113312 185
1325 3300005983 Ga0081540_1029085 Ga0081540_10290852 185
1326 3300005985 Ga0081539_10002004 Ga0081539_100020045 185
1327 3300006038 Ga0075365_10004176 Ga0075365_100041764 185
1328 3300006038 Ga0075365_10006633 Ga0075365_100066335 185
1329 3300006038 Ga0075365_10011265 Ga0075365_100112654 185
1330 3300006038 Ga0075365_10023551 Ga0075365_100235516 185
1331 3300006038 Ga0075365_10052752 Ga0075365_100527522 185
1332 3300006038 Ga0075365_10288533 Ga0075365_102885332 185
1333 3300006042 Ga0075368_10005353 Ga0075368_100053531 185
1334 3300006042 Ga0075368_10035760 Ga0075368_100357603 185
1335 3300006048 Ga0075363_100089591 Ga0075363_1000895912 185
1336 3300006048 Ga0075363_100094838 Ga0075363_1000948381 185
1337 3300006048 Ga0075363_100120761 Ga0075363_1001207612 185
1338 3300006051 Ga0075364_10000157 Ga0075364_1000015743 185
1339 3300006051 Ga0075364_10003611 Ga0075364_1000361111 185
1340 3300006051 Ga0075364_10010836 Ga0075364_100108365 185
1341 3300006051 Ga0075364_10149669 Ga0075364_101496692 185
1342 3300006177 Ga0075362_10000293 Ga0075362_1000029311 185
1343 3300006177 Ga0075362_10006767 Ga0075362_100067676 185
1344 3300006177 Ga0075362_10007354 Ga0075362_100073543 185
1345 3300006177 Ga0075362_10060453 Ga0075362_100604532 185
1346 3300006177 Ga0075362_10355401 Ga0075362_103554012 185
1347 3300006178 Ga0075367_10001300 Ga0075367_100013009 185
1348 3300006178 Ga0075367_10001485 Ga0075367_100014859 185
1349 3300006178 Ga0075367_10031249 Ga0075367_100312492 185
1350 3300006178 Ga0075367_10074556 Ga0075367_100745562 185
1351 3300006178 Ga0075367_10183797 Ga0075367_101837972 185
1352 3300006178 Ga0075367_10248519 Ga0075367_102485192 185
1353 3300006178 Ga0075367_10302709 Ga0075367_103027091 185
1354 3300006178 Ga0075367_10307118 Ga0075367_103071182 185
1355 3300006178 Ga0075367_10622784 Ga0075367_106227841 185
1356 3300006186 Ga0075369_10000770 Ga0075369_100007709 185
1357 3300006186 Ga0075369_10097842 Ga0075369_100978422 185
1358 3300006186 Ga0075369_10225645 Ga0075369_102256452 185
1359 3300006195 Ga0075366_10067308 Ga0075366_100673082 185
1360 3300006195 Ga0075366_10084259 Ga0075366_100842593 185
1361 3300006195 Ga0075366_10245143 Ga0075366_102451432 185
1362 3300006353 Ga0075370_10011674 Ga0075370_100116743 185
1363 3300006353 Ga0075370_10018590 Ga0075370_100185903 185
1364 3300006353 Ga0075370_10085817 Ga0075370_100858172 185
1365 3300006353 Ga0075370_10112335 Ga0075370_101123352 185
1366 3300006353 Ga0075370_10437222 Ga0075370_104372221 185
1367 3300006353 Ga0075370_10480422 Ga0075370_104804222 185
1368 3300006946 Ga0079104_1000101 Ga0079104_100010126 185
1369 3300006946 Ga0079104_1003469 Ga0079104_10034693 185
1370 3300006948 Ga0099826_10000025 Ga0099826_1000002540 185
1371 3300006948 Ga0099826_10119128 Ga0099826_101191282 185
1372 3300009036 Ga0105244_10056525 Ga0105244_100565252 185
1373 3300009093 Ga0105240_10394474 Ga0105240_103944742 185
1374 3300009093 Ga0105240_10522780 Ga0105240_105227802 185
1375 3300009093 Ga0105240_10593790 Ga0105240_105937902 185
1376 3300009098 Ga0105245_11239150 Ga0105245_112391502 185
1377 3300009098 Ga0105245_11874825 Ga0105245_118748251 185
1378 3300009148 Ga0105243_10024593 Ga0105243_100245936 185
1379 3300009148 Ga0105243_10547021 Ga0105243_105470212 185
1380 3300009174 Ga0105241_10288863 Ga0105241_102888632 185
1381 3300009177 Ga0105248_10689207 Ga0105248_106892071 185
1382 3300009545 Ga0105237_10357992 Ga0105237_103579922 185
1383 3300009553 Ga0105249_10843282 Ga0105249_108432822 185
1384 3300009553 Ga0105249_10909470 Ga0105249_109094702 185
1385 3300009765 Ga0123341_1000187 Ga0123341_100018729 185
1386 3300009765 Ga0123341_1107456 Ga0123341_11074562 185
1387 3300009766 Ga0123342_1010657 Ga0123342_10106579 185
1388 3300009766 Ga0123342_1021786 Ga0123342_10217865 185
1389 3300010375 Ga0105239_11501822 Ga0105239_115018221 185
1390 3300010375 Ga0105239_12099761 Ga0105239_120997611 185
1391 3300011119 Ga0105246_10507415 Ga0105246_105074152 185
1392 3300011119 Ga0105246_10992854 Ga0105246_109928541 185
1393 3300011119 Ga0105246_11143753 Ga0105246_111437531 185
1394 3300012500 Ga0157314_1003929 Ga0157314_10039291 185
1395 3300012503 Ga0157313_1001120 Ga0157313_10011202 185
1396 3300013100 Ga0157373_10000538 Ga0157373_100005389 185
1397 3300013100 Ga0157373_10414892 Ga0157373_104148922 185
1398 3300013102 Ga0157371_10000002 Ga0157371_10000002242 185
1399 3300013102 Ga0157371_10051193 Ga0157371_100511933 185
1400 3300013104 Ga0157370_10001468 Ga0157370_1000146822 185
1401 3300013104 Ga0157370_10002446 Ga0157370_1000244620 185
1402 3300013105 Ga0157369_10054796 Ga0157369_100547964 185
1403 3300013105 Ga0157369_10431985 Ga0157369_104319852 185
1404 3300013306 Ga0163162_10831721 Ga0163162_108317212 185
1405 3300013307 Ga0157372_10977776 Ga0157372_109777761 185
1406 3300014326 Ga0157380_10446605 Ga0157380_104466052 185
1407 3300014968 Ga0157379_10806308 Ga0157379_108063082 185
1408 3300014968 Ga0157379_11103406 Ga0157379_111034061 185
1409 3300015261 Ga0182006_1070635 Ga0182006_10706351 185
1410 3300015690 Ga0183363_1270 Ga0183363_12705 185
1411 3300017792 Ga0163161_10025594 Ga0163161_100255946 185
1412 3300017792 Ga0163161_10575580 Ga0163161_105755802 185
1413 3300017792 Ga0163161_10594470 Ga0163161_105944702 185
1414 3300021320 Ga0214544_1000132 Ga0214544_100013277 185
1415 3300021321 Ga0214542_1004982 Ga0214542_100498223 185
1416 3300021321 Ga0214542_1027376 Ga0214542_10273764 185
1417 3300021327 Ga0214543_1000008 Ga0214543_100000824 185
1418 3300021327 Ga0214543_1000102 Ga0214543_100010229 185
1419 3300021377 Ga0213874_10017735 Ga0213874_100177351 185
1420 3300021384 Ga0213876_10000074 Ga0213876_1000007483 185
1421 3300022739 Ga0228711_1000022 Ga0228711_100002229 185
1422 3300022740 Ga0228710_1000028 Ga0228710_100002829 185
1423 3300025206 Ga0209435_100009 Ga0209435_100009430 185
1424 3300025207 Ga0209760_100811 Ga0209760_1008114 185
1425 3300025208 Ga0209436_100089 Ga0209436_10008936 185
1426 3300025208 Ga0209436_100658 Ga0209436_10065810 185
1427 3300025208 Ga0209436_104215 Ga0209436_1042152 185
1428 3300025233 Ga0209437_100057 Ga0209437_10005737 185
1429 3300025233 Ga0209437_100902 Ga0209437_1009028 185
1430 3300025245 Ga0207425_1000034 Ga0207425_1000034135 185
1431 3300025245 Ga0207425_1001593 Ga0207425_10015934 185
1432 3300025245 Ga0207425_1004102 Ga0207425_10041024 185
1433 3300025245 Ga0207425_1019678 Ga0207425_10196783 185
1434 3300025245 Ga0207425_1043848 Ga0207425_10438481 185
1435 3300025246 Ga0209646_1000018 Ga0209646_1000018430 185
1436 3300025246 Ga0209646_1012231 Ga0209646_10122311 185
