F496462
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2144 | 1312 | 1253 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300050490|nmdc:mga03n38_71667_c1|nmdc:mga03n38_71667_c1_106_777 |
| Length | 223 |
| Sequence | LKSCVFEAADQRQSASHPCHVGLTVSAPIGFETKEVNKVTVAVSPDGLPALVLNADYRPLSYYPLSLWSWQDAIKAVFLDRVNIVAEYEHAVSSPTFSMKLPSVVSLKAYVKPSRHPAFTRFNVFLRDRFQCQYCSTPDDLTFDHVIPRHRGGATTWENVVAACSPCNLRKGGMMPAHAKMWPLQKPYQPTVHDLHNNGRLFPPNHLHESWMDYLYWDVELEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 6 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 7 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 8 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 9 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 10 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 11 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 12 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 13 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 14 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 15 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 16 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 17 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 18 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 19 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 20 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 21 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 22 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 23 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 24 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 25 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 26 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 27 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 28 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 29 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 30 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 31 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 32 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 33 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 34 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 35 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 36 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 37 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 38 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 39 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 40 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 41 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 42 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 43 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 44 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 45 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 46 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 47 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 48 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 49 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 50 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 51 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 52 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 53 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 54 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 55 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 56 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 57 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 58 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 59 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 60 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 61 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 62 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 63 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 64 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 65 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 66 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 67 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 68 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 69 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 70 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 71 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 72 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 73 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 74 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 75 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 76 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 77 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 78 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 79 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 80 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 81 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 82 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 83 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 84 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 85 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 86 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 87 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 88 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 89 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 90 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 91 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 92 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 93 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 94 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 95 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 96 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 97 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 98 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 99 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 100 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 101 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 102 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 103 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 104 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 105 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 106 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 107 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 108 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 109 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 110 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 111 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 112 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 113 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 114 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 115 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 116 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 117 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 118 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 119 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 120 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 121 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 122 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 123 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 124 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 125 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 126 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 127 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 128 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 129 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 130 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 131 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 132 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 133 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 134 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 135 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 136 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 137 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 138 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 139 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 140 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 141 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 142 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 143 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 144 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 145 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 146 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 147 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 148 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 149 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 150 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 151 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 152 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 153 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 154 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 155 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 156 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 157 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 158 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 159 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 160 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 161 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 162 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 163 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 164 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 165 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 166 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 167 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 168 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 169 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 170 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 171 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 172 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 173 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 174 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 175 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 176 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 177 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 178 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 179 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 180 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 181 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 182 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 183 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 184 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 185 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 186 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 187 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 188 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 189 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 190 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 191 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 192 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 193 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 194 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 195 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 196 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 197 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 198 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 199 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 200 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 201 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 202 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 203 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 204 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 205 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 206 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 207 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 208 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 209 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 210 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 211 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 212 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 213 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 214 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 215 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 216 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 217 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 218 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 219 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 220 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 221 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 222 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 223 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 224 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 225 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 226 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 227 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 228 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 229 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 230 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 231 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 232 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 233 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 234 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 235 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 236 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 237 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 238 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 239 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 240 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 241 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 242 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 243 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 244 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 245 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 246 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 247 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 248 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 249 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 250 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 251 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 252 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 253 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 254 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 255 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 256 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 257 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 258 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 259 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 260 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 261 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 262 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 263 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 264 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 265 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 266 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 267 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 268 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 269 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 270 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 271 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 272 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 273 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 274 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 275 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 276 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 277 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 278 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 279 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 280 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 281 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 282 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 283 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 284 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 285 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 286 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 287 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 288 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 289 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 290 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 291 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 292 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 293 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 294 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 295 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 296 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 297 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 298 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 299 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 300 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 301 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 302 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 303 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 304 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 305 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 306 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 307 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 308 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 309 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 310 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 311 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 312 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 313 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 314 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 315 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 316 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 317 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 318 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 319 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 320 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 321 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 322 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 323 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 324 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 325 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 326 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 327 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 328 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 329 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 330 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 331 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 332 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 333 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 334 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 335 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 336 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 337 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 338 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 339 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 340 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 341 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 342 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 343 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 344 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 345 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 346 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 347 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 348 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 349 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 350 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 351 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 352 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 353 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 354 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 355 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 356 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 357 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 358 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 359 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 360 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 361 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 362 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 363 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 364 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 365 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 366 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 367 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 368 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 369 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 370 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 371 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 372 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 373 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 374 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 375 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 376 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 377 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 378 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 379 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 380 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 381 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 382 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 383 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 384 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 385 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 386 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 387 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 388 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 389 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 390 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 391 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 392 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 393 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 394 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 395 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 396 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 397 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 398 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 399 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 400 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 401 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 402 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 403 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 404 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 405 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 406 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 407 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 408 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 409 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 410 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 411 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 412 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 413 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 414 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 415 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 416 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 417 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 418 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 419 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 420 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 421 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 422 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 423 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 424 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 425 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 426 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 427 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 428 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 429 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 430 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 431 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 432 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 433 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 434 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 435 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 436 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 437 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 438 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 439 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 440 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 441 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 442 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 443 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 444 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 445 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 446 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 447 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 448 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 449 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 450 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 451 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 452 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 453 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 454 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 455 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 456 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 457 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 458 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 459 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 460 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 461 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 462 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 463 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 464 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 465 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 466 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 467 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 468 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 469 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 470 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 471 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 472 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 473 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 474 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 475 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 476 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 477 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 478 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 479 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 480 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 481 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 482 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 483 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 484 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 485 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 486 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 487 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 488 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 489 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 490 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 491 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 492 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 493 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 494 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 495 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 496 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 497 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 498 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 499 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 500 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 501 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 502 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 503 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 504 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 505 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 506 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 507 