1437 3300025250 Ga0209026_1000068 Ga0209026_1000068172 185
1438 3300025250 Ga0209026_1000228 Ga0209026_100022829 185
1439 3300025254 Ga0209148_1000069 Ga0209148_1000069244 185
1440 3300025254 Ga0209148_1007004 Ga0209148_10070043 185
1441 3300025254 Ga0209148_1021821 Ga0209148_10218211 185
1442 3300025256 Ga0209759_1000007 Ga0209759_1000007430 185
1443 3300025256 Ga0209759_1000183 Ga0209759_100018315 185
1444 3300025258 Ga0209129_1000094 Ga0209129_100009480 185
1445 3300025258 Ga0209129_1000290 Ga0209129_100029042 185
1446 3300025258 Ga0209129_1000519 Ga0209129_10005199 185
1447 3300025258 Ga0209129_1002114 Ga0209129_10021147 185
1448 3300025258 Ga0209129_1003585 Ga0209129_10035854 185
1449 3300025258 Ga0209129_1003749 Ga0209129_10037496 185
1450 3300025258 Ga0209129_1004237 Ga0209129_10042374 185
1451 3300025261 Ga0209233_1000030 Ga0209233_1000030594 185
1452 3300025261 Ga0209233_1000134 Ga0209233_100013437 185
1453 3300025261 Ga0209233_1000343 Ga0209233_100034338 185
1454 3300025261 Ga0209233_1016673 Ga0209233_10166731 185
1455 3300025263 Ga0209565_1016275 Ga0209565_10162752 185
1456 3300025272 Ga0209455_1000317 Ga0209455_100031744 185
1457 3300025273 Ga0209673_1000158 Ga0209673_100015899 185
1458 3300025273 Ga0209673_1000283 Ga0209673_100028367 185
1459 3300025273 Ga0209673_1000771 Ga0209673_100077135 185
1460 3300025273 Ga0209673_1001504 Ga0209673_100150416 185
1461 3300025273 Ga0209673_1003477 Ga0209673_10034778 185
1462 3300025273 Ga0209673_1003564 Ga0209673_100356412 185
1463 3300025273 Ga0209673_1003775 Ga0209673_10037758 185
1464 3300025273 Ga0209673_1004667 Ga0209673_10046675 185
1465 3300025284 Ga0209130_1000009 Ga0209130_1000009446 185
1466 3300025284 Ga0209130_1000265 Ga0209130_100026546 185
1467 3300025284 Ga0209130_1000465 Ga0209130_10004659 185
1468 3300025284 Ga0209130_1015015 Ga0209130_10150152 185
1469 3300025284 Ga0209130_1041671 Ga0209130_10416712 185
1470 3300025291 Ga0209675_1038367 Ga0209675_10383672 185
1471 3300025292 Ga0209676_1000038 Ga0209676_1000038291 185
1472 3300025292 Ga0209676_1000539 Ga0209676_10005393 185
1473 3300025292 Ga0209676_1010592 Ga0209676_10105922 185
1474 3300025292 Ga0209676_1021463 Ga0209676_10214633 185
1475 3300025292 Ga0209676_1024037 Ga0209676_10240372 185
1476 3300025292 Ga0209676_1035340 Ga0209676_10353401 185
1477 3300025294 Ga0209025_1000184 Ga0209025_100018490 185
1478 3300025294 Ga0209025_1000245 Ga0209025_100024582 185
1479 3300025294 Ga0209025_1000581 Ga0209025_100058151 185
1480 3300025294 Ga0209025_1000725 Ga0209025_100072532 185
1481 3300025294 Ga0209025_1002093 Ga0209025_100209312 185
1482 3300025294 Ga0209025_1003260 Ga0209025_10032609 185
1483 3300025294 Ga0209025_1012441 Ga0209025_10124415 185
1484 3300025294 Ga0209025_1057164 Ga0209025_10571642 185
1485 3300025295 Ga0209564_1000381 Ga0209564_100038150 185
1486 3300025295 Ga0209564_1000960 Ga0209564_10009609 185
1487 3300025295 Ga0209564_1003061 Ga0209564_10030619 185
1488 3300025295 Ga0209564_1003163 Ga0209564_10031639 185
1489 3300025295 Ga0209564_1010609 Ga0209564_10106093 185
1490 3300025297 Ga0209758_1000159 Ga0209758_100015990 185
1491 3300025297 Ga0209758_1000265 Ga0209758_1000265100 185
1492 3300025297 Ga0209758_1000462 Ga0209758_100046215 185
1493 3300025297 Ga0209758_1001526 Ga0209758_100152626 185
1494 3300025297 Ga0209758_1002391 Ga0209758_10023916 185
1495 3300025297 Ga0209758_1002525 Ga0209758_100252513 185
1496 3300025297 Ga0209758_1008637 Ga0209758_10086377 185
1497 3300025297 Ga0209758_1028509 Ga0209758_10285093 185
1498 3300025298 Ga0209050_1004927 Ga0209050_10049278 185
1499 3300025298 Ga0209050_1006083 Ga0209050_100608310 185
1500 3300025298 Ga0209050_1007118 Ga0209050_10071182 185
1501 3300025298 Ga0209050_1008284 Ga0209050_10082844 185
1502 3300025299 Ga0209256_1000440 Ga0209256_100044040 185
1503 3300025299 Ga0209256_1000892 Ga0209256_100089231 185
1504 3300025299 Ga0209256_1001107 Ga0209256_100110727 185
1505 3300025299 Ga0209256_1006273 Ga0209256_10062732 185
1506 3300025299 Ga0209256_1014284 Ga0209256_10142842 185
1507 3300025302 Ga0207426_1000041 Ga0207426_1000041384 185
1508 3300025302 Ga0207426_1000048 Ga0207426_100004833 185
1509 3300025302 Ga0207426_1000309 Ga0207426_100030958 185
1510 3300025302 Ga0207426_1000646 Ga0207426_10006469 185
1511 3300025302 Ga0207426_1003476 Ga0207426_10034769 185
1512 3300025303 Ga0209051_1001304 Ga0209051_100130415 185
1513 3300025303 Ga0209051_1002360 Ga0209051_100236010 185
1514 3300025303 Ga0209051_1002835 Ga0209051_10028358 185
1515 3300025303 Ga0209051_1004388 Ga0209051_10043885 185
1516 3300025303 Ga0209051_1004410 Ga0209051_10044102 185
1517 3300025303 Ga0209051_1054500 Ga0209051_10545002 185
1518 3300025303 Ga0209051_1101445 Ga0209051_11014452 185
1519 3300025304 Ga0209257_1000060 Ga0209257_100006011 185
1520 3300025304 Ga0209257_1001125 Ga0209257_10011254 185
1521 3300025304 Ga0209257_1006305 Ga0209257_100630510 185
1522 3300025304 Ga0209257_1007702 Ga0209257_10077029 185
1523 3300025304 Ga0209257_1031615 Ga0209257_10316151 185
1524 3300025304 Ga0209257_1063100 Ga0209257_10631002 185
1525 3300025735 Ga0207713_1071064 Ga0207713_10710642 185
1526 3300025900 Ga0207710_10154357 Ga0207710_101543572 185
1527 3300025901 Ga0207688_10279851 Ga0207688_102798511 185
1528 3300025903 Ga0207680_10281379 Ga0207680_102813791 185
1529 3300025904 Ga0207647_10053199 Ga0207647_100531993 185
1530 3300025904 Ga0207647_10118430 Ga0207647_101184302 185
1531 3300025909 Ga0207705_10085130 Ga0207705_100851302 185
1532 3300025911 Ga0207654_10608385 Ga0207654_106083851 185
1533 3300025913 Ga0207695_10543581 Ga0207695_105435811 185
1534 3300025913 Ga0207695_10854070 Ga0207695_108540701 185
1535 3300025914 Ga0207671_10095065 Ga0207671_100950653 185
1536 3300025914 Ga0207671_10206144 Ga0207671_102061442 185
1537 3300025919 Ga0207657_10131743 Ga0207657_101317431 185
1538 3300025923 Ga0207681_10117602 Ga0207681_101176023 185
1539 3300025923 Ga0207681_10419238 Ga0207681_104192381 185
1540 3300025925 Ga0207650_10000206 Ga0207650_1000020654 185
1541 3300025927 Ga0207687_10417212 Ga0207687_104172122 185
1542 3300025931 Ga0207644_10060751 Ga0207644_100607514 185
1543 3300025932 Ga0207690_10133448 Ga0207690_101334483 185
1544 3300025932 Ga0207690_10150289 Ga0207690_101502891 185
1545 3300025936 Ga0207670_10919524 Ga0207670_109195241 185
1546 3300025938 Ga0207704_11141340 Ga0207704_111413401 185
1547 3300025941 Ga0207711_10048402 Ga0207711_100484024 185
1548 3300025949 Ga0207667_10203312 Ga0207667_102033122 185
1549 3300025961 Ga0207712_10475390 Ga0207712_104753901 185
1550 3300025972 Ga0207668_10197804 Ga0207668_101978042 185