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 508 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 509 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 510 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 511 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 512 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 513 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 514 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 515 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 516 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 517 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 518 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 519 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 520 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 521 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 522 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 523 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 524 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 525 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 526 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 527 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 528 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 529 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 530 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 531 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 532 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 533 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 534 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 535 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 536 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 537 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 538 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 539 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 540 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 541 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 542 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 543 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 544 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 545 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 546 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 547 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 548 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 549 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 550 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 551 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 552 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 553 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 554 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 555 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 556 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 557 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 558 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 559 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 560 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 561 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 562 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 563 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 564 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 565 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 566 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 567 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 568 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 569 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 570 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 571 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 572 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 573 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 574 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 575 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 576 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 577 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 578 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 579 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 580 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 581 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 582 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 583 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 584 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 585 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 586 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 587 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 588 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 589 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 590 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 591 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 592 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 593 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 594 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 595 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 596 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 597 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 598 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 599 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 600 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 601 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 602 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 603 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 604 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 605 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 606 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 607 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 608 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 609 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 610 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 611 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 612 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 613 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 614 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 615 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 616 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 617 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 618 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 619 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 620 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 621 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 622 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 623 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 624 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 625 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 626 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 627 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 628 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 629 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 630 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 631 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 632 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 633 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 634 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 635 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 636 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 637 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 638 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 639 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 640 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 641 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 642 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 643 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 644 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 645 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 646 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 647 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 648 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 649 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 650 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 651 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 652 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 653 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 654 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 655 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 656 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 657 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 658 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 659 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 660 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 661 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 662 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 663 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 664 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 665 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 666 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 667 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 668 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 669 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 670 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 671 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 672 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 673 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 674 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 675 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 676 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 677 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 678 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 679 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 680 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 681 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 682 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 683 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 684 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 685 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 686 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 687 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 688 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 689 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 690 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 691 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 692 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 693 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 694 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 695 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 696 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 697 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 698 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 699 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 700 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 701 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 702 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 703 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 704 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 705 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 706 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 707 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 708 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 709 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 710 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 711 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 712 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 713 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 714 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 715 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 716 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 717 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 718 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 719 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 720 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 721 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 722 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 723 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 724 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 725 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 726 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 727 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 728 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 729 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 730 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 731 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 732 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 733 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 734 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 735 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 736 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 737 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 738 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 739 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 740 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 741 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 742 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 743 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 744 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 745 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 746 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 747 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 748 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 749 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 750 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 751 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 752 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 753 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 754 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 755 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 756 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 757 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 758 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 759 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 760 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 761 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 762 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 763 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 764 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 765 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 766 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 767 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 768 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 769 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 770 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 771 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 772 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 773 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 774 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 775 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 776 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 777 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 778 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 779 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 780 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 781 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 782 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 783 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 784 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 785 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 786 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 787 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 788 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 789 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 790 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 791 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 792 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 793 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 794 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 795 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 796 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 797 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 798 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 799 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 800 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 801 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 802 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 803 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 804 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 805 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 806 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 807 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 808 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 809 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 810 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 811 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 812 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 813 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 814 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 815 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 816 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 817 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 818 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 819 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 820 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 821 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 822 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 823 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 824 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 825 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 826 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 827 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 828 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 829 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 830 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 831 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 832 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 833 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 834 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 835 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 836 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 837 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 838 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 839 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 840 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 841 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 842 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 843 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 844 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 845 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 846 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 847 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 848 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 849 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 850 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 851 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 852 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 853 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 854 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 855 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 856 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 857 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 858 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 859 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 860 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 861 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 862 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 863 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 864 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 865 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 866 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 867 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 868 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 869 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 870 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 871 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 872 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 873 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 874 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 875 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 876 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 877 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 878 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 879 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 880 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 881 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 882 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 883 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 884 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 885 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 886 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 887 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 888 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 889 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 890 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 891 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 892 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 893 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 894 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 895 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 896 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 897 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 898 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 899 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 900 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 901 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 902 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 903 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 904 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 905 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 906 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 907 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 908 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 909 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 910 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 911 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 912 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 913 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 914 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 915 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 916 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 917 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 918 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 919 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 920 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 921 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 922 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 923 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 924 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 925 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 926 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 927 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 928 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 929 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 930 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 931 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 932 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 933 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 934 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 935 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 936 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 937 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 938 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 939 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 940 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 941 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 942 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 943 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 944 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 945 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 946 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 947 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 948 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 949 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 950 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 951 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 952 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 953 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 954 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 955 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 956 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 957 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 958 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 959 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 960 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 961 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 962 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 963 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 964 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 965 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 966 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 967 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 968 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 969 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 970 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 971 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 972 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 973 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 974 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 975 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 976 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 977 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 978 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 979 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 980 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 981 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 982 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 983 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 984 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 985 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 986 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 987 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 988 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 989 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 990 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 991 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 992 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 993 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 994 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 995 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 996 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 997 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 998 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 999 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1000 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1001 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1002 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1003 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1004 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1005 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1006 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1007 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1008 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1009 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1010 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1011 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1012 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1013 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1014 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1015 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1016 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1017 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1018 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1019 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1020 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1021 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1022 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1023 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1024 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1025 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1026 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1027 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1028 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 1029 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1030 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1031 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 1032 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1033 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1034 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 1035 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1036 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1037 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 1038 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 1039 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 1040 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 1041 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 1042 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 1043 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 1044 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 1045 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 1046 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 1047 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 1048 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 1049 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 1050 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 1051 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 1052 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 1053 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 1054 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 1055 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 1056 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 1057 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 1058 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 1059 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 1060 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 1061 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 1062 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 1063 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 1064 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1065 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 1066 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 1067 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 1068 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 1069 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1070 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1071 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1072 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 1073 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 1074 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 1075 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1076 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1077 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1078 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1079 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1080 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 1081 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1082 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 1083 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 1084 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 1085 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 1086 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 1087 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 1088 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 1089 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1090 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 1091 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 1092 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 1093 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 1094 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 1095 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 1096 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 1097 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 1098 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 1099 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 1100 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1101 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 1102 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 1103 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 1104 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 1105 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1106 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 1107 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 1108 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1109 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 1110 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 1111 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1112 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1113 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 1114 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 1115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1116 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1117 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 1118 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 1119 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1120 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1121 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1122 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1123 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1124 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1125 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1126 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1127 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 1128 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1129 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1130 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 1131 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1132 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1133 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1134 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1135 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 1136 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1137 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 1138 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1139 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1140 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1141 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 1142 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1143 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 1144 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1145 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1146 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 1147 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1150 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1151 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1155 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1156 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1157 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1158 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1159 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1160 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1161 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1162 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1163 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1164 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1165 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1166 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1167 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1168 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1169 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1171 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1172 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1173 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1174 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1175 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1176 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1177 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1179 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1180 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1181 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1182 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1183 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1185 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1186 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1187 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1188 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1189 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1190 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1191 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 1192 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 1193 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1194 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1195 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1196 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1197 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 1198 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 1199 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1201 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1202 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1203 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1204 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1205 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1206 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1207 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1208 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1209 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1210 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1211 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1212 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 1213 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 1214 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1215 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1216 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 1217 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1218 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1219 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1220 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1221 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1222 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1223 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1224 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1225 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1226 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1227 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1228 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1229 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1230 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 1231 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1232 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 1233 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1234 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1235 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1236 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1237 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1238 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1239 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1240 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1241 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1242 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1243 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1244 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1245 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1246 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1247 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1248 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 1249 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1250 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1251 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1252 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1253 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1254 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1255 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1256 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1257 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1258 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1259 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1260 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1261 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1262 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1263 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1264 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1265 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1266 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1267 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1268 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1269 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1270 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1271 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1272 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1273 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1274 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1275 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1276 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1277 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1278 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1279 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1280 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1281 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1282 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1283 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1284 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1285 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1286 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1287 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1288 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1289 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1290 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1291 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1292 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1293 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1294 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1295 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1296 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1297 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1298 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1299 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1300 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1301 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1302 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1303 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1304 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1305 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1306 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1307 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1308 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1309 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1310 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1311 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1312 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 57.84 |
| Metatranscriptomes | 0.65 |
| Isolates | 41.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 13.25 |
| Nodule | 32.09 |
| Rhizoplane | 1.26 |
| Rhizosphere | 40.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C103 | 2010549000 | Bacteria | 1505 |
| 2 | JGI24740J21852_10019185 | 3300001979 | Bacteria | 2413 |
| 3 | JGI24739J22299_10005006 | 3300001989 | Bacteria | 5043 |
| 4 | JGI24739J22299_10086897 | 3300001989 | Bacteria | 955 |
| 5 | JGI24735J21928_10031234 | 3300002067 | Bacteria | 1579 |
| 6 | JGI25155J39150_1000010 | 3300002704 | Bacteria | 207717 |
| 7 | JGI25156J39149_1000033 | 3300002705 | Bacteria | 114688 |
| 8 | JGI25156J39149_1000186 | 3300002705 | Bacteria | 45132 |
| 9 | JGI25156J39149_1020859 | 3300002705 | Bacteria | 1143 |
| 10 | JGI25162J39368_1000413 | 3300002737 | Bacteria | 34872 |
| 11 | JGI25154J39366_1000187 | 3300002738 | Bacteria | 46590 |
| 12 | JGI25157J39369_1000009 | 3300002741 | Bacteria | 207868 |
| 13 | JGI25157J39369_1001145 | 3300002741 | Bacteria | 11504 |
| 14 | JGI25152J39213_1002996 | 3300002773 | Bacteria | 5979 |
| 15 | JGI25152J39213_1003625 | 3300002773 | Bacteria | 5214 |
| 16 | JGI25150J39212_1000061 | 3300002774 | Bacteria | 64691 |
| 17 | JGI25150J39212_1008264 | 3300002774 | Bacteria | 2046 |
| 18 | JGI25159J45721_1000095 | 3300002987 | Bacteria | 41848 |
| 19 | JGI25159J45721_1001470 | 3300002987 | Bacteria | 9709 |
| 20 | JGI25151J46595_10000081 | 3300003187 | Bacteria | 131317 |
| 21 | JGI25151J46595_10004446 | 3300003187 | Bacteria | 7418 |
| 22 | JGI25151J46595_10006138 | 3300003187 | Bacteria | 6093 |
| 23 | JGI25151J46595_10019526 | 3300003187 | Bacteria | 2877 |
| 24 | JGI25151J46595_10097824 | 3300003187 | Bacteria | 798 |
| 25 | JGI25406J46586_10032295 | 3300003203 | Bacteria | 1946 |
| 26 | JGI25165J46597_1000310 | 3300003214 | Bacteria | 59406 |
| 27 | JGI25165J46597_1000560 | 3300003214 | Bacteria | 33696 |
| 28 | JGI25165J46597_1001161 | 3300003214 | Bacteria | 16286 |
| 29 | JGI25153J46596_10002363 | 3300003215 | Bacteria | 10925 |
| 30 | JGI25153J46596_10002751 | 3300003215 | Bacteria | 10011 |
| 31 | JGI25153J46596_10031226 | 3300003215 | Bacteria | 1797 |
| 32 | JGI25153J46596_10081950 | 3300003215 | Bacteria | 802 |
| 33 | JGI25160J50197_1000085 | 3300003354 | Bacteria | 96359 |
| 34 | JGI25160J50197_1000247 | 3300003354 | Bacteria | 41848 |
| 35 | JGI25160J50197_1003745 | 3300003354 | Bacteria | 6702 |
| 36 | JGI25160J50197_1006221 | 3300003354 | Bacteria | 4856 |
| 37 | JGI25160J50197_1022172 | 3300003354 | Bacteria | 1867 |
| 38 | JGI25161J50226_1000065 | 3300003374 | Bacteria | 96359 |
| 39 | JGI25161J50226_1000136 | 3300003374 | Bacteria | 50681 |
| 40 | JGI25161J50226_1000853 | 3300003374 | Bacteria | 11310 |
| 41 | JGI25161J50226_1003104 | 3300003374 | Bacteria | 3957 |
| 42 | Ga0006562J51391_1055964 | 3300003578 | Bacteria | 14900 |
| 43 | Ga0006562J51391_1055965 | 3300003578 | Bacteria | 10100 |
| 44 | Ga0055542_1000373 | 3300003762 | Bacteria | 46236 |
| 45 | Ga0055529_1003026 | 3300003763 | Bacteria | 2944 |
| 46 | Ga0055526_1006261 | 3300003771 | Bacteria | 6519 |
| 47 | Ga0055526_1007490 | 3300003771 | Bacteria | 5657 |
| 48 | Ga0055526_1008265 | 3300003771 | Bacteria | 5222 |
| 49 | Ga0055526_1010341 | 3300003771 | Bacteria | 4356 |
| 50 | Ga0055526_1012355 | 3300003771 | Bacteria | 3737 |
| 51 | Ga0055524_1001281 | 3300003775 | Bacteria | 14737 |
| 52 | Ga0055524_1003268 | 3300003775 | Bacteria | 7936 |
| 53 | Ga0055524_1009629 | 3300003775 | Bacteria | 3906 |
| 54 | Ga0055524_1025110 | 3300003775 | Bacteria | 1873 |
| 55 | Ga0055536_1001218 | 3300003781 | Bacteria | 15948 |
| 56 | Ga0055536_1001688 | 3300003781 | Bacteria | 13068 |
| 57 | Ga0055536_1003846 | 3300003781 | Bacteria | 7901 |
| 58 | Ga0055528_1002915 | 3300003790 | Bacteria | 8890 |
| 59 | Ga0055528_1010563 | 3300003790 | Bacteria | 3744 |
| 60 | Ga0055528_1023567 | 3300003790 | Bacteria | 1873 |
| 61 | Ga0055530_10016258 | 3300003791 | Bacteria | 2387 |
| 62 | Ga0055540_1000789 | 3300003792 | Bacteria | 21439 |
| 63 | Ga0055540_1009670 | 3300003792 | Bacteria | 3299 |
| 64 | Ga0055540_1009673 | 3300003792 | Bacteria | 3298 |
| 65 | Ga0055540_1037182 | 3300003792 | Bacteria | 1075 |
| 66 | Ga0055540_1048437 | 3300003792 | Bacteria | 886 |
| 67 | Ga0055531_10004531 | 3300003794 | Bacteria | 8427 |
| 68 | Ga0055531_10011999 | 3300003794 | Bacteria | 4115 |
| 69 | Ga0055531_10058681 | 3300003794 | Bacteria | 955 |
| 70 | Ga0058692_1005178 | 3300003856 | Bacteria | 3749 |
| 71 | Ga0058692_1006935 | 3300003856 | Bacteria | 3054 |
| 72 | Ga0055543_1000067 | 3300004625 | Bacteria | 96039 |
| 73 | Ga0055543_1000228 | 3300004625 | Bacteria | 44611 |
| 74 | Ga0055543_1000496 | 3300004625 | Bacteria | 22765 |
| 75 | Ga0055543_1001108 | 3300004625 | Bacteria | 11622 |
| 76 | Ga0065165_1000237 | 3300005262 | Bacteria | 96039 |
| 77 | Ga0065165_1000804 | 3300005262 | Bacteria | 41886 |
| 78 | Ga0065165_1007131 | 3300005262 | Bacteria | 5600 |
| 79 | Ga0065165_1008692 | 3300005262 | Bacteria | 4697 |
| 80 | Ga0065715_10502147 | 3300005293 | Bacteria | 779 |
| 81 | Ga0070658_10028401 | 3300005327 | Bacteria | 4490 |
| 82 | Ga0070658_10073839 | 3300005327 | Bacteria | 2797 |
| 83 | Ga0070670_100000117 | 3300005331 | Bacteria | 74455 |
| 84 | Ga0070670_100501705 | 3300005331 | Bacteria | 1079 |
| 85 | Ga0070666_10302678 | 3300005335 | Bacteria | 1139 |
| 86 | Ga0070680_100029781 | 3300005336 | Bacteria | 4382 |
| 87 | Ga0070682_100157304 | 3300005337 | Bacteria | 1566 |
| 88 | Ga0068868_100115786 | 3300005338 | Bacteria | 2182 |
| 89 | Ga0070660_100016402 | 3300005339 | Bacteria | 5375 |
| 90 | Ga0070660_100038074 | 3300005339 | Bacteria | 3649 |
| 91 | Ga0070660_100166434 | 3300005339 | Bacteria | 1779 |
| 92 | Ga0070660_100526988 | 3300005339 | Bacteria | 984 |
| 93 | Ga0070661_100000296 | 3300005344 | Bacteria | 40209 |
| 94 | Ga0070661_100012968 | 3300005344 | Bacteria | 5843 |
| 95 | Ga0070661_100024245 | 3300005344 | Bacteria | 4351 |
| 96 | Ga0070661_100107162 | 3300005344 | Bacteria | 2084 |
| 97 | Ga0070668_100013003 | 3300005347 | Bacteria | 6198 |
| 98 | Ga0070668_100027637 | 3300005347 | Bacteria | 4307 |
| 99 | Ga0070669_100008498 | 3300005353 | Bacteria | 7327 |
| 100 | Ga0070669_100409453 | 3300005353 | Bacteria | 1111 |
| 101 | Ga0070669_100675388 | 3300005353 | Bacteria | 871 |
| 102 | Ga0070671_100016041 | 3300005355 | Bacteria | 6053 |
| 103 | Ga0070674_100018397 | 3300005356 | Bacteria | 4417 |
| 104 | Ga0070674_100237318 | 3300005356 | Bacteria | 1426 |
| 105 | Ga0070674_101220888 | 3300005356 | Bacteria | 668 |
| 106 | Ga0070673_100057713 | 3300005364 | Bacteria | 3067 |
| 107 | Ga0070659_100035513 | 3300005366 | Bacteria | 3881 |
| 108 | Ga0070659_100197099 | 3300005366 | Bacteria | 1657 |
| 109 | Ga0070659_100256634 | 3300005366 | Bacteria | 1450 |
| 110 | Ga0070667_100033713 | 3300005367 | Bacteria | 4283 |
| 111 | Ga0070709_10017337 | 3300005434 | Bacteria | 4129 |
| 112 | Ga0070709_10084634 | 3300005434 | Bacteria | 2077 |
| 113 | Ga0070709_10235681 | 3300005434 | Bacteria | 1312 |
| 114 | Ga0070714_100033220 | 3300005435 | Bacteria | 4313 |
| 115 | Ga0070714_100386106 | 3300005435 | Bacteria | 1321 |
| 116 | Ga0070714_100966881 | 3300005435 | Bacteria | 828 |
| 117 | Ga0070713_100460638 | 3300005436 | Bacteria | 1195 |
| 118 | Ga0070713_100599204 | 3300005436 | Bacteria | 1047 |
| 119 | Ga0070713_100905204 | 3300005436 | Bacteria | 849 |
| 120 | Ga0070710_10413748 | 3300005437 | Bacteria | 906 |
| 121 | Ga0070711_100576550 | 3300005439 | Bacteria | 936 |
| 122 | Ga0070700_100432498 | 3300005441 | Bacteria | 997 |
| 123 | Ga0070708_101662325 | 3300005445 | Bacteria | 594 |
| 124 | Ga0070663_100112459 | 3300005455 | Bacteria | 2048 |
| 125 | Ga0070663_100142237 | 3300005455 | Bacteria | 1833 |
| 126 | Ga0070663_100193263 | 3300005455 | Bacteria | 1585 |
| 127 | Ga0070663_100219303 | 3300005455 | Bacteria | 1492 |
| 128 | Ga0070678_100274208 | 3300005456 | Bacteria | 1424 |
| 129 | Ga0070678_100857650 | 3300005456 | Bacteria | 828 |
| 130 | Ga0070662_100573401 | 3300005457 | Bacteria | 947 |
| 131 | Ga0070662_100942425 | 3300005457 | Bacteria | 738 |
| 132 | Ga0070681_10174837 | 3300005458 | Bacteria | 2069 |
| 133 | Ga0070681_10293492 | 3300005458 | Bacteria | 1536 |
| 134 | Ga0070681_10466499 | 3300005458 | Bacteria | 1175 |
| 135 | Ga0070698_100007183 | 3300005471 | Bacteria | 12067 |
| 136 | Ga0070698_100118552 | 3300005471 | Bacteria | 2608 |
| 137 | Ga0070698_100571281 | 3300005471 | Bacteria | 1070 |
| 138 | Ga0070679_100027144 | 3300005530 | Bacteria | 5631 |
| 139 | Ga0070679_100280171 | 3300005530 | Bacteria | 1620 |
| 140 | Ga0068853_100001252 | 3300005539 | Bacteria | 18139 |
| 141 | Ga0068853_100005716 | 3300005539 | Bacteria | 9787 |
| 142 | Ga0068853_100031089 | 3300005539 | Bacteria | 4514 |
| 143 | Ga0068853_100563317 | 3300005539 | Bacteria | 1080 |
| 144 | Ga0070672_100076275 | 3300005543 | Bacteria | 2678 |
| 145 | Ga0070693_100089909 | 3300005547 | Bacteria | 1849 |
| 146 | Ga0070665_100005352 | 3300005548 | Bacteria | 13259 |
| 147 | Ga0070665_100015576 | 3300005548 | Bacteria | 7638 |
| 148 | Ga0070665_100032869 | 3300005548 | Bacteria | 5220 |
| 149 | Ga0070665_100177540 | 3300005548 | Bacteria | 2130 |
| 150 | Ga0070665_100300247 | 3300005548 | Bacteria | 1609 |
| 151 | Ga0070665_100336560 | 3300005548 | Bacteria | 1514 |
| 152 | Ga0070665_100457868 | 3300005548 | Bacteria | 1286 |
| 153 | Ga0070704_100407133 | 3300005549 | Bacteria | 1162 |
| 154 | Ga0068855_100060065 | 3300005563 | Bacteria | 4447 |
| 155 | Ga0068855_100108106 | 3300005563 | Bacteria | 3194 |
| 156 | Ga0068855_100257099 | 3300005563 | Bacteria | 1947 |
| 157 | Ga0068855_100264287 | 3300005563 | Bacteria | 1916 |
| 158 | Ga0068855_100389576 | 3300005563 | Bacteria | 1529 |
| 159 | Ga0068857_100346296 | 3300005577 | Bacteria | 1375 |
| 160 | Ga0068854_100005130 | 3300005578 | Bacteria | 8256 |
| 161 | Ga0068854_100043930 | 3300005578 | Bacteria | 3170 |
| 162 | Ga0068854_100241213 | 3300005578 | Bacteria | 1439 |
| 163 | Ga0068854_100440531 | 3300005578 | Bacteria | 1086 |
| 164 | Ga0068856_100026673 | 3300005614 | Bacteria | 5634 |
| 165 | Ga0068856_100162455 | 3300005614 | Bacteria | 2244 |
| 166 | Ga0068856_100246144 | 3300005614 | Bacteria | 1803 |
| 167 | Ga0068856_100348899 | 3300005614 | Bacteria | 1498 |
| 168 | Ga0068856_100639003 | 3300005614 | Bacteria | 1085 |
| 169 | Ga0068856_100723633 | 3300005614 | Bacteria | 1015 |
| 170 | Ga0070702_100499621 | 3300005615 | Bacteria | 893 |
| 171 | Ga0068852_100047717 | 3300005616 | Bacteria | 3655 |
| 172 | Ga0068852_100060673 | 3300005616 | Bacteria | 3283 |
| 173 | Ga0068852_100092597 | 3300005616 | Bacteria | 2707 |
| 174 | Ga0068852_100259378 | 3300005616 | Bacteria | 1668 |
| 175 | Ga0068864_100570136 | 3300005618 | Bacteria | 1096 |
| 176 | Ga0068851_10016887 | 3300005834 | Bacteria | 3498 |
| 177 | Ga0068851_10111015 | 3300005834 | Bacteria | 1464 |
| 178 | Ga0068870_10298444 | 3300005840 | Bacteria | 1016 |
| 179 | Ga0068858_100227085 | 3300005842 | Bacteria | 1769 |
| 180 | Ga0068862_100262437 | 3300005844 | Bacteria | 1577 |
| 181 | Ga0081455_10000455 | 3300005937 | Bacteria | 53708 |
| 182 | Ga0081455_10311331 | 3300005937 | Bacteria | 1125 |
| 183 | Ga0081540_1029085 | 3300005983 | Bacteria | 3087 |
| 184 | Ga0081540_1035798 | 3300005983 | Bacteria | 2657 |
| 185 | Ga0081539_10002004 | 3300005985 | Bacteria | 30879 |
| 186 | Ga0070717_10002293 | 3300006028 | Bacteria | 13425 |
| 187 | Ga0075365_10004176 | 3300006038 | Bacteria | 7605 |
| 188 | Ga0075365_10006633 | 3300006038 | Bacteria | 6390 |
| 189 | Ga0075365_10011265 | 3300006038 | Bacteria | 5253 |
| 190 | Ga0075365_10023551 | 3300006038 | Bacteria | 3874 |
| 191 | Ga0075365_10052752 | 3300006038 | Bacteria | 2691 |
| 192 | Ga0075365_10288533 | 3300006038 | Bacteria | 1155 |
| 193 | Ga0075365_10382480 | 3300006038 | Bacteria | 993 |
| 194 | Ga0075368_10005353 | 3300006042 | Bacteria | 4410 |
| 195 | Ga0075368_10027055 | 3300006042 | Bacteria | 2210 |
| 196 | Ga0075368_10035760 | 3300006042 | Bacteria | 1939 |
| 197 | Ga0075363_100049065 | 3300006048 | Bacteria | 2247 |
| 198 | Ga0075363_100089591 | 3300006048 | Bacteria | 1691 |
| 199 | Ga0075363_100094838 | 3300006048 | Bacteria | 1645 |
| 200 | Ga0075363_100120761 | 3300006048 | Bacteria | 1463 |
| 201 | Ga0075363_100391793 | 3300006048 | Bacteria | 815 |
| 202 | Ga0075364_10000157 | 3300006051 | Bacteria | 29932 |
| 203 | Ga0075364_10003611 | 3300006051 | Bacteria | 8817 |
| 204 | Ga0075364_10010836 | 3300006051 | Bacteria | 5520 |
| 205 | Ga0075364_10047128 | 3300006051 | Bacteria | 2807 |