1551 3300025981 Ga0207640_10517991 Ga0207640_105179911 185
1552 3300025981 Ga0207640_10898440 Ga0207640_108984401 185
1553 3300025986 Ga0207658_10353083 Ga0207658_103530832 185
1554 3300025986 Ga0207658_11176451 Ga0207658_111764511 185
1555 3300026041 Ga0207639_10405333 Ga0207639_104053332 185
1556 3300026067 Ga0207678_10020346 Ga0207678_100203465 185
1557 3300026067 Ga0207678_10095428 Ga0207678_100954282 185
1558 3300026078 Ga0207702_10118579 Ga0207702_101185793 185
1559 3300026078 Ga0207702_10541531 Ga0207702_105415311 185
1560 3300026095 Ga0207676_10355690 Ga0207676_103556902 185
1561 3300026118 Ga0207675_100443710 Ga0207675_1004437103 185
1562 3300026121 Ga0207683_10061765 Ga0207683_100617655 185
1563 3300026121 Ga0207683_10458199 Ga0207683_104581992 185
1564 3300026142 Ga0207698_10039501 Ga0207698_100395013 185
1565 3300027111 Ga0209281_1000028 Ga0209281_1000028196 185
1566 3300027111 Ga0209281_1000247 Ga0209281_100024729 185
1567 3300027111 Ga0209281_1000628 Ga0209281_100062810 185
1568 3300027312 Ga0209371_1000003 Ga0209371_1000003628 185
1569 3300027312 Ga0209371_1000340 Ga0209371_10003401 185
1570 3300027312 Ga0209371_1001537 Ga0209371_10015378 185
1571 3300027312 Ga0209371_1036922 Ga0209371_10369222 185
1572 3300027666 Ga0209282_1000037 Ga0209282_1000037106 185
1573 3300027666 Ga0209282_1000130 Ga0209282_100013040 185
1574 3300027666 Ga0209282_1111015 Ga0209282_11110152 185
1575 3300027866 Ga0209813_10001200 Ga0209813_100012005 185
1576 3300027876 Ga0209974_10310239 Ga0209974_103102391 185
1577 3300028379 Ga0268266_10003518 Ga0268266_100035189 185
1578 3300028379 Ga0268266_10006863 Ga0268266_100068639 185
1579 3300028379 Ga0268266_10527024 Ga0268266_105270242 185
1580 3300028379 Ga0268266_10536901 Ga0268266_105369011 185
1581 3300028379 Ga0268266_11188042 Ga0268266_111880421 185
1582 3300028379 Ga0268266_11412693 Ga0268266_114126931 185
1583 3300028794 Ga0307515_10000017 Ga0307515_10000017407 185
1584 3300028794 Ga0307515_10046556 Ga0307515_100465566 185
1585 3300028794 Ga0307515_10071980 Ga0307515_100719807 185
1586 3300030500 Ga0268256_1000004 Ga0268256_1000004422 185
1587 3300030500 Ga0268256_1000728 Ga0268256_10007288 185
1588 3300030500 Ga0268256_1041783 Ga0268256_10417831 185
1589 3300030744 Ga0316181_1064299 Ga0316181_10642994 185
1590 3300031235 Ga0265330_10129050 Ga0265330_101290502 185
1591 3300031239 Ga0265328_10000008 Ga0265328_10000008149 185
1592 3300031239 Ga0265328_10000392 Ga0265328_1000039218 185
1593 3300031239 Ga0265328_10002235 Ga0265328_100022353 185
1594 3300031239 Ga0265328_10003144 Ga0265328_1000314410 185
1595 3300031239 Ga0265328_10005367 Ga0265328_100053672 185
1596 3300031239 Ga0265328_10064041 Ga0265328_100640412 185
1597 3300031239 Ga0265328_10109261 Ga0265328_101092612 185
1598 3300031241 Ga0265325_10010419 Ga0265325_100104195 185
1599 3300031241 Ga0265325_10072621 Ga0265325_100726212 185
1600 3300031241 Ga0265325_10174123 Ga0265325_101741231 185
1601 3300031242 Ga0265329_10023459 Ga0265329_100234592 185
1602 3300031242 Ga0265329_10033763 Ga0265329_100337631 185
1603 3300031247 Ga0265340_10015941 Ga0265340_100159413 185
1604 3300031247 Ga0265340_10063001 Ga0265340_100630013 185
1605 3300031247 Ga0265340_10070684 Ga0265340_100706842 185
1606 3300031247 Ga0265340_10090555 Ga0265340_100905552 185
1607 3300031249 Ga0265339_10043834 Ga0265339_100438343 185
1608 3300031249 Ga0265339_10045047 Ga0265339_100450472 185
1609 3300031250 Ga0265331_10000087 Ga0265331_10000087111 185
1610 3300031250 Ga0265331_10001355 Ga0265331_100013555 185
1611 3300031250 Ga0265331_10001484 Ga0265331_100014848 185
1612 3300031251 Ga0265327_10007959 Ga0265327_100079592 185
1613 3300031344 Ga0265316_10015136 Ga0265316_100151366 185
1614 3300031344 Ga0265316_10033919 Ga0265316_100339196 185
1615 3300031344 Ga0265316_10485333 Ga0265316_104853331 185
1616 3300031456 Ga0307513_10020102 Ga0307513_100201029 185
1617 3300031456 Ga0307513_10070744 Ga0307513_100707445 185
1618 3300031456 Ga0307513_10426558 Ga0307513_104265582 185
1619 3300031548 Ga0307408_100225213 Ga0307408_1002252132 185
1620 3300031548 Ga0307408_100231278 Ga0307408_1002312782 185
1621 3300031548 Ga0307408_100698162 Ga0307408_1006981622 185
1622 3300031595 Ga0265313_10000869 Ga0265313_1000086930 185
1623 3300031595 Ga0265313_10015451 Ga0265313_100154516 185
1624 3300031595 Ga0265313_10033239 Ga0265313_100332393 185
1625 3300031595 Ga0265313_10060026 Ga0265313_100600262 185
1626 3300031711 Ga0265314_10019522 Ga0265314_100195225 185
1627 3300031711 Ga0265314_10123433 Ga0265314_101234332 185
1628 3300031712 Ga0265342_10090293 Ga0265342_100902932 185
1629 3300031712 Ga0265342_10156815 Ga0265342_101568151 185
1630 3300031731 Ga0307405_10000088 Ga0307405_100000888 185
1631 3300031824 Ga0307413_10024596 Ga0307413_100245964 185
1632 3300031824 Ga0307413_10035838 Ga0307413_100358381 185
1633 3300031852 Ga0307410_10487774 Ga0307410_104877741 185
1634 3300031901 Ga0307406_10003431 Ga0307406_100034317 185
1635 3300031901 Ga0307406_10005469 Ga0307406_100054697 185
1636 3300031901 Ga0307406_10012491 Ga0307406_100124916 185
1637 3300031911 Ga0307412_10002438 Ga0307412_100024388 185
1638 3300031911 Ga0307412_10003535 Ga0307412_100035359 185
1639 3300031911 Ga0307412_10035030 Ga0307412_100350303 185
1640 3300031911 Ga0307412_10062171 Ga0307412_100621713 185
1641 3300031911 Ga0307412_11398152 Ga0307412_113981521 185
1642 3300031967 Ga0315914_1000002 Ga0315914_100000229 185
1643 3300031995 Ga0307409_100038419 Ga0307409_1000384192 185
1644 3300032002 Ga0307416_100143536 Ga0307416_1001435362 185
1645 3300032002 Ga0307416_101130629 Ga0307416_1011306292 185
1646 3300032002 Ga0307416_101468116 Ga0307416_1014681162 185
1647 3300032004 Ga0307414_10025261 Ga0307414_100252613 185
1648 3300032004 Ga0307414_10043277 Ga0307414_100432772 185
1649 3300032004 Ga0307414_10198675 Ga0307414_101986752 185
1650 3300032004 Ga0307414_10231311 Ga0307414_102313112 185
1651 3300032004 Ga0307414_10272794 Ga0307414_102727941 185
1652 3300032004 Ga0307414_10368039 Ga0307414_103680392 185
1653 3300032004 Ga0307414_10622486 Ga0307414_106224862 185
1654 3300032004 Ga0307414_10647136 Ga0307414_106471361 185
1655 3300032004 Ga0307414_10742428 Ga0307414_107424282 185
1656 3300032004 Ga0307414_11005447 Ga0307414_110054471 185
1657 3300032126 Ga0307415_100954884 Ga0307415_1009548841 185
1658 3300032168 Ga0316593_10043353 Ga0316593_100433531 185
1659 3300033430 Ga0315913_1000018 Ga0315913_100001871 185
1660 3300033464 Ga0315915_1000005 Ga0315915_100000529 185
1661 3300037068 Ga0373925_0001010 Ga0373925_0001010_4232_4822 185
1662 3300037312 Ga0395899_0000107 Ga0395899_0000107_38694_39281 185