| 206 | Ga0075364_10149669 | 3300006051 | Bacteria | 1573 |
| 207 | Ga0075364_10447909 | 3300006051 | Bacteria | 882 |
| 208 | Ga0070716_100050646 | 3300006173 | Bacteria | 2358 |
| 209 | Ga0070716_100390035 | 3300006173 | Bacteria | 998 |
| 210 | Ga0070712_100010231 | 3300006175 | Bacteria | 5914 |
| 211 | Ga0070712_100097656 | 3300006175 | Bacteria | 2165 |
| 212 | Ga0075362_10000293 | 3300006177 | Bacteria | 14125 |
| 213 | Ga0075362_10006767 | 3300006177 | Bacteria | 4286 |
| 214 | Ga0075362_10007354 | 3300006177 | Bacteria | 4166 |
| 215 | Ga0075362_10020155 | 3300006177 | Bacteria | 2783 |
| 216 | Ga0075362_10060453 | 3300006177 | Bacteria | 1713 |
| 217 | Ga0075362_10102680 | 3300006177 | Bacteria | 1338 |
| 218 | Ga0075362_10355401 | 3300006177 | Bacteria | 734 |
| 219 | Ga0075367_10001300 | 3300006178 | Bacteria | 10583 |
| 220 | Ga0075367_10001485 | 3300006178 | Bacteria | 10122 |
| 221 | Ga0075367_10031249 | 3300006178 | Bacteria | 3057 |
| 222 | Ga0075367_10074556 | 3300006178 | Bacteria | 2046 |
| 223 | Ga0075367_10087198 | 3300006178 | Bacteria | 1895 |
| 224 | Ga0075367_10183797 | 3300006178 | Bacteria | 1304 |
| 225 | Ga0075367_10248519 | 3300006178 | Bacteria | 1115 |
| 226 | Ga0075367_10302709 | 3300006178 | Bacteria | 1006 |
| 227 | Ga0075367_10307118 | 3300006178 | Bacteria | 999 |
| 228 | Ga0075367_10622784 | 3300006178 | Bacteria | 686 |
| 229 | Ga0075369_10000770 | 3300006186 | Bacteria | 10465 |
| 230 | Ga0075369_10097842 | 3300006186 | Bacteria | 1314 |
| 231 | Ga0075369_10225645 | 3300006186 | Bacteria | 867 |
| 232 | Ga0075366_10053986 | 3300006195 | Bacteria | 2387 |
| 233 | Ga0075366_10067308 | 3300006195 | Bacteria | 2131 |
| 234 | Ga0075366_10084259 | 3300006195 | Bacteria | 1900 |
| 235 | Ga0075366_10245143 | 3300006195 | Bacteria | 1093 |
| 236 | Ga0075370_10011674 | 3300006353 | Bacteria | 4623 |
| 237 | Ga0075370_10018590 | 3300006353 | Bacteria | 3773 |
| 238 | Ga0075370_10038072 | 3300006353 | Bacteria | 2706 |
| 239 | Ga0075370_10085817 | 3300006353 | Bacteria | 1813 |
| 240 | Ga0075370_10112335 | 3300006353 | Bacteria | 1583 |
| 241 | Ga0075370_10437222 | 3300006353 | Bacteria | 787 |
| 242 | Ga0075370_10480422 | 3300006353 | Bacteria | 749 |
| 243 | Ga0075434_100087692 | 3300006871 | Bacteria | 3113 |
| 244 | Ga0075434_100695696 | 3300006871 | Bacteria | 1034 |
| 245 | Ga0068865_100423903 | 3300006881 | Bacteria | 1095 |
| 246 | Ga0079104_1000101 | 3300006946 | Bacteria | 125456 |
| 247 | Ga0079104_1003469 | 3300006946 | Bacteria | 7301 |
| 248 | Ga0099826_10000025 | 3300006948 | Bacteria | 146840 |
| 249 | Ga0099826_10119128 | 3300006948 | Bacteria | 1558 |
| 250 | Ga0099795_10026661 | 3300007788 | Bacteria | 1949 |
| 251 | Ga0105244_10056525 | 3300009036 | Bacteria | 1986 |
| 252 | Ga0105240_10185538 | 3300009093 | Bacteria | 2450 |
| 253 | Ga0105240_10394474 | 3300009093 | Bacteria | 1560 |
| 254 | Ga0105240_10522780 | 3300009093 | Bacteria | 1316 |
| 255 | Ga0105240_10593790 | 3300009093 | Bacteria | 1220 |
| 256 | Ga0105245_10002744 | 3300009098 | Bacteria | 15829 |
| 257 | Ga0105245_11239150 | 3300009098 | Bacteria | 794 |
| 258 | Ga0105245_11874825 | 3300009098 | Bacteria | 653 |
| 259 | Ga0105243_10024593 | 3300009148 | Bacteria | 4595 |
| 260 | Ga0105243_10450830 | 3300009148 | Bacteria | 1207 |
| 261 | Ga0105243_10547021 | 3300009148 | Bacteria | 1105 |
| 262 | Ga0105243_11666717 | 3300009148 | Bacteria | 666 |
| 263 | Ga0105241_10116885 | 3300009174 | Bacteria | 2142 |
| 264 | Ga0105241_10288863 | 3300009174 | Bacteria | 1403 |
| 265 | Ga0105241_10302386 | 3300009174 | Bacteria | 1373 |
| 266 | Ga0105248_10689207 | 3300009177 | Bacteria | 1153 |
| 267 | Ga0105237_10357992 | 3300009545 | Bacteria | 1464 |
| 268 | Ga0105238_10056299 | 3300009551 | Bacteria | 3946 |
| 269 | Ga0105238_10100900 | 3300009551 | Bacteria | 2869 |
| 270 | Ga0105238_10134744 | 3300009551 | Bacteria | 2448 |
| 271 | Ga0105249_10843282 | 3300009553 | Bacteria | 982 |
| 272 | Ga0105249_10909470 | 3300009553 | Bacteria | 947 |
| 273 | Ga0123341_1000187 | 3300009765 | Bacteria | 31482 |
| 274 | Ga0123341_1107456 | 3300009765 | Bacteria | 885 |
| 275 | Ga0123342_1010657 | 3300009766 | Bacteria | 10417 |
| 276 | Ga0123342_1021786 | 3300009766 | Bacteria | 4447 |
| 277 | Ga0099796_10026125 | 3300010159 | Bacteria | 1851 |
| 278 | Ga0105239_10190855 | 3300010375 | Bacteria | 2293 |
| 279 | Ga0105239_10247749 | 3300010375 | Bacteria | 2001 |
| 280 | Ga0105239_11501822 | 3300010375 | Bacteria | 779 |
| 281 | Ga0105239_12099761 | 3300010375 | Bacteria | 656 |
| 282 | Ga0105246_10507415 | 3300011119 | Bacteria | 1025 |
| 283 | Ga0105246_10992854 | 3300011119 | Bacteria | 759 |
| 284 | Ga0105246_11143753 | 3300011119 | Bacteria | 713 |
| 285 | Ga0157314_1003929 | 3300012500 | Bacteria | 1074 |
| 286 | Ga0157313_1001120 | 3300012503 | Bacteria | 1392 |
| 287 | Ga0157373_10000538 | 3300013100 | Bacteria | 29637 |
| 288 | Ga0157373_10315789 | 3300013100 | Bacteria | 1111 |
| 289 | Ga0157373_10414892 | 3300013100 | Bacteria | 966 |
| 290 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 291 | Ga0157371_10051193 | 3300013102 | Bacteria | 2934 |
| 292 | Ga0157371_10362901 | 3300013102 | Bacteria | 1056 |
| 293 | Ga0157371_10467772 | 3300013102 | Bacteria | 928 |
| 294 | Ga0157370_10001468 | 3300013104 | Bacteria | 29148 |
| 295 | Ga0157370_10002446 | 3300013104 | Bacteria | 22403 |
| 296 | Ga0157370_10073529 | 3300013104 | Bacteria | 3225 |
| 297 | Ga0157370_10092381 | 3300013104 | Bacteria | 2841 |
| 298 | Ga0157370_10241426 | 3300013104 | Bacteria | 1671 |
| 299 | Ga0157369_10054796 | 3300013105 | Bacteria | 4305 |
| 300 | Ga0157369_10068264 | 3300013105 | Bacteria | 3819 |
| 301 | Ga0157369_10431985 | 3300013105 | Bacteria | 1365 |
| 302 | Ga0157369_10667326 | 3300013105 | Bacteria | 1071 |
| 303 | Ga0157374_10038063 | 3300013296 | Bacteria | 4419 |
| 304 | Ga0163162_10831721 | 3300013306 | Bacteria | 1039 |
| 305 | Ga0157372_10176020 | 3300013307 | Bacteria | 2476 |
| 306 | Ga0157372_10977776 | 3300013307 | Bacteria | 981 |
| 307 | Ga0157372_11201125 | 3300013307 | Bacteria | 876 |
| 308 | Ga0157380_10446605 | 3300014326 | Bacteria | 1241 |
| 309 | Ga0182008_10031185 | 3300014497 | Bacteria | 2684 |
| 310 | Ga0157379_10806308 | 3300014968 | Bacteria | 886 |
| 311 | Ga0157379_11103406 | 3300014968 | Bacteria | 760 |
| 312 | Ga0182006_1070635 | 3300015261 | Bacteria | 1296 |
| 313 | Ga0183363_1270 | 3300015690 | Bacteria | 8323 |
| 314 | Ga0163161_10025594 | 3300017792 | Bacteria | 4177 |
| 315 | Ga0163161_10575580 | 3300017792 | Bacteria | 926 |
| 316 | Ga0163161_10594470 | 3300017792 | Bacteria | 912 |
| 317 | Ga0214544_1000132 | 3300021320 | Bacteria | 108681 |
| 318 | Ga0214542_1004982 | 3300021321 | Bacteria | 25735 |
| 319 | Ga0214542_1027376 | 3300021321 | Bacteria | 2620 |
| 320 | Ga0214543_1000008 | 3300021327 | Bacteria | 385680 |
| 321 | Ga0214543_1000102 | 3300021327 | Bacteria | 108906 |
| 322 | Ga0213873_10119079 | 3300021358 | Bacteria | 774 |
| 323 | Ga0213874_10017735 | 3300021377 | Bacteria | 1914 |
| 324 | Ga0213874_10039805 | 3300021377 | Bacteria | 1401 |
| 325 | Ga0213874_10240690 | 3300021377 | Bacteria | 664 |
| 326 | Ga0213876_10000074 | 3300021384 | Bacteria | 120394 |
| 327 | Ga0213876_10001741 | 3300021384 | Bacteria | 13209 |
| 328 | Ga0228711_1000022 | 3300022739 | Bacteria | 107483 |
| 329 | Ga0228710_1000028 | 3300022740 | Bacteria | 102538 |
| 330 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 331 | Ga0209760_100811 | 3300025207 | Bacteria | 4237 |
| 332 | Ga0209436_100089 | 3300025208 | Bacteria | 45843 |
| 333 | Ga0209436_100658 | 3300025208 | Bacteria | 14733 |
| 334 | Ga0209436_104215 | 3300025208 | Bacteria | 3600 |
| 335 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 336 | Ga0209437_100902 | 3300025233 | Bacteria | 11804 |
| 337 | Ga0207425_1000034 | 3300025245 | Bacteria | 227886 |
| 338 | Ga0207425_1001593 | 3300025245 | Bacteria | 9200 |
| 339 | Ga0207425_1004102 | 3300025245 | Bacteria | 4457 |
| 340 | Ga0207425_1019678 | 3300025245 | Bacteria | 1450 |
| 341 | Ga0207425_1043848 | 3300025245 | Bacteria | 841 |
| 342 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 343 | Ga0209646_1012231 | 3300025246 | Bacteria | 1320 |
| 344 | Ga0209026_1000068 | 3300025250 | Bacteria | 207601 |
| 345 | Ga0209026_1000228 | 3300025250 | Bacteria | 77019 |
| 346 | Ga0209148_1000069 | 3300025254 | Bacteria | 334444 |
| 347 | Ga0209148_1007004 | 3300025254 | Bacteria | 2382 |
| 348 | Ga0209148_1021821 | 3300025254 | Bacteria | 1036 |
| 349 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 350 | Ga0209759_1000183 | 3300025256 | Bacteria | 102218 |
| 351 | Ga0209129_1000094 | 3300025258 | Bacteria | 172051 |
| 352 | Ga0209129_1000290 | 3300025258 | Bacteria | 47943 |
| 353 | Ga0209129_1000519 | 3300025258 | Bacteria | 27449 |
| 354 | Ga0209129_1002114 | 3300025258 | Bacteria | 10121 |
| 355 | Ga0209129_1003585 | 3300025258 | Bacteria | 6645 |
| 356 | Ga0209129_1003749 | 3300025258 | Bacteria | 6418 |
| 357 | Ga0209129_1004237 | 3300025258 | Bacteria | 5740 |
| 358 | Ga0209233_1000030 | 3300025261 | Bacteria | 636702 |
| 359 | Ga0209233_1000134 | 3300025261 | Bacteria | 202535 |
| 360 | Ga0209233_1000343 | 3300025261 | Bacteria | 45433 |
| 361 | Ga0209233_1001986 | 3300025261 | Bacteria | 7748 |
| 362 | Ga0209233_1016673 | 3300025261 | Bacteria | 2018 |
| 363 | Ga0209565_1016275 | 3300025263 | Bacteria | 1657 |
| 364 | Ga0209455_1000317 | 3300025272 | Bacteria | 48015 |
| 365 | Ga0209673_1000158 | 3300025273 | Bacteria | 143067 |
| 366 | Ga0209673_1000283 | 3300025273 | Bacteria | 94995 |
| 367 | Ga0209673_1000771 | 3300025273 | Bacteria | 43169 |
| 368 | Ga0209673_1001504 | 3300025273 | Bacteria | 21530 |
| 369 | Ga0209673_1003477 | 3300025273 | Bacteria | 9250 |
| 370 | Ga0209673_1003564 | 3300025273 | Bacteria | 9065 |
| 371 | Ga0209673_1003775 | 3300025273 | Bacteria | 8614 |
| 372 | Ga0209673_1004667 | 3300025273 | Bacteria | 7238 |
| 373 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 374 | Ga0209130_1000265 | 3300025284 | Bacteria | 65775 |
| 375 | Ga0209130_1000465 | 3300025284 | Bacteria | 41986 |
| 376 | Ga0209130_1015015 | 3300025284 | Bacteria | 1923 |
| 377 | Ga0209130_1041671 | 3300025284 | Bacteria | 882 |
| 378 | Ga0209675_1038367 | 3300025291 | Bacteria | 1068 |
| 379 | Ga0209676_1000038 | 3300025292 | Bacteria | 449305 |
| 380 | Ga0209676_1000539 | 3300025292 | Bacteria | 58730 |
| 381 | Ga0209676_1010592 | 3300025292 | Bacteria | 3816 |
| 382 | Ga0209676_1021463 | 3300025292 | Bacteria | 2168 |
| 383 | Ga0209676_1024037 | 3300025292 | Bacteria | 1982 |
| 384 | Ga0209676_1035340 | 3300025292 | Bacteria | 1466 |
| 385 | Ga0209025_1000184 | 3300025294 | Bacteria | 155611 |
| 386 | Ga0209025_1000245 | 3300025294 | Bacteria | 127801 |
| 387 | Ga0209025_1000581 | 3300025294 | Bacteria | 66321 |
| 388 | Ga0209025_1000725 | 3300025294 | Bacteria | 55900 |
| 389 | Ga0209025_1002093 | 3300025294 | Bacteria | 22567 |
| 390 | Ga0209025_1003260 | 3300025294 | Bacteria | 15630 |
| 391 | Ga0209025_1012441 | 3300025294 | Bacteria | 5451 |
| 392 | Ga0209025_1057164 | 3300025294 | Bacteria | 1493 |
| 393 | Ga0209564_1000381 | 3300025295 | Bacteria | 81150 |
| 394 | Ga0209564_1000960 | 3300025295 | Bacteria | 36623 |
| 395 | Ga0209564_1003061 | 3300025295 | Bacteria | 11875 |
| 396 | Ga0209564_1003163 | 3300025295 | Bacteria | 11588 |
| 397 | Ga0209564_1010609 | 3300025295 | Bacteria | 4219 |
| 398 | Ga0209758_1000159 | 3300025297 | Bacteria | 155588 |
| 399 | Ga0209758_1000265 | 3300025297 | Bacteria | 104078 |
| 400 | Ga0209758_1000462 | 3300025297 | Bacteria | 67358 |
| 401 | Ga0209758_1001526 | 3300025297 | Bacteria | 26781 |
| 402 | Ga0209758_1002391 | 3300025297 | Bacteria | 19295 |
| 403 | Ga0209758_1002525 | 3300025297 | Bacteria | 18509 |
| 404 | Ga0209758_1002933 | 3300025297 | Bacteria | 16417 |
| 405 | Ga0209758_1008637 | 3300025297 | Bacteria | 6541 |
| 406 | Ga0209758_1028509 | 3300025297 | Bacteria | 2358 |
| 407 | Ga0209050_1004927 | 3300025298 | Bacteria | 8718 |
| 408 | Ga0209050_1006083 | 3300025298 | Bacteria | 7294 |
| 409 | Ga0209050_1007118 | 3300025298 | Bacteria | 6390 |
| 410 | Ga0209050_1008284 | 3300025298 | Bacteria | 5598 |
| 411 | Ga0209256_1000440 | 3300025299 | Bacteria | 63735 |
| 412 | Ga0209256_1000892 | 3300025299 | Bacteria | 36721 |
| 413 | Ga0209256_1001107 | 3300025299 | Bacteria | 30848 |
| 414 | Ga0209256_1006273 | 3300025299 | Bacteria | 6381 |
| 415 | Ga0209256_1014284 | 3300025299 | Bacteria | 2868 |
| 416 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 417 | Ga0207426_1000048 | 3300025302 | Bacteria | 409127 |
| 418 | Ga0207426_1000309 | 3300025302 | Bacteria | 96053 |
| 419 | Ga0207426_1000646 | 3300025302 | Bacteria | 43187 |
| 420 | Ga0207426_1003476 | 3300025302 | Bacteria | 8516 |
| 421 | Ga0209051_1001304 | 3300025303 | Bacteria | 21914 |
| 422 | Ga0209051_1002360 | 3300025303 | Bacteria | 13662 |
| 423 | Ga0209051_1002835 | 3300025303 | Bacteria | 11944 |
| 424 | Ga0209051_1004388 | 3300025303 | Bacteria | 8723 |
| 425 | Ga0209051_1004410 | 3300025303 | Bacteria | 8691 |
| 426 | Ga0209051_1054500 | 3300025303 | Bacteria | 1304 |
| 427 | Ga0209051_1101445 | 3300025303 | Bacteria | 773 |
| 428 | Ga0209257_1000060 | 3300025304 | Bacteria | 372267 |
| 429 | Ga0209257_1001125 | 3300025304 | Bacteria | 34448 |
| 430 | Ga0209257_1006305 | 3300025304 | Bacteria | 7736 |
| 431 | Ga0209257_1007702 | 3300025304 | Bacteria | 6426 |
| 432 | Ga0209257_1031615 | 3300025304 | Bacteria | 1690 |
| 433 | Ga0209257_1063100 | 3300025304 | Bacteria | 1000 |
| 434 | Ga0207713_1071064 | 3300025735 | Bacteria | 1285 |
| 435 | Ga0207692_10631129 | 3300025898 | Bacteria | 691 |
| 436 | Ga0207710_10154357 | 3300025900 | Bacteria | 1115 |
| 437 | Ga0207688_10279851 | 3300025901 | Bacteria | 1016 |
| 438 | Ga0207680_10281379 | 3300025903 | Bacteria | 1156 |
| 439 | Ga0207647_10032473 | 3300025904 | Bacteria | 3352 |
| 440 | Ga0207647_10053199 | 3300025904 | Bacteria | 2496 |
| 441 | Ga0207647_10118430 | 3300025904 | Bacteria | 1562 |
| 442 | Ga0207647_10201441 | 3300025904 | Bacteria | 1151 |
| 443 | Ga0207699_10046469 | 3300025906 | Bacteria | 2540 |
| 444 | Ga0207699_10061156 | 3300025906 | Bacteria | 2265 |
| 445 | Ga0207699_10423327 | 3300025906 | Bacteria | 951 |
| 446 | Ga0207645_10027448 | 3300025907 | Bacteria | 3676 |
| 447 | Ga0207705_10001133 | 3300025909 | Bacteria | 21689 |
| 448 | Ga0207705_10079479 | 3300025909 | Bacteria | 2388 |
| 449 | Ga0207705_10085130 | 3300025909 | Bacteria | 2309 |
| 450 | Ga0207705_10143375 | 3300025909 | Bacteria | 1785 |
| 451 | Ga0207705_10222022 | 3300025909 | Bacteria | 1436 |
| 452 | Ga0207684_10055486 | 3300025910 | Bacteria | 3361 |
| 453 | Ga0207684_10534251 | 3300025910 | Bacteria | 1004 |
| 454 | Ga0207654_10227493 | 3300025911 | Bacteria | 1240 |
| 455 | Ga0207654_10608385 | 3300025911 | Bacteria | 780 |
| 456 | Ga0207707_10067233 | 3300025912 | Bacteria | 3122 |
| 457 | Ga0207707_10256007 | 3300025912 | Bacteria | 1520 |
| 458 | Ga0207707_10471559 | 3300025912 | Bacteria | 1073 |
| 459 | Ga0207707_10483369 | 3300025912 | Bacteria | 1058 |
| 460 | Ga0207695_10409873 | 3300025913 | Bacteria | 1240 |
| 461 | Ga0207695_10414699 | 3300025913 | Bacteria | 1231 |
| 462 | Ga0207695_10543581 | 3300025913 | Bacteria | 1043 |
| 463 | Ga0207695_10854070 | 3300025913 | Bacteria | 790 |
| 464 | Ga0207671_10000177 | 3300025914 | Bacteria | 97072 |
| 465 | Ga0207671_10095065 | 3300025914 | Bacteria | 2250 |
| 466 | Ga0207671_10133677 | 3300025914 | Bacteria | 1906 |
| 467 | Ga0207671_10206144 | 3300025914 | Bacteria | 1537 |
| 468 | Ga0207693_10339374 | 3300025915 | Bacteria | 1176 |
| 469 | Ga0207663_10194392 | 3300025916 | Bacteria | 1459 |
| 470 | Ga0207663_10349901 | 3300025916 | Bacteria | 1118 |
| 471 | Ga0207660_10018910 | 3300025917 | Bacteria | 4600 |
| 472 | Ga0207657_10006597 | 3300025919 | Bacteria | 12018 |
| 473 | Ga0207657_10012909 | 3300025919 | Bacteria | 8215 |
| 474 | Ga0207657_10125620 | 3300025919 | Bacteria | 2107 |
| 475 | Ga0207657_10131743 | 3300025919 | Bacteria | 2048 |
| 476 | Ga0207649_10001157 | 3300025920 | Bacteria | 15886 |
| 477 | Ga0207649_10100278 | 3300025920 | Bacteria | 1915 |
| 478 | Ga0207649_10210782 | 3300025920 | Bacteria | 1378 |
| 479 | Ga0207652_10477491 | 3300025921 | Bacteria | 1123 |
| 480 | Ga0207652_10911058 | 3300025921 | Bacteria | 776 |
| 481 | Ga0207681_10117602 | 3300025923 | Bacteria | 1944 |
| 482 | Ga0207681_10419238 | 3300025923 | Bacteria | 1084 |
| 483 | Ga0207694_10351430 | 3300025924 | Bacteria | 1220 |
| 484 | Ga0207694_10885412 | 3300025924 | Bacteria | 755 |
| 485 | Ga0207650_10000206 | 3300025925 | Bacteria | 67660 |
| 486 | Ga0207659_10392284 | 3300025926 | Bacteria | 1159 |
| 487 | Ga0207687_10051378 | 3300025927 | Bacteria | 2874 |
| 488 | Ga0207687_10417212 | 3300025927 | Bacteria | 1107 |
| 489 | Ga0207687_10563238 | 3300025927 | Bacteria | 957 |
| 490 | Ga0207687_10719552 | 3300025927 | Bacteria | 848 |
| 491 | Ga0207700_10485354 | 3300025928 | Bacteria | 1092 |
| 492 | Ga0207700_10896745 | 3300025928 | Bacteria | 793 |
| 493 | Ga0207664_10169360 | 3300025929 | Bacteria | 1868 |
| 494 | Ga0207664_10377512 | 3300025929 | Bacteria | 1258 |
| 495 | Ga0207664_10707083 | 3300025929 | Bacteria | 906 |
| 496 | Ga0207644_10060751 | 3300025931 | Bacteria | 2735 |
| 497 | Ga0207690_10079684 | 3300025932 | Bacteria | 2283 |
| 498 | Ga0207690_10133448 | 3300025932 | Bacteria | 1820 |
| 499 | Ga0207690_10150289 | 3300025932 | Bacteria | 1726 |
| 500 | Ga0207690_10258408 | 3300025932 | Bacteria | 1348 |
| 501 | Ga0207706_10019600 | 3300025933 | Bacteria | 6085 |
| 502 | Ga0207709_10466523 | 3300025935 | Bacteria | 979 |
| 503 | Ga0207670_10919524 | 3300025936 | Bacteria | 733 |
| 504 | Ga0207669_10065440 | 3300025937 | Bacteria | 2255 |
| 505 | Ga0207704_10652192 | 3300025938 | Bacteria | 867 |
| 506 | Ga0207704_11141340 | 3300025938 | Bacteria | 663 |
| 507 | Ga0207665_10058456 | 3300025939 | Bacteria | 2607 |
| 508 | Ga0207665_10275933 | 3300025939 | Bacteria | 1250 |
| 509 | Ga0207691_10081034 | 3300025940 | Bacteria | 2918 |
| 510 | Ga0207711_10048402 | 3300025941 | Bacteria | 3637 |
| 511 | Ga0207661_10267073 | 3300025944 | Bacteria | 1526 |
| 512 | Ga0207667_10016808 | 3300025949 | Bacteria | 8254 |
| 513 | Ga0207667_10071271 | 3300025949 | Bacteria | 3614 |
| 514 | Ga0207667_10134484 | 3300025949 | Bacteria | 2546 |
| 515 | Ga0207667_10203312 | 3300025949 | Bacteria | 2031 |
| 516 | Ga0207667_10380655 | 3300025949 | Bacteria | 1438 |
| 517 | Ga0207712_10475390 | 3300025961 | Bacteria | 1064 |
| 518 | Ga0207668_10007643 | 3300025972 | Bacteria | 6434 |
| 519 | Ga0207668_10197804 | 3300025972 | Bacteria | 1598 |
| 520 | Ga0207640_10082243 | 3300025981 | Bacteria | 2204 |
| 521 | Ga0207640_10517991 | 3300025981 | Bacteria | 996 |
| 522 | Ga0207640_10562269 | 3300025981 | Bacteria | 960 |
| 523 | Ga0207640_10898440 | 3300025981 | Bacteria | 773 |
| 524 | Ga0207658_10349383 | 3300025986 | Bacteria | 1287 |
| 525 | Ga0207658_10353083 | 3300025986 | Bacteria | 1281 |
| 526 | Ga0207658_11176451 | 3300025986 | Bacteria | 701 |
| 527 | Ga0207677_10329860 | 3300026023 | Bacteria | 1271 |
| 528 | Ga0207677_10643058 | 3300026023 | Bacteria | 935 |
| 529 | Ga0207639_10000849 | 3300026041 | Bacteria | 20766 |
| 530 | Ga0207639_10001693 | 3300026041 | Bacteria | 14889 |
| 531 | Ga0207639_10215902 | 3300026041 | Bacteria | 1654 |
| 532 | Ga0207639_10405333 | 3300026041 | Bacteria | 1229 |
| 533 | Ga0207678_10020346 | 3300026067 | Bacteria | 5823 |
| 534 | Ga0207678_10095428 | 3300026067 | Bacteria | 2542 |
| 535 | Ga0207678_10126030 | 3300026067 | Bacteria | 2184 |
| 536 | Ga0207678_10214409 | 3300026067 | Bacteria | 1647 |
| 537 | Ga0207702_10012990 | 3300026078 | Bacteria | 6926 |
| 538 | Ga0207702_10100471 | 3300026078 | Bacteria | 2552 |
| 539 | Ga0207702_10118579 | 3300026078 | Bacteria | 2365 |
| 540 | Ga0207702_10220251 | 3300026078 | Bacteria | 1768 |
| 541 | Ga0207702_10541531 | 3300026078 | Bacteria | 1138 |
| 542 | Ga0207702_10704290 | 3300026078 | Bacteria | 995 |
| 543 | Ga0207648_10128230 | 3300026089 | Bacteria | 2232 |
| 544 | Ga0207676_10355690 | 3300026095 | Bacteria | 1356 |
| 545 | Ga0207676_10575492 | 3300026095 | Bacteria | 1079 |
| 546 | Ga0207674_10097480 | 3300026116 | Bacteria | 2924 |
| 547 | Ga0207674_10586338 | 3300026116 | Bacteria | 1077 |
| 548 | Ga0207675_100443710 | 3300026118 | Bacteria | 1285 |
| 549 | Ga0207683_10061765 | 3300026121 | Bacteria | 3298 |
| 550 | Ga0207683_10458199 | 3300026121 | Bacteria | 1176 |
| 551 | Ga0207698_10039501 | 3300026142 | Bacteria | 3497 |
| 552 | Ga0207698_10094689 | 3300026142 | Bacteria | 2456 |
| 553 | Ga0207698_10168960 | 3300026142 | Bacteria | 1923 |
| 554 | Ga0207698_10391489 | 3300026142 | Bacteria | 1325 |
| 555 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 556 | Ga0209281_1000247 | 3300027111 | Bacteria | 107495 |
| 557 | Ga0209281_1000628 | 3300027111 | Bacteria | 39061 |
| 558 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 559 | Ga0209371_1000340 | 3300027312 | Bacteria | 51178 |
| 560 | Ga0209371_1001537 | 3300027312 | Bacteria | 15275 |
| 561 | Ga0209371_1036922 | 3300027312 | Bacteria | 1018 |
| 562 | Ga0209983_1012619 | 3300027665 | Bacteria | 1735 |
| 563 | Ga0209282_1000037 | 3300027666 | Bacteria | 130160 |
| 564 | Ga0209282_1000130 | 3300027666 | Bacteria | 46001 |
| 565 | Ga0209282_1111015 | 3300027666 | Bacteria | 1392 |
| 566 | Ga0209813_10001200 | 3300027866 | Bacteria | 5787 |
| 567 | Ga0209974_10310239 | 3300027876 | Bacteria | 605 |
| 568 | Ga0207428_10196817 | 3300027907 | Bacteria | 1517 |
| 569 | Ga0268266_10002019 | 3300028379 | Bacteria | 22623 |
| 570 | Ga0268266_10003518 | 3300028379 | Bacteria | 15546 |
| 571 | Ga0268266_10006863 | 3300028379 | Bacteria | 10364 |
| 572 | Ga0268266_10272937 | 3300028379 | Bacteria | 1570 |
| 573 | Ga0268266_10527024 | 3300028379 | Bacteria | 1130 |
| 574 | Ga0268266_10536901 | 3300028379 | Bacteria | 1119 |
| 575 | Ga0268266_11188042 | 3300028379 | Bacteria | 738 |
| 576 | Ga0268266_11412693 | 3300028379 | Bacteria | 671 |
| 577 | Ga0268265_10129874 | 3300028380 | Bacteria | 2092 |
| 578 | Ga0265318_10000737 | 3300028577 | Bacteria | 21809 |
| 579 | Ga0265318_10066028 | 3300028577 | Bacteria | 1345 |
| 580 | Ga0265318_10066634 | 3300028577 | Bacteria | 1337 |
| 581 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 582 | Ga0307515_10046556 | 3300028794 | Bacteria | 6625 |
| 583 | Ga0307515_10071980 | 3300028794 | Bacteria | 4675 |
| 584 | Ga0265338_10063693 | 3300028800 | Bacteria | 3213 |
| 585 | Ga0265338_10165595 | 3300028800 | Bacteria | 1702 |
| 586 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 587 | Ga0268256_1000728 | 3300030500 | Bacteria | 24256 |
| 588 | Ga0268256_1041783 | 3300030500 | Bacteria | 1022 |
| 589 | Ga0316181_1064299 | 3300030744 | Bacteria | 2497 |
| 590 | Ga0265330_10077890 | 3300031235 | Bacteria | 1430 |
| 591 | Ga0265330_10129050 | 3300031235 | Bacteria | 1076 |
| 592 | Ga0265332_10054513 | 3300031238 | Bacteria | 1715 |
| 593 | Ga0265332_10081345 | 3300031238 | Bacteria | 1374 |
| 594 | Ga0265332_10096593 | 3300031238 | Bacteria | 1248 |
| 595 | Ga0265328_10000008 | 3300031239 | Bacteria | 208282 |
| 596 | Ga0265328_10000392 | 3300031239 | Bacteria | 20467 |
| 597 | Ga0265328_10002235 | 3300031239 | Bacteria | 8729 |
| 598 | Ga0265328_10003144 | 3300031239 | Bacteria | 7352 |
| 599 | Ga0265328_10005367 | 3300031239 | Bacteria | 5490 |
| 600 | Ga0265328_10064041 | 3300031239 | Bacteria | 1350 |
| 601 | Ga0265328_10109261 | 3300031239 | Bacteria | 1027 |
| 602 | Ga0265320_10126179 | 3300031240 | Bacteria | 1164 |
| 603 | Ga0265325_10010419 | 3300031241 | Bacteria | 5385 |
| 604 | Ga0265325_10020012 | 3300031241 | Bacteria | 3694 |
| 605 | Ga0265325_10072621 | 3300031241 | Bacteria | 1724 |
| 606 | Ga0265325_10174123 | 3300031241 | Bacteria | 1005 |
| 607 | Ga0265325_10268296 | 3300031241 | Bacteria | 768 |
| 608 | Ga0265329_10021873 | 3300031242 | Bacteria | 2144 |
| 609 | Ga0265329_10023459 | 3300031242 | Bacteria | 2055 |
| 610 | Ga0265329_10033763 | 3300031242 | Bacteria | 1654 |
| 611 | Ga0265340_10015941 | 3300031247 | Bacteria | 3897 |
| 612 | Ga0265340_10063001 | 3300031247 | Bacteria | 1770 |
| 613 | Ga0265340_10070684 | 3300031247 | Bacteria | 1655 |
| 614 | Ga0265340_10090555 | 3300031247 | Bacteria | 1430 |
| 615 | Ga0265339_10001557 | 3300031249 | Bacteria | 16946 |
| 616 | Ga0265339_10043834 | 3300031249 | Bacteria | 2471 |
| 617 | Ga0265339_10045047 | 3300031249 | Bacteria | 2429 |
| 618 | Ga0265331_10000087 | 3300031250 | Bacteria | 125673 |
| 619 | Ga0265331_10001355 | 3300031250 | Bacteria | 17996 |
| 620 | Ga0265331_10001484 | 3300031250 | Bacteria | 17311 |
| 621 | Ga0265331_10302478 | 3300031250 | Bacteria | 716 |
| 622 | Ga0265327_10007959 | 3300031251 | Bacteria | 8018 |
| 623 | Ga0265327_10039122 | 3300031251 | Bacteria | 2579 |
| 624 | Ga0265316_10015136 | 3300031344 | Bacteria | 6756 |
| 625 | Ga0265316_10033919 | 3300031344 | Bacteria | 4151 |
| 626 | Ga0265316_10035031 | 3300031344 | Bacteria | 4074 |
| 627 | Ga0265316_10119542 | 3300031344 | Bacteria | 1991 |
| 628 | Ga0265316_10485333 | 3300031344 | Bacteria | 884 |
| 629 | Ga0307513_10020102 | 3300031456 | Bacteria | 7926 |
| 630 | Ga0307513_10070744 | 3300031456 | Bacteria | 3645 |
| 631 | Ga0307513_10426558 | 3300031456 | Bacteria | 1055 |
| 632 | Ga0307408_100225213 | 3300031548 | Bacteria | 1532 |
| 633 | Ga0307408_100231278 | 3300031548 | Bacteria | 1514 |
| 634 | Ga0307408_100698162 | 3300031548 | Bacteria | 912 |
| 635 | Ga0307408_101038673 | 3300031548 | Bacteria | 757 |
| 636 | Ga0265313_10000070 | 3300031595 | Bacteria | 99384 |
| 637 | Ga0265313_10000338 | 3300031595 | Bacteria | 50856 |
| 638 | Ga0265313_10000674 | 3300031595 | Bacteria | 35158 |
| 639 | Ga0265313_10000869 | 3300031595 | Bacteria | 30503 |
| 640 | Ga0265313_10015451 | 3300031595 | Bacteria | 4441 |
| 641 | Ga0265313_10033239 | 3300031595 | Bacteria | 2624 |
| 642 | Ga0265313_10060026 | 3300031595 | Bacteria | 1785 |
| 643 | Ga0265314_10004909 | 3300031711 | Bacteria | 12222 |
| 644 | Ga0265314_10006102 | 3300031711 | Bacteria | 10709 |
| 645 | Ga0265314_10019522 | 3300031711 | Bacteria | 5251 |
| 646 | Ga0265314_10041875 | 3300031711 | Bacteria | 3273 |
| 647 | Ga0265314_10123433 | 3300031711 | Bacteria | 1626 |
| 648 | Ga0265314_10163664 | 3300031711 | Bacteria | 1351 |
| 649 | Ga0265314_10182865 | 3300031711 | Bacteria | 1254 |
| 650 | Ga0265342_10027030 | 3300031712 | Bacteria | 3592 |
| 651 | Ga0265342_10090293 | 3300031712 | Bacteria | 1757 |
| 652 | Ga0265342_10156815 | 3300031712 | Bacteria | 1260 |
| 653 | Ga0307405_10000088 | 3300031731 | Bacteria | 39053 |
| 654 | Ga0307405_10352710 | 3300031731 | Bacteria | 1135 |
| 655 | Ga0307413_10024596 | 3300031824 | Bacteria | 3286 |
| 656 | Ga0307413_10035838 | 3300031824 | Bacteria | 2851 |
| 657 | Ga0307413_10255722 | 3300031824 | Bacteria | 1302 |
| 658 | Ga0307410_10181904 | 3300031852 | Bacteria | 1592 |
| 659 | Ga0307410_10487774 | 3300031852 | Bacteria | 1012 |
| 660 | Ga0307406_10003431 | 3300031901 | Bacteria | 8624 |
| 661 | Ga0307406_10005469 | 3300031901 | Bacteria | 6954 |
| 662 | Ga0307406_10012491 | 3300031901 | Bacteria | 4841 |
| 663 | Ga0307406_10077862 | 3300031901 | Bacteria | 2195 |
| 664 | Ga0307407_10463425 | 3300031903 | Bacteria | 922 |
| 665 | Ga0307412_10002438 | 3300031911 | Bacteria | 10344 |
| 666 | Ga0307412_10003535 | 3300031911 | Bacteria | 8678 |
| 667 | Ga0307412_10035030 | 3300031911 | Bacteria | 3204 |
| 668 | Ga0307412_10062171 | 3300031911 | Bacteria | 2513 |
| 669 | Ga0307412_10074549 | 3300031911 | Bacteria | 2325 |
| 670 | Ga0307412_10209352 | 3300031911 | Bacteria | 1487 |
| 671 | Ga0307412_10791937 | 3300031911 | Bacteria | 822 |
| 672 | Ga0307412_11398152 | 3300031911 | Bacteria | 633 |
| 673 | Ga0315914_1000002 | 3300031967 | Bacteria | 365357 |
| 674 | Ga0307409_100038419 | 3300031995 | Bacteria | 3541 |
| 675 | Ga0307409_100281060 | 3300031995 | Bacteria | 1538 |
| 676 | Ga0307409_100677931 | 3300031995 | Bacteria | 1028 |
| 677 | Ga0307416_100143536 | 3300032002 | Bacteria | 2175 |
| 678 | Ga0307416_100908663 | 3300032002 | Bacteria | 981 |
| 679 | Ga0307416_101130629 | 3300032002 | Bacteria | 888 |
| 680 | Ga0307416_101468116 | 3300032002 | Bacteria | 788 |
| 681 | Ga0307414_10010459 | 3300032004 | Bacteria | 5384 |
| 682 | Ga0307414_10025261 | 3300032004 | Bacteria | 3802 |
| 683 | Ga0307414_10043277 | 3300032004 | Bacteria | 3066 |
| 684 | Ga0307414_10043568 | 3300032004 | Bacteria | 3058 |
| 685 | Ga0307414_10198675 | 3300032004 | Bacteria | 1629 |
| 686 | Ga0307414_10224309 | 3300032004 | Bacteria | 1545 |
| 687 | Ga0307414_10231311 | 3300032004 | Bacteria | 1524 |
| 688 | Ga0307414_10272794 | 3300032004 | Bacteria | 1417 |
| 689 | Ga0307414_10368039 | 3300032004 | Bacteria | 1239 |
| 690 | Ga0307414_10622486 | 3300032004 | Bacteria | 970 |
| 691 | Ga0307414_10647136 | 3300032004 | Bacteria | 952 |
| 692 | Ga0307414_10707404 | 3300032004 | Bacteria | 912 |
| 693 | Ga0307414_10742428 | 3300032004 | Bacteria | 891 |
| 694 | Ga0307414_11005447 | 3300032004 | Bacteria | 768 |
| 695 | Ga0307414_11005870 | 3300032004 | Bacteria | 767 |
| 696 | Ga0307415_100954884 | 3300032126 | Bacteria | 794 |
| 697 | Ga0307415_101107621 | 3300032126 | Bacteria | 742 |
| 698 | Ga0316593_10043353 | 3300032168 | Bacteria | 1503 |
| 699 | Ga0315913_1000018 | 3300033430 | Bacteria | 102535 |
| 700 | Ga0315915_1000005 | 3300033464 | Bacteria | 397591 |
| 701 | Ga0373961_0292471 | 3300035241 | Bacteria | 600 |
| 702 | Ga0316574_0001388 | 3300035398 | Bacteria | 11446 |
| 703 | Ga0373931_0066210 | 3300035691 | Bacteria | 1960 |
| 704 | Ga0373925_0001010 | 3300037068 | Bacteria | 25444 |
| 705 | Ga0395899_0000107 | 3300037312 | Bacteria | 144087 |
| 706 | Ga0395899_0161351 | 3300037312 | Bacteria | 1583 |
| 707 | Ga0395899_0228539 | 3300037312 | Bacteria | 1286 |
| 708 | Ga0395900_0000101 | 3300037418 | Bacteria | 153550 |
| 709 | Ga0395900_0027014 | 3300037418 | Bacteria | 5876 |
| 710 | Ga0395900_0085364 | 3300037418 | Bacteria | 3244 |
| 711 | Ga0395900_0235140 | 3300037418 | Bacteria | 1841 |
| 712 | Ga0395900_0320341 | 3300037418 | Bacteria | 1531 |
| 713 | Ga0395900_0999442 | 3300037418 | Bacteria | 756 |
| 714 | Ga0395900_1281839 | 3300037418 | Bacteria | 647 |
| 715 | Ga0395898_0000043 | 3300037466 | Bacteria | 301783 |
| 716 | Ga0395898_0080973 | 3300037466 | Bacteria | 3131 |
| 717 | Ga0395898_0111816 | 3300037466 | Bacteria | 2618 |
| 718 | Ga0395898_0359141 | 3300037466 | Bacteria | 1389 |
| 719 | Ga0395898_0952062 | 3300037466 | Bacteria | 795 |
| 720 | Ga0395905_0000101 | 3300037471 | Bacteria | 144115 |
| 721 | Ga0395905_0009560 | 3300037471 | Bacteria | 9467 |
| 722 | Ga0395905_0020046 | 3300037471 | Bacteria | 6336 |
| 723 | Ga0395905_0031687 | 3300037471 | Bacteria | 4974 |
| 724 | Ga0395905_0080404 | 3300037471 | Bacteria | 3054 |
| 725 | Ga0395905_0096247 | 3300037471 | Bacteria | 2779 |
| 726 | Ga0436364_0281196 | 3300037853 | Bacteria | 892 |
| 727 | Ga0436364_0920022 | 3300037853 | Bacteria | 1620 |
| 728 | Ga0436364_0949431 | 3300037853 | Bacteria | 1108 |
| 729 | Ga0395901_0000068 | 3300038443 | Bacteria | 144095 |
| 730 | Ga0395901_0007729 | 3300038443 | Bacteria | 10846 |
| 731 | Ga0395901_0017499 | 3300038443 | Bacteria | 7316 |
| 732 | Ga0395901_0073030 | 3300038443 | Bacteria | 3577 |
| 733 | Ga0395901_0178429 | 3300038443 | Bacteria | 2227 |
| 734 | Ga0395901_0720200 | 3300038443 | Bacteria | 993 |
| 735 | Ga0400483_117096 | 3300039062 | Bacteria | 1211 |
| 736 | Ga0436365_0669703 | 3300039437 | Bacteria | 2144 |
| 737 | Ga0436365_1373922 | 3300039437 | Bacteria | 27022 |
| 738 | Ga0436365_1797099 | 3300039437 | Bacteria | 84930 |
| 739 | Ga0436360_0774037 | 3300039438 | Bacteria | 1175 |
| 740 | Ga0436361_0311057 | 3300039447 | Bacteria | 2508 |
| 741 | Ga0436361_0596215 | 3300039447 | Bacteria | 778 |
| 742 | Ga0436361_0774089 | 3300039447 | Bacteria | 890 |
| 743 | Ga0436361_0782552 | 3300039447 | Bacteria | 1258 |
| 744 | Ga0436361_1068522 | 3300039447 | Bacteria | 640 |
| 745 | Ga0436363_0577421 | 3300039450 | Bacteria | 899 |
| 746 | Ga0436363_0693641 | 3300039450 | Bacteria | 10508 |
| 747 | Ga0436363_1325730 | 3300039450 | Bacteria | 2427 |
| 748 | Ga0436363_1447886 | 3300039450 | Bacteria | 1689 |
| 749 | Ga0436363_1639159 | 3300039450 | Bacteria | 3358 |
| 750 | Ga0436362_0302411 | 3300039453 | Bacteria | 648 |
| 751 | Ga0436362_1053283 | 3300039453 | Bacteria | 2337 |
| 752 | Ga0439466_0080708 | 3300041411 | Bacteria | 1026 |
| 753 | Ga0439465_0012626 | 3300041413 | Bacteria | 2641 |
| 754 | Ga0451791_0541240 | 3300041451 | Bacteria | 788 |
| 755 | Ga0451798_0152628 | 3300041458 | Bacteria | 724 |
| 756 | Ga0451798_0312749 | 3300041458 | Bacteria | 3086 |
| 757 | Ga0451835_0706473 | 3300041492 | Bacteria | 3677 |
| 758 | Ga0451837_1013830 | 3300041494 | Bacteria | 890 |
| 759 | Ga0451839_0431211 | 3300041496 | Bacteria | 2781 |
| 760 | Ga0451841_1367572 | 3300041498 | Bacteria | 1206 |
| 761 | Ga0451846_65127 | 3300041502 | Bacteria | 725 |
| 762 | Ga0451847_0708780 | 3300041503 | Bacteria | 1882 |
| 763 | Ga0451849_0224148 | 3300041505 | Bacteria | 903 |
| 764 | Ga0451850_39042 | 3300041506 | Bacteria | 909 |
| 765 | Ga0451851_0590795 | 3300041507 | Bacteria | 2463 |
| 766 | Ga0451853_0990214 | 3300041512 | Bacteria | 992 |
| 767 | Ga0452268_17051 | 3300041907 | Bacteria | 766 |
| 768 | Ga0452271_20105 | 3300041916 | Bacteria | 855 |
| 769 | Ga0439431_0028270 | 3300041997 | Bacteria | 1381 |
| 770 | Ga0439449_0006212 | 3300042007 | Bacteria | 4565 |
| 771 | Ga0439449_0021428 | 3300042007 | Bacteria | 2420 |
| 772 | Ga0439456_079755 | 3300042013 | Bacteria | 730 |
| 773 | Ga0450918_065565 | 3300042531 | Bacteria | 676 |
| 774 | Ga0466972_0126642 | 3300044658 | Bacteria | 1203 |
| 775 | Ga0453683_0004944 | 3300044673 | Bacteria | 9364 |
| 776 | Ga0466965_0126003 | 3300044683 | Bacteria | 1325 |
| 777 | Ga0466963_0298316 | 3300044694 | Bacteria | 1133 |
| 778 | Ga0466963_0320928 | 3300044694 | Bacteria | 1090 |
| 779 | Ga0466970_0056180 | 3300044765 | Bacteria | 2104 |
| 780 | Ga0451576_0001612 | 3300045051 | Bacteria | 37855 |
| 781 | Ga0466967_0585332 | 3300045976 | Bacteria | 1100 |
| 782 | Ga0466967_0735427 | 3300045976 | Bacteria | 978 |
| 783 | Ga0495629_0070349 | 3300046459 | Bacteria | 2441 |
| 784 | Ga0495629_0461864 | 3300046459 | Bacteria | 859 |
| 785 | Ga0495638_0000397 | 3300046460 | Bacteria | 53684 |
| 786 | Ga0495638_0032069 | 3300046460 | Bacteria | 3371 |
| 787 | Ga0495638_0204001 | 3300046460 | Bacteria | 1114 |
| 788 | Ga0495651_0170179 | 3300046462 | Bacteria | 1552 |
| 789 | Ga0495650_0059547 | 3300046471 | Bacteria | 1538 |
| 790 | Ga0495662_0067394 | 3300046476 | Bacteria | 1732 |
| 791 | Ga0495585_0035006 | 3300046492 | Bacteria | 2840 |
| 792 | Ga0495585_0071516 | 3300046492 | Bacteria | 1891 |
| 793 | Ga0495607_0166062 | 3300046501 | Bacteria | 1118 |
| 794 | Ga0495583_0007197 | 3300046506 | Bacteria | 7062 |
| 795 | Ga0495606_0027869 | 3300046507 | Bacteria | 3996 |
| 796 | Ga0495606_0036482 | 3300046507 | Bacteria | 3348 |
| 797 | Ga0495606_0125600 | 3300046507 | Bacteria | 1530 |
| 798 | Ga0495606_0188043 | 3300046507 | Bacteria | 1186 |
| 799 | Ga0495606_0310109 | 3300046507 | Bacteria | 852 |
| 800 | Ga0495610_0024722 | 3300046512 | Bacteria | 3236 |
| 801 | Ga0495631_0010602 | 3300046518 | Bacteria | 4557 |
| 802 | Ga0495632_0003737 | 3300046519 | Bacteria | 10652 |
| 803 | Ga0495632_0090148 | 3300046519 | Bacteria | 1454 |
| 804 | Ga0495637_0103229 | 3300046520 | Bacteria | 1112 |
| 805 | Ga0495643_0011844 | 3300046522 | Bacteria | 5288 |
| 806 | Ga0495643_0013228 | 3300046522 | Bacteria | 4948 |
| 807 | Ga0495643_0070443 | 3300046522 | Bacteria | 1836 |
| 808 | Ga0495643_0265724 | 3300046522 | Bacteria | 795 |
| 809 | Ga0495648_0228828 | 3300046524 | Bacteria | 912 |
| 810 | Ga0495663_0006433 | 3300046525 | Bacteria | 3246 |
| 811 | Ga0495652_0306511 | 3300046529 | Bacteria | 1152 |
| 812 | Ga0495654_0000571 | 3300046530 | Bacteria | 29572 |
| 813 | Ga0495633_0000438 | 3300046558 | Bacteria | 43059 |
| 814 | Ga0495633_0016621 | 3300046558 | Bacteria | 3787 |
| 815 | Ga0495633_0102668 | 3300046558 | Bacteria | 1327 |
| 816 | Ga0495668_0010444 | 3300046616 | Bacteria | 5618 |
| 817 | Ga0495668_0274987 | 3300046616 | Bacteria | 923 |
| 818 | Ga0495611_0036513 | 3300046648 | Bacteria | 2181 |
| 819 | Ga0495625_0002547 | 3300046660 | Bacteria | 19601 |
| 820 | Ga0495625_0020782 | 3300046660 | Bacteria | 5061 |
| 821 | Ga0495625_0251332 | 3300046660 | Bacteria | 1147 |
| 822 | Ga0495625_0292968 | 3300046660 | Bacteria | 1044 |
| 823 | Ga0495661_0047783 | 3300046665 | Bacteria | 2604 |
| 824 | Ga0495661_0185115 | 3300046665 | Bacteria | 1101 |
| 825 | Ga0495624_0105980 | 3300046690 | Bacteria | 1730 |
| 826 | Ga0495649_0000134 | 3300046694 | Bacteria | 64953 |
| 827 | Ga0495660_0025628 | 3300046810 | Bacteria | 3348 |
| 828 | Ga0495636_0045367 | 3300047318 | Bacteria | 1832 |
| 829 | Ga0495672_0009559 | 3300047320 | Bacteria | 7009 |
| 830 | Ga0495672_0295943 | 3300047320 | Bacteria | 768 |
| 831 | Ga0495685_194225 | 3300047447 | Bacteria | 652 |
| 832 | Ga0495686_0046483 | 3300047472 | Bacteria | 2743 |
| 833 | Ga0495686_0152390 | 3300047472 | Bacteria | 1356 |
| 834 | Ga0495602_0190888 | 3300048088 | Bacteria | 1571 |
| 835 | Ga0495602_0627029 | 3300048088 | Bacteria | 737 |
| 836 | Ga0495626_0040279 | 3300048091 | Bacteria | 2208 |
| 837 | Ga0495626_0083378 | 3300048091 | Bacteria | 1416 |
| 838 | Ga0496103_0397870 | 3300048906 | Bacteria | 885 |
| 839 | Ga0496104_0777668 | 3300048907 | Bacteria | 864 |
| 840 | Ga0496106_0001794 | 3300048909 | Bacteria | 16032 |
| 841 | Ga0496110_0453094 | 3300048913 | Bacteria | 1169 |
| 842 | Ga0496110_0688861 | 3300048913 | Bacteria | 923 |
| 843 | Ga0496111_0002868 | 3300048914 | Bacteria | 10521 |
| 844 | Ga0496111_0465641 | 3300048914 | Bacteria | 932 |
| 845 | Ga0496112_0063240 | 3300048915 | Bacteria | 3650 |
| 846 | Ga0496114_0233894 | 3300048917 | Bacteria | 1615 |
| 847 | Ga0496114_0879510 | 3300048917 | Bacteria | 777 |
| 848 | Ga0496115_0006857 | 3300048918 | Bacteria | 8363 |
| 849 | Ga0496115_0323360 | 3300048918 | Bacteria | 1261 |
| 850 | Ga0496116_0024906 | 3300048919 | Bacteria | 4412 |
| 851 | Ga0496116_0037404 | 3300048919 | Bacteria | 3385 |
| 852 | Ga0496116_0043619 | 3300048919 | Bacteria | 3054 |
| 853 | Ga0496116_0044656 | 3300048919 | Bacteria | 3008 |
| 854 | Ga0496116_0292637 | 3300048919 | Bacteria | 780 |
| 855 | Ga0496117_0000016 | 3300048920 | Bacteria | 523642 |
| 856 | Ga0496117_0005852 | 3300048920 | Bacteria | 12727 |
| 857 | Ga0496117_0014948 | 3300048920 | Bacteria | 6652 |
| 858 | Ga0496117_0050674 | 3300048920 | Bacteria | 2942 |
| 859 | Ga0496118_0005627 | 3300048921 | Bacteria | 14144 |
| 860 | Ga0496118_0016278 | 3300048921 | Bacteria | 6829 |
| 861 | Ga0496118_0056054 | 3300048921 | Bacteria | 2966 |
| 862 | Ga0496118_0323745 | 3300048921 | Bacteria | 835 |
| 863 | Ga0496119_0023848 | 3300048922 | Bacteria | 4324 |
| 864 | Ga0496119_0026449 | 3300048922 | Bacteria | 4023 |
| 865 | Ga0496119_0040525 | 3300048922 | Bacteria | 2977 |
| 866 | Ga0496119_0111375 | 3300048922 | Bacteria | 1519 |
| 867 | Ga0496119_0172451 | 3300048922 | Bacteria | 1141 |
| 868 | Ga0496120_0000164 | 3300048923 | Bacteria | 111959 |
| 869 | Ga0496120_0000550 | 3300048923 | Bacteria | 57310 |
| 870 | Ga0496120_0069810 | 3300048923 | Bacteria | 1934 |
| 871 | Ga0496120_0077183 | 3300048923 | Bacteria | 1814 |
| 872 | Ga0496121_0002925 | 3300048924 | Bacteria | 25017 |
| 873 | Ga0496121_0044960 | 3300048924 | Bacteria | 3801 |
| 874 | Ga0496121_0080370 | 3300048924 | Bacteria | 2584 |
| 875 | Ga0496121_0178702 | 3300048924 | Bacteria | 1534 |
| 876 | Ga0496121_0212190 | 3300048924 | Bacteria | 1370 |
| 877 | Ga0496121_0220874 | 3300048924 | Bacteria | 1335 |
| 878 | Ga0496121_0569806 | 3300048924 | Bacteria | 705 |
| 879 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 880 | Ga0496122_0001100 | 3300048925 | Bacteria | 46751 |
| 881 | Ga0496122_0001424 | 3300048925 | Bacteria | 38740 |
| 882 | Ga0496122_0026493 | 3300048925 | Bacteria | 4995 |
| 883 | Ga0496122_0027392 | 3300048925 | Bacteria | 4875 |
| 884 | Ga0496122_0047818 | 3300048925 | Bacteria | 3297 |
| 885 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 886 | Ga0496123_0001129 | 3300048926 | Bacteria | 39855 |
| 887 | Ga0496123_0001147 | 3300048926 | Bacteria | 39513 |
| 888 | Ga0496123_0003982 | 3300048926 | Bacteria | 15997 |
| 889 | Ga0496123_0006102 | 3300048926 | Bacteria | 11813 |
| 890 | Ga0496123_0022124 | 3300048926 | Bacteria | 4911 |
| 891 | Ga0496123_0031999 | 3300048926 | Bacteria | 3817 |
| 892 | Ga0496123_0350005 | 3300048926 | Bacteria | 687 |
| 893 | Ga0496124_0000094 | 3300048927 | Bacteria | 189147 |
| 894 | Ga0496124_0030277 | 3300048927 | Bacteria | 4806 |
| 895 | Ga0496124_0041684 | 3300048927 | Bacteria | 3958 |
| 896 | Ga0496124_0066058 | 3300048927 | Bacteria | 3014 |
| 897 | Ga0496124_0113690 | 3300048927 | Bacteria | 2175 |
| 898 | Ga0496124_0144534 | 3300048927 | Bacteria | 1873 |
| 899 | Ga0496124_0231818 | 3300048927 | Bacteria | 1380 |
| 900 | Ga0496124_0239659 | 3300048927 | Bacteria | 1350 |
| 901 | Ga0496125_0000374 | 3300048928 | Bacteria | 83816 |
| 902 | Ga0496125_0000564 | 3300048928 | Bacteria | 63635 |
| 903 | Ga0496125_0000585 | 3300048928 | Bacteria | 62191 |
| 904 | Ga0496125_0005990 | 3300048928 | Bacteria | 13306 |
| 905 | Ga0496125_0014364 | 3300048928 | Bacteria | 7715 |
| 906 | Ga0496125_0016356 | 3300048928 | Bacteria | 7128 |
| 907 | Ga0496125_0026192 | 3300048928 | Bacteria | 5320 |
| 908 | Ga0496125_0154752 | 3300048928 | Bacteria | 1568 |
| 909 | Ga0496125_0234678 | 3300048928 | Bacteria | 1170 |
| 910 | Ga0496126_0034256 | 3300048929 | Bacteria | 4771 |
| 911 | Ga0496126_0034848 | 3300048929 | Bacteria | 4722 |
| 912 | Ga0496126_0062938 | 3300048929 | Bacteria | 3327 |
| 913 | Ga0496126_0119146 | 3300048929 | Bacteria | 2291 |
| 914 | Ga0496126_0125604 | 3300048929 | Bacteria | 2220 |
| 915 | Ga0496126_0233414 | 3300048929 | Bacteria | 1540 |
| 916 | Ga0496126_0284144 | 3300048929 | Bacteria | 1370 |
| 917 | Ga0495678_022706 | 3300049459 | Bacteria | 2739 |
| 918 | Ga0501031_0000016 | 3300049568 | Bacteria | 110858 |
| 919 | Ga0501031_0009606 | 3300049568 | Bacteria | 6298 |
| 920 | Ga0501031_0020950 | 3300049568 | Bacteria | 4262 |
| 921 | Ga0501031_0170597 | 3300049568 | Bacteria | 1422 |
| 922 | Ga0501031_0179041 | 3300049568 | Bacteria | 1385 |
| 923 | Ga0501031_0441093 | 3300049568 | Bacteria | 841 |
| 924 | Ga0501031_0447758 | 3300049568 | Bacteria | 834 |
| 925 | Ga0501032_0000029 | 3300049569 | Bacteria | 130865 |
| 926 | Ga0501032_0000044 | 3300049569 | Bacteria | 110899 |
| 927 | Ga0501032_0000435 | 3300049569 | Bacteria | 34412 |
| 928 | Ga0501032_0009080 | 3300049569 | Bacteria | 7218 |
| 929 | Ga0501032_0031986 | 3300049569 | Bacteria | 3607 |
| 930 | Ga0501032_0035913 | 3300049569 | Bacteria | 3386 |
| 931 | Ga0501032_0084070 | 3300049569 | Bacteria | 2116 |
| 932 | Ga0501032_0085875 | 3300049569 | Bacteria | 2091 |
| 933 | Ga0501032_0107664 | 3300049569 | Bacteria | 1846 |
| 934 | Ga0501032_0189147 | 3300049569 | Bacteria | 1346 |
| 935 | Ga0501032_0239270 | 3300049569 | Bacteria | 1179 |
| 936 | Ga0501032_0324968 | 3300049569 | Bacteria | 992 |
| 937 | Ga0501032_0610462 | 3300049569 | Bacteria | 694 |
| 938 | Ga0501033_0000052 | 3300049570 | Bacteria | 110545 |
| 939 | Ga0501033_0000168 | 3300049570 | Bacteria | 62921 |
| 940 | Ga0501033_0011017 | 3300049570 | Bacteria | 6924 |
| 941 | Ga0501033_0026324 | 3300049570 | Bacteria | 4379 |
| 942 | Ga0501033_0032234 | 3300049570 | Bacteria | 3935 |
| 943 | Ga0501033_0053399 | 3300049570 | Bacteria | 2993 |
| 944 | Ga0501033_0109660 | 3300049570 | Bacteria | 2009 |
| 945 | Ga0501033_0456584 | 3300049570 | Bacteria | 887 |
| 946 | Ga0501033_0648971 | 3300049570 | Bacteria | 721 |
| 947 | Ga0501034_0000212 | 3300049571 | Bacteria | 110795 |
| 948 | Ga0501034_0000434 | 3300049571 | Bacteria | 69367 |
| 949 | Ga0501034_0000675 | 3300049571 | Bacteria | 51860 |
| 950 | Ga0501034_0001360 | 3300049571 | Bacteria | 33027 |
| 951 | Ga0501034_0026045 | 3300049571 | Bacteria | 5957 |
| 952 | Ga0501034_0050235 | 3300049571 | Bacteria | 4206 |
| 953 | Ga0501034_0062180 | 3300049571 | Bacteria | 3749 |
| 954 | Ga0501034_0067777 | 3300049571 | Bacteria | 3580 |
| 955 | Ga0501034_0073976 | 3300049571 | Bacteria | 3416 |
| 956 | Ga0501034_0098011 | 3300049571 | Bacteria | 2927 |
| 957 | Ga0501034_0118813 | 3300049571 | Bacteria | 2630 |
| 958 | Ga0501034_0145726 | 3300049571 | Bacteria | 2345 |
| 959 | Ga0501034_0189933 | 3300049571 | Bacteria | 2017 |
| 960 | Ga0501034_0285744 | 3300049571 | Bacteria | 1589 |
| 961 | Ga0501034_0303946 | 3300049571 | Bacteria | 1531 |
| 962 | Ga0501034_0361940 | 3300049571 | Bacteria | 1378 |
| 963 | Ga0501034_0394511 | 3300049571 | Bacteria | 1307 |
| 964 | Ga0501034_0431702 | 3300049571 | Bacteria | 1237 |
| 965 | Ga0501034_0447037 | 3300049571 | Bacteria | 1210 |
| 966 | Ga0501034_0470139 | 3300049571 | Bacteria | 1173 |
| 967 | Ga0501034_0526515 | 3300049571 | Bacteria | 1093 |
| 968 | Ga0501034_0574674 | 3300049571 | Bacteria | 1034 |
| 969 | Ga0501034_0652964 | 3300049571 | Bacteria | 953 |
| 970 | Ga0501034_0754298 | 3300049571 | Bacteria | 868 |
| 971 | Ga0501034_0876318 | 3300049571 | Bacteria | 787 |
| 972 | Ga0501034_0942601 | 3300049571 | Bacteria | 749 |
| 973 | Ga0501034_0960610 | 3300049571 | Bacteria | 740 |
| 974 | Ga0501034_0999344 | 3300049571 | Bacteria | 721 |
| 975 | Ga0501036_0000022 | 3300049572 | Bacteria | 111251 |
| 976 | Ga0501036_0000533 | 3300049572 | Bacteria | 27318 |
| 977 | Ga0501036_0049068 | 3300049572 | Bacteria | 3574 |
| 978 | Ga0501036_0290662 | 3300049572 | Bacteria | 1367 |
| 979 | Ga0501036_0508579 | 3300049572 | Bacteria | 1002 |
| 980 | Ga0501037_0000049 | 3300049573 | Bacteria | 113246 |
| 981 | Ga0501037_0000052 | 3300049573 | Bacteria | 110932 |
| 982 | Ga0501037_0000335 | 3300049573 | Bacteria | 39826 |
| 983 | Ga0501037_0044673 | 3300049573 | Bacteria | 3253 |
| 984 | Ga0501037_0074156 | 3300049573 | Bacteria | 2473 |
| 985 | Ga0501037_0101319 | 3300049573 | Bacteria | 2078 |
| 986 | Ga0501037_0133986 | 3300049573 | Bacteria | 1775 |
| 987 | Ga0501037_0157477 | 3300049573 | Bacteria | 1620 |
| 988 | Ga0501037_0191340 | 3300049573 | Bacteria | 1448 |
| 989 | Ga0501037_0286244 | 3300049573 | Bacteria | 1147 |
| 990 | Ga0501037_0295876 | 3300049573 | Bacteria | 1125 |
| 991 | Ga0501037_0322396 | 3300049573 | Bacteria | 1069 |
| 992 | Ga0501037_0402663 | 3300049573 | Bacteria | 938 |
| 993 | Ga0501038_0000044 | 3300049574 | Bacteria | 110876 |
| 994 | Ga0501038_0000275 | 3300049574 | Bacteria | 43504 |
| 995 | Ga0501038_0084357 | 3300049574 | Bacteria | 2673 |
| 996 | Ga0501038_0190158 | 3300049574 | Bacteria | 1652 |
| 997 | Ga0501038_0212096 | 3300049574 | Bacteria | 1548 |
| 998 | Ga0501038_0291543 | 3300049574 | Bacteria | 1282 |
| 999 | Ga0501038_0309624 | 3300049574 | Bacteria | 1238 |
| 1000 | Ga0501039_0000040 | 3300049575 | Bacteria | 115567 |
| 1001 | Ga0501039_0000042 | 3300049575 | Bacteria | 113008 |
| 1002 | Ga0501039_0143435 | 3300049575 | Bacteria | 1876 |
| 1003 | Ga0501039_0237677 | 3300049575 | Bacteria | 1432 |
| 1004 | Ga0501039_0439392 | 3300049575 | Bacteria | 1025 |
| 1005 | Ga0501039_0482240 | 3300049575 | Bacteria | 974 |
| 1006 | Ga0501040_0103312 | 3300049576 | Bacteria | 1989 |
| 1007 | Ga0501040_0141414 | 3300049576 | Bacteria | 1696 |
| 1008 | Ga0501042_0129112 | 3300049578 | Bacteria | 1821 |
| 1009 | Ga0501043_0000006 | 3300049579 | Bacteria | 234413 |
| 1010 | Ga0501043_0000054 | 3300049579 | Bacteria | 105924 |
| 1011 | Ga0501043_0000236 | 3300049579 | Bacteria | 49931 |
| 1012 | Ga0501043_0013995 | 3300049579 | Bacteria | 6278 |
| 1013 | Ga0501043_0054340 | 3300049579 | Bacteria | 3145 |
| 1014 | Ga0501043_0131977 | 3300049579 | Bacteria | 1957 |
| 1015 | Ga0501043_0138189 | 3300049579 | Bacteria | 1909 |
| 1016 | Ga0501043_0270670 | 3300049579 | Bacteria | 1304 |
| 1017 | Ga0501043_0298880 | 3300049579 | Bacteria | 1230 |
| 1018 | Ga0501043_0321123 | 3300049579 | Bacteria | 1180 |
| 1019 | Ga0501043_0354325 | 3300049579 | Bacteria | 1114 |
| 1020 | Ga0501043_0398511 | 3300049579 | Bacteria | 1040 |
| 1021 | Ga0501043_0782297 | 3300049579 | Bacteria | 691 |
| 1022 | Ga0501043_0825108 | 3300049579 | Bacteria | 669 |
| 1023 | Ga0501046_0019865 | 3300049580 | Bacteria | 5564 |
| 1024 | Ga0501046_0135926 | 3300049580 | Bacteria | 1862 |
| 1025 | Ga0501046_0380901 | 3300049580 | Bacteria | 1021 |
| 1026 | Ga0501047_0000838 | 3300049581 | Bacteria | 31753 |
| 1027 | Ga0501047_0009345 | 3300049581 | Bacteria | 9257 |
| 1028 | Ga0501047_0039981 | 3300049581 | Bacteria | 4535 |
| 1029 | Ga0501047_0045832 | 3300049581 | Bacteria | 4227 |
| 1030 | Ga0501047_0070750 | 3300049581 | Bacteria | 3359 |
| 1031 | Ga0501047_0081264 | 3300049581 | Bacteria | 3115 |
| 1032 | Ga0501047_0096030 | 3300049581 | Bacteria | 2842 |
| 1033 | Ga0501047_0123404 | 3300049581 | Bacteria | 2470 |
| 1034 | Ga0501047_0139999 | 3300049581 | Bacteria | 2298 |
| 1035 | Ga0501047_0143198 | 3300049581 | Bacteria | 2268 |
| 1036 | Ga0501047_0183726 | 3300049581 | Bacteria | 1957 |
| 1037 | Ga0501047_0302382 | 3300049581 | Bacteria | 1442 |
| 1038 | Ga0501047_0335137 | 3300049581 | Bacteria | 1351 |
| 1039 | Ga0501048_0202630 | 3300049582 | Bacteria | 1407 |
| 1040 | Ga0501048_0431877 | 3300049582 | Bacteria | 943 |
| 1041 | Ga0501067_0001248 | 3300049583 | Bacteria | 13824 |
| 1042 | Ga0501067_0003119 | 3300049583 | Bacteria | 9153 |
| 1043 | Ga0501067_0004746 | 3300049583 | Bacteria | 7525 |
| 1044 | Ga0501067_0055009 | 3300049583 | Bacteria | 2205 |
| 1045 | Ga0501067_0069494 | 3300049583 | Bacteria | 1950 |
| 1046 | Ga0501067_0214054 | 3300049583 | Bacteria | 1073 |
| 1047 | Ga0501067_0307199 | 3300049583 | Bacteria | 883 |
| 1048 | Ga0501067_0325059 | 3300049583 | Bacteria | 856 |
| 1049 | Ga0501067_0361412 | 3300049583 | Bacteria | 809 |
| 1050 | Ga0501068_0007310 | 3300049584 | Bacteria | 6118 |
| 1051 | Ga0501068_0216057 | 3300049584 | Bacteria | 1218 |
| 1052 | Ga0501068_0344231 | 3300049584 | Bacteria | 958 |
| 1053 | Ga0501069_0000141 | 3300049585 | Bacteria | 31844 |
| 1054 | Ga0501069_0013189 | 3300049585 | Bacteria | 4404 |
| 1055 | Ga0501069_0084971 | 3300049585 | Bacteria | 1785 |
| 1056 | Ga0501069_0112182 | 3300049585 | Bacteria | 1553 |
| 1057 | Ga0501069_0217062 | 3300049585 | Bacteria | 1111 |
| 1058 | Ga0501070_0000081 | 3300049586 | Bacteria | 81543 |
| 1059 | Ga0501070_0000254 | 3300049586 | Bacteria | 50216 |
| 1060 | Ga0501070_0005587 | 3300049586 | Bacteria | 10729 |
| 1061 | Ga0501070_0064518 | 3300049586 | Bacteria | 3032 |
| 1062 | Ga0501070_0069657 | 3300049586 | Bacteria | 2912 |
| 1063 | Ga0501070_0088763 | 3300049586 | Bacteria | 2559 |
| 1064 | Ga0501070_0108673 | 3300049586 | Bacteria | 2291 |
| 1065 | Ga0501070_0126634 | 3300049586 | Bacteria | 2110 |
| 1066 | Ga0501070_0159445 | 3300049586 | Bacteria | 1860 |
| 1067 | Ga0501070_0207403 | 3300049586 | Bacteria | 1609 |
| 1068 | Ga0501070_0213963 | 3300049586 | Bacteria | 1581 |
| 1069 | Ga0501070_0224883 | 3300049586 | Bacteria | 1538 |
| 1070 | Ga0501070_0405989 | 3300049586 | Bacteria | 1101 |
| 1071 | Ga0501070_0639216 | 3300049586 | Bacteria | 845 |
| 1072 | Ga0501071_0043325 | 3300049587 | Bacteria | 3226 |
| 1073 | Ga0501071_0134976 | 3300049587 | Bacteria | 1836 |
| 1074 | Ga0501071_0889993 | 3300049587 | Bacteria | 687 |
| 1075 | Ga0501072_0121254 | 3300049588 | Bacteria | 2083 |
| 1076 | Ga0501072_0429892 | 3300049588 | Bacteria | 1046 |
| 1077 | Ga0501072_0624195 | 3300049588 | Bacteria | 849 |
| 1078 | Ga0501073_0000019 | 3300049589 | Bacteria | 144300 |
| 1079 | Ga0501073_0015418 | 3300049589 | Bacteria | 5544 |
| 1080 | Ga0501073_0019232 | 3300049589 | Bacteria | 4934 |
| 1081 | Ga0501073_0026648 | 3300049589 | Bacteria | 4139 |
| 1082 | Ga0501073_0071790 | 3300049589 | Bacteria | 2411 |
| 1083 | Ga0501073_0128800 | 3300049589 | Bacteria | 1754 |
| 1084 | Ga0501073_0157634 | 3300049589 | Bacteria | 1573 |
| 1085 | Ga0501073_0362758 | 3300049589 | Bacteria | 1000 |
| 1086 | Ga0501074_0000011 | 3300049590 | Bacteria | 93181 |
| 1087 | Ga0501074_0029334 | 3300049590 | Bacteria | 3985 |
| 1088 | Ga0501074_0199990 | 3300049590 | Bacteria | 1424 |
| 1089 | Ga0501074_0409747 | 3300049590 | Bacteria | 961 |
| 1090 | Ga0501074_0444228 | 3300049590 | Bacteria | 920 |
| 1091 | Ga0501074_0541464 | 3300049590 | Bacteria | 824 |
| 1092 | Ga0501076_0126748 | 3300049592 | Bacteria | 2069 |
| 1093 | Ga0501077_0000035 | 3300049593 | Bacteria | 68535 |
| 1094 | Ga0501077_0041346 | 3300049593 | Bacteria | 2935 |
| 1095 | Ga0501077_0057700 | 3300049593 | Bacteria | 2465 |
| 1096 | Ga0501077_0616935 | 3300049593 | Bacteria | 697 |
| 1097 | Ga0501238_005423 | 3300049671 | Bacteria | 1617 |
| 1098 | Ga0501252_005771 | 3300049682 | Bacteria | 1357 |
| 1099 | Ga0501079_0142963 | 3300049741 | Bacteria | 1864 |
| 1100 | Ga0501079_0700156 | 3300049741 | Bacteria | 797 |
| 1101 | Ga0501080_0000582 | 3300049742 | Bacteria | 28889 |
| 1102 | Ga0501080_0005452 | 3300049742 | Bacteria | 11348 |
| 1103 | Ga0501080_0025036 | 3300049742 | Bacteria | 5537 |
| 1104 | Ga0501080_0029481 | 3300049742 | Bacteria | 5109 |
| 1105 | Ga0501080_0051297 | 3300049742 | Bacteria | 3839 |
| 1106 | Ga0501080_0099925 | 3300049742 | Bacteria | 2692 |
| 1107 | Ga0501080_0107954 | 3300049742 | Bacteria | 2580 |
| 1108 | Ga0501080_0126220 | 3300049742 | Bacteria | 2370 |
| 1109 | Ga0501080_0145057 | 3300049742 | Bacteria | 2194 |
| 1110 | Ga0501080_0146315 | 3300049742 | Bacteria | 2184 |
| 1111 | Ga0501080_0186994 | 3300049742 | Bacteria | 1904 |
| 1112 | Ga0501080_0480481 | 3300049742 | Bacteria | 1111 |
| 1113 | Ga0501080_0621599 | 3300049742 | Bacteria | 958 |
| 1114 | Ga0501080_0674999 | 3300049742 | Bacteria | 913 |
| 1115 | Ga0501081_1013335 | 3300049743 | Bacteria | 628 |
| 1116 | Ga0501083_0002722 | 3300049744 | Bacteria | 12205 |
| 1117 | Ga0501083_0002864 | 3300049744 | Bacteria | 11933 |
| 1118 | Ga0501083_0003672 | 3300049744 | Bacteria | 10773 |
| 1119 | Ga0501083_0004693 | 3300049744 | Bacteria | 9654 |
| 1120 | Ga0501083_0048536 | 3300049744 | Bacteria | 2865 |
| 1121 | Ga0501083_0060795 | 3300049744 | Bacteria | 2523 |
| 1122 | Ga0501083_0077252 | 3300049744 | Bacteria | 2210 |
| 1123 | Ga0501083_0223140 | 3300049744 | Bacteria | 1228 |
| 1124 | Ga0501083_0254278 | 3300049744 | Bacteria | 1143 |
| 1125 | Ga0501083_0298190 | 3300049744 | Bacteria | 1048 |
| 1126 | Ga0501241_025024 | 3300049758 | Bacteria | 1110 |
| 1127 | Ga0501280_001991 | 3300049776 | Bacteria | 3552 |
| 1128 | Ga0501035_0000068 | 3300049822 | Bacteria | 128392 |
| 1129 | Ga0501035_0000095 | 3300049822 | Bacteria | 110735 |
| 1130 | Ga0501035_0000557 | 3300049822 | Bacteria | 41380 |
| 1131 | Ga0501035_0004674 | 3300049822 | Bacteria | 12998 |
| 1132 | Ga0501035_0010601 | 3300049822 | Bacteria | 8535 |
| 1133 | Ga0501035_0024027 | 3300049822 | Bacteria | 5592 |
| 1134 | Ga0501035_0036936 | 3300049822 | Bacteria | 4426 |
| 1135 | Ga0501035_0078780 | 3300049822 | Bacteria | 2910 |
| 1136 | Ga0501035_0122679 | 3300049822 | Bacteria | 2270 |
| 1137 | Ga0501035_0331737 | 3300049822 | Bacteria | 1276 |
| 1138 | Ga0501035_0559839 | 3300049822 | Bacteria | 935 |
| 1139 | Ga0501044_0000082 | 3300049823 | Bacteria | 115127 |
| 1140 | Ga0501044_0000091 | 3300049823 | Bacteria | 111251 |
| 1141 | Ga0501044_0002199 | 3300049823 | Bacteria | 22360 |
| 1142 | Ga0501044_0020085 | 3300049823 | Bacteria | 7132 |
| 1143 | Ga0501044_0020231 | 3300049823 | Bacteria | 7103 |
| 1144 | Ga0501044_0031213 | 3300049823 | Bacteria | 5609 |
| 1145 | Ga0501044_0032766 | 3300049823 | Bacteria | 5461 |
| 1146 | Ga0501044_0049026 | 3300049823 | Bacteria | 4359 |
| 1147 | Ga0501044_0073302 | 3300049823 | Bacteria | 3480 |
| 1148 | Ga0501044_0083450 | 3300049823 | Bacteria | 3231 |
| 1149 | Ga0501044_0211824 | 3300049823 | Bacteria | 1892 |
| 1150 | Ga0501044_0229990 | 3300049823 | Bacteria | 1802 |
| 1151 | Ga0501044_0359888 | 3300049823 | Bacteria | 1373 |
| 1152 | Ga0501044_0964401 | 3300049823 | Bacteria | 725 |
| 1153 | Ga0501045_0024565 | 3300049824 | Bacteria | 4327 |
| 1154 | Ga0501045_0176570 | 3300049824 | Bacteria | 1591 |
| 1155 | nmdc:mga03683_111492_c1 | 3300050489 | Bacteria | 1210 |
| 1156 | nmdc:mga03683_42799_c1 | 3300050489 | Bacteria | 1865 |
| 1157 | nmdc:mga03683_5389_c1 | 3300050489 | Bacteria | 2592 |
| 1158 | nmdc:mga03683_59901_c1 | 3300050489 | Bacteria | 1607 |
| 1159 | nmdc:mga03683_75411_c1 | 3300050489 | Bacteria | 1448 |
| 1160 | nmdc:mga03n38_168036_c1 | 3300050490 | Bacteria | 1115 |
| 1161 | nmdc:mga03n38_2162_c1 | 3300050490 | Bacteria | 5984 |
| 1162 | nmdc:mga03n38_71667_c1 | 3300050490 | Bacteria | 1605 |
| 1163 | nmdc:mga03n38_98276_c1 | 3300050490 | Bacteria | 1408 |
| 1164 | nmdc:mga00v17_13_c1 | 3300050491 | Bacteria | 128511 |
| 1165 | nmdc:mga00v17_268670_c1 | 3300050491 | Bacteria | 1107 |
| 1166 | nmdc:mga00v17_27_c2 | 3300050491 | Bacteria | 60228 |
| 1167 | nmdc:mga00v17_362934_c1 | 3300050491 | Bacteria | 942 |
| 1168 | nmdc:mga00v17_50366_c1 | 3300050491 | Bacteria | 2530 |
| 1169 | nmdc:mga00v17_588903_c1 | 3300050491 | Bacteria | 718 |
| 1170 | nmdc:mga00v17_70873_c1 | 3300050491 | Bacteria | 2160 |
| 1171 | nmdc:mga0yw44_147119_c1 | 3300050492 | Bacteria | 1535 |
| 1172 | nmdc:mga0yw44_19066_c1 | 3300050492 | Bacteria | 3775 |
| 1173 | nmdc:mga0yw44_3221_c1 | 3300050492 | Bacteria | 7188 |
| 1174 | nmdc:mga0yw44_44476_c1 | 3300050492 | Bacteria | 2656 |
| 1175 | nmdc:mga0yw44_570844_c1 | 3300050492 | Bacteria | 768 |
| 1176 | nmdc:mga0yw44_76857_c1 | 3300050492 | Bacteria | 2085 |
| 1177 | nmdc:mga0k408_134222_c2 | 3300050493 | Bacteria | 1147 |
| 1178 | nmdc:mga0k408_29119_c1 | 3300050493 | Bacteria | 3142 |
| 1179 | nmdc:mga0k408_4447_c1 | 3300050493 | Bacteria | 7438 |
| 1180 | nmdc:mga06z11_1915_c1 | 3300050494 | Bacteria | 7845 |
| 1181 | nmdc:mga06z11_206948_c1 | 3300050494 | Bacteria | 1142 |
| 1182 | nmdc:mga06z11_272774_c1 | 3300050494 | Bacteria | 1000 |
| 1183 | nmdc:mga06z11_326017_c1 | 3300050494 | Bacteria | 917 |
| 1184 | nmdc:mga06z11_43138_c1 | 3300050494 | Bacteria | 2267 |
| 1185 | nmdc:mga06z11_46794_c1 | 3300050494 | Bacteria | 2194 |
| 1186 | nmdc:mga06z11_597420_c1 | 3300050494 | Bacteria | 671 |
| 1187 | nmdc:mga06z11_82691_c1 | 3300050494 | Bacteria | 1727 |
| 1188 | nmdc:mga04h51_161881_c1 | 3300050495 | Bacteria | 862 |
| 1189 | nmdc:mga07m45_145356_c1 | 3300050496 | Bacteria | 1374 |
| 1190 | nmdc:mga07m45_26378_c1 | 3300050496 | Bacteria | 3194 |
| 1191 | nmdc:mga07m45_353596_c1 | 3300050496 | Bacteria | 854 |