1663 3300037418 Ga0395900_0000101 Ga0395900_0000101_104807_105394 185
1664 3300037418 Ga0395900_0085364 Ga0395900_0085364_2079_2636 185
1665 3300037418 Ga0395900_0235140 Ga0395900_0235140_1125_1706 185
1666 3300037418 Ga0395900_0320341 Ga0395900_0320341_450_1007 185
1667 3300037418 Ga0395900_1281839 Ga0395900_1281839_58_621 185
1668 3300037466 Ga0395898_0000043 Ga0395898_0000043_38722_39309 185
1669 3300037466 Ga0395898_0111816 Ga0395898_0111816_390_971 185
1670 3300037471 Ga0395905_0000101 Ga0395905_0000101_38722_39309 185
1671 3300037471 Ga0395905_0009560 Ga0395905_0009560_5369_5926 185
1672 3300037471 Ga0395905_0031687 Ga0395905_0031687_1650_2231 185
1673 3300037471 Ga0395905_0080404 Ga0395905_0080404_875_1432 185
1674 3300037471 Ga0395905_0096247 Ga0395905_0096247_1681_2238 185
1675 3300037853 Ga0436364_0920022 Ga0436364_0920022_349_936 185
1676 3300038443 Ga0395901_0000068 Ga0395901_0000068_38722_39309 185
1677 3300038443 Ga0395901_0017499 Ga0395901_0017499_6629_7186 185
1678 3300038443 Ga0395901_0073030 Ga0395901_0073030_1476_2033 185
1679 3300038443 Ga0395901_0720200 Ga0395901_0720200_157_714 185
1680 3300039062 Ga0400483_117096 Ga0400483_117096_317_880 185
1681 3300039437 Ga0436365_0669703 Ga0436365_0669703_548_1105 185
1682 3300039437 Ga0436365_1797099 Ga0436365_1797099_8673_9233 185
1683 3300039447 Ga0436361_0774089 Ga0436361_0774089_178_828 185
1684 3300039450 Ga0436363_0693641 Ga0436363_0693641_1534_2103 185
1685 3300039450 Ga0436363_1325730 Ga0436363_1325730_654_1307 185
1686 3300039450 Ga0436363_1447886 Ga0436363_1447886_247_807 185
1687 3300039453 Ga0436362_0302411 Ga0436362_0302411_63_635 185
1688 3300041411 Ga0439466_0080708 Ga0439466_0080708_353_910 185
1689 3300041413 Ga0439465_0012626 Ga0439465_0012626_79_636 185
1690 3300041458 Ga0451798_0152628 Ga0451798_0152628_83_667 185
1691 3300041458 Ga0451798_0312749 Ga0451798_0312749_1667_2224 185
1692 3300041492 Ga0451835_0706473 Ga0451835_0706473_1827_2384 185
1693 3300041494 Ga0451837_1013830 Ga0451837_1013830_254_811 185
1694 3300041496 Ga0451839_0431211 Ga0451839_0431211_135_692 185
1695 3300041498 Ga0451841_1367572 Ga0451841_1367572_203_760 185
1696 3300041502 Ga0451846_65127 Ga0451846_65127_31_588 185
1697 3300041503 Ga0451847_0708780 Ga0451847_0708780_1246_1803 185
1698 3300041505 Ga0451849_0224148 Ga0451849_0224148_127_684 185
1699 3300041506 Ga0451850_39042 Ga0451850_39042_250_807 185
1700 3300041507 Ga0451851_0590795 Ga0451851_0590795_1279_1836 185
1701 3300041907 Ga0452268_17051 Ga0452268_17051_13_570 185
1702 3300041916 Ga0452271_20105 Ga0452271_20105_181_738 185
1703 3300041997 Ga0439431_0028270 Ga0439431_0028270_506_1063 185
1704 3300042007 Ga0439449_0006212 Ga0439449_0006212_202_759 185
1705 3300042007 Ga0439449_0021428 Ga0439449_0021428_82_639 185
1706 3300042013 Ga0439456_079755 Ga0439456_079755_124_681 185
1707 3300044658 Ga0466972_0126642 Ga0466972_0126642_189_746 185
1708 3300044683 Ga0466965_0126003 Ga0466965_0126003_49_606 185
1709 3300044765 Ga0466970_0056180 Ga0466970_0056180_1062_1619 185
1710 3300045976 Ga0466967_0735427 Ga0466967_0735427_182_739 185
1711 3300046459 Ga0495629_0070349 Ga0495629_0070349_542_1099 185
1712 3300046459 Ga0495629_0461864 Ga0495629_0461864_190_747 185
1713 3300046460 Ga0495638_0000397 Ga0495638_0000397_5470_6027 185
1714 3300046460 Ga0495638_0032069 Ga0495638_0032069_422_982 185
1715 3300046460 Ga0495638_0204001 Ga0495638_0204001_465_1022 185
1716 3300046471 Ga0495650_0059547 Ga0495650_0059547_71_628 185
1717 3300046476 Ga0495662_0067394 Ga0495662_0067394_618_1175 185
1718 3300046492 Ga0495585_0035006 Ga0495585_0035006_1258_1815 185
1719 3300046492 Ga0495585_0071516 Ga0495585_0071516_1211_1768 185
1720 3300046501 Ga0495607_0166062 Ga0495607_0166062_341_898 185
1721 3300046506 Ga0495583_0007197 Ga0495583_0007197_562_1119 185
1722 3300046507 Ga0495606_0027869 Ga0495606_0027869_1043_1600 185
1723 3300046507 Ga0495606_0036482 Ga0495606_0036482_2140_2697 185
1724 3300046507 Ga0495606_0125600 Ga0495606_0125600_148_705 185
1725 3300046507 Ga0495606_0188043 Ga0495606_0188043_572_1129 185
1726 3300046507 Ga0495606_0310109 Ga0495606_0310109_44_601 185
1727 3300046512 Ga0495610_0024722 Ga0495610_0024722_24_581 185
1728 3300046518 Ga0495631_0010602 Ga0495631_0010602_3931_4488 185
1729 3300046519 Ga0495632_0003737 Ga0495632_0003737_5137_5694 185
1730 3300046519 Ga0495632_0090148 Ga0495632_0090148_63_620 185
1731 3300046520 Ga0495637_0103229 Ga0495637_0103229_97_654 185
1732 3300046522 Ga0495643_0011844 Ga0495643_0011844_2371_2928 185
1733 3300046522 Ga0495643_0013228 Ga0495643_0013228_2129_2686 185
1734 3300046522 Ga0495643_0070443 Ga0495643_0070443_1180_1737 185
1735 3300046522 Ga0495643_0265724 Ga0495643_0265724_176_733 185
1736 3300046524 Ga0495648_0228828 Ga0495648_0228828_203_760 185
1737 3300046525 Ga0495663_0006433 Ga0495663_0006433_2510_3067 185
1738 3300046530 Ga0495654_0000571 Ga0495654_0000571_17524_18093 185
1739 3300046558 Ga0495633_0000438 Ga0495633_0000438_41666_42226 185
1740 3300046558 Ga0495633_0016621 Ga0495633_0016621_2984_3541 185
1741 3300046558 Ga0495633_0102668 Ga0495633_0102668_373_930 185
1742 3300046616 Ga0495668_0010444 Ga0495668_0010444_696_1253 185
1743 3300046648 Ga0495611_0036513 Ga0495611_0036513_1178_1735 185
1744 3300046660 Ga0495625_0002547 Ga0495625_0002547_13632_14189 185
1745 3300046660 Ga0495625_0020782 Ga0495625_0020782_4363_4920 185
1746 3300046660 Ga0495625_0251332 Ga0495625_0251332_81_638 185
1747 3300046660 Ga0495625_0292968 Ga0495625_0292968_182_739 185
1748 3300046665 Ga0495661_0047783 Ga0495661_0047783_110_667 185
1749 3300046665 Ga0495661_0185115 Ga0495661_0185115_64_621 185
1750 3300046690 Ga0495624_0105980 Ga0495624_0105980_558_1115 185
1751 3300046694 Ga0495649_0000134 Ga0495649_0000134_20167_20727 185
1752 3300046810 Ga0495660_0025628 Ga0495660_0025628_935_1492 185
1753 3300047318 Ga0495636_0045367 Ga0495636_0045367_1012_1569 185
1754 3300047320 Ga0495672_0009559 Ga0495672_0009559_1601_2158 185
1755 3300047320 Ga0495672_0295943 Ga0495672_0295943_39_596 185
1756 3300047447 Ga0495685_194225 Ga0495685_194225_49_606 185
1757 3300047472 Ga0495686_0046483 Ga0495686_0046483_1699_2256 185
1758 3300047472 Ga0495686_0152390 Ga0495686_0152390_739_1296 185
1759 3300048088 Ga0495602_0627029 Ga0495602_0627029_41_598 185
1760 3300048091 Ga0495626_0040279 Ga0495626_0040279_1030_1587 185
1761 3300048091 Ga0495626_0083378 Ga0495626_0083378_79_636 185
1762 3300048906 Ga0496103_0397870 Ga0496103_0397870_127_684 185
1763 3300048907 Ga0496104_0777668 Ga0496104_0777668_137_694 185
1764 3300048909 Ga0496106_0001794 Ga0496106_0001794_7617_8174 185
1765 3300048913 Ga0496110_0688861 Ga0496110_0688861_339_896 185
1766 3300048914 Ga0496111_0002868 Ga0496111_0002868_9566_10123 185
1767 3300048914 Ga0496111_0465641 Ga0496111_0465641_141_698 185
1768 3300048915 Ga0496112_0063240 Ga0496112_0063240_305_862 185
1769 3300048917 Ga0496114_0233894 Ga0496114_0233894_420_980 185
1770 3300048918 Ga0496115_0323360 Ga0496115_0323360_342_902 185
1771 3300048919 Ga0496116_0024906 Ga0496116_0024906_1206_1763 185
1772 3300048919 Ga0496116_0037404 Ga0496116_0037404_272_829 185
1773 3300048919 Ga0496116_0044656 Ga0496116_0044656_1508_2080 185
1774 3300048919 Ga0496116_0292637 Ga0496116_0292637_12_569 185
1775 3300048920 Ga0496117_0000016 Ga0496117_0000016_101376_101933 185
1776 3300048920 Ga0496117_0005852 Ga0496117_0005852_2101_2658 185
1777 3300048920 Ga0496117_0014948 Ga0496117_0014948_378_935 185
1778 3300048920 Ga0496117_0050674 Ga0496117_0050674_14_571 185
1779 3300048921 Ga0496118_0005627 Ga0496118_0005627_8691_9248 185
1780 3300048921 Ga0496118_0016278 Ga0496118_0016278_1777_2334 185
1781 3300048921 Ga0496118_0056054 Ga0496118_0056054_489_1046 185
1782 3300048921 Ga0496118_0323745 Ga0496118_0323745_210_791 185
1783 3300048922 Ga0496119_0023848 Ga0496119_0023848_716_1273 185
1784 3300048922 Ga0496119_0026449 Ga0496119_0026449_1261_1818 185
1785 3300048922 Ga0496119_0040525 Ga0496119_0040525_2287_2844 185
1786 3300048922 Ga0496119_0111375 Ga0496119_0111375_94_651 185
1787 3300048922 Ga0496119_0172451 Ga0496119_0172451_308_865 185
1788 3300048923 Ga0496120_0000164 Ga0496120_0000164_66559_67116 185
1789 3300048923 Ga0496120_0000550 Ga0496120_0000550_44856_45413 185
1790 3300048923 Ga0496120_0069810 Ga0496120_0069810_525_1082 185
1791 3300048923 Ga0496120_0077183 Ga0496120_0077183_954_1511 185
1792 3300048924 Ga0496121_0002925 Ga0496121_0002925_17397_17954 185
1793 3300048924 Ga0496121_0044960 Ga0496121_0044960_109_666 185
1794 3300048924 Ga0496121_0080370 Ga0496121_0080370_844_1401 185
1795 3300048924 Ga0496121_0178702 Ga0496121_0178702_447_1004 185
1796 3300048924 Ga0496121_0212190 Ga0496121_0212190_98_655 185
1797 3300048924 Ga0496121_0569806 Ga0496121_0569806_127_684 185
1798 3300048925 Ga0496122_0000002 Ga0496122_0000002_102037_102594 185
1799 3300048925 Ga0496122_0001100 Ga0496122_0001100_13988_14545 185
1800 3300048925 Ga0496122_0001424 Ga0496122_0001424_5728_6285 185
1801 3300048925 Ga0496122_0026493 Ga0496122_0026493_3406_3963 185
1802 3300048925 Ga0496122_0027392 Ga0496122_0027392_2153_2713 185
1803 3300048925 Ga0496122_0047818 Ga0496122_0047818_379_936 185
1804 3300048926 Ga0496123_0000002 Ga0496123_0000002_102037_102594 185
1805 3300048926 Ga0496123_0000002 Ga0496123_0000002_1709089_1709646 185
1806 3300048926 Ga0496123_0001129 Ga0496123_0001129_25961_26518 185
1807 3300048926 Ga0496123_0001147 Ga0496123_0001147_6501_7058 185
1808 3300048926 Ga0496123_0003982 Ga0496123_0003982_6475_7035 185
1809 3300048926 Ga0496123_0006102 Ga0496123_0006102_5012_5569 185
1810 3300048926 Ga0496123_0022124 Ga0496123_0022124_3440_3997 185
1811 3300048926 Ga0496123_0031999 Ga0496123_0031999_2688_3245 185
1812 3300048927 Ga0496124_0000094 Ga0496124_0000094_87921_88478 185
1813 3300048927 Ga0496124_0030277 Ga0496124_0030277_819_1376 185
1814 3300048927 Ga0496124_0041684 Ga0496124_0041684_721_1278 185
1815 3300048927 Ga0496124_0113690 Ga0496124_0113690_259_816 185
1816 3300048927 Ga0496124_0144534 Ga0496124_0144534_387_944 185
1817 3300048927 Ga0496124_0231818 Ga0496124_0231818_82_642 185
1818 3300048927 Ga0496124_0239659 Ga0496124_0239659_125_682 185
1819 3300048928 Ga0496125_0000374 Ga0496125_0000374_47002_47559 185
1820 3300048928 Ga0496125_0000564 Ga0496125_0000564_30333_30890 185
1821 3300048928 Ga0496125_0005990 Ga0496125_0005990_5941_6498 185
1822 3300048928 Ga0496125_0014364 Ga0496125_0014364_6253_6810 185
1823 3300048928 Ga0496125_0016356 Ga0496125_0016356_6326_6898 185
1824 3300048928 Ga0496125_0026192 Ga0496125_0026192_1233_1790 185
1825 3300048928 Ga0496125_0154752 Ga0496125_0154752_685_1242 185
1826 3300048928 Ga0496125_0234678 Ga0496125_0234678_513_1070 185
1827 3300048929 Ga0496126_0062938 Ga0496126_0062938_43_600 185
1828 3300048929 Ga0496126_0125604 Ga0496126_0125604_521_1078 185
1829 3300048929 Ga0496126_0233414 Ga0496126_0233414_18_575 185
1830 3300049459 Ga0495678_022706 Ga0495678_022706_1279_1836 185
1831 3300049568 Ga0501031_0000016 Ga0501031_0000016_36507_37064 185
1832 3300049568 Ga0501031_0009606 Ga0501031_0009606_2828_3397 185
1833 3300049568 Ga0501031_0020950 Ga0501031_0020950_1896_2474 185
1834 3300049568 Ga0501031_0170597 Ga0501031_0170597_480_1037 185
1835 3300049568 Ga0501031_0179041 Ga0501031_0179041_75_632 185
1836 3300049569 Ga0501032_0000029 Ga0501032_0000029_98619_99188 185
1837 3300049569 Ga0501032_0000044 Ga0501032_0000044_36507_37064 185
1838 3300049569 Ga0501032_0000435 Ga0501032_0000435_6546_7109 185
1839 3300049569 Ga0501032_0009080 Ga0501032_0009080_557_1135 185
1840 3300049569 Ga0501032_0031986 Ga0501032_0031986_1189_1746 185
1841 3300049569 Ga0501032_0035913 Ga0501032_0035913_1268_1825 185
1842 3300049569 Ga0501032_0084070 Ga0501032_0084070_316_894 185
1843 3300049569 Ga0501032_0085875 Ga0501032_0085875_232_789 185
1844 3300049569 Ga0501032_0107664 Ga0501032_0107664_498_1055 185
1845 3300049569 Ga0501032_0189147 Ga0501032_0189147_578_1135 185
1846 3300049569 Ga0501032_0324968 Ga0501032_0324968_152_730 185
1847 3300049569 Ga0501032_0610462 Ga0501032_0610462_116_673 185
1848 3300049570 Ga0501033_0000052 Ga0501033_0000052_36181_36738 185
1849 3300049570 Ga0501033_0000168 Ga0501033_0000168_37203_37772 185
1850 3300049570 Ga0501033_0011017 Ga0501033_0011017_4804_5361 185
1851 3300049570 Ga0501033_0026324 Ga0501033_0026324_178_756 185
1852 3300049570 Ga0501033_0053399 Ga0501033_0053399_1997_2554 185
1853 3300049570 Ga0501033_0109660 Ga0501033_0109660_12_569 185
1854 3300049570 Ga0501033_0648971 Ga0501033_0648971_31_588 185
1855 3300049571 Ga0501034_0000212 Ga0501034_0000212_36507_37064 185
1856 3300049571 Ga0501034_0000434 Ga0501034_0000434_37204_37773 185
1857 3300049571 Ga0501034_0000675 Ga0501034_0000675_6099_6656 185
1858 3300049571 Ga0501034_0026045 Ga0501034_0026045_3977_4534 185
1859 3300049571 Ga0501034_0050235 Ga0501034_0050235_3220_3777 185
1860 3300049571 Ga0501034_0062180 Ga0501034_0062180_1594_2151 185
1861 3300049571 Ga0501034_0067777 Ga0501034_0067777_1917_2474 185
1862 3300049571 Ga0501034_0073976 Ga0501034_0073976_1010_1630 185
1863 3300049571 Ga0501034_0118813 Ga0501034_0118813_1957_2514 185
1864 3300049571 Ga0501034_0145726 Ga0501034_0145726_1373_1936 185