| 1192 | nmdc:mga07m45_7795_c1 | 3300050496 | Bacteria | 5480 |
| 1193 | nmdc:mga0n895_633833_c1 | 3300050512 | Bacteria | 1069 |
| 1194 | nmdc:mga0sz30_144_c1 | 3300050516 | Bacteria | 26567 |
| 1195 | nmdc:mga0sz30_16819_c1 | 3300050516 | Bacteria | 2909 |
| 1196 | nmdc:mga0sz30_3454_c1 | 3300050516 | Bacteria | 5690 |
| 1197 | nmdc:mga0sz30_72679_c2 | 3300050516 | Bacteria | 949 |
| 1198 | Ga0500610_0019125 | 3300053079 | Bacteria | 3324 |
| 1199 | Ga0495655_0142832 | 3300053083 | Bacteria | 747 |
| 1200 | Ga0495619_0643357 | 3300053085 | Bacteria | 724 |
| 1201 | Ga0500643_023639 | 3300053087 | Bacteria | 1961 |
| 1202 | Ga0500644_0004259 | 3300053088 | Bacteria | 3574 |
| 1203 | Ga0500644_0104460 | 3300053088 | Bacteria | 1081 |
| 1204 | Ga0500651_0004289 | 3300053093 | Bacteria | 7967 |
| 1205 | Ga0500651_0043132 | 3300053093 | Bacteria | 2841 |
| 1206 | Ga0500562_041029 | 3300053108 | Bacteria | 1230 |
| 1207 | Ga0500594_0001379 | 3300053118 | Bacteria | 5268 |
| 1208 | Ga0500595_043033 | 3300053119 | Bacteria | 1441 |
| 1209 | Ga0500595_104570 | 3300053119 | Bacteria | 809 |
| 1210 | Ga0500658_0000770 | 3300053134 | Bacteria | 13199 |
| 1211 | Ga0500561_0000316 | 3300053137 | Bacteria | 8163 |
| 1212 | Ga0500568_0000232 | 3300053139 | Bacteria | 47704 |
| 1213 | Ga0500568_0002531 | 3300053139 | Bacteria | 10680 |
| 1214 | Ga0500568_0004124 | 3300053139 | Bacteria | 7865 |
| 1215 | Ga0500573_0114773 | 3300053140 | Bacteria | 1504 |
| 1216 | Ga0500604_0000343 | 3300053151 | Bacteria | 12861 |
| 1217 | Ga0500604_0027954 | 3300053151 | Bacteria | 1635 |
| 1218 | Ga0500616_0002417 | 3300053153 | Bacteria | 15555 |
| 1219 | Ga0500616_0003618 | 3300053153 | Bacteria | 11657 |
| 1220 | Ga0500616_0016515 | 3300053153 | Bacteria | 4200 |
| 1221 | Ga0500616_0033355 | 3300053153 | Bacteria | 2810 |
| 1222 | Ga0500616_0040621 | 3300053153 | Bacteria | 2501 |
| 1223 | Ga0500622_0001821 | 3300053156 | Bacteria | 16201 |
| 1224 | Ga0500624_000169 | 3300053157 | Bacteria | 26446 |
| 1225 | Ga0500627_0067430 | 3300053158 | Bacteria | 1581 |
| 1226 | Ga0500633_0001269 | 3300053160 | Bacteria | 4655 |
| 1227 | Ga0500634_0000017 | 3300053161 | Bacteria | 111983 |
| 1228 | Ga0500611_004585 | 3300053727 | Bacteria | 1875 |
| 1229 | Ga0501084_0011010 | 3300054114 | Bacteria | 7492 |
| 1230 | Ga0501084_0126094 | 3300054114 | Bacteria | 2154 |
| 1231 | Ga0501084_0296332 | 3300054114 | Bacteria | 1366 |
| 1232 | Ga0501084_0419458 | 3300054114 | Bacteria | 1131 |
| 1233 | Ga0501084_0450168 | 3300054114 | Bacteria | 1088 |
| 1234 | Ga0501084_0822704 | 3300054114 | Bacteria | 782 |
| 1235 | Ga0501084_0840652 | 3300054114 | Bacteria | 773 |
| 1236 | Ga0501084_0847638 | 3300054114 | Bacteria | 769 |
| 1237 | Ga0587090_026817 | 3300059510 | Bacteria | 939 |
| 1238 | Ga0587062_021177 | 3300059639 | Bacteria | 923 |
| 1239 | Ga0587067_105934 | 3300059640 | Bacteria | 657 |
| 1240 | Ga0587068_007676 | 3300059641 | Bacteria | 1544 |
| 1241 | Ga0587072_001125 | 3300059643 | Bacteria | 3166 |
| 1242 | Ga0587107_069084 | 3300059652 | Bacteria | 641 |
| 1243 | Ga0587114_026655 | 3300059655 | Bacteria | 856 |
| 1244 | Ga0501082_0001935 | 3300060353 | Bacteria | 18229 |
| 1245 | Ga0501082_0008096 | 3300060353 | Bacteria | 9068 |
| 1246 | Ga0501082_0012643 | 3300060353 | Bacteria | 7257 |
| 1247 | Ga0501082_0025508 | 3300060353 | Bacteria | 5093 |
| 1248 | Ga0501082_0050904 | 3300060353 | Bacteria | 3571 |
| 1249 | Ga0501082_0237644 | 3300060353 | Bacteria | 1586 |
| 1250 | Ga0501082_0284231 | 3300060353 | Bacteria | 1440 |
| 1251 | Ga0501082_0616415 | 3300060353 | Bacteria | 950 |
| 1252 | Ga0501082_0661721 | 3300060353 | Bacteria | 914 |
| 1253 | Ga0501082_1193747 | 3300060353 | Bacteria | 665 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041451 | Ga0451791_0541240 | Ga0451791_0541240_110_589 | 154 |
| 2 | 3300048088 | Ga0495602_0190888 | Ga0495602_0190888_55_567 | 166 |
| 3 | 3300021377 | Ga0213874_10039805 | Ga0213874_100398052 | 172 |
| 4 | 3300027907 | Ga0207428_10196817 | Ga0207428_101968171 | 173 |
| 5 | 3300037853 | Ga0436364_0281196 | Ga0436364_0281196_322_855 | 173 |
| 6 | 3300039450 | Ga0436363_0577421 | Ga0436363_0577421_324_857 | 173 |
| 7 | 3300039453 | Ga0436362_1053283 | Ga0436362_1053283_310_843 | 173 |
| 8 | 3300050512 | nmdc:mga0n895_633833_c1 | nmdc:mga0n895_633833_c1_228_761 | 173 |
| 9 | 3300031241 | Ga0265325_10268296 | Ga0265325_102682962 | 179 |
| 10 | 3300046616 | Ga0495668_0274987 | Ga0495668_0274987_206_748 | 180 |
| 11 | 3300059655 | Ga0587114_026655 | Ga0587114_026655_94_654 | 180 |
| 12 | 3300005336 | Ga0070680_100029781 | Ga0070680_1000297814 | 181 |
| 13 | 3300005434 | Ga0070709_10235681 | Ga0070709_102356812 | 181 |
| 14 | 3300005439 | Ga0070711_100576550 | Ga0070711_1005765501 | 181 |
| 15 | 3300005530 | Ga0070679_100027144 | Ga0070679_1000271446 | 181 |
| 16 | 3300005563 | Ga0068855_100257099 | Ga0068855_1002570992 | 181 |
| 17 | 3300006173 | Ga0070716_100050646 | Ga0070716_1000506464 | 181 |
| 18 | 3300009098 | Ga0105245_10002744 | Ga0105245_100027442 | 181 |
| 19 | 3300013104 | Ga0157370_10092381 | Ga0157370_100923812 | 181 |
| 20 | 3300013105 | Ga0157369_10667326 | Ga0157369_106673261 | 181 |
| 21 | 3300025906 | Ga0207699_10061156 | Ga0207699_100611562 | 181 |
| 22 | 3300025912 | Ga0207707_10067233 | Ga0207707_100672334 | 181 |
| 23 | 3300025915 | Ga0207693_10339374 | Ga0207693_103393741 | 181 |
| 24 | 3300025917 | Ga0207660_10018910 | Ga0207660_100189102 | 181 |
| 25 | 3300025921 | Ga0207652_10911058 | Ga0207652_109110582 | 181 |
| 26 | 3300025939 | Ga0207665_10058456 | Ga0207665_100584564 | 181 |
| 27 | 3300037312 | Ga0395899_0228539 | Ga0395899_0228539_467_1012 | 181 |
| 28 | 3300037466 | Ga0395898_0359141 | Ga0395898_0359141_339_884 | 181 |
| 29 | 3300037471 | Ga0395905_0020046 | Ga0395905_0020046_4598_5143 | 181 |
| 30 | 3300039437 | Ga0436365_1373922 | Ga0436365_1373922_19218_19763 | 181 |
| 31 | 3300039447 | Ga0436361_0311057 | Ga0436361_0311057_205_771 | 181 |
| 32 | 3300039447 | Ga0436361_0596215 | Ga0436361_0596215_59_616 | 181 |
| 33 | 3300039447 | Ga0436361_1068522 | Ga0436361_1068522_30_587 | 181 |
| 34 | 3300044694 | Ga0466963_0298316 | Ga0466963_0298316_423_986 | 181 |
| 35 | 3300048917 | Ga0496114_0879510 | Ga0496114_0879510_16_561 | 181 |
| 36 | 3300048918 | Ga0496115_0006857 | Ga0496115_0006857_4189_4734 | 181 |
| 37 | 3300048924 | Ga0496121_0220874 | Ga0496121_0220874_646_1203 | 181 |
| 38 | 3300048929 | Ga0496126_0119146 | Ga0496126_0119146_1310_1867 | 181 |
| 39 | 3300048929 | Ga0496126_0284144 | Ga0496126_0284144_112_657 | 181 |
| 40 | 3300049568 | Ga0501031_0447758 | Ga0501031_0447758_49_594 | 181 |
| 41 | 3300049571 | Ga0501034_0098011 | Ga0501034_0098011_1872_2417 | 181 |
| 42 | 3300049571 | Ga0501034_0189933 | Ga0501034_0189933_892_1437 | 181 |
| 43 | 3300049571 | Ga0501034_0285744 | Ga0501034_0285744_104_649 | 181 |
| 44 | 3300049571 | Ga0501034_0361940 | Ga0501034_0361940_715_1260 | 181 |
| 45 | 3300049571 | Ga0501034_0447037 | Ga0501034_0447037_488_1033 | 181 |
| 46 | 3300049571 | Ga0501034_0526515 | Ga0501034_0526515_434_979 | 181 |
| 47 | 3300049571 | Ga0501034_0942601 | Ga0501034_0942601_53_598 | 181 |
| 48 | 3300049671 | Ga0501238_005423 | Ga0501238_005423_500_1045 | 181 |
| 49 | 3300049682 | Ga0501252_005771 | Ga0501252_005771_386_931 | 181 |
| 50 | 3300049822 | Ga0501035_0078780 | Ga0501035_0078780_113_658 | 181 |
| 51 | 3300050489 | nmdc:mga03683_5389_c1 | nmdc:mga03683_5389_c1_1354_1899 | 181 |
| 52 | 3300050489 | nmdc:mga03683_75411_c1 | nmdc:mga03683_75411_c1_380_925 | 181 |
| 53 | 3300050491 | nmdc:mga00v17_362934_c1 | nmdc:mga00v17_362934_c1_186_731 | 181 |
| 54 | 3300050491 | nmdc:mga00v17_588903_c1 | nmdc:mga00v17_588903_c1_26_571 | 181 |
| 55 | 3300050492 | nmdc:mga0yw44_570844_c1 | nmdc:mga0yw44_570844_c1_82_627 | 181 |
| 56 | 3300050493 | nmdc:mga0k408_29119_c1 | nmdc:mga0k408_29119_c1_2376_2921 | 181 |
| 57 | 3300050494 | nmdc:mga06z11_46794_c1 | nmdc:mga06z11_46794_c1_610_1155 | 181 |
| 58 | 3300050496 | nmdc:mga07m45_7795_c1 | nmdc:mga07m45_7795_c1_233_778 | 181 |
| 59 | 3300053108 | Ga0500562_041029 | Ga0500562_041029_599_1144 | 181 |
| 60 | 3300053727 | Ga0500611_004585 | Ga0500611_004585_568_1113 | 181 |
| 61 | 3300059652 | Ga0587107_069084 | Ga0587107_069084_57_614 | 181 |
| 62 | iso_pu_bacteria | 2503198000 | 2503199646 | 181 |
| 63 | iso_pu_bacteria | 2508501122 | 2509112457 | 181 |
| 64 | iso_pu_bacteria | 2508501123 | 2509115159 | 181 |
| 65 | iso_pu_bacteria | 2508501127 | 2509142726 | 181 |
| 66 | iso_pu_bacteria | 2509276018 | 2509371086 | 181 |
| 67 | iso_pu_bacteria | 2509276019 | 2509379109 | 181 |
| 68 | iso_pu_bacteria | 2509276021 | 2509389621 | 181 |
| 69 | iso_pu_bacteria | 2509276022 | 2509394572 | 181 |
| 70 | iso_pu_bacteria | 2509276033 | 2509445963 | 181 |
| 71 | iso_pu_bacteria | 2510065019 | 2510135037 | 181 |
| 72 | iso_pu_bacteria | 2510065057 | 2510306687 | 181 |
| 73 | iso_pu_bacteria | 2510065059 | 2510319200 | 181 |
| 74 | iso_pu_bacteria | 2510461076 | 2510896463 | 181 |
| 75 | iso_pu_bacteria | 2510917022 | 2511133817 | 181 |
| 76 | iso_pu_bacteria | 2510917026 | 2511173583 | 181 |
| 77 | iso_pu_bacteria | 2510917028 | 2511182859 | 181 |
| 78 | iso_pu_bacteria | 2510917030 | 2511199721 | 181 |
| 79 | iso_pu_bacteria | 2511231027 | 2511392237 | 181 |
| 80 | iso_pu_bacteria | 2511231052 | 2511502720 | 181 |
| 81 | iso_pu_bacteria | 2512047086 | 2512534020 | 181 |
| 82 | iso_pu_bacteria | 2512875016 | 2512932952 | 181 |
| 83 | iso_pu_bacteria | 2512875024 | 2512960973 | 181 |
| 84 | iso_pu_bacteria | 2512875026 | 2512974258 | 181 |
| 85 | iso_pu_bacteria | 2513237084 | 2513571408 | 181 |
| 86 | iso_pu_bacteria | 2513237085 | 2513581335 | 181 |
| 87 | iso_pu_bacteria | 2513237086 | 2513586633 | 181 |
| 88 | iso_pu_bacteria | 2513237088 | 2513600958 | 181 |
| 89 | iso_pu_bacteria | 2513237089 | 2513602136 | 181 |
| 90 | iso_pu_bacteria | 2513237090 | 2513611158 | 181 |
| 91 | iso_pu_bacteria | 2513237091 | 2513618438 | 181 |
| 92 | iso_pu_bacteria | 2513237093 | 2513630427 | 181 |
| 93 | iso_pu_bacteria | 2513237103 | 2513713950 | 181 |
| 94 | iso_pu_bacteria | 2513237138 | 2513869405 | 181 |
| 95 | iso_pu_bacteria | 2513237140 | 2513886572 | 181 |
| 96 | iso_pu_bacteria | 2513237143 | 2513906064 | 181 |
| 97 | iso_pu_bacteria | 2513237144 | 2513912968 | 181 |
| 98 | iso_pu_bacteria | 2513237146 | 2513929915 | 181 |
| 99 | iso_pu_bacteria | 2513237156 | 2513986407 | 181 |
| 100 | iso_pu_bacteria | 2513237159 | 2513997873 | 181 |
| 101 | iso_pu_bacteria | 2513237160 | 2514003723 | 181 |
| 102 | iso_pu_bacteria | 2513237162 | 2514024247 | 181 |
| 103 | iso_pu_bacteria | 2513237164 | 2514038507 | 181 |
| 104 | iso_pu_bacteria | 2513237305 | 2514416908 | 181 |
| 105 | iso_pu_bacteria | 2513237351 | 2514587215 | 181 |
| 106 | iso_pu_bacteria | 2515075009 | 2515114124 | 181 |
| 107 | iso_pu_bacteria | 2515154107 | 2515610561 | 181 |
| 108 | iso_pu_bacteria | 2515154113 | 2515636346 | 181 |
| 109 | iso_pu_bacteria | 2515154114 | 2515646270 | 181 |
| 110 | iso_pu_bacteria | 2515154116 | 2515660547 | 181 |
| 111 | iso_pu_bacteria | 2515154134 | 2515741356 | 181 |
| 112 | iso_pu_bacteria | 2516143018 | 2516205000 | 181 |
| 113 | iso_pu_bacteria | 2516653046 | 2516894095 | 181 |
| 114 | iso_pu_bacteria | 2516653077 | 2517037760 | 181 |
| 115 | iso_pu_bacteria | 2516653085 | 2517078075 | 181 |
| 116 | iso_pu_bacteria | 2517093000 | 2517096846 | 181 |
| 117 | iso_pu_bacteria | 2517287029 | 2517408743 | 181 |
| 118 | iso_pu_bacteria | 2517487022 | 2517570788 | 181 |
| 119 | iso_pu_bacteria | 2519899620 | 2520376322 | 181 |
| 120 | iso_pu_bacteria | 2523231067 | 2523467780 | 181 |
| 121 | iso_pu_bacteria | 2524023207 | 2524454025 | 181 |
| 122 | iso_pu_bacteria | 2524023209 | 2524462354 | 181 |
| 123 | iso_pu_bacteria | 2529292951 | 2530647536 | 181 |
| 124 | iso_pu_bacteria | 2534681796 | 2535518763 | 181 |
| 125 | iso_pu_bacteria | 2537561587 | 2537874236 | 181 |
| 126 | iso_pu_bacteria | 2551306084 | 2551679057 | 181 |
| 127 | iso_pu_bacteria | 2551306084 | 2551681848 | 181 |
| 128 | iso_pu_bacteria | 2551306085 | 2551686696 | 181 |
| 129 | iso_pu_bacteria | 2551306086 | 2551693631 | 181 |
| 130 | iso_pu_bacteria | 2551306087 | 2551699067 | 181 |
| 131 | iso_pu_bacteria | 2551306089 | 2551710116 | 181 |
| 132 | iso_pu_bacteria | 2551306090 | 2551719631 | 181 |
| 133 | iso_pu_bacteria | 2551306091 | 2551725347 | 181 |
| 134 | iso_pu_bacteria | 2551306092 | 2551734239 | 181 |
| 135 | iso_pu_bacteria | 2551306093 | 2551740615 | 181 |
| 136 | iso_pu_bacteria | 2554235003 | 2554245365 | 181 |
| 137 | iso_pu_bacteria | 2558860100 | 2558860211 | 181 |
| 138 | iso_pu_bacteria | 2558860242 | 2559296806 | 181 |
| 139 | iso_pu_bacteria | 2558860983 | 2561466951 | 181 |
| 140 | iso_pu_bacteria | 2582581283 | 2585167792 | 181 |
| 141 | iso_pu_bacteria | 2582581294 | 2585205552 | 181 |
| 142 | iso_pu_bacteria | 2582581298 | 2585223748 | 181 |
| 143 | iso_pu_bacteria | 2582581299 | 2585228872 | 181 |
| 144 | iso_pu_bacteria | 2582581304 | 2585257535 | 181 |
| 145 | iso_pu_bacteria | 2582581306 | 2585270328 | 181 |
| 146 | iso_pu_bacteria | 2582581307 | 2585271479 | 181 |
| 147 | iso_pu_bacteria | 2582581308 | 2585280546 | 181 |
| 148 | iso_pu_bacteria | 2582581315 | 2585327911 | 181 |
| 149 | iso_pu_bacteria | 2582581316 | 2585334338 | 181 |
| 150 | iso_pu_bacteria | 2582581865 | 2585391500 | 181 |
| 151 | iso_pu_bacteria | 2582581866 | 2585394735 | 181 |
| 152 | iso_pu_bacteria | 2582581867 | 2585403619 | 181 |
| 153 | iso_pu_bacteria | 2585427526 | 2585530123 | 181 |
| 154 | iso_pu_bacteria | 2585427527 | 2585531484 | 181 |
| 155 | iso_pu_bacteria | 2585427528 | 2585543768 | 181 |
| 156 | iso_pu_bacteria | 2585427529 | 2585548971 | 181 |
| 157 | iso_pu_bacteria | 2585427530 | 2585557731 | 181 |
| 158 | iso_pu_bacteria | 2585427531 | 2585563281 | 181 |
| 159 | iso_pu_bacteria | 2585427590 | 2585824187 | 181 |
| 160 | iso_pu_bacteria | 2585427593 | 2585842092 | 181 |
| 161 | iso_pu_bacteria | 2585427594 | 2585844764 | 181 |
| 162 | iso_pu_bacteria | 2585427608 | 2585902666 | 181 |
| 163 | iso_pu_bacteria | 2585427609 | 2585907499 | 181 |
| 164 | iso_pu_bacteria | 2585427633 | 2585997612 | 181 |
| 165 | iso_pu_bacteria | 2585427634 | 2586002200 | 181 |
| 166 | iso_pu_bacteria | 2585428125 | 2587982507 | 181 |
| 167 | iso_pu_bacteria | 2588253730 | 2588519005 | 181 |
| 168 | iso_pu_bacteria | 2597489875 | 2597811319 | 181 |
| 169 | iso_pu_bacteria | 2599185156 | 2599334958 | 181 |
| 170 | iso_pu_bacteria | 2599185170 | 2599420370 | 181 |
| 171 | iso_pu_bacteria | 2599185210 | 2599604498 | 181 |
| 172 | iso_pu_bacteria | 2599185236 | 2599720158 | 181 |
| 173 | iso_pu_bacteria | 2599185301 | 2599939011 | 181 |
| 174 | iso_pu_bacteria | 2599185352 | 2600197458 | 181 |
| 175 | iso_pu_bacteria | 2600254933 | 2600373388 | 181 |
| 176 | iso_pu_bacteria | 2600255279 | 2601610314 | 181 |
| 177 | iso_pu_bacteria | 2600255308 | 2601747356 | 181 |
| 178 | iso_pu_bacteria | 2615840624 | 2616297933 | 181 |
| 179 | iso_pu_bacteria | 2615840626 | 2616306908 | 181 |
| 180 | iso_pu_bacteria | 2615840698 | 2616557768 | 181 |
| 181 | iso_pu_bacteria | 2617270742 | 2617385016 | 181 |
| 182 | iso_pu_bacteria | 2643221550 | 2643770044 | 181 |
| 183 | iso_pu_bacteria | 2643221551 | 2643776821 | 181 |
| 184 | iso_pu_bacteria | 2643221555 | 2643795269 | 181 |
| 185 | iso_pu_bacteria | 2643221557 | 2643806803 | 181 |
| 186 | iso_pu_bacteria | 2643221558 | 2643813586 | 181 |
| 187 | iso_pu_bacteria | 2643221564 | 2643840224 | 181 |
| 188 | iso_pu_bacteria | 2643221580 | 2643911743 | 181 |
| 189 | iso_pu_bacteria | 2643221582 | 2643917110 | 181 |
| 190 | iso_pu_bacteria | 2643221595 | 2643986039 | 181 |
| 191 | iso_pu_bacteria | 2643221599 | 2644002337 | 181 |
| 192 | iso_pu_bacteria | 2643221607 | 2644050850 | 181 |
| 193 | iso_pu_bacteria | 2643221610 | 2644064753 | 181 |
| 194 | iso_pu_bacteria | 2643221618 | 2644108723 | 181 |
| 195 | iso_pu_bacteria | 2643221623 | 2644130782 | 181 |
| 196 | iso_pu_bacteria | 2643221626 | 2644149778 | 181 |
| 197 | iso_pu_bacteria | 2643221627 | 2644153605 | 181 |
| 198 | iso_pu_bacteria | 2643221629 | 2644169411 | 181 |
| 199 | iso_pu_bacteria | 2643221634 | 2644194059 | 181 |
| 200 | iso_pu_bacteria | 2643221636 | 2644205353 | 181 |
| 201 | iso_pu_bacteria | 2643221637 | 2644208431 | 181 |
| 202 | iso_pu_bacteria | 2643221643 | 2644240722 | 181 |
| 203 | iso_pu_bacteria | 2643221653 | 2644300055 | 181 |
| 204 | iso_pu_bacteria | 2643221655 | 2644311139 | 181 |
| 205 | iso_pu_bacteria | 2643221659 | 2644335046 | 181 |
| 206 | iso_pu_bacteria | 2643221662 | 2644350808 | 181 |
| 207 | iso_pu_bacteria | 2643221668 | 2644376310 | 181 |
| 208 | iso_pu_bacteria | 2643221674 | 2644413110 | 181 |
| 209 | iso_pu_bacteria | 2643221675 | 2644416426 | 181 |
| 210 | iso_pu_bacteria | 2643221680 | 2644449466 | 181 |
| 211 | iso_pu_bacteria | 2643221686 | 2644483754 | 181 |
| 212 | iso_pu_bacteria | 2643221688 | 2644496063 | 181 |
| 213 | iso_pu_bacteria | 2643221689 | 2644500430 | 181 |
| 214 | iso_pu_bacteria | 2643221693 | 2644520933 | 181 |
| 215 | iso_pu_bacteria | 2643221698 | 2644544532 | 181 |
| 216 | iso_pu_bacteria | 2643221712 | 2644616969 | 181 |
| 217 | iso_pu_bacteria | 2643221718 | 2644651682 | 181 |
| 218 | iso_pu_bacteria | 2643221719 | 2644658281 | 181 |
| 219 | iso_pu_bacteria | 2643221723 | 2644676964 | 181 |
| 220 | iso_pu_bacteria | 2643221726 | 2644688040 | 181 |
| 221 | iso_pu_bacteria | 2657244999 | 2657685273 | 181 |
| 222 | iso_pu_bacteria | 2667528174 | 2671113652 | 181 |
| 223 | iso_pu_bacteria | 2671180139 | 2671693434 | 181 |
| 224 | iso_pu_bacteria | 2687453392 | 2688596894 | 181 |
| 225 | iso_pu_bacteria | 2690316117 | 2692314822 | 181 |
| 226 | iso_pu_bacteria | 2693429783 | 2694629221 | 181 |
| 227 | iso_pu_bacteria | 2693429784 | 2694637913 | 181 |
| 228 | iso_pu_bacteria | 2718217882 | 2719182780 | 181 |
| 229 | iso_pu_bacteria | 2718217927 | 2719387471 | 181 |
| 230 | iso_pu_bacteria | 2718217997 | 2719667117 | 181 |
| 231 | iso_pu_bacteria | 2718218009 | 2719733497 | 181 |
| 232 | iso_pu_bacteria | 2718218199 | 2720493537 | 181 |
| 233 | iso_pu_bacteria | 2718218232 | 2720614995 | 181 |
| 234 | iso_pu_bacteria | 2718218233 | 2720621767 | 181 |
| 235 | iso_pu_bacteria | 2718218235 | 2720633101 | 181 |
| 236 | iso_pu_bacteria | 2718218269 | 2720776820 | 181 |
| 237 | iso_pu_bacteria | 2718218363 | 2721148892 | 181 |
| 238 | iso_pu_bacteria | 2718218365 | 2721160290 | 181 |
| 239 | iso_pu_bacteria | 2718218366 | 2721165705 | 181 |
| 240 | iso_pu_bacteria | 2718218423 | 2721401105 | 181 |
| 241 | iso_pu_bacteria | 2721755514 | 2722841875 | 181 |
| 242 | iso_pu_bacteria | 2721755556 | 2723028410 | 181 |
| 243 | iso_pu_bacteria | 2721755684 | 2723562036 | 181 |
| 244 | iso_pu_bacteria | 2721755685 | 2723568668 | 181 |
| 245 | iso_pu_bacteria | 2721755686 | 2723574016 | 181 |
| 246 | iso_pu_bacteria | 2721755809 | 2724039919 | 181 |
| 247 | iso_pu_bacteria | 2721755810 | 2724046253 | 181 |
| 248 | iso_pu_bacteria | 2721755819 | 2724091427 | 181 |
| 249 | iso_pu_bacteria | 2721755822 | 2724105933 | 181 |
| 250 | iso_pu_bacteria | 2721755823 | 2724111758 | 181 |
| 251 | iso_pu_bacteria | 2724679232 | 2725947288 | 181 |
| 252 | iso_pu_bacteria | 2728369352 | 2730109346 | 181 |
| 253 | iso_pu_bacteria | 2728369365 | 2730166015 | 181 |
| 254 | iso_pu_bacteria | 2728369397 | 2730299922 | 181 |
| 255 | iso_pu_bacteria | 2738541293 | 2738803832 | 181 |
| 256 | iso_pu_bacteria | 2738541317 | 2738947472 | 181 |
| 257 | iso_pu_bacteria | 2738541333 | 2739038946 | 181 |
| 258 | iso_pu_bacteria | 2738543024 | 2739310356 | 181 |
| 259 | iso_pu_bacteria | 2738543031 | 2739349230 | 181 |
| 260 | iso_pu_bacteria | 2756170246 | 2756670836 | 181 |
| 261 | iso_pu_bacteria | 2757320392 | 2757570571 | 181 |
| 262 | iso_pu_bacteria | 2765235802 | 2765467932 | 181 |
| 263 | iso_pu_bacteria | 2765235942 | 2766062428 | 181 |
| 264 | iso_pu_bacteria | 2767802442 | 2770198569 | 181 |
| 265 | iso_pu_bacteria | 2775506902 | 2776270113 | 181 |
| 266 | iso_pu_bacteria | 2775506904 | 2776281224 | 181 |
| 267 | iso_pu_bacteria | 2775507049 | 2776915290 | 181 |
| 268 | iso_pu_bacteria | 2775507266 | 2778176211 | 181 |
| 269 | iso_pu_bacteria | 2791355082 | 2792582756 | 181 |
| 270 | iso_pu_bacteria | 2791355091 | 2792624700 | 181 |
| 271 | iso_pu_bacteria | 2791355092 | 2792630774 | 181 |
| 272 | iso_pu_bacteria | 2791355094 | 2792643624 | 181 |
| 273 | iso_pu_bacteria | 2791355123 | 2792748353 | 181 |
| 274 | iso_pu_bacteria | 2791355253 | 2793282673 | 181 |
| 275 | iso_pu_bacteria | 2791355256 | 2793299517 | 181 |
| 276 | iso_pu_bacteria | 2791355259 | 2793318254 | 181 |
| 277 | iso_pu_bacteria | 2791355260 | 2793325129 | 181 |
| 278 | iso_pu_bacteria | 2791355261 | 2793330889 | 181 |
| 279 | iso_pu_bacteria | 2791355262 | 2793337727 | 181 |
| 280 | iso_pu_bacteria | 2791355263 | 2793338607 | 181 |
| 281 | iso_pu_bacteria | 2791355264 | 2793346417 | 181 |
| 282 | iso_pu_bacteria | 2791355265 | 2793357268 | 181 |
| 283 | iso_pu_bacteria | 2791355266 | 2793363981 | 181 |
| 284 | iso_pu_bacteria | 2791355267 | 2793370913 | 181 |
| 285 | iso_pu_bacteria | 2802428858 | 2802718120 | 181 |
| 286 | iso_pu_bacteria | 2802428859 | 2802725028 | 181 |
| 287 | iso_pu_bacteria | 2802428860 | 2802730848 | 181 |
| 288 | iso_pu_bacteria | 2802428861 | 2802738196 | 181 |
| 289 | iso_pu_bacteria | 2802428862 | 2802743936 | 181 |
| 290 | iso_pu_bacteria | 2802428863 | 2802750814 | 181 |
| 291 | iso_pu_bacteria | 2802429268 | 2804753116 | 181 |
| 292 | iso_pu_bacteria | 2802429605 | 2805931594 | 181 |
| 293 | iso_pu_bacteria | 2802429606 | 2805937617 | 181 |
| 294 | iso_pu_bacteria | 2802429633 | 2806049336 | 181 |
| 295 | iso_pu_bacteria | 2802429634 | 2806056294 | 181 |
| 296 | iso_pu_bacteria | 2802429635 | 2806063432 | 181 |
| 297 | iso_pu_bacteria | 2802429636 | 2806071005 | 181 |
| 298 | iso_pu_bacteria | 2802429637 | 2806077964 | 181 |
| 299 | iso_pu_bacteria | 2808606387 | 2808987262 | 181 |
| 300 | iso_pu_bacteria | 2818991272 | 2819243612 | 181 |
| 301 | iso_pu_bacteria | 2818991439 | 2819557354 | 181 |
| 302 | iso_pu_bacteria | 2818991448 | 2819611070 | 181 |
| 303 | iso_pu_bacteria | 2818991453 | 2819639001 | 181 |
| 304 | iso_pu_bacteria | 2818991461 | 2819687178 | 181 |
| 305 | iso_pu_bacteria | 2821123053 | 2821128555 | 181 |
| 306 | iso_pu_bacteria | 2837651117 | 2837653980 | 181 |
| 307 | iso_pu_bacteria | 2837678835 | 2837680397 | 181 |
| 308 | iso_pu_bacteria | 2838016132 | 2838021959 | 181 |
| 309 | iso_pu_bacteria | 2838022645 | 2838028649 | 181 |
| 310 | iso_pu_bacteria | 2838029111 | 2838030756 | 181 |
| 311 | iso_pu_bacteria | 2838035591 | 2838042291 | 181 |
| 312 | iso_pu_bacteria | 2838042994 | 2838048219 | 181 |
| 313 | iso_pu_bacteria | 2838048938 | 2838053623 | 181 |
| 314 | iso_pu_bacteria | 2838061910 | 2838067584 | 181 |
| 315 | iso_pu_bacteria | 2838068647 | 2838073897 | 181 |
| 316 | iso_pu_bacteria | 2838074704 | 2838077225 | 181 |
| 317 | iso_pu_bacteria | 2838661181 | 2838668303 | 181 |
| 318 | iso_pu_bacteria | 2838668709 | 2838674794 | 181 |
| 319 | iso_pu_bacteria | 2838675328 | 2838678089 | 181 |
| 320 | iso_pu_bacteria | 2838680041 | 2838684083 | 181 |
| 321 | iso_pu_bacteria | 2838686498 | 2838694020 | 181 |
| 322 | iso_pu_bacteria | 2838694306 | 2838698612 | 181 |
| 323 | iso_pu_bacteria | 2838701080 | 2838707097 | 181 |
| 324 | iso_pu_bacteria | 2838707686 | 2838711727 | 181 |
| 325 | iso_pu_bacteria | 2838714209 | 2838717004 | 181 |
| 326 | iso_pu_bacteria | 2838719591 | 2838722385 | 181 |
| 327 | iso_pu_bacteria | 2838724970 | 2838727754 | 181 |
| 328 | iso_pu_bacteria | 2838729681 | 2838731816 | 181 |
| 329 | iso_pu_bacteria | 2838736955 | 2838741572 | 181 |
| 330 | iso_pu_bacteria | 2838742623 | 2838749410 | 181 |
| 331 | iso_pu_bacteria | 2839993093 | 2839997880 | 181 |
| 332 | iso_pu_bacteria | 2840764183 | 2840765518 | 181 |
| 333 | iso_pu_bacteria | 2841734538 | 2841737387 | 181 |
| 334 | iso_pu_bacteria | 2841840854 | 2841845593 | 181 |
| 335 | iso_pu_bacteria | 2841846520 | 2841849410 | 181 |
| 336 | iso_pu_bacteria | 2841851746 | 2841858799 | 181 |
| 337 | iso_pu_bacteria | 2841859092 | 2841861547 | 181 |
| 338 | iso_pu_bacteria | 2841864319 | 2841867961 | 181 |
| 339 | iso_pu_bacteria | 2842077413 | 2842081528 | 181 |
| 340 | iso_pu_bacteria | 2842110456 | 2842116212 | 181 |
| 341 | iso_pu_bacteria | 2842118031 | 2842124888 | 181 |
| 342 | iso_pu_bacteria | 2842124991 | 2842127841 | 181 |
| 343 | iso_pu_bacteria | 2842130223 | 2842132982 | 181 |
| 344 | iso_pu_bacteria | 2842140634 | 2842145297 | 181 |
| 345 | iso_pu_bacteria | 2842146304 | 2842149842 | 181 |
| 346 | iso_pu_bacteria | 2842152218 | 2842154976 | 181 |
| 347 | iso_pu_bacteria | 2842156927 | 2842163443 | 181 |
| 348 | iso_pu_bacteria | 2842163707 | 2842166457 | 181 |
| 349 | iso_pu_bacteria | 2842170452 | 2842173475 | 181 |
| 350 | iso_pu_bacteria | 2842175837 | 2842178596 | 181 |
| 351 | iso_pu_bacteria | 2842180545 | 2842187053 | 181 |
| 352 | iso_pu_bacteria | 2842187318 | 2842190112 | 181 |
| 353 | iso_pu_bacteria | 2842192696 | 2842198678 | 181 |
| 354 | iso_pu_bacteria | 2842198810 | 2842204702 | 181 |
| 355 | iso_pu_bacteria | 2842205361 | 2842207215 | 181 |
| 356 | iso_pu_bacteria | 2842211629 | 2842214426 | 181 |
| 357 | iso_pu_bacteria | 2842217011 | 2842224147 | 181 |
| 358 | iso_pu_bacteria | 2842224351 | 2842227145 | 181 |
| 359 | iso_pu_bacteria | 2842229732 | 2842235814 | 181 |
| 360 | iso_pu_bacteria | 2842237096 | 2842240710 | 181 |
| 361 | iso_pu_bacteria | 2842243621 | 2842250383 | 181 |
| 362 | iso_pu_bacteria | 2842250916 | 2842256935 | 181 |
| 363 | iso_pu_bacteria | 2842257432 | 2842264319 | 181 |
| 364 | iso_pu_bacteria | 2842264693 | 2842269104 | 181 |
| 365 | iso_pu_bacteria | 2842271015 | 2842278502 | 181 |
| 366 | iso_pu_bacteria | 2842278818 | 2842281074 | 181 |
| 367 | iso_pu_bacteria | 2842285085 | 2842288312 | 181 |
| 368 | iso_pu_bacteria | 2842291075 | 2842295185 | 181 |
| 369 | iso_pu_bacteria | 2842298080 | 2842300460 | 181 |
| 370 | iso_pu_bacteria | 2842304105 | 2842306080 | 181 |
| 371 | iso_pu_bacteria | 2842311132 | 2842311164 | 181 |
| 372 | iso_pu_bacteria | 2842317721 | 2842320915 | 181 |
| 373 | iso_pu_bacteria | 2842341865 | 2842348045 | 181 |
| 374 | iso_pu_bacteria | 2842357229 | 2842362241 | 181 |
| 375 | iso_pu_bacteria | 2842363717 | 2842366467 | 181 |
| 376 | iso_pu_bacteria | 2842370503 | 2842374797 | 181 |
| 377 | iso_pu_bacteria | 2842377471 | 2842381584 | 181 |
| 378 | iso_pu_bacteria | 2842384541 | 2842388654 | 181 |
| 379 | iso_pu_bacteria | 2842395702 | 2842396252 | 181 |
| 380 | iso_pu_bacteria | 2842402390 | 2842408617 | 181 |
| 381 | iso_pu_bacteria | 2842409023 | 2842415270 | 181 |
| 382 | iso_pu_bacteria | 2842415677 | 2842421889 | 181 |
| 383 | iso_pu_bacteria | 2842422224 | 2842427764 | 181 |
| 384 | iso_pu_bacteria | 2842428310 | 2842433203 | 181 |
| 385 | iso_pu_bacteria | 2842434925 | 2842439629 | 181 |
| 386 | iso_pu_bacteria | 2842441272 | 2842446292 | 181 |
| 387 | iso_pu_bacteria | 2842447887 | 2842448972 | 181 |
| 388 | iso_pu_bacteria | 2842462802 | 2842467487 | 181 |
| 389 | iso_pu_bacteria | 2842469257 | 2842474000 | 181 |
| 390 | iso_pu_bacteria | 2842475841 | 2842477488 | 181 |
| 391 | iso_pu_bacteria | 2842482326 | 2842488054 | 181 |
| 392 | iso_pu_bacteria | 2842489311 | 2842490966 | 181 |
| 393 | iso_pu_bacteria | 2842495871 | 2842498305 | 181 |
| 394 | iso_pu_bacteria | 2842502639 | 2842504639 | 181 |
| 395 | iso_pu_bacteria | 2842509118 | 2842511892 | 181 |
| 396 | iso_pu_bacteria | 2842515876 | 2842518187 | 181 |
| 397 | iso_pu_bacteria | 2842521101 | 2842522978 | 181 |
| 398 | iso_pu_bacteria | 2842871566 | 2842875884 | 181 |
| 399 | iso_pu_bacteria | 2842922631 | 2842926139 | 181 |
| 400 | iso_pu_bacteria | 2844002411 | 2844009078 | 181 |
| 401 | iso_pu_bacteria | 2844009547 | 2844012241 | 181 |
| 402 | iso_pu_bacteria | 2844163670 | 2844168873 | 181 |
| 403 | iso_pu_bacteria | 2844454524 | 2844457261 | 181 |
| 404 | iso_pu_bacteria | 2847417321 | 2847420123 | 181 |
| 405 | iso_pu_bacteria | 2847670302 | 2847674653 | 181 |
| 406 | iso_pu_bacteria | 2847686936 | 2847690777 | 181 |
| 407 | iso_pu_bacteria | 2848992105 | 2848995001 | 181 |
| 408 | iso_pu_bacteria | 2850079185 | 2850082105 | 181 |
| 409 | iso_pu_bacteria | 2852387548 | 2852391508 | 181 |
| 410 | iso_pu_bacteria | 2854896431 | 2854896955 | 181 |
| 411 | iso_pu_bacteria | 2854916844 | 2854917106 | 181 |
| 412 | iso_pu_bacteria | 2855825444 | 2855826813 | 181 |
| 413 | iso_pu_bacteria | 2855839649 | 2855842211 | 181 |
| 414 | iso_pu_bacteria | 2855872281 | 2855874691 | 181 |
| 415 | iso_pu_bacteria | 2856314179 | 2856317461 | 181 |
| 416 | iso_pu_bacteria | 2856328259 | 2856328804 | 181 |
| 417 | iso_pu_bacteria | 2856334872 | 2856336778 | 181 |
| 418 | iso_pu_bacteria | 2856342000 | 2856346056 | 181 |
| 419 | iso_pu_bacteria | 2856364286 | 2856366765 | 181 |
| 420 | iso_pu_bacteria | 2857349434 | 2857356552 | 181 |
| 421 | iso_pu_bacteria | 2857367948 | 2857374742 | 181 |
| 422 | iso_pu_bacteria | 2857516855 | 2857521209 | 181 |
| 423 | iso_pu_bacteria | 2857531043 | 2857534292 | 181 |
| 424 | iso_pu_bacteria | 2858800743 | 2858801874 | 181 |
| 425 | iso_pu_bacteria | 2869162929 | 2869165203 | 181 |
| 426 | iso_pu_bacteria | 2869169390 | 2869174281 | 181 |
| 427 | iso_pu_bacteria | 2869234852 | 2869237251 | 181 |