1865 3300049571 Ga0501034_0303946 Ga0501034_0303946_805_1362 185
1866 3300049571 Ga0501034_0394511 Ga0501034_0394511_280_837 185
1867 3300049571 Ga0501034_0431702 Ga0501034_0431702_263_820 185
1868 3300049571 Ga0501034_0470139 Ga0501034_0470139_137_694 185
1869 3300049571 Ga0501034_0574674 Ga0501034_0574674_206_763 185
1870 3300049571 Ga0501034_0652964 Ga0501034_0652964_192_749 185
1871 3300049571 Ga0501034_0754298 Ga0501034_0754298_296_853 185
1872 3300049571 Ga0501034_0876318 Ga0501034_0876318_105_683 185
1873 3300049571 Ga0501034_0999344 Ga0501034_0999344_40_618 185
1874 3300049572 Ga0501036_0000022 Ga0501036_0000022_73733_74290 185
1875 3300049572 Ga0501036_0000533 Ga0501036_0000533_17294_17863 185
1876 3300049572 Ga0501036_0049068 Ga0501036_0049068_883_1440 185
1877 3300049572 Ga0501036_0508579 Ga0501036_0508579_162_719 185
1878 3300049573 Ga0501037_0000049 Ga0501037_0000049_83883_84461 185
1879 3300049573 Ga0501037_0000052 Ga0501037_0000052_36507_37064 185
1880 3300049573 Ga0501037_0000335 Ga0501037_0000335_31583_32152 185
1881 3300049573 Ga0501037_0044673 Ga0501037_0044673_57_614 185
1882 3300049573 Ga0501037_0074156 Ga0501037_0074156_478_1035 185
1883 3300049573 Ga0501037_0101319 Ga0501037_0101319_412_969 185
1884 3300049573 Ga0501037_0133986 Ga0501037_0133986_627_1184 185
1885 3300049573 Ga0501037_0157477 Ga0501037_0157477_114_671 185
1886 3300049573 Ga0501037_0191340 Ga0501037_0191340_57_614 185
1887 3300049573 Ga0501037_0286244 Ga0501037_0286244_330_908 185
1888 3300049573 Ga0501037_0295876 Ga0501037_0295876_135_713 185
1889 3300049574 Ga0501038_0000044 Ga0501038_0000044_73869_74426 185
1890 3300049574 Ga0501038_0000275 Ga0501038_0000275_11345_11914 185
1891 3300049574 Ga0501038_0084357 Ga0501038_0084357_671_1228 185
1892 3300049574 Ga0501038_0190158 Ga0501038_0190158_551_1108 185
1893 3300049574 Ga0501038_0212096 Ga0501038_0212096_232_789 185
1894 3300049574 Ga0501038_0291543 Ga0501038_0291543_403_960 185
1895 3300049574 Ga0501038_0309624 Ga0501038_0309624_302_859 185
1896 3300049575 Ga0501039_0000040 Ga0501039_0000040_82667_83236 185
1897 3300049575 Ga0501039_0000042 Ga0501039_0000042_38719_39276 185
1898 3300049575 Ga0501039_0237677 Ga0501039_0237677_232_789 185
1899 3300049575 Ga0501039_0439392 Ga0501039_0439392_335_892 185
1900 3300049575 Ga0501039_0482240 Ga0501039_0482240_286_843 185
1901 3300049576 Ga0501040_0103312 Ga0501040_0103312_679_1236 185
1902 3300049576 Ga0501040_0141414 Ga0501040_0141414_71_628 185
1903 3300049578 Ga0501042_0129112 Ga0501042_0129112_56_613 185
1904 3300049579 Ga0501043_0000006 Ga0501043_0000006_149838_150416 185
1905 3300049579 Ga0501043_0000054 Ga0501043_0000054_31499_32056 185
1906 3300049579 Ga0501043_0000236 Ga0501043_0000236_17735_18304 185
1907 3300049579 Ga0501043_0013995 Ga0501043_0013995_1043_1621 185
1908 3300049579 Ga0501043_0054340 Ga0501043_0054340_1110_1667 185
1909 3300049579 Ga0501043_0131977 Ga0501043_0131977_498_1061 185
1910 3300049579 Ga0501043_0138189 Ga0501043_0138189_1020_1577 185
1911 3300049579 Ga0501043_0270670 Ga0501043_0270670_639_1196 185
1912 3300049579 Ga0501043_0298880 Ga0501043_0298880_442_999 185
1913 3300049579 Ga0501043_0321123 Ga0501043_0321123_59_637 185
1914 3300049579 Ga0501043_0398511 Ga0501043_0398511_114_671 185
1915 3300049579 Ga0501043_0782297 Ga0501043_0782297_49_606 185
1916 3300049579 Ga0501043_0825108 Ga0501043_0825108_100_657 185
1917 3300049580 Ga0501046_0019865 Ga0501046_0019865_1011_1580 185
1918 3300049580 Ga0501046_0135926 Ga0501046_0135926_349_906 185
1919 3300049580 Ga0501046_0380901 Ga0501046_0380901_437_994 185
1920 3300049581 Ga0501047_0000838 Ga0501047_0000838_9077_9634 185
1921 3300049581 Ga0501047_0009345 Ga0501047_0009345_1902_2480 185
1922 3300049581 Ga0501047_0039981 Ga0501047_0039981_749_1306 185
1923 3300049581 Ga0501047_0045832 Ga0501047_0045832_2411_2980 185
1924 3300049581 Ga0501047_0070750 Ga0501047_0070750_221_778 185
1925 3300049581 Ga0501047_0081264 Ga0501047_0081264_439_996 185
1926 3300049581 Ga0501047_0096030 Ga0501047_0096030_1303_1860 185
1927 3300049581 Ga0501047_0123404 Ga0501047_0123404_1451_2029 185
1928 3300049581 Ga0501047_0143198 Ga0501047_0143198_1584_2141 185
1929 3300049581 Ga0501047_0183726 Ga0501047_0183726_529_1086 185
1930 3300049581 Ga0501047_0302382 Ga0501047_0302382_129_686 185
1931 3300049581 Ga0501047_0335137 Ga0501047_0335137_607_1218 185
1932 3300049582 Ga0501048_0431877 Ga0501048_0431877_14_571 185
1933 3300049583 Ga0501067_0001248 Ga0501067_0001248_11226_11783 185
1934 3300049583 Ga0501067_0003119 Ga0501067_0003119_236_799 185
1935 3300049583 Ga0501067_0004746 Ga0501067_0004746_380_937 185
1936 3300049583 Ga0501067_0055009 Ga0501067_0055009_1318_1875 185
1937 3300049583 Ga0501067_0069494 Ga0501067_0069494_116_673 185
1938 3300049583 Ga0501067_0214054 Ga0501067_0214054_173_751 185
1939 3300049583 Ga0501067_0307199 Ga0501067_0307199_22_582 185
1940 3300049583 Ga0501067_0325059 Ga0501067_0325059_281_838 185
1941 3300049583 Ga0501067_0361412 Ga0501067_0361412_143_700 185
1942 3300049584 Ga0501068_0007310 Ga0501068_0007310_3509_4072 185
1943 3300049584 Ga0501068_0216057 Ga0501068_0216057_392_949 185
1944 3300049584 Ga0501068_0344231 Ga0501068_0344231_377_934 185
1945 3300049585 Ga0501069_0000141 Ga0501069_0000141_787_1365 185
1946 3300049585 Ga0501069_0013189 Ga0501069_0013189_2866_3423 185
1947 3300049585 Ga0501069_0084971 Ga0501069_0084971_1027_1584 185
1948 3300049585 Ga0501069_0112182 Ga0501069_0112182_68_625 185
1949 3300049585 Ga0501069_0217062 Ga0501069_0217062_243_800 185
1950 3300049586 Ga0501070_0000081 Ga0501070_0000081_49680_50258 185
1951 3300049586 Ga0501070_0000254 Ga0501070_0000254_3956_4534 185
1952 3300049586 Ga0501070_0005587 Ga0501070_0005587_5884_6441 185
1953 3300049586 Ga0501070_0064518 Ga0501070_0064518_1173_1751 185
1954 3300049586 Ga0501070_0069657 Ga0501070_0069657_383_940 185
1955 3300049586 Ga0501070_0088763 Ga0501070_0088763_1574_2152 185
1956 3300049586 Ga0501070_0108673 Ga0501070_0108673_255_812 185
1957 3300049586 Ga0501070_0126634 Ga0501070_0126634_1026_1604 185
1958 3300049586 Ga0501070_0159445 Ga0501070_0159445_1029_1586 185
1959 3300049586 Ga0501070_0207403 Ga0501070_0207403_1015_1572 185
1960 3300049586 Ga0501070_0213963 Ga0501070_0213963_924_1481 185
1961 3300049586 Ga0501070_0224883 Ga0501070_0224883_419_976 185
1962 3300049586 Ga0501070_0405989 Ga0501070_0405989_342_899 185
1963 3300049586 Ga0501070_0639216 Ga0501070_0639216_17_595 185
1964 3300049587 Ga0501071_0043325 Ga0501071_0043325_1150_1728 185
1965 3300049587 Ga0501071_0134976 Ga0501071_0134976_630_1187 185
1966 3300049587 Ga0501071_0889993 Ga0501071_0889993_23_580 185
1967 3300049588 Ga0501072_0121254 Ga0501072_0121254_633_1196 185
1968 3300049588 Ga0501072_0429892 Ga0501072_0429892_100_657 185
1969 3300049588 Ga0501072_0624195 Ga0501072_0624195_109_669 185
1970 3300049589 Ga0501073_0000019 Ga0501073_0000019_71228_71791 185
1971 3300049589 Ga0501073_0015418 Ga0501073_0015418_1172_1729 185
1972 3300049589 Ga0501073_0019232 Ga0501073_0019232_2665_3222 185
1973 3300049589 Ga0501073_0026648 Ga0501073_0026648_1648_2205 185
1974 3300049589 Ga0501073_0071790 Ga0501073_0071790_744_1301 185
1975 3300049589 Ga0501073_0128800 Ga0501073_0128800_580_1137 185
1976 3300049589 Ga0501073_0157634 Ga0501073_0157634_561_1118 185
1977 3300049589 Ga0501073_0362758 Ga0501073_0362758_421_978 185
1978 3300049590 Ga0501074_0000011 Ga0501074_0000011_29181_29759 185
1979 3300049590 Ga0501074_0029334 Ga0501074_0029334_144_701 185
1980 3300049590 Ga0501074_0199990 Ga0501074_0199990_327_884 185
1981 3300049590 Ga0501074_0409747 Ga0501074_0409747_11_568 185
1982 3300049590 Ga0501074_0541464 Ga0501074_0541464_166_723 185
1983 3300049592 Ga0501076_0126748 Ga0501076_0126748_1486_2043 185
1984 3300049593 Ga0501077_0000035 Ga0501077_0000035_62475_63038 185
1985 3300049593 Ga0501077_0041346 Ga0501077_0041346_425_982 185
1986 3300049593 Ga0501077_0057700 Ga0501077_0057700_641_1198 185
1987 3300049593 Ga0501077_0616935 Ga0501077_0616935_36_683 185
1988 3300049741 Ga0501079_0142963 Ga0501079_0142963_1221_1778 185
1989 3300049741 Ga0501079_0700156 Ga0501079_0700156_208_765 185
1990 3300049742 Ga0501080_0000582 Ga0501080_0000582_21792_22370 185
1991 3300049742 Ga0501080_0005452 Ga0501080_0005452_4564_5124 185
1992 3300049742 Ga0501080_0025036 Ga0501080_0025036_3613_4170 185
1993 3300049742 Ga0501080_0029481 Ga0501080_0029481_2974_3531 185
1994 3300049742 Ga0501080_0099925 Ga0501080_0099925_64_642 185
1995 3300049742 Ga0501080_0107954 Ga0501080_0107954_1262_1840 185
1996 3300049742 Ga0501080_0145057 Ga0501080_0145057_276_833 185
1997 3300049742 Ga0501080_0146315 Ga0501080_0146315_1020_1577 185
1998 3300049742 Ga0501080_0186994 Ga0501080_0186994_640_1197 185
1999 3300049742 Ga0501080_0480481 Ga0501080_0480481_433_990 185
2000 3300049742 Ga0501080_0621599 Ga0501080_0621599_313_870 185
2001 3300049742 Ga0501080_0674999 Ga0501080_0674999_121_678 185
2002 3300049743 Ga0501081_1013335 Ga0501081_1013335_53_610 185
2003 3300049744 Ga0501083_0002722 Ga0501083_0002722_9731_10291 185
2004 3300049744 Ga0501083_0002864 Ga0501083_0002864_2144_2701 185
2005 3300049744 Ga0501083_0003672 Ga0501083_0003672_9920_10498 185
2006 3300049744 Ga0501083_0004693 Ga0501083_0004693_8027_8584 185
2007 3300049744 Ga0501083_0048536 Ga0501083_0048536_1011_1568 185
2008 3300049744 Ga0501083_0060795 Ga0501083_0060795_1207_1764 185
2009 3300049744 Ga0501083_0077252 Ga0501083_0077252_1413_1970 185
2010 3300049744 Ga0501083_0223140 Ga0501083_0223140_240_797 185
2011 3300049744 Ga0501083_0254278 Ga0501083_0254278_85_642 185
2012 3300049744 Ga0501083_0298190 Ga0501083_0298190_84_641 185
2013 3300049758 Ga0501241_025024 Ga0501241_025024_333_890 185
2014 3300049776 Ga0501280_001991 Ga0501280_001991_1267_1824 185
2015 3300049822 Ga0501035_0000068 Ga0501035_0000068_1767_2345 185
2016 3300049822 Ga0501035_0000095 Ga0501035_0000095_73715_74272 185
2017 3300049822 Ga0501035_0000557 Ga0501035_0000557_9032_9601 185
2018 3300049822 Ga0501035_0004674 Ga0501035_0004674_1927_2505 185
2019 3300049822 Ga0501035_0010601 Ga0501035_0010601_6617_7174 185
2020 3300049822 Ga0501035_0024027 Ga0501035_0024027_4804_5361 185
2021 3300049822 Ga0501035_0036936 Ga0501035_0036936_1591_2148 185
2022 3300049822 Ga0501035_0122679 Ga0501035_0122679_318_896 185
2023 3300049822 Ga0501035_0331737 Ga0501035_0331737_522_1079 185
2024 3300049823 Ga0501044_0000082 Ga0501044_0000082_84010_84588 185
2025 3300049823 Ga0501044_0000091 Ga0501044_0000091_36962_37519 185
2026 3300049823 Ga0501044_0002199 Ga0501044_0002199_21684_22247 185
2027 3300049823 Ga0501044_0020085 Ga0501044_0020085_957_1535 185
2028 3300049823 Ga0501044_0020231 Ga0501044_0020231_1413_1991 185
2029 3300049823 Ga0501044_0031213 Ga0501044_0031213_3937_4494 185
2030 3300049823 Ga0501044_0032766 Ga0501044_0032766_3997_4554 185
2031 3300049823 Ga0501044_0049026 Ga0501044_0049026_3761_4330 185
2032 3300049823 Ga0501044_0073302 Ga0501044_0073302_1548_2105 185
2033 3300049823 Ga0501044_0083450 Ga0501044_0083450_1331_1909 185
2034 3300049823 Ga0501044_0211824 Ga0501044_0211824_851_1408 185
2035 3300049823 Ga0501044_0229990 Ga0501044_0229990_608_1165 185
2036 3300049823 Ga0501044_0359888 Ga0501044_0359888_168_725 185
2037 3300049823 Ga0501044_0964401 Ga0501044_0964401_43_600 185
2038 3300049824 Ga0501045_0024565 Ga0501045_0024565_2054_2611 185
2039 3300049824 Ga0501045_0176570 Ga0501045_0176570_439_996 185
2040 3300050489 nmdc:mga03683_59901_c1 nmdc:mga03683_59901_c1_367_924 185
2041 3300050490 nmdc:mga03n38_168036_c1 nmdc:mga03n38_168036_c1_198_755 185
2042 3300050490 nmdc:mga03n38_2162_c1 nmdc:mga03n38_2162_c1_3431_3988 185
2043 3300050490 nmdc:mga03n38_71667_c1 nmdc:mga03n38_71667_c1_106_777 185
2044 3300050490 nmdc:mga03n38_98276_c1 nmdc:mga03n38_98276_c1_835_1392 185
2045 3300050491 nmdc:mga00v17_13_c1 nmdc:mga00v17_13_c1_977_1534 185
2046 3300050491 nmdc:mga00v17_268670_c1 nmdc:mga00v17_268670_c1_193_864 185
2047 3300050491 nmdc:mga00v17_27_c2 nmdc:mga00v17_27_c2_5934_6491 185
2048 3300050491 nmdc:mga00v17_50366_c1 nmdc:mga00v17_50366_c1_1367_1924 185
2049 3300050491 nmdc:mga00v17_70873_c1 nmdc:mga00v17_70873_c1_364_924 185
2050 3300050492 nmdc:mga0yw44_147119_c1 nmdc:mga0yw44_147119_c1_752_1309 185
2051 3300050492 nmdc:mga0yw44_19066_c1 nmdc:mga0yw44_19066_c1_2327_2884 185
2052 3300050492 nmdc:mga0yw44_3221_c1 nmdc:mga0yw44_3221_c1_3624_4181 185
2053 3300050492 nmdc:mga0yw44_44476_c1 nmdc:mga0yw44_44476_c1_355_912 185
2054 3300050492 nmdc:mga0yw44_76857_c1 nmdc:mga0yw44_76857_c1_748_1305 185
2055 3300050493 nmdc:mga0k408_134222_c2 nmdc:mga0k408_134222_c2_346_903 185
2056 3300050493 nmdc:mga0k408_4447_c1 nmdc:mga0k408_4447_c1_548_1105 185
2057 3300050494 nmdc:mga06z11_1915_c1 nmdc:mga06z11_1915_c1_1768_2325 185
2058 3300050494 nmdc:mga06z11_206948_c1 nmdc:mga06z11_206948_c1_572_1129 185
2059 3300050494 nmdc:mga06z11_272774_c1 nmdc:mga06z11_272774_c1_183_740 185
2060 3300050494 nmdc:mga06z11_326017_c1 nmdc:mga06z11_326017_c1_199_870 185
2061 3300050494 nmdc:mga06z11_43138_c1 nmdc:mga06z11_43138_c1_1107_1664 185
2062 3300050494 nmdc:mga06z11_597420_c1 nmdc:mga06z11_597420_c1_57_614 185
2063 3300050494 nmdc:mga06z11_82691_c1 nmdc:mga06z11_82691_c1_361_918 185