| 428 | iso_pu_bacteria | 2869242130 | 2869247142 | 181 |
| 429 | iso_pu_bacteria | 2869249662 | 2869250851 | 181 |
| 430 | iso_pu_bacteria | 2869256925 | 2869258888 | 181 |
| 431 | iso_pu_bacteria | 2869264136 | 2869264459 | 181 |
| 432 | iso_pu_bacteria | 2869271264 | 2869276804 | 181 |
| 433 | iso_pu_bacteria | 2869278585 | 2869285753 | 181 |
| 434 | iso_pu_bacteria | 2869285874 | 2869287824 | 181 |
| 435 | iso_pu_bacteria | 2871429161 | 2871435772 | 181 |
| 436 | iso_pu_bacteria | 2871435913 | 2871443143 | 181 |
| 437 | iso_pu_bacteria | 2871444079 | 2871445204 | 181 |
| 438 | iso_pu_bacteria | 2871451962 | 2871454586 | 181 |
| 439 | iso_pu_bacteria | 2871459585 | 2871460160 | 181 |
| 440 | iso_pu_bacteria | 2871466892 | 2871474233 | 181 |
| 441 | iso_pu_bacteria | 2871474448 | 2871478866 | 181 |
| 442 | iso_pu_bacteria | 2871481445 | 2871487855 | 181 |
| 443 | iso_pu_bacteria | 2871495908 | 2871498074 | 181 |
| 444 | iso_pu_bacteria | 2874102143 | 2874104569 | 181 |
| 445 | iso_pu_bacteria | 2874109183 | 2874110476 | 181 |
| 446 | iso_pu_bacteria | 2874116593 | 2874120416 | 181 |
| 447 | iso_pu_bacteria | 2874123672 | 2874128867 | 181 |
| 448 | iso_pu_bacteria | 2874139085 | 2874141933 | 181 |
| 449 | iso_pu_bacteria | 2874146452 | 2874151456 | 181 |
| 450 | iso_pu_bacteria | 2874155637 | 2874159089 | 181 |
| 451 | iso_pu_bacteria | 2874162495 | 2874167650 | 181 |
| 452 | iso_pu_bacteria | 2874168670 | 2874175642 | 181 |
| 453 | iso_pu_bacteria | 2876363079 | 2876364802 | 181 |
| 454 | iso_pu_bacteria | 2876369609 | 2876371391 | 181 |
| 455 | iso_pu_bacteria | 2876377896 | 2876385296 | 181 |
| 456 | iso_pu_bacteria | 2876386047 | 2876387710 | 181 |
| 457 | iso_pu_bacteria | 2876392853 | 2876396141 | 181 |
| 458 | iso_pu_bacteria | 2876399893 | 2876404743 | 181 |
| 459 | iso_pu_bacteria | 2876406927 | 2876412398 | 181 |
| 460 | iso_pu_bacteria | 2876413966 | 2876417508 | 181 |
| 461 | iso_pu_bacteria | 2876420981 | 2876423455 | 181 |
| 462 | iso_pu_bacteria | 2878035449 | 2878038499 | 181 |
| 463 | iso_pu_bacteria | 2878730984 | 2878733847 | 181 |
| 464 | iso_pu_bacteria | 2878738818 | 2878739328 | 181 |
| 465 | iso_pu_bacteria | 2878745973 | 2878749335 | 181 |
| 466 | iso_pu_bacteria | 2878760144 | 2878762296 | 181 |
| 467 | iso_pu_bacteria | 2878767105 | 2878769263 | 181 |
| 468 | iso_pu_bacteria | 2878774303 | 2878774888 | 181 |
| 469 | iso_pu_bacteria | 2878781027 | 2878786337 | 181 |
| 470 | iso_pu_bacteria | 2878788777 | 2878796716 | 181 |
| 471 | iso_pu_bacteria | 2881147464 | 2881149477 | 181 |
| 472 | iso_pu_bacteria | 2881161766 | 2881166368 | 181 |
| 473 | iso_pu_bacteria | 2882632389 | 2882634141 | 181 |
| 474 | iso_pu_bacteria | 2885305155 | 2885307805 | 181 |
| 475 | iso_pu_bacteria | 2885312484 | 2885313201 | 181 |
| 476 | iso_pu_bacteria | 2885326080 | 2885334029 | 181 |
| 477 | iso_pu_bacteria | 2885334103 | 2885340263 | 181 |
| 478 | iso_pu_bacteria | 2888337043 | 2888338019 | 181 |
| 479 | iso_pu_bacteria | 2888343758 | 2888345318 | 181 |
| 480 | iso_pu_bacteria | 2888350351 | 2888354608 | 181 |
| 481 | iso_pu_bacteria | 2889010040 | 2889016217 | 181 |
| 482 | iso_pu_bacteria | 2889016732 | 2889018747 | 181 |
| 483 | iso_pu_bacteria | 2889914905 | 2889917645 | 181 |
| 484 | iso_pu_bacteria | 2891048133 | 2891049380 | 181 |
| 485 | iso_pu_bacteria | 2891373044 | 2891373788 | 181 |
| 486 | iso_pu_bacteria | 2894652903 | 2894654197 | 181 |
| 487 | iso_pu_bacteria | 2894817345 | 2894817963 | 181 |
| 488 | iso_pu_bacteria | 2896384573 | 2896387854 | 181 |
| 489 | iso_pu_bacteria | 2899792073 | 2899792669 | 181 |
| 490 | iso_pu_bacteria | 2899803654 | 2899808206 | 181 |
| 491 | iso_pu_bacteria | 2899845264 | 2899850114 | 181 |
| 492 | iso_pu_bacteria | 2903448605 | 2903449212 | 181 |
| 493 | iso_pu_bacteria | 2903492973 | 2903504197 | 181 |
| 494 | iso_pu_bacteria | 2903513507 | 2903518102 | 181 |
| 495 | iso_pu_bacteria | 2903521522 | 2903522462 | 181 |
| 496 | iso_pu_bacteria | 2903528002 | 2903528841 | 181 |
| 497 | iso_pu_bacteria | 2903540706 | 2903542872 | 181 |
| 498 | iso_pu_bacteria | 2904578770 | 2904580458 | 181 |
| 499 | iso_pu_bacteria | 2904659560 | 2904662917 | 181 |
| 500 | iso_pu_bacteria | 2906308376 | 2906310373 | 181 |
| 501 | iso_pu_bacteria | 2906321335 | 2906324438 | 181 |
| 502 | iso_pu_bacteria | 2906328253 | 2906333239 | 181 |
| 503 | iso_pu_bacteria | 2906354277 | 2906356848 | 181 |
| 504 | iso_pu_bacteria | 2906363423 | 2906370345 | 181 |
| 505 | iso_pu_bacteria | 2906370794 | 2906377945 | 181 |
| 506 | iso_pu_bacteria | 2906378014 | 2906379222 | 181 |
| 507 | iso_pu_bacteria | 2906386501 | 2906386870 | 181 |
| 508 | iso_pu_bacteria | 2906393657 | 2906399058 | 181 |
| 509 | iso_pu_bacteria | 2906401398 | 2906405706 | 181 |
| 510 | iso_pu_bacteria | 2906408224 | 2906412905 | 181 |
| 511 | iso_pu_bacteria | 2906414383 | 2906417526 | 181 |
| 512 | iso_pu_bacteria | 2906427513 | 2906435879 | 181 |
| 513 | iso_pu_bacteria | 2913295892 | 2913299627 | 181 |
| 514 | iso_pu_bacteria | 2913308742 | 2913312379 | 181 |
| 515 | iso_pu_bacteria | 2915980308 | 2915980336 | 181 |
| 516 | iso_pu_bacteria | 2915986958 | 2915992074 | 181 |
| 517 | iso_pu_bacteria | 2915993759 | 2915994548 | 181 |
| 518 | iso_pu_bacteria | 2916000859 | 2916007613 | 181 |
| 519 | iso_pu_bacteria | 2916007675 | 2916012878 | 181 |
| 520 | iso_pu_bacteria | 2916014648 | 2916019376 | 181 |
| 521 | iso_pu_bacteria | 2916021584 | 2916026008 | 181 |
| 522 | iso_pu_bacteria | 2916028427 | 2916032945 | 181 |
| 523 | iso_pu_bacteria | 2916035215 | 2916040142 | 181 |
| 524 | iso_pu_bacteria | 2916041962 | 2916048001 | 181 |
| 525 | iso_pu_bacteria | 2916048683 | 2916049964 | 181 |
| 526 | iso_pu_bacteria | 2916055098 | 2916060212 | 181 |
| 527 | iso_pu_bacteria | 2916061851 | 2916066687 | 181 |
| 528 | iso_pu_bacteria | 2916068649 | 2916069616 | 181 |
| 529 | iso_pu_bacteria | 2916076590 | 2916083076 | 181 |
| 530 | iso_pu_bacteria | 2917554339 | 2917554496 | 181 |
| 531 | iso_pu_bacteria | 2919100787 | 2919105205 | 181 |
| 532 | iso_pu_bacteria | 2919114240 | 2919117262 | 181 |
| 533 | iso_pu_bacteria | 2919119836 | 2919119865 | 181 |
| 534 | iso_pu_bacteria | 2919171160 | 2919175961 | 181 |
| 535 | iso_pu_bacteria | 2919408235 | 2919410888 | 181 |
| 536 | iso_pu_bacteria | 2920760137 | 2920760986 | 181 |
| 537 | iso_pu_bacteria | 2920822456 | 2920828736 | 181 |
| 538 | iso_pu_bacteria | 2921201388 | 2921203700 | 181 |
| 539 | iso_pu_bacteria | 2921208531 | 2921213349 | 181 |
| 540 | iso_pu_bacteria | 2921237296 | 2921240674 | 181 |
| 541 | iso_pu_bacteria | 2921244191 | 2921249341 | 181 |
| 542 | iso_pu_bacteria | 2921250672 | 2921252153 | 181 |
| 543 | iso_pu_bacteria | 2921257292 | 2921258045 | 181 |
| 544 | iso_pu_bacteria | 2921263974 | 2921268521 | 181 |
| 545 | iso_pu_bacteria | 2921282425 | 2921287475 | 181 |
| 546 | iso_pu_bacteria | 2921289301 | 2921295175 | 181 |
| 547 | iso_pu_bacteria | 2921296804 | 2921301569 | 181 |
| 548 | iso_pu_bacteria | 2922130491 | 2922132205 | 181 |
| 549 | iso_pu_bacteria | 2922151315 | 2922154018 | 181 |
| 550 | iso_pu_bacteria | 2922158528 | 2922161684 | 181 |
| 551 | iso_pu_bacteria | 2922172374 | 2922173371 | 181 |
| 552 | iso_pu_bacteria | 2922178524 | 2922183913 | 181 |
| 553 | iso_pu_bacteria | 2922185730 | 2922192104 | 181 |
| 554 | iso_pu_bacteria | 2923556063 | 2923561784 | 181 |
| 555 | iso_pu_bacteria | 2924144063 | 2924149617 | 181 |
| 556 | iso_pu_bacteria | 2924150972 | 2924152690 | 181 |
| 557 | iso_pu_bacteria | 2924158325 | 2924163623 | 181 |
| 558 | iso_pu_bacteria | 2924165586 | 2924167672 | 181 |
| 559 | iso_pu_bacteria | 2924172951 | 2924178293 | 181 |
| 560 | iso_pu_bacteria | 2924179722 | 2924185175 | 181 |
| 561 | iso_pu_bacteria | 2924186466 | 2924191730 | 181 |
| 562 | iso_pu_bacteria | 2924193448 | 2924198747 | 181 |
| 563 | iso_pu_bacteria | 2924200457 | 2924205327 | 181 |
| 564 | iso_pu_bacteria | 2924207177 | 2924212233 | 181 |
| 565 | iso_pu_bacteria | 2924214083 | 2924216488 | 181 |
| 566 | iso_pu_bacteria | 2924221636 | 2924227265 | 181 |
| 567 | iso_pu_bacteria | 2924228884 | 2924233968 | 181 |
| 568 | iso_pu_bacteria | 2924710171 | 2924716462 | 181 |
| 569 | iso_pu_bacteria | 2924726620 | 2924729312 | 181 |
| 570 | iso_pu_bacteria | 2924733363 | 2924734008 | 181 |
| 571 | iso_pu_bacteria | 2924741084 | 2924748271 | 181 |
| 572 | iso_pu_bacteria | 2924748358 | 2924748463 | 181 |
| 573 | iso_pu_bacteria | 2924754689 | 2924756344 | 181 |
| 574 | iso_pu_bacteria | 2924762789 | 2924769239 | 181 |
| 575 | iso_pu_bacteria | 2924776078 | 2924776849 | 181 |
| 576 | iso_pu_bacteria | 2926754445 | 2926758709 | 181 |
| 577 | iso_pu_bacteria | 2926760298 | 2926763761 | 181 |
| 578 | iso_pu_bacteria | 2928521798 | 2928526645 | 181 |
| 579 | iso_pu_bacteria | 2929138655 | 2929141669 | 181 |
| 580 | iso_pu_bacteria | 2932401849 | 2932406050 | 181 |
| 581 | iso_pu_bacteria | 2933006813 | 2933009642 | 181 |
| 582 | iso_pu_bacteria | 2933011516 | 2933013815 | 181 |
| 583 | iso_pu_bacteria | 2933570622 | 2933572583 | 181 |
| 584 | iso_pu_bacteria | 2933586486 | 2933592430 | 181 |
| 585 | iso_pu_bacteria | 2933594066 | 2933595619 | 181 |
| 586 | iso_pu_bacteria | 2933599457 | 2933604282 | 181 |
| 587 | iso_pu_bacteria | 2935894831 | 2935897739 | 181 |
| 588 | iso_pu_bacteria | 2935901341 | 2935903871 | 181 |
| 589 | iso_pu_bacteria | 2936367885 | 2936370180 | 181 |
| 590 | iso_pu_bacteria | 2936375103 | 2936379331 | 181 |
| 591 | iso_pu_bacteria | 2936381700 | 2936385918 | 181 |
| 592 | iso_pu_bacteria | 2936996657 | 2936999825 | 181 |
| 593 | iso_pu_bacteria | 2937002841 | 2937007849 | 181 |
| 594 | iso_pu_bacteria | 2937009748 | 2937013858 | 181 |
| 595 | iso_pu_bacteria | 2937016420 | 2937021515 | 181 |
| 596 | iso_pu_bacteria | 2937023124 | 2937027672 | 181 |
| 597 | iso_pu_bacteria | 2937029754 | 2937032443 | 181 |
| 598 | iso_pu_bacteria | 2937036028 | 2937039818 | 181 |
| 599 | iso_pu_bacteria | 2937042894 | 2937047885 | 181 |
| 600 | iso_pu_bacteria | 2937049772 | 2937054760 | 181 |
| 601 | iso_pu_bacteria | 2937056579 | 2937058767 | 181 |
| 602 | iso_pu_bacteria | 2937063883 | 2937070159 | 181 |
| 603 | iso_pu_bacteria | 2937071275 | 2937076857 | 181 |
| 604 | iso_pu_bacteria | 2937078374 | 2937078402 | 181 |
| 605 | iso_pu_bacteria | 2937084907 | 2937088189 | 181 |
| 606 | iso_pu_bacteria | 2937091812 | 2937093976 | 181 |
| 607 | iso_pu_bacteria | 2937098957 | 2937104889 | 181 |
| 608 | iso_pu_bacteria | 2937106411 | 2937112712 | 181 |
| 609 | iso_pu_bacteria | 2937113482 | 2937117965 | 181 |
| 610 | iso_pu_bacteria | 2937119839 | 2937124694 | 181 |
| 611 | iso_pu_bacteria | 2937126314 | 2937131280 | 181 |
| 612 | iso_pu_bacteria | 2937813078 | 2937817201 | 181 |
| 613 | iso_pu_bacteria | 2937822353 | 2937826864 | 181 |
| 614 | iso_pu_bacteria | 2937836603 | 2937840683 | 181 |
| 615 | iso_pu_bacteria | 2937848649 | 2937855391 | 181 |
| 616 | iso_pu_bacteria | 2937861824 | 2937862314 | 181 |
| 617 | iso_pu_bacteria | 2937877337 | 2937883550 | 181 |
| 618 | iso_pu_bacteria | 2937891427 | 2937897843 | 181 |
| 619 | iso_pu_bacteria | 2937972304 | 2937973471 | 181 |
| 620 | iso_pu_bacteria | 2937980651 | 2937987440 | 181 |
| 621 | iso_pu_bacteria | 2937994558 | 2937996722 | 181 |
| 622 | iso_pu_bacteria | 2938014810 | 2938014938 | 181 |
| 623 | iso_pu_bacteria | 2941499720 | 2941501934 | 181 |
| 624 | iso_pu_bacteria | 2954011201 | 2954013365 | 181 |
| 625 | iso_pu_bacteria | 2957375807 | 2957378338 | 181 |
| 626 | iso_pu_bacteria | 2957382221 | 2957387327 | 181 |
| 627 | iso_pu_bacteria | 2957388812 | 2957393674 | 181 |
| 628 | iso_pu_bacteria | 2957395598 | 2957400209 | 181 |
| 629 | iso_pu_bacteria | 2957402308 | 2957407276 | 181 |
| 630 | iso_pu_bacteria | 2957408893 | 2957413039 | 181 |
| 631 | iso_pu_bacteria | 2957415311 | 2957420888 | 181 |
| 632 | iso_pu_bacteria | 2957422303 | 2957425050 | 181 |
| 633 | iso_pu_bacteria | 2957430029 | 2957435775 | 181 |
| 634 | iso_pu_bacteria | 2957437181 | 2957440274 | 181 |
| 635 | iso_pu_bacteria | 2957443900 | 2957449139 | 181 |
| 636 | iso_pu_bacteria | 2957450854 | 2957455195 | 181 |
| 637 | iso_pu_bacteria | 2957457609 | 2957463290 | 181 |
| 638 | iso_pu_bacteria | 2957464669 | 2957469791 | 181 |
| 639 | iso_pu_bacteria | 2957471148 | 2957476533 | 181 |
| 640 | iso_pu_bacteria | 2957478035 | 2957483015 | 181 |
| 641 | iso_pu_bacteria | 2957484790 | 2957486245 | 181 |
| 642 | iso_pu_bacteria | 2957491536 | 2957496332 | 181 |
| 643 | iso_pu_bacteria | 2957498199 | 2957504040 | 181 |
| 644 | iso_pu_bacteria | 2957505466 | 2957507751 | 181 |
| 645 | iso_pu_bacteria | 2958034702 | 2958041768 | 181 |
| 646 | iso_pu_bacteria | 2958041894 | 2958050299 | 181 |
| 647 | iso_pu_bacteria | 2958064165 | 2958065874 | 181 |
| 648 | iso_pu_bacteria | 2958071322 | 2958073683 | 181 |
| 649 | iso_pu_bacteria | 2958084443 | 2958090718 | 181 |
| 650 | iso_pu_bacteria | 2958092219 | 2958098634 | 181 |
| 651 | iso_pu_bacteria | 2958100919 | 2958106412 | 181 |
| 652 | iso_pu_bacteria | 2958108152 | 2958110685 | 181 |
| 653 | iso_pu_bacteria | 2958115193 | 2958120830 | 181 |
| 654 | iso_pu_bacteria | 2958122699 | 2958124260 | 181 |
| 655 | iso_pu_bacteria | 2958130278 | 2958132228 | 181 |
| 656 | iso_pu_bacteria | 2958137437 | 2958138737 | 181 |
| 657 | iso_pu_bacteria | 2958144490 | 2958144990 | 181 |
| 658 | iso_pu_bacteria | 2958158011 | 2958160939 | 181 |
| 659 | iso_pu_bacteria | 2958165035 | 2958167194 | 181 |
| 660 | iso_pu_bacteria | 2958172287 | 2958176549 | 181 |
| 661 | iso_pu_bacteria | 2958179912 | 2958182042 | 181 |
| 662 | iso_pu_bacteria | 2960584000 | 2960585592 | 181 |
| 663 | iso_pu_bacteria | 2960591022 | 2960591050 | 181 |
| 664 | iso_pu_bacteria | 2960597568 | 2960602898 | 181 |
| 665 | iso_pu_bacteria | 2960603979 | 2960609801 | 181 |
| 666 | iso_pu_bacteria | 2960610863 | 2960612970 | 181 |
| 667 | iso_pu_bacteria | 2960617483 | 2960622119 | 181 |
| 668 | iso_pu_bacteria | 2960624210 | 2960629685 | 181 |
| 669 | iso_pu_bacteria | 2960631154 | 2960634912 | 181 |
| 670 | iso_pu_bacteria | 2960637947 | 2960638398 | 181 |
| 671 | iso_pu_bacteria | 2960645483 | 2960650994 | 181 |
| 672 | iso_pu_bacteria | 2960652885 | 2960658196 | 181 |
| 673 | iso_pu_bacteria | 2960660292 | 2960666198 | 181 |
| 674 | iso_pu_bacteria | 2960667422 | 2960672596 | 181 |
| 675 | iso_pu_bacteria | 2960674078 | 2960677913 | 181 |
| 676 | iso_pu_bacteria | 2960680706 | 2960685393 | 181 |
| 677 | iso_pu_bacteria | 2960687367 | 2960692292 | 181 |
| 678 | iso_pu_bacteria | 2960693952 | 2960694421 | 181 |
| 679 | iso_pu_bacteria | 2961077736 | 2961079886 | 181 |
| 680 | iso_pu_bacteria | 2961114664 | 2961117943 | 181 |
| 681 | iso_pu_bacteria | 2961136820 | 2961144440 | 181 |
| 682 | iso_pu_bacteria | 2961163497 | 2961165663 | 181 |
| 683 | iso_pu_bacteria | 2961183825 | 2961189554 | 181 |
| 684 | iso_pu_bacteria | 2963644680 | 2963646258 | 181 |
| 685 | iso_pu_bacteria | 2964607997 | 2964610640 | 181 |
| 686 | iso_pu_bacteria | 2964615318 | 2964620159 | 181 |
| 687 | iso_pu_bacteria | 2964621998 | 2964627076 | 181 |
| 688 | iso_pu_bacteria | 2964628898 | 2964634507 | 181 |
| 689 | iso_pu_bacteria | 2964636051 | 2964641096 | 181 |
| 690 | iso_pu_bacteria | 2964643177 | 2964648086 | 181 |
| 691 | iso_pu_bacteria | 2964649959 | 2964654951 | 181 |
| 692 | iso_pu_bacteria | 2964656573 | 2964662444 | 181 |
| 693 | iso_pu_bacteria | 2964663802 | 2964669134 | 181 |
| 694 | iso_pu_bacteria | 2964670856 | 2964674045 | 181 |
| 695 | iso_pu_bacteria | 2964678106 | 2964678734 | 181 |
| 696 | iso_pu_bacteria | 2964685014 | 2964690022 | 181 |
| 697 | iso_pu_bacteria | 2964691889 | 2964697176 | 181 |
| 698 | iso_pu_bacteria | 2964698721 | 2964703192 | 181 |
| 699 | iso_pu_bacteria | 2964705432 | 2964711323 | 181 |
| 700 | iso_pu_bacteria | 2964712639 | 2964717503 | 181 |
| 701 | iso_pu_bacteria | 2964719344 | 2964719677 | 181 |
| 702 | iso_pu_bacteria | 2965018300 | 2965020486 | 181 |
| 703 | iso_pu_bacteria | 2965025482 | 2965025722 | 181 |
| 704 | iso_pu_bacteria | 2965032056 | 2965039871 | 181 |
| 705 | iso_pu_bacteria | 2965040258 | 2965042137 | 181 |
| 706 | iso_pu_bacteria | 2965047637 | 2965049572 | 181 |
| 707 | iso_pu_bacteria | 2965062239 | 2965064839 | 181 |
| 708 | iso_pu_bacteria | 2965089291 | 2965089707 | 181 |
| 709 | iso_pu_bacteria | 2965102966 | 2965109125 | 181 |
| 710 | iso_pu_bacteria | 2965110997 | 2965115108 | 181 |
| 711 | iso_pu_bacteria | 2965119406 | 2965124273 | 181 |
| 712 | iso_pu_bacteria | 2967664464 | 2967669875 | 181 |
| 713 | iso_pu_bacteria | 2967671571 | 2967677271 | 181 |
| 714 | iso_pu_bacteria | 2967678726 | 2967684348 | 181 |
| 715 | iso_pu_bacteria | 2967686174 | 2967687699 | 181 |
| 716 | iso_pu_bacteria | 2967693043 | 2967698255 | 181 |
| 717 | iso_pu_bacteria | 2967699805 | 2967706762 | 181 |
| 718 | iso_pu_bacteria | 2967706974 | 2967712557 | 181 |
| 719 | iso_pu_bacteria | 2967714385 | 2967719591 | 181 |
| 720 | iso_pu_bacteria | 2967721400 | 2967726539 | 181 |
| 721 | iso_pu_bacteria | 2967728569 | 2967729517 | 181 |
| 722 | iso_pu_bacteria | 2967735183 | 2967740126 | 181 |
| 723 | iso_pu_bacteria | 2967742019 | 2967743872 | 181 |
| 724 | iso_pu_bacteria | 2967748971 | 2967754245 | 181 |
| 725 | iso_pu_bacteria | 2967755722 | 2967760756 | 181 |
| 726 | iso_pu_bacteria | 2967762386 | 2967767570 | 181 |
| 727 | iso_pu_bacteria | 2967769361 | 2967774264 | 181 |
| 728 | iso_pu_bacteria | 2967775926 | 2967781874 | 181 |
| 729 | iso_pu_bacteria | 2968016561 | 2968016734 | 181 |
| 730 | iso_pu_bacteria | 2968083720 | 2968085275 | 181 |
| 731 | iso_pu_bacteria | 2968091066 | 2968091393 | 181 |
| 732 | iso_pu_bacteria | 2968097103 | 2968099072 | 181 |
| 733 | iso_pu_bacteria | 2968110612 | 2968114004 | 181 |
| 734 | iso_pu_bacteria | 2968117919 | 2968123194 | 181 |
| 735 | iso_pu_bacteria | 2968128360 | 2968129015 | 181 |
| 736 | iso_pu_bacteria | 2968138860 | 2968143671 | 181 |
| 737 | iso_pu_bacteria | 2968171901 | 2968174065 | 181 |
| 738 | iso_pu_bacteria | 2970019648 | 2970025388 | 181 |
| 739 | iso_pu_bacteria | 2970026789 | 2970033463 | 181 |
| 740 | iso_pu_bacteria | 2970033650 | 2970039484 | 181 |
| 741 | iso_pu_bacteria | 2970040964 | 2970046281 | 181 |
| 742 | iso_pu_bacteria | 2970047711 | 2970054800 | 181 |
| 743 | iso_pu_bacteria | 2970054988 | 2970059982 | 181 |
| 744 | iso_pu_bacteria | 2970061556 | 2970067522 | 181 |
| 745 | iso_pu_bacteria | 2970068827 | 2970074583 | 181 |
| 746 | iso_pu_bacteria | 2970076120 | 2970081028 | 181 |
| 747 | iso_pu_bacteria | 2970082768 | 2970083223 | 181 |
| 748 | iso_pu_bacteria | 2970088815 | 2970094376 | 181 |
| 749 | iso_pu_bacteria | 2970095765 | 2970097252 | 181 |
| 750 | iso_pu_bacteria | 2970102677 | 2970107051 | 181 |
| 751 | iso_pu_bacteria | 2970109326 | 2970115115 | 181 |
| 752 | iso_pu_bacteria | 2970116247 | 2970121114 | 181 |
| 753 | iso_pu_bacteria | 2970122695 | 2970128787 | 181 |
| 754 | iso_pu_bacteria | 2970129317 | 2970134449 | 181 |
| 755 | iso_pu_bacteria | 2970136068 | 2970137194 | 181 |
| 756 | iso_pu_bacteria | 2970143518 | 2970146405 | 181 |
| 757 | iso_pu_bacteria | 2970149975 | 2970155435 | 181 |
| 758 | iso_pu_bacteria | 2970156795 | 2970163585 | 181 |
| 759 | iso_pu_bacteria | 2970164137 | 2970169389 | 181 |
| 760 | iso_pu_bacteria | 2970170962 | 2970171591 | 181 |
| 761 | iso_pu_bacteria | 2970177841 | 2970183237 | 181 |
| 762 | iso_pu_bacteria | 2970184632 | 2970191780 | 181 |
| 763 | iso_pu_bacteria | 2970191845 | 2970197348 | 181 |
| 764 | iso_pu_bacteria | 2970469710 | 2970470076 | 181 |
| 765 | iso_pu_bacteria | 2970489779 | 2970490504 | 181 |
| 766 | iso_pu_bacteria | 2970510686 | 2970515131 | 181 |
| 767 | iso_pu_bacteria | 2970524798 | 2970527026 | 181 |
| 768 | iso_pu_bacteria | 2970532167 | 2970535580 | 181 |
| 769 | iso_pu_bacteria | 2970540015 | 2970545712 | 181 |
| 770 | iso_pu_bacteria | 2970547951 | 2970554739 | 181 |
| 771 | iso_pu_bacteria | 2970554993 | 2970557151 | 181 |
| 772 | iso_pu_bacteria | 2970593180 | 2970600369 | 181 |
| 773 | iso_pu_bacteria | 2970619444 | 2970623056 | 181 |
| 774 | iso_pu_bacteria | 2970627176 | 2970630709 | 181 |
| 775 | iso_pu_bacteria | 2977516862 | 2977521532 | 181 |
| 776 | iso_pu_bacteria | 2977523885 | 2977529255 | 181 |
| 777 | iso_pu_bacteria | 2977530762 | 2977534127 | 181 |
| 778 | iso_pu_bacteria | 2977537788 | 2977542959 | 181 |
| 779 | iso_pu_bacteria | 2977544691 | 2977547398 | 181 |
| 780 | iso_pu_bacteria | 2977551784 | 2977557174 | 181 |
| 781 | iso_pu_bacteria | 2977558990 | 2977565379 | 181 |
| 782 | iso_pu_bacteria | 2977565890 | 2977571381 | 181 |
| 783 | iso_pu_bacteria | 2977572785 | 2977578132 | 181 |
| 784 | iso_pu_bacteria | 2977579622 | 2977584876 | 181 |
| 785 | iso_pu_bacteria | 2977843712 | 2977847490 | 181 |
| 786 | iso_pu_bacteria | 2977851361 | 2977852071 | 181 |
| 787 | iso_pu_bacteria | 2977858184 | 2977864842 | 181 |
| 788 | iso_pu_bacteria | 2977872689 | 2977878845 | 181 |
| 789 | iso_pu_bacteria | 2977898635 | 2977899153 | 181 |
| 790 | iso_pu_bacteria | 2977907340 | 2977909546 | 181 |
| 791 | iso_pu_bacteria | 2977915119 | 2977922593 | 181 |
| 792 | iso_pu_bacteria | 2977922695 | 2977928903 | 181 |
| 793 | iso_pu_bacteria | 2977935797 | 2977940569 | 181 |
| 794 | iso_pu_bacteria | 2977942078 | 2977943122 | 181 |
| 795 | iso_pu_bacteria | 2977950692 | 2977956609 | 181 |
| 796 | iso_pu_bacteria | 2977957713 | 2977959865 | 181 |
| 797 | iso_pu_bacteria | 2977971508 | 2977979571 | 181 |
| 798 | iso_pu_bacteria | 2977986579 | 2977990186 | 181 |
| 799 | iso_pu_bacteria | 2979089926 | 2979091197 | 181 |
| 800 | iso_pu_bacteria | 2979095461 | 2979096722 | 181 |
| 801 | iso_pu_bacteria | 2979100975 | 2979102389 | 181 |
| 802 | iso_pu_bacteria | 2979710463 | 2979712314 | 181 |
| 803 | iso_pu_bacteria | 2979742915 | 2979744254 | 181 |
| 804 | iso_pu_bacteria | 2979764755 | 2979769138 | 181 |
| 805 | iso_pu_bacteria | 2979772303 | 2979777738 | 181 |
| 806 | iso_pu_bacteria | 2979779861 | 2979783997 | 181 |
| 807 | iso_pu_bacteria | 2979793036 | 2979799757 | 181 |
| 808 | iso_pu_bacteria | 2984509177 | 2984509674 | 181 |
| 809 | iso_pu_bacteria | 2984518228 | 2984519627 | 181 |
| 810 | iso_pu_bacteria | 2984537506 | 2984538012 | 181 |
| 811 | iso_pu_bacteria | 2984601300 | 2984604751 | 181 |
| 812 | iso_pu_bacteria | 2987636660 | 2987643832 | 181 |
| 813 | iso_pu_bacteria | 2987645492 | 2987647003 | 181 |
| 814 | iso_pu_bacteria | 2987652177 | 2987659081 | 181 |
| 815 | iso_pu_bacteria | 2987659509 | 2987661671 | 181 |
| 816 | iso_pu_bacteria | 2987666974 | 2987672415 | 181 |
| 817 | iso_pu_bacteria | 2987673487 | 2987674768 | 181 |
| 818 | iso_pu_bacteria | 2989349275 | 2989352175 | 181 |
| 819 | iso_pu_bacteria | 2989771324 | 2989771361 | 181 |
| 820 | iso_pu_bacteria | 2989776772 | 2989779885 | 181 |
| 821 | iso_pu_bacteria | 2995392953 | 2995395358 | 181 |
| 822 | iso_pu_bacteria | 2996310559 | 2996313428 | 181 |
| 823 | iso_pu_bacteria | 2996336353 | 2996341272 | 181 |
| 824 | iso_pu_bacteria | 2996341866 | 2996347871 | 181 |
| 825 | iso_pu_bacteria | 2996348954 | 2996352995 | 181 |
| 826 | iso_pu_bacteria | 2996386984 | 2996391822 | 181 |
| 827 | iso_pu_bacteria | 2996887358 | 2996890764 | 181 |
| 828 | iso_pu_bacteria | 2996893221 | 2996895985 | 181 |
| 829 | iso_pu_bacteria | 3000135777 | 3000141286 | 181 |
| 830 | iso_pu_bacteria | 3003930520 | 3003930858 | 181 |
| 831 | iso_pu_bacteria | 3004167301 | 3004174409 | 181 |
| 832 | iso_pu_bacteria | 3004188549 | 3004190720 | 181 |
| 833 | iso_pu_bacteria | 3004195979 | 3004199970 | 181 |
| 834 | iso_pu_bacteria | 3004203850 | 3004207981 | 181 |
| 835 | iso_pu_bacteria | 3004211236 | 3004211549 | 181 |
| 836 | iso_pu_bacteria | 3004218560 | 3004224902 | 181 |
| 837 | iso_pu_bacteria | 3004232784 | 3004233474 | 181 |
| 838 | iso_pu_bacteria | 3004239961 | 3004247381 | 181 |
| 839 | iso_pu_bacteria | 3004248173 | 3004251778 | 181 |
| 840 | iso_pu_bacteria | 3004268573 | 3004270005 | 181 |
| 841 | iso_pu_bacteria | 3004275668 | 3004279677 | 181 |
| 842 | iso_pu_bacteria | 3004289098 | 3004293684 | 181 |
| 843 | iso_pu_bacteria | 3004334049 | 3004336160 | 181 |
| 844 | iso_pu_bacteria | 3005409236 | 3005409459 | 181 |
| 845 | iso_pu_bacteria | 3005416602 | 3005421810 | 181 |
| 846 | iso_pu_bacteria | 3005445848 | 3005449480 | 181 |
| 847 | iso_pu_bacteria | 3005452660 | 3005455808 | 181 |
| 848 | iso_pu_bacteria | 637000159 | 637076032 | 181 |
| 849 | iso_pu_bacteria | 639633055 | 639650196 | 181 |
| 850 | iso_pu_bacteria | 643692032 | 643826876 | 181 |
| 851 | iso_pu_bacteria | 648276728 | 648741072 | 181 |
| 852 | iso_pu_bacteria | 649633066 | 649871453 | 181 |
| 853 | iso_pu_bacteria | 650716007 | 650843227 | 181 |
| 854 | iso_pu_bacteria | 8002285264 | 8002290158 | 181 |
| 855 | iso_pu_bacteria | 8003570095 | 8003572806 | 181 |
| 856 | iso_pu_bacteria | 8003992118 | 8003994721 | 181 |
| 857 | iso_pu_bacteria | 8003999396 | 8004002391 | 181 |
| 858 | iso_pu_bacteria | 8004300914 | 8004302880 | 181 |
| 859 | iso_pu_bacteria | 8004312739 | 8004315481 | 181 |
| 860 | iso_pu_bacteria | 8004361976 | 8004366181 | 181 |
| 861 | iso_pu_bacteria | 8004387939 | 8004389612 | 181 |
| 862 | iso_pu_bacteria | 8004395343 | 8004398626 | 181 |
| 863 | iso_pu_bacteria | 8004445564 | 8004449990 | 181 |
| 864 | iso_pu_bacteria | 8004633249 | 8004636773 | 181 |
| 865 | iso_pu_bacteria | 8004640170 | 8004645464 | 181 |
| 866 | iso_pu_bacteria | 8004695233 | 8004697597 | 181 |
| 867 | iso_pu_bacteria | 8004703790 | 8004705623 | 181 |
| 868 | iso_pu_bacteria | 8004714634 | 8004718009 | 181 |
| 869 | iso_pu_bacteria | 8004727605 | 8004730718 | 181 |
| 870 | iso_pu_bacteria | 8005246636 | 8005249046 | 181 |
| 871 | iso_pu_bacteria | 8005258706 | 8005262831 | 181 |
| 872 | iso_pu_bacteria | 8005275841 | 8005282221 | 181 |
| 873 | iso_pu_bacteria | 8005282627 | 8005286347 | 181 |
| 874 | iso_pu_bacteria | 8005289223 | 8005292182 | 181 |
| 875 | iso_pu_bacteria | 8005301065 | 8005302440 | 181 |
| 876 | iso_pu_bacteria | 8005307578 | 8005313463 | 181 |
| 877 | iso_pu_bacteria | 8005314921 | 8005319490 | 181 |
| 878 | iso_pu_bacteria | 8005321885 | 8005325291 | 181 |
| 879 | iso_pu_bacteria | 8005376324 | 8005381781 | 181 |
| 880 | iso_pu_bacteria | 8005382845 | 8005387964 | 181 |
| 881 | iso_pu_bacteria | 8005395548 | 8005401002 | 181 |
| 882 | iso_pu_bacteria | 8005430974 | 8005435277 | 181 |
| 883 | iso_pu_bacteria | 8005460587 | 8005464814 | 181 |
| 884 | iso_pu_bacteria | 8005484373 | 8005490121 | 181 |
| 885 | iso_pu_bacteria | 8005497431 | 8005497467 | 181 |
| 886 | iso_pu_bacteria | 8005542996 | 8005546469 | 181 |
| 887 | iso_pu_bacteria | 8005556819 | 8005560881 | 181 |
| 888 | iso_pu_bacteria | 8005563573 | 8005565081 | 181 |
| 889 | iso_pu_bacteria | 8005570704 | 8005576743 | 181 |
| 890 | iso_pu_bacteria | 8005619151 | 8005623210 | 181 |
| 891 | iso_pu_bacteria | 8005626139 | 8005627672 | 181 |
| 892 | iso_pu_bacteria | 8005645114 | 8005646778 | 181 |
| 893 | iso_pu_bacteria | 8005658619 | 8005660636 | 181 |
| 894 | iso_pu_bacteria | 8005668836 | 8005668872 | 181 |
| 895 | iso_pu_bacteria | 8005682033 | 8005687639 | 181 |
| 896 | iso_pu_bacteria | 8005688590 | 8005691338 | 181 |
| 897 | iso_pu_bacteria | 8005695170 | 8005695520 | 181 |
| 898 | iso_pu_bacteria | 8018127388 | 8018130726 | 181 |
| 899 | iso_pu_bacteria | 8018150411 | 8018154558 | 181 |
| 900 | iso_pu_bacteria | 8018163183 | 8018169556 | 181 |
| 901 | iso_pu_bacteria | 8018176218 | 8018178295 | 181 |
| 902 | iso_pu_bacteria | 8023680758 | 8023686301 | 181 |
| 903 | iso_pu_bacteria | 8024479707 | 8024482478 | 181 |
| 904 | iso_pu_bacteria | 8024486573 | 8024490661 | 181 |
| 905 | iso_pu_bacteria | 8024501048 | 8024504766 | 181 |
| 906 | iso_pu_bacteria | 8045864390 | 8045869091 | 181 |
| 907 | iso_pu_bacteria | 8046767195 | 8046772769 | 181 |
| 908 | iso_pu_bacteria | 8049293176 | 8049295729 | 181 |
| 909 | iso_pu_bacteria | 8054558443 | 8054561374 | 181 |
| 910 | iso_pu_bacteria | 8055431914 | 8055435745 | 181 |
| 911 | iso_pu_bacteria | 8056375014 | 8056379587 | 181 |
| 912 | iso_pu_bacteria | 8056382006 | 8056384003 | 181 |
| 913 | iso_pu_bacteria | 8056875544 | 8056878084 | 181 |
| 914 | iso_pu_bacteria | 8057575449 | 8057581764 | 181 |
| 915 | iso_pu_bacteria | 8057874678 | 8057879957 | 181 |
| 916 | 3300010375 | Ga0105239_10247749 | Ga0105239_102477493 | 182 |
| 917 | iso_pu_bacteria | 2643221574 | 2643883910 | 182 |
| 918 | iso_pu_bacteria | 2643221699 | 2644551171 | 182 |
| 919 | iso_pu_bacteria | 2643221699 | 2644552434 | 182 |
| 920 | iso_pu_bacteria | 2891088606 | 2891089698 | 182 |
| 921 | iso_pu_bacteria | 2928972540 | 2928974236 | 182 |
| 922 | iso_pu_bacteria | 2941485952 | 2941486342 | 182 |
| 923 | iso_pu_bacteria | 2977240413 | 2977243168 | 182 |
| 924 | iso_pu_bacteria | 8002060224 | 8002063788 | 182 |
| 925 | 3300005353 | Ga0070669_100409453 | Ga0070669_1004094531 | 183 |
| 926 | 3300005434 | Ga0070709_10017337 | Ga0070709_100173374 | 183 |
| 927 | 3300005434 | Ga0070709_10084634 | Ga0070709_100846342 | 183 |
| 928 | 3300005435 | Ga0070714_100033220 | Ga0070714_1000332204 | 183 |
| 929 | 3300005435 | Ga0070714_100386106 | Ga0070714_1003861062 | 183 |
| 930 | 3300005436 | Ga0070713_100460638 | Ga0070713_1004606382 | 183 |
| 931 | 3300005436 | Ga0070713_100599204 | Ga0070713_1005992042 | 183 |
| 932 | 3300005436 | Ga0070713_100905204 | Ga0070713_1009052041 | 183 |
| 933 | 3300005437 | Ga0070710_10413748 | Ga0070710_104137481 | 183 |
| 934 | 3300005445 | Ga0070708_101662325 | Ga0070708_1016623251 | 183 |
| 935 | 3300005471 | Ga0070698_100007183 | Ga0070698_10000718313 | 183 |
| 936 | 3300005471 | Ga0070698_100118552 | Ga0070698_1001185524 | 183 |
| 937 | 3300005471 | Ga0070698_100571281 | Ga0070698_1005712812 | 183 |
| 938 | 3300005614 | Ga0068856_100246144 | Ga0068856_1002461442 | 183 |
| 939 | 3300005844 | Ga0068862_100262437 | Ga0068862_1002624371 | 183 |
| 940 | 3300005937 | Ga0081455_10000455 | Ga0081455_1000045535 | 183 |
| 941 | 3300005983 | Ga0081540_1035798 | Ga0081540_10357982 | 183 |
| 942 | 3300006028 | Ga0070717_10002293 | Ga0070717_100022933 | 183 |
| 943 | 3300006048 | Ga0075363_100391793 | Ga0075363_1003917932 | 183 |
| 944 | 3300006173 | Ga0070716_100390035 | Ga0070716_1003900351 | 183 |
| 945 | 3300006175 | Ga0070712_100010231 | Ga0070712_1000102312 | 183 |
| 946 | 3300006175 | Ga0070712_100097656 | Ga0070712_1000976562 | 183 |
| 947 | 3300006177 | Ga0075362_10102680 | Ga0075362_101026802 | 183 |
| 948 | 3300006871 | Ga0075434_100695696 | Ga0075434_1006956962 | 183 |
| 949 | 3300007788 | Ga0099795_10026661 | Ga0099795_100266612 | 183 |
| 950 | 3300009093 | Ga0105240_10185538 | Ga0105240_101855383 | 183 |
| 951 | 3300009148 | Ga0105243_11666717 | Ga0105243_116667171 | 183 |
| 952 | 3300010159 | Ga0099796_10026125 | Ga0099796_100261252 | 183 |
| 953 | 3300014497 | Ga0182008_10031185 | Ga0182008_100311854 | 183 |
| 954 | 3300021358 | Ga0213873_10119079 | Ga0213873_101190791 | 183 |
| 955 | 3300021377 | Ga0213874_10240690 | Ga0213874_102406901 | 183 |
| 956 | 3300021384 | Ga0213876_10001741 | Ga0213876_100017414 | 183 |
| 957 | 3300025898 | Ga0207692_10631129 | Ga0207692_106311291 | 183 |
| 958 | 3300025906 | Ga0207699_10046469 | Ga0207699_100464692 | 183 |
| 959 | 3300025906 | Ga0207699_10423327 | Ga0207699_104233272 | 183 |
| 960 | 3300025910 | Ga0207684_10055486 | Ga0207684_100554863 | 183 |
| 961 | 3300025910 | Ga0207684_10534251 | Ga0207684_105342511 | 183 |
| 962 | 3300025913 | Ga0207695_10414699 | Ga0207695_104146992 | 183 |
| 963 | 3300025916 | Ga0207663_10194392 | Ga0207663_101943922 | 183 |
| 964 | 3300025916 | Ga0207663_10349901 | Ga0207663_103499012 | 183 |
| 965 | 3300025927 | Ga0207687_10051378 | Ga0207687_100513786 | 183 |
| 966 | 3300025928 | Ga0207700_10485354 | Ga0207700_104853542 | 183 |
| 967 | 3300025928 | Ga0207700_10896745 | Ga0207700_108967451 | 183 |
| 968 | 3300025929 | Ga0207664_10169360 | Ga0207664_101693602 | 183 |
| 969 | 3300025929 | Ga0207664_10377512 | Ga0207664_103775122 | 183 |
| 970 | 3300025929 | Ga0207664_10707083 | Ga0207664_107070831 | 183 |
| 971 | 3300025939 | Ga0207665_10275933 | Ga0207665_102759332 | 183 |
| 972 | 3300028380 | Ga0268265_10129874 | Ga0268265_101298741 | 183 |
| 973 | 3300028577 | Ga0265318_10000737 | Ga0265318_1000073716 | 183 |
| 974 | 3300028577 | Ga0265318_10066028 | Ga0265318_100660282 | 183 |
| 975 | 3300028800 | Ga0265338_10165595 | Ga0265338_101655951 | 183 |
| 976 | 3300031238 | Ga0265332_10096593 | Ga0265332_100965932 | 183 |
| 977 | 3300031241 | Ga0265325_10020012 | Ga0265325_100200124 | 183 |
| 978 | 3300031250 | Ga0265331_10302478 | Ga0265331_103024781 | 183 |
| 979 | 3300031344 | Ga0265316_10119542 | Ga0265316_101195422 | 183 |
| 980 | 3300031595 | Ga0265313_10000338 | Ga0265313_1000033841 | 183 |
| 981 | 3300031595 | Ga0265313_10000674 | Ga0265313_1000067412 | 183 |
| 982 | 3300031711 | Ga0265314_10004909 | Ga0265314_100049092 | 183 |
| 983 | 3300031711 | Ga0265314_10006102 | Ga0265314_100061027 | 183 |
| 984 | 3300031711 | Ga0265314_10041875 | Ga0265314_100418756 | 183 |
| 985 | 3300032126 | Ga0307415_101107621 | Ga0307415_1011076211 | 183 |
| 986 | 3300037853 | Ga0436364_0949431 | Ga0436364_0949431_509_1072 | 183 |
| 987 | 3300039438 | Ga0436360_0774037 | Ga0436360_0774037_388_951 | 183 |
| 988 | 3300039447 | Ga0436361_0782552 | Ga0436361_0782552_390_953 | 183 |
| 989 | 3300039450 | Ga0436363_1639159 | Ga0436363_1639159_1427_1990 | 183 |
| 990 | 3300044673 | Ga0453683_0004944 | Ga0453683_0004944_7386_7952 | 183 |
| 991 | 3300044694 | Ga0466963_0320928 | Ga0466963_0320928_80_643 | 183 |
| 992 | 3300045051 | Ga0451576_0001612 | Ga0451576_0001612_19173_19739 | 183 |
| 993 | 3300049742 | Ga0501080_0126220 | Ga0501080_0126220_458_1018 | 183 |
| 994 | 3300050489 | nmdc:mga03683_111492_c1 | nmdc:mga03683_111492_c1_513_1073 | 183 |
| 995 | 3300050489 | nmdc:mga03683_42799_c1 | nmdc:mga03683_42799_c1_683_1243 | 183 |
| 996 | iso_pu_bacteria | 2937843397 | 2937845344 | 183 |
| 997 | 3300005327 | Ga0070658_10028401 | Ga0070658_100284013 | 184 |
| 998 | 3300005327 | Ga0070658_10073839 | Ga0070658_100738394 | 184 |
| 999 | 3300005335 | Ga0070666_10302678 | Ga0070666_103026782 | 184 |
| 1000 | 3300005338 | Ga0068868_100115786 | Ga0068868_1001157863 | 184 |
| 1001 | 3300005339 | Ga0070660_100016402 | Ga0070660_1000164021 | 184 |
| 1002 | 3300005339 | Ga0070660_100038074 | Ga0070660_1000380745 | 184 |
| 1003 | 3300005339 | Ga0070660_100166434 | Ga0070660_1001664342 | 184 |
| 1004 | 3300005344 | Ga0070661_100000296 | Ga0070661_10000029617 | 184 |
| 1005 | 3300005344 | Ga0070661_100012968 | Ga0070661_1000129682 | 184 |
| 1006 | 3300005344 | Ga0070661_100024245 | Ga0070661_1000242454 | 184 |
| 1007 | 3300005344 | Ga0070661_100107162 | Ga0070661_1001071622 | 184 |
| 1008 | 3300005347 | Ga0070668_100013003 | Ga0070668_1000130036 | 184 |
| 1009 | 3300005356 | Ga0070674_100018397 | Ga0070674_1000183972 | 184 |
| 1010 | 3300005364 | Ga0070673_100057713 | Ga0070673_1000577132 | 184 |
| 1011 | 3300005366 | Ga0070659_100035513 | Ga0070659_1000355135 | 184 |
| 1012 | 3300005367 | Ga0070667_100033713 | Ga0070667_1000337137 | 184 |
| 1013 | 3300005455 | Ga0070663_100112459 | Ga0070663_1001124593 | 184 |
| 1014 | 3300005455 | Ga0070663_100142237 | Ga0070663_1001422374 | 184 |
| 1015 | 3300005455 | Ga0070663_100219303 | Ga0070663_1002193033 | 184 |
| 1016 | 3300005456 | Ga0070678_100274208 | Ga0070678_1002742081 | 184 |
| 1017 | 3300005458 | Ga0070681_10174837 | Ga0070681_101748373 | 184 |
| 1018 | 3300005458 | Ga0070681_10293492 | Ga0070681_102934922 | 184 |
| 1019 | 3300005458 | Ga0070681_10466499 | Ga0070681_104664992 | 184 |
| 1020 | 3300005530 | Ga0070679_100280171 | Ga0070679_1002801713 | 184 |
| 1021 | 3300005539 | Ga0068853_100001252 | Ga0068853_1000012524 | 184 |
| 1022 | 3300005539 | Ga0068853_100005716 | Ga0068853_1000057167 | 184 |
| 1023 | 3300005539 | Ga0068853_100031089 | Ga0068853_1000310896 | 184 |
| 1024 | 3300005543 | Ga0070672_100076275 | Ga0070672_1000762753 | 184 |
| 1025 | 3300005547 | Ga0070693_100089909 | Ga0070693_1000899093 | 184 |
| 1026 | 3300005548 | Ga0070665_100032869 | Ga0070665_1000328691 | 184 |
| 1027 | 3300005563 | Ga0068855_100060065 | Ga0068855_1000600658 | 184 |
| 1028 | 3300005563 | Ga0068855_100108106 | Ga0068855_1001081064 | 184 |
| 1029 | 3300005563 | Ga0068855_100389576 | Ga0068855_1003895762 | 184 |
| 1030 | 3300005578 | Ga0068854_100005130 | Ga0068854_1000051306 | 184 |
| 1031 | 3300005578 | Ga0068854_100043930 | Ga0068854_1000439303 | 184 |
| 1032 | 3300005578 | Ga0068854_100440531 | Ga0068854_1004405311 | 184 |
| 1033 | 3300005614 | Ga0068856_100026673 | Ga0068856_1000266732 | 184 |
| 1034 | 3300005614 | Ga0068856_100162455 | Ga0068856_1001624554 | 184 |
| 1035 | 3300005614 | Ga0068856_100348899 | Ga0068856_1003488992 | 184 |
| 1036 | 3300005616 | Ga0068852_100047717 | Ga0068852_1000477172 | 184 |
| 1037 | 3300005616 | Ga0068852_100092597 | Ga0068852_1000925975 | 184 |
| 1038 | 3300005616 | Ga0068852_100259378 | Ga0068852_1002593784 | 184 |
| 1039 | 3300005618 | Ga0068864_100570136 | Ga0068864_1005701362 | 184 |
| 1040 | 3300005834 | Ga0068851_10016887 | Ga0068851_100168873 | 184 |
| 1041 | 3300005842 | Ga0068858_100227085 | Ga0068858_1002270852 | 184 |
| 1042 | 3300006038 | Ga0075365_10382480 | Ga0075365_103824802 | 184 |
| 1043 | 3300006042 | Ga0075368_10027055 | Ga0075368_100270552 | 184 |
| 1044 | 3300006048 | Ga0075363_100049065 | Ga0075363_1000490652 | 184 |
| 1045 | 3300006051 | Ga0075364_10047128 | Ga0075364_100471283 | 184 |
| 1046 | 3300006051 | Ga0075364_10447909 | Ga0075364_104479091 | 184 |
| 1047 | 3300006177 | Ga0075362_10020155 | Ga0075362_100201552 | 184 |
| 1048 | 3300006178 | Ga0075367_10087198 | Ga0075367_100871982 | 184 |
| 1049 | 3300006195 | Ga0075366_10053986 | Ga0075366_100539863 | 184 |
| 1050 | 3300006353 | Ga0075370_10038072 | Ga0075370_100380722 | 184 |
| 1051 | 3300006871 | Ga0075434_100087692 | Ga0075434_1000876924 | 184 |
| 1052 | 3300006881 | Ga0068865_100423903 | Ga0068865_1004239032 | 184 |
| 1053 | 3300009148 | Ga0105243_10450830 | Ga0105243_104508302 | 184 |
| 1054 | 3300009174 | Ga0105241_10116885 | Ga0105241_101168853 | 184 |
| 1055 | 3300009174 | Ga0105241_10302386 | Ga0105241_103023862 | 184 |
| 1056 | 3300009551 | Ga0105238_10056299 | Ga0105238_100562997 | 184 |
| 1057 | 3300009551 | Ga0105238_10100900 | Ga0105238_101009003 | 184 |
| 1058 | 3300009551 | Ga0105238_10134744 | Ga0105238_101347443 | 184 |
| 1059 | 3300010375 | Ga0105239_10190855 | Ga0105239_101908553 | 184 |
| 1060 | 3300013100 | Ga0157373_10315789 | Ga0157373_103157892 | 184 |
| 1061 | 3300013102 | Ga0157371_10362901 | Ga0157371_103629011 | 184 |
| 1062 | 3300013102 | Ga0157371_10467772 | Ga0157371_104677722 | 184 |
| 1063 | 3300013104 | Ga0157370_10073529 | Ga0157370_100735292 | 184 |
| 1064 | 3300013104 | Ga0157370_10241426 | Ga0157370_102414262 | 184 |
| 1065 | 3300013105 | Ga0157369_10068264 | Ga0157369_100682644 | 184 |
| 1066 | 3300013296 | Ga0157374_10038063 | Ga0157374_100380635 | 184 |
| 1067 | 3300013307 | Ga0157372_10176020 | Ga0157372_101760204 | 184 |
| 1068 | 3300013307 | Ga0157372_11201125 | Ga0157372_112011252 | 184 |
| 1069 | 3300025261 | Ga0209233_1001986 | Ga0209233_10019868 | 184 |
| 1070 | 3300025297 | Ga0209758_1002933 | Ga0209758_10029338 | 184 |
| 1071 | 3300025904 | Ga0207647_10032473 | Ga0207647_100324734 | 184 |
| 1072 | 3300025904 | Ga0207647_10201441 | Ga0207647_102014412 | 184 |
| 1073 | 3300025907 | Ga0207645_10027448 | Ga0207645_100274484 | 184 |
| 1074 | 3300025909 | Ga0207705_10001133 | Ga0207705_1000113315 | 184 |
| 1075 | 3300025909 | Ga0207705_10079479 | Ga0207705_100794794 | 184 |
| 1076 | 3300025909 | Ga0207705_10143375 | Ga0207705_101433752 | 184 |
| 1077 | 3300025909 | Ga0207705_10222022 | Ga0207705_102220223 | 184 |
| 1078 | 3300025911 | Ga0207654_10227493 | Ga0207654_102274932 | 184 |
| 1079 | 3300025912 | Ga0207707_10256007 | Ga0207707_102560072 | 184 |
| 1080 | 3300025912 | Ga0207707_10471559 | Ga0207707_104715591 | 184 |
| 1081 | 3300025912 | Ga0207707_10483369 | Ga0207707_104833692 | 184 |
| 1082 | 3300025913 | Ga0207695_10409873 | Ga0207695_104098732 | 184 |
| 1083 | 3300025914 | Ga0207671_10000177 | Ga0207671_1000017772 | 184 |
| 1084 | 3300025914 | Ga0207671_10133677 | Ga0207671_101336773 | 184 |
| 1085 | 3300025919 | Ga0207657_10006597 | Ga0207657_1000659715 | 184 |
| 1086 | 3300025919 | Ga0207657_10012909 | Ga0207657_1001290911 | 184 |
| 1087 | 3300025919 | Ga0207657_10125620 | Ga0207657_101256203 | 184 |
| 1088 | 3300025920 | Ga0207649_10001157 | Ga0207649_1000115721 | 184 |
| 1089 | 3300025920 | Ga0207649_10100278 | Ga0207649_101002782 | 184 |
| 1090 | 3300025920 | Ga0207649_10210782 | Ga0207649_102107822 | 184 |
| 1091 | 3300025921 | Ga0207652_10477491 | Ga0207652_104774911 | 184 |
| 1092 | 3300025924 | Ga0207694_10351430 | Ga0207694_103514301 | 184 |
| 1093 | 3300025924 | Ga0207694_10885412 | Ga0207694_108854121 | 184 |
| 1094 | 3300025926 | Ga0207659_10392284 | Ga0207659_103922842 | 184 |
| 1095 | 3300025927 | Ga0207687_10563238 | Ga0207687_105632382 | 184 |
| 1096 | 3300025927 | Ga0207687_10719552 | Ga0207687_107195521 | 184 |
| 1097 | 3300025932 | Ga0207690_10079684 | Ga0207690_100796843 | 184 |
| 1098 | 3300025932 | Ga0207690_10258408 | Ga0207690_102584082 | 184 |
| 1099 | 3300025933 | Ga0207706_10019600 | Ga0207706_100196009 | 184 |
| 1100 | 3300025935 | Ga0207709_10466523 | Ga0207709_104665232 | 184 |
| 1101 | 3300025937 | Ga0207669_10065440 | Ga0207669_100654403 | 184 |
| 1102 | 3300025938 | Ga0207704_10652192 | Ga0207704_106521922 | 184 |
| 1103 | 3300025940 | Ga0207691_10081034 | Ga0207691_100810342 | 184 |
| 1104 | 3300025944 | Ga0207661_10267073 | Ga0207661_102670732 | 184 |
| 1105 | 3300025949 | Ga0207667_10016808 | Ga0207667_1001680812 | 184 |
| 1106 | 3300025949 | Ga0207667_10071271 | Ga0207667_100712713 | 184 |
| 1107 | 3300025949 | Ga0207667_10134484 | Ga0207667_101344842 | 184 |
| 1108 | 3300025949 | Ga0207667_10380655 | Ga0207667_103806553 | 184 |
| 1109 | 3300025972 | Ga0207668_10007643 | Ga0207668_100076435 | 184 |
| 1110 | 3300025981 | Ga0207640_10082243 | Ga0207640_100822432 | 184 |
| 1111 | 3300025981 | Ga0207640_10562269 | Ga0207640_105622692 | 184 |
| 1112 | 3300025986 | Ga0207658_10349383 | Ga0207658_103493832 | 184 |
| 1113 | 3300026023 | Ga0207677_10329860 | Ga0207677_103298602 | 184 |
| 1114 | 3300026023 | Ga0207677_10643058 | Ga0207677_106430581 | 184 |
| 1115 | 3300026041 | Ga0207639_10000849 | Ga0207639_1000084920 | 184 |
| 1116 | 3300026041 | Ga0207639_10001693 | Ga0207639_1000169315 | 184 |
| 1117 | 3300026041 | Ga0207639_10215902 | Ga0207639_102159022 | 184 |
| 1118 | 3300026067 | Ga0207678_10126030 | Ga0207678_101260303 | 184 |
| 1119 | 3300026067 | Ga0207678_10214409 | Ga0207678_102144093 | 184 |
| 1120 | 3300026078 | Ga0207702_10012990 | Ga0207702_100129907 | 184 |
| 1121 | 3300026078 | Ga0207702_10100471 | Ga0207702_101004714 | 184 |
| 1122 | 3300026078 | Ga0207702_10220251 | Ga0207702_102202513 | 184 |
| 1123 | 3300026078 | Ga0207702_10704290 | Ga0207702_107042901 | 184 |
| 1124 | 3300026089 | Ga0207648_10128230 | Ga0207648_101282303 | 184 |
| 1125 | 3300026095 | Ga0207676_10575492 | Ga0207676_105754921 | 184 |
| 1126 | 3300026116 | Ga0207674_10097480 | Ga0207674_100974802 | 184 |
| 1127 | 3300026116 | Ga0207674_10586338 | Ga0207674_105863381 | 184 |
| 1128 | 3300026142 | Ga0207698_10094689 | Ga0207698_100946892 | 184 |
| 1129 | 3300026142 | Ga0207698_10168960 | Ga0207698_101689602 | 184 |
| 1130 | 3300026142 | Ga0207698_10391489 | Ga0207698_103914892 | 184 |
| 1131 | 3300027665 | Ga0209983_1012619 | Ga0209983_10126192 | 184 |
| 1132 | 3300028379 | Ga0268266_10002019 | Ga0268266_1000201914 | 184 |
| 1133 | 3300028379 | Ga0268266_10272937 | Ga0268266_102729371 | 184 |
| 1134 | 3300028577 | Ga0265318_10066634 | Ga0265318_100666342 | 184 |
| 1135 | 3300028800 | Ga0265338_10063693 | Ga0265338_100636931 | 184 |
| 1136 | 3300031235 | Ga0265330_10077890 | Ga0265330_100778902 | 184 |
| 1137 | 3300031238 | Ga0265332_10054513 | Ga0265332_100545132 | 184 |
| 1138 | 3300031238 | Ga0265332_10081345 | Ga0265332_100813452 | 184 |
| 1139 | 3300031240 | Ga0265320_10126179 | Ga0265320_101261792 | 184 |
| 1140 | 3300031242 | Ga0265329_10021873 | Ga0265329_100218732 | 184 |
| 1141 | 3300031249 | Ga0265339_10001557 | Ga0265339_1000155719 | 184 |
| 1142 | 3300031251 | Ga0265327_10039122 | Ga0265327_100391223 | 184 |
| 1143 | 3300031344 | Ga0265316_10035031 | Ga0265316_100350316 | 184 |
| 1144 | 3300031548 | Ga0307408_101038673 | Ga0307408_1010386731 | 184 |
| 1145 | 3300031595 | Ga0265313_10000070 | Ga0265313_1000007010 | 184 |
| 1146 | 3300031711 | Ga0265314_10163664 | Ga0265314_101636642 | 184 |
| 1147 | 3300031711 | Ga0265314_10182865 | Ga0265314_101828652 | 184 |
| 1148 | 3300031712 | Ga0265342_10027030 | Ga0265342_100270304 | 184 |
| 1149 | 3300031731 | Ga0307405_10352710 | Ga0307405_103527102 | 184 |
| 1150 | 3300031824 | Ga0307413_10255722 | Ga0307413_102557222 | 184 |
| 1151 | 3300031852 | Ga0307410_10181904 | Ga0307410_101819042 | 184 |
| 1152 | 3300031901 | Ga0307406_10077862 | Ga0307406_100778624 | 184 |
| 1153 | 3300031903 | Ga0307407_10463425 | Ga0307407_104634252 | 184 |
| 1154 | 3300031911 | Ga0307412_10074549 | Ga0307412_100745492 | 184 |
| 1155 | 3300031911 | Ga0307412_10209352 | Ga0307412_102093523 | 184 |
| 1156 | 3300031911 | Ga0307412_10791937 | Ga0307412_107919371 | 184 |
| 1157 | 3300031995 | Ga0307409_100281060 | Ga0307409_1002810602 | 184 |
| 1158 | 3300031995 | Ga0307409_100677931 | Ga0307409_1006779312 | 184 |
| 1159 | 3300032002 | Ga0307416_100908663 | Ga0307416_1009086632 | 184 |
| 1160 | 3300032004 | Ga0307414_10010459 | Ga0307414_100104595 | 184 |
| 1161 | 3300032004 | Ga0307414_10043568 | Ga0307414_100435684 | 184 |
| 1162 | 3300032004 | Ga0307414_10224309 | Ga0307414_102243091 | 184 |
| 1163 | 3300032004 | Ga0307414_10707404 | Ga0307414_107074042 | 184 |
| 1164 | 3300032004 | Ga0307414_11005870 | Ga0307414_110058701 | 184 |
| 1165 | 3300035241 | Ga0373961_0292471 | Ga0373961_0292471_26_583 | 184 |
| 1166 | 3300035398 | Ga0316574_0001388 | Ga0316574_0001388_7695_8255 | 184 |
| 1167 | 3300035691 | Ga0373931_0066210 | Ga0373931_0066210_20_577 | 184 |
| 1168 | 3300037312 | Ga0395899_0161351 | Ga0395899_0161351_279_836 | 184 |
| 1169 | 3300037418 | Ga0395900_0027014 | Ga0395900_0027014_2434_2991 | 184 |
| 1170 | 3300037418 | Ga0395900_0999442 | Ga0395900_0999442_157_714 | 184 |
| 1171 | 3300037466 | Ga0395898_0080973 | Ga0395898_0080973_1916_2473 | 184 |
| 1172 | 3300037466 | Ga0395898_0952062 | Ga0395898_0952062_68_625 | 184 |
| 1173 | 3300038443 | Ga0395901_0007729 | Ga0395901_0007729_3749_4306 | 184 |
| 1174 | 3300038443 | Ga0395901_0178429 | Ga0395901_0178429_68_625 | 184 |
| 1175 | 3300041512 | Ga0451853_0990214 | Ga0451853_0990214_306_863 | 184 |
| 1176 | 3300042531 | Ga0450918_065565 | Ga0450918_065565_13_570 | 184 |
| 1177 | 3300045976 | Ga0466967_0585332 | Ga0466967_0585332_451_1008 | 184 |
| 1178 | 3300046462 | Ga0495651_0170179 | Ga0495651_0170179_358_963 | 184 |
| 1179 | 3300046529 | Ga0495652_0306511 | Ga0495652_0306511_266_844 | 184 |
| 1180 | 3300048913 | Ga0496110_0453094 | Ga0496110_0453094_297_854 | 184 |
| 1181 | 3300048919 | Ga0496116_0043619 | Ga0496116_0043619_2371_2928 | 184 |
| 1182 | 3300048926 | Ga0496123_0350005 | Ga0496123_0350005_84_641 | 184 |
| 1183 | 3300048927 | Ga0496124_0066058 | Ga0496124_0066058_763_1320 | 184 |
| 1184 | 3300048928 | Ga0496125_0000585 | Ga0496125_0000585_59745_60302 | 184 |
| 1185 | 3300048929 | Ga0496126_0034256 | Ga0496126_0034256_263_820 | 184 |
| 1186 | 3300048929 | Ga0496126_0034848 | Ga0496126_0034848_3033_3590 | 184 |
| 1187 | 3300049568 | Ga0501031_0441093 | Ga0501031_0441093_113_670 | 184 |
| 1188 | 3300049569 | Ga0501032_0239270 | Ga0501032_0239270_545_1117 | 184 |
| 1189 | 3300049570 | Ga0501033_0032234 | Ga0501033_0032234_3296_3868 | 184 |
| 1190 | 3300049570 | Ga0501033_0456584 | Ga0501033_0456584_294_851 | 184 |
| 1191 | 3300049571 | Ga0501034_0001360 | Ga0501034_0001360_18638_19195 | 184 |
| 1192 | 3300049571 | Ga0501034_0960610 | Ga0501034_0960610_103_660 | 184 |
| 1193 | 3300049572 | Ga0501036_0290662 | Ga0501036_0290662_214_786 | 184 |
| 1194 | 3300049573 | Ga0501037_0322396 | Ga0501037_0322396_308_880 | 184 |
| 1195 | 3300049573 | Ga0501037_0402663 | Ga0501037_0402663_170_727 | 184 |
| 1196 | 3300049575 | Ga0501039_0143435 | Ga0501039_0143435_805_1377 | 184 |
| 1197 | 3300049579 | Ga0501043_0354325 | Ga0501043_0354325_308_880 | 184 |
| 1198 | 3300049581 | Ga0501047_0139999 | Ga0501047_0139999_933_1505 | 184 |
| 1199 | 3300049582 | Ga0501048_0202630 | Ga0501048_0202630_129_701 | 184 |
| 1200 | 3300049590 | Ga0501074_0444228 | Ga0501074_0444228_272_844 | 184 |
| 1201 | 3300049742 | Ga0501080_0051297 | Ga0501080_0051297_2875_3447 | 184 |
| 1202 | 3300049822 | Ga0501035_0559839 | Ga0501035_0559839_56_628 | 184 |
| 1203 | 3300053083 | Ga0495655_0142832 | Ga0495655_0142832_38_595 | 184 |
| 1204 | 3300053119 | Ga0500595_043033 | Ga0500595_043033_58_615 | 184 |
| 1205 | 3300053151 | Ga0500604_0000343 | Ga0500604_0000343_9912_10469 | 184 |
| 1206 | 3300053153 | Ga0500616_0033355 | Ga0500616_0033355_702_1259 | 184 |
| 1207 | 3300053161 | Ga0500634_0000017 | Ga0500634_0000017_87226_87783 | 184 |
| 1208 | 3300059640 | Ga0587067_105934 | Ga0587067_105934_13_570 | 184 |
| 1209 | 2010549000 | RicEn_C103 | RicEn_01990 | 185 |
| 1210 | 3300001979 | JGI24740J21852_10019185 | JGI24740J21852_100191853 | 185 |
| 1211 | 3300001989 | JGI24739J22299_10005006 | JGI24739J22299_100050066 | 185 |
| 1212 | 3300001989 | JGI24739J22299_10086897 | JGI24739J22299_100868971 | 185 |
| 1213 | 3300002067 | JGI24735J21928_10031234 | JGI24735J21928_100312342 | 185 |
| 1214 | 3300002704 | JGI25155J39150_1000010 | JGI25155J39150_1000010174 | 185 |
| 1215 | 3300002705 | JGI25156J39149_1000033 | JGI25156J39149_10000339 | 185 |
| 1216 | 3300002705 | JGI25156J39149_1000186 | JGI25156J39149_100018635 | 185 |
| 1217 | 3300002705 | JGI25156J39149_1020859 | JGI25156J39149_10208591 | 185 |
| 1218 | 3300002737 | JGI25162J39368_1000413 | JGI25162J39368_10004138 | 185 |
| 1219 | 3300002738 | JGI25154J39366_1000187 | JGI25154J39366_100018711 | 185 |
| 1220 | 3300002741 | JGI25157J39369_1000009 | JGI25157J39369_1000009173 | 185 |
| 1221 | 3300002741 | JGI25157J39369_1001145 | JGI25157J39369_10011452 | 185 |
| 1222 | 3300002773 | JGI25152J39213_1002996 | JGI25152J39213_10029967 | 185 |
| 1223 | 3300002773 | JGI25152J39213_1003625 | JGI25152J39213_10036252 | 185 |
| 1224 | 3300002774 | JGI25150J39212_1000061 | JGI25150J39212_100006144 | 185 |
| 1225 | 3300002774 | JGI25150J39212_1008264 | JGI25150J39212_10082641 | 185 |
| 1226 | 3300002987 | JGI25159J45721_1000095 | JGI25159J45721_100009534 | 185 |
| 1227 | 3300002987 | JGI25159J45721_1001470 | JGI25159J45721_10014709 | 185 |
| 1228 | 3300003187 | JGI25151J46595_10000081 | JGI25151J46595_1000008191 | 185 |
| 1229 | 3300003187 | JGI25151J46595_10004446 | JGI25151J46595_1000444610 | 185 |
| 1230 | 3300003187 | JGI25151J46595_10006138 | JGI25151J46595_100061382 | 185 |
| 1231 | 3300003187 | JGI25151J46595_10019526 | JGI25151J46595_100195263 | 185 |
| 1232 | 3300003187 | JGI25151J46595_10097824 | JGI25151J46595_100978241 | 185 |
| 1233 | 3300003203 | JGI25406J46586_10032295 | JGI25406J46586_100322952 | 185 |
| 1234 | 3300003214 | JGI25165J46597_1000310 | JGI25165J46597_100031051 | 185 |
| 1235 | 3300003214 | JGI25165J46597_1000560 | JGI25165J46597_100056033 | 185 |
| 1236 | 3300003214 | JGI25165J46597_1001161 | JGI25165J46597_10011612 | 185 |
| 1237 | 3300003215 | JGI25153J46596_10002363 | JGI25153J46596_100023639 | 185 |
| 1238 | 3300003215 | JGI25153J46596_10002751 | JGI25153J46596_100027517 | 185 |
| 1239 | 3300003215 | JGI25153J46596_10031226 | JGI25153J46596_100312262 | 185 |
| 1240 | 3300003215 | JGI25153J46596_10081950 | JGI25153J46596_100819501 | 185 |
| 1241 | 3300003354 | JGI25160J50197_1000085 | JGI25160J50197_100008547 | 185 |
| 1242 | 3300003354 | JGI25160J50197_1000247 | JGI25160J50197_100024734 | 185 |
| 1243 | 3300003354 | JGI25160J50197_1003745 | JGI25160J50197_10037458 | 185 |
| 1244 | 3300003354 | JGI25160J50197_1006221 | JGI25160J50197_10062216 | 185 |
| 1245 | 3300003354 | JGI25160J50197_1022172 | JGI25160J50197_10221722 | 185 |
| 1246 | 3300003374 | JGI25161J50226_1000065 | JGI25161J50226_100006547 | 185 |
| 1247 | 3300003374 | JGI25161J50226_1000136 | JGI25161J50226_100013628 | 185 |
| 1248 | 3300003374 | JGI25161J50226_1000853 | JGI25161J50226_10008536 | 185 |
| 1249 | 3300003374 | JGI25161J50226_1003104 | JGI25161J50226_10031045 | 185 |
| 1250 | 3300003578 | Ga0006562J51391_1055964 | Ga0006562J51391_10559648 | 185 |
| 1251 | 3300003578 | Ga0006562J51391_1055965 | Ga0006562J51391_10559654 | 185 |
| 1252 | 3300003762 | Ga0055542_1000373 | Ga0055542_10003736 | 185 |
| 1253 | 3300003763 | Ga0055529_1003026 | Ga0055529_10030264 | 185 |
| 1254 | 3300003771 | Ga0055526_1006261 | Ga0055526_10062611 | 185 |
| 1255 | 3300003771 | Ga0055526_1007490 | Ga0055526_10074904 | 185 |
| 1256 | 3300003771 | Ga0055526_1008265 | Ga0055526_10082657 | 185 |
| 1257 | 3300003771 | Ga0055526_1010341 | Ga0055526_10103411 | 185 |
| 1258 | 3300003771 | Ga0055526_1012355 | Ga0055526_10123553 | 185 |
| 1259 | 3300003775 | Ga0055524_1001281 | Ga0055524_10012812 | 185 |
| 1260 | 3300003775 | Ga0055524_1003268 | Ga0055524_10032688 | 185 |
| 1261 | 3300003775 | Ga0055524_1009629 | Ga0055524_10096292 | 185 |
| 1262 | 3300003775 | Ga0055524_1025110 | Ga0055524_10251103 | 185 |
| 1263 | 3300003781 | Ga0055536_1001218 | Ga0055536_100121811 | 185 |
| 1264 | 3300003781 | Ga0055536_1001688 | Ga0055536_100168811 | 185 |
| 1265 | 3300003781 | Ga0055536_1003846 | Ga0055536_10038464 | 185 |
| 1266 | 3300003790 | Ga0055528_1002915 | Ga0055528_100291510 | 185 |
| 1267 | 3300003790 | Ga0055528_1010563 | Ga0055528_10105634 | 185 |
| 1268 | 3300003790 | Ga0055528_1023567 | Ga0055528_10235673 | 185 |
| 1269 | 3300003791 | Ga0055530_10016258 | Ga0055530_100162582 | 185 |
| 1270 | 3300003792 | Ga0055540_1000789 | Ga0055540_100078915 | 185 |
| 1271 | 3300003792 | Ga0055540_1009670 | Ga0055540_10096703 | 185 |
| 1272 | 3300003792 | Ga0055540_1009673 | Ga0055540_10096733 | 185 |
| 1273 | 3300003792 | Ga0055540_1037182 | Ga0055540_10371821 | 185 |
| 1274 | 3300003792 | Ga0055540_1048437 | Ga0055540_10484372 | 185 |
| 1275 | 3300003794 | Ga0055531_10004531 | Ga0055531_100045314 | 185 |
| 1276 | 3300003794 | Ga0055531_10011999 | Ga0055531_100119995 | 185 |
| 1277 | 3300003794 | Ga0055531_10058681 | Ga0055531_100586812 | 185 |
| 1278 | 3300003856 | Ga0058692_1005178 | Ga0058692_10051782 | 185 |
| 1279 | 3300003856 | Ga0058692_1006935 | Ga0058692_10069352 | 185 |
| 1280 | 3300004625 | Ga0055543_1000067 | Ga0055543_100006746 | 185 |
| 1281 | 3300004625 | Ga0055543_1000228 | Ga0055543_100022837 | 185 |
| 1282 | 3300004625 | Ga0055543_1000496 | Ga0055543_100049619 | 185 |
| 1283 | 3300004625 | Ga0055543_1001108 | Ga0055543_10011089 | 185 |
| 1284 | 3300005262 | Ga0065165_1000237 | Ga0065165_100023758 | 185 |
| 1285 | 3300005262 | Ga0065165_1000804 | Ga0065165_100080434 | 185 |
| 1286 | 3300005262 | Ga0065165_1007131 | Ga0065165_10071315 | 185 |
| 1287 | 3300005262 | Ga0065165_1008692 | Ga0065165_10086926 | 185 |
| 1288 | 3300005293 | Ga0065715_10502147 | Ga0065715_105021471 | 185 |
| 1289 | 3300005331 | Ga0070670_100000117 | Ga0070670_10000011741 | 185 |
| 1290 | 3300005331 | Ga0070670_100501705 | Ga0070670_1005017052 | 185 |
| 1291 | 3300005337 | Ga0070682_100157304 | Ga0070682_1001573042 | 185 |
| 1292 | 3300005339 | Ga0070660_100526988 | Ga0070660_1005269881 | 185 |
| 1293 | 3300005347 | Ga0070668_100027637 | Ga0070668_1000276372 | 185 |
| 1294 | 3300005353 | Ga0070669_100008498 | Ga0070669_1000084985 | 185 |
| 1295 | 3300005353 | Ga0070669_100675388 | Ga0070669_1006753881 | 185 |
| 1296 | 3300005355 | Ga0070671_100016041 | Ga0070671_1000160416 | 185 |
| 1297 | 3300005356 | Ga0070674_100237318 | Ga0070674_1002373182 | 185 |
| 1298 | 3300005356 | Ga0070674_101220888 | Ga0070674_1012208881 | 185 |
| 1299 | 3300005366 | Ga0070659_100197099 | Ga0070659_1001970991 | 185 |
| 1300 | 3300005366 | Ga0070659_100256634 | Ga0070659_1002566341 | 185 |
| 1301 | 3300005435 | Ga0070714_100966881 | Ga0070714_1009668812 | 185 |
| 1302 | 3300005441 | Ga0070700_100432498 | Ga0070700_1004324981 | 185 |
| 1303 | 3300005455 | Ga0070663_100193263 | Ga0070663_1001932632 | 185 |
| 1304 | 3300005456 | Ga0070678_100857650 | Ga0070678_1008576501 | 185 |
| 1305 | 3300005457 | Ga0070662_100573401 | Ga0070662_1005734011 | 185 |
| 1306 | 3300005457 | Ga0070662_100942425 | Ga0070662_1009424251 | 185 |
| 1307 | 3300005539 | Ga0068853_100563317 | Ga0068853_1005633172 | 185 |
| 1308 | 3300005548 | Ga0070665_100005352 | Ga0070665_1000053526 | 185 |
| 1309 | 3300005548 | Ga0070665_100015576 | Ga0070665_1000155767 | 185 |
| 1310 | 3300005548 | Ga0070665_100177540 | Ga0070665_1001775401 | 185 |
| 1311 | 3300005548 | Ga0070665_100300247 | Ga0070665_1003002472 | 185 |
| 1312 | 3300005548 | Ga0070665_100336560 | Ga0070665_1003365602 | 185 |
| 1313 | 3300005548 | Ga0070665_100457868 | Ga0070665_1004578682 | 185 |
| 1314 | 3300005549 | Ga0070704_100407133 | Ga0070704_1004071332 | 185 |
| 1315 | 3300005563 | Ga0068855_100264287 | Ga0068855_1002642872 | 185 |
| 1316 | 3300005577 | Ga0068857_100346296 | Ga0068857_1003462961 | 185 |
| 1317 | 3300005578 | Ga0068854_100241213 | Ga0068854_1002412132 | 185 |
| 1318 | 3300005614 | Ga0068856_100639003 | Ga0068856_1006390032 | 185 |
| 1319 | 3300005614 | Ga0068856_100723633 | Ga0068856_1007236331 | 185 |
| 1320 | 3300005615 | Ga0070702_100499621 | Ga0070702_1004996212 | 185 |
| 1321 | 3300005616 | Ga0068852_100060673 | Ga0068852_1000606733 | 185 |
| 1322 | 3300005834 | Ga0068851_10111015 | Ga0068851_101110152 | 185 |
| 1323 | 3300005840 | Ga0068870_10298444 | Ga0068870_102984442 | 185 |
| 1324 | 3300005937 | Ga0081455_10311331 | Ga0081455_103113312 | 185 |
| 1325 | 3300005983 | Ga0081540_1029085 | Ga0081540_10290852 | 185 |
| 1326 | 3300005985 | Ga0081539_10002004 | Ga0081539_100020045 | 185 |
| 1327 | 3300006038 | Ga0075365_10004176 | Ga0075365_100041764 | 185 |
| 1328 | 3300006038 | Ga0075365_10006633 | Ga0075365_100066335 | 185 |
| 1329 | 3300006038 | Ga0075365_10011265 | Ga0075365_100112654 | 185 |
| 1330 | 3300006038 | Ga0075365_10023551 | Ga0075365_100235516 | 185 |
| 1331 | 3300006038 | Ga0075365_10052752 | Ga0075365_100527522 | 185 |
| 1332 | 3300006038 | Ga0075365_10288533 | Ga0075365_102885332 | 185 |
| 1333 | 3300006042 | Ga0075368_10005353 | Ga0075368_100053531 | 185 |
| 1334 | 3300006042 | Ga0075368_10035760 | Ga0075368_100357603 | 185 |
| 1335 | 3300006048 | Ga0075363_100089591 | Ga0075363_1000895912 | 185 |
| 1336 | 3300006048 | Ga0075363_100094838 | Ga0075363_1000948381 | 185 |
| 1337 | 3300006048 | Ga0075363_100120761 | Ga0075363_1001207612 | 185 |
| 1338 | 3300006051 | Ga0075364_10000157 | Ga0075364_1000015743 | 