2064 3300050495 nmdc:mga04h51_161881_c1 nmdc:mga04h51_161881_c1_150_821 185
2065 3300050496 nmdc:mga07m45_145356_c1 nmdc:mga07m45_145356_c1_401_958 185
2066 3300050496 nmdc:mga07m45_26378_c1 nmdc:mga07m45_26378_c1_1626_2183 185
2067 3300050496 nmdc:mga07m45_353596_c1 nmdc:mga07m45_353596_c1_132_803 185
2068 3300050516 nmdc:mga0sz30_144_c1 nmdc:mga0sz30_144_c1_7086_7643 185
2069 3300050516 nmdc:mga0sz30_16819_c1 nmdc:mga0sz30_16819_c1_1595_2152 185
2070 3300050516 nmdc:mga0sz30_3454_c1 nmdc:mga0sz30_3454_c1_4439_4996 185
2071 3300050516 nmdc:mga0sz30_72679_c2 nmdc:mga0sz30_72679_c2_12_569 185
2072 3300053079 Ga0500610_0019125 Ga0500610_0019125_2693_3250 185
2073 3300053085 Ga0495619_0643357 Ga0495619_0643357_133_690 185
2074 3300053087 Ga0500643_023639 Ga0500643_023639_667_1224 185
2075 3300053088 Ga0500644_0004259 Ga0500644_0004259_1799_2359 185
2076 3300053088 Ga0500644_0104460 Ga0500644_0104460_25_582 185
2077 3300053093 Ga0500651_0004289 Ga0500651_0004289_2582_3142 185
2078 3300053093 Ga0500651_0043132 Ga0500651_0043132_1230_1790 185
2079 3300053118 Ga0500594_0001379 Ga0500594_0001379_82_639 185
2080 3300053119 Ga0500595_104570 Ga0500595_104570_177_734 185
2081 3300053134 Ga0500658_0000770 Ga0500658_0000770_7702_8259 185
2082 3300053137 Ga0500561_0000316 Ga0500561_0000316_3351_3908 185
2083 3300053139 Ga0500568_0000232 Ga0500568_0000232_31531_32103 185
2084 3300053139 Ga0500568_0002531 Ga0500568_0002531_2214_2771 185
2085 3300053139 Ga0500568_0004124 Ga0500568_0004124_3790_4347 185
2086 3300053140 Ga0500573_0114773 Ga0500573_0114773_52_612 185
2087 3300053151 Ga0500604_0027954 Ga0500604_0027954_381_938 185
2088 3300053153 Ga0500616_0002417 Ga0500616_0002417_9364_9921 185
2089 3300053153 Ga0500616_0003618 Ga0500616_0003618_2134_2691 185
2090 3300053153 Ga0500616_0016515 Ga0500616_0016515_1509_2066 185
2091 3300053153 Ga0500616_0040621 Ga0500616_0040621_1250_1807 185
2092 3300053156 Ga0500622_0001821 Ga0500622_0001821_7871_8428 185
2093 3300053157 Ga0500624_000169 Ga0500624_000169_17439_17996 185
2094 3300053158 Ga0500627_0067430 Ga0500627_0067430_973_1530 185
2095 3300053160 Ga0500633_0001269 Ga0500633_0001269_93_650 185
2096 3300054114 Ga0501084_0011010 Ga0501084_0011010_4011_4568 185
2097 3300054114 Ga0501084_0126094 Ga0501084_0126094_871_1428 185
2098 3300054114 Ga0501084_0296332 Ga0501084_0296332_659_1216 185
2099 3300054114 Ga0501084_0419458 Ga0501084_0419458_478_1035 185
2100 3300054114 Ga0501084_0450168 Ga0501084_0450168_41_598 185
2101 3300054114 Ga0501084_0822704 Ga0501084_0822704_84_641 185
2102 3300054114 Ga0501084_0840652 Ga0501084_0840652_55_612 185
2103 3300054114 Ga0501084_0847638 Ga0501084_0847638_193_750 185
2104 3300059510 Ga0587090_026817 Ga0587090_026817_121_678 185
2105 3300059639 Ga0587062_021177 Ga0587062_021177_100_657 185
2106 3300059641 Ga0587068_007676 Ga0587068_007676_738_1295 185
2107 3300059643 Ga0587072_001125 Ga0587072_001125_1752_2309 185
2108 3300060353 Ga0501082_0001935 Ga0501082_0001935_2395_2955 185
2109 3300060353 Ga0501082_0008096 Ga0501082_0008096_6018_6575 185
2110 3300060353 Ga0501082_0012643 Ga0501082_0012643_5783_6361 185
2111 3300060353 Ga0501082_0025508 Ga0501082_0025508_2878_3435 185
2112 3300060353 Ga0501082_0050904 Ga0501082_0050904_1384_1941 185
2113 3300060353 Ga0501082_0237644 Ga0501082_0237644_289_867 185
2114 3300060353 Ga0501082_0284231 Ga0501082_0284231_664_1221 185
2115 3300060353 Ga0501082_0616415 Ga0501082_0616415_41_598 185
2116 3300060353 Ga0501082_0661721 Ga0501082_0661721_300_857 185
2117 3300060353 Ga0501082_1193747 Ga0501082_1193747_33_590 185
2118 iso_pu_bacteria 2856320880 2856322729 185
2119 iso_pu_bacteria 2856349417 2856351513 185
2120 iso_pu_bacteria 2856356410 2856356981 185
2121 iso_pu_bacteria 2871488783 2871489952 185
2122 iso_pu_bacteria 2878753008 2878754482 185
2123 iso_pu_bacteria 2881845957 2881847390 185
2124 iso_pu_bacteria 2881853255 2881856121 185
2125 iso_pu_bacteria 2881861095 2881864936 185
2126 iso_pu_bacteria 2882912400 2882913161 185
2127 iso_pu_bacteria 2885318864 2885318952 185
2128 iso_pu_bacteria 2885342637 2885350019 185
2129 iso_pu_bacteria 2885350715 2885354958 185
2130 iso_pu_bacteria 2903492973 2903497687 185
2131 iso_pu_bacteria 2924718760 2924720507 185
2132 iso_pu_bacteria 2924784321 2924790130 185
2133 iso_pu_bacteria 2961127735 2961134757 185
2134 iso_pu_bacteria 2961170736 2961171912 185
2135 iso_pu_bacteria 2967996073 2967997019 185
2136 iso_pu_bacteria 2968003550 2968005080 185
2137 iso_pu_bacteria 2970503327 2970504510 185
2138 iso_pu_bacteria 2977821940 2977823699 185
2139 iso_pu_bacteria 2977828996 2977833145 185
2140 iso_pu_bacteria 2977864932 2977866787 185
2141 iso_pu_bacteria 2979808191 2979809147 185
2142 iso_pu_bacteria 3002141150 3002141193 185
2143 iso_pu_bacteria 8004374579 8004376058 185
2144 iso_pu_bacteria 8055617313 8055618890 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01844

HNH

HNH endonuclease

132

173

0.97

PF14279

HNH_5

HNH endonuclease

132

184

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f43-assembly1.cif.gz_A hnh nuclease domain from g. stearothermophilus cas9, k597a mutant 0.8227 83 141
6j9n-assembly1.cif.gz_A nmehnh+acriic3 0.8016 83 141
5vgb-assembly1.cif.gz_A crystal structure of nmecas9 hnh domain bound to anti-crispr acriic1 0.7897 83 141
7ovb-assembly1.cif.gz_C l. pneumophila type iv coupling complex (t4cc) with density for doty n-terminal and middle domains 0.7719 86 129
4h9d-assembly1.cif.gz_A crystal structure of mn-dependent gme hnh nicking endonuclease from geobacter metallireducens gs-15, northeast structural genomics consortium (nesg) target gmr87 0.7481 85 142
ID Description Score Start End Superfamily
af_Q8LMG0_22_125_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.9619 103 136 1.10.30.50
af_I1MTW9_33_119_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.9568 103 137 1.10.30.50
af_P71806_355_434_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8595 86 133 2.30.29.30
2qgpB00 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.7334 89 142 1.10.30.50
af_I1MTU7_87_181_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.727 105 160 1.10.30.50
ID Description Score Start End GO Terms
AF-A0A3C1HRD6-F1-model_v4 deleted 0.9876 86 142
AF-A0A355QQL5-F1-model_v4 deleted 0.9779 80 185
AF-A0A3D2L8Y0-F1-model_v4 HNH endonuclease 0.9682 74 152 GO:0004519
AF-A0A2H1HV63-F1-model_v4 HNH endonuclease 0.961 78 159 GO:0004519
AF-A0A355QQL5-F1-model_v4 deleted 0.9602 80 185

Feature Viewer

pLDDT pTM Quality
85.75 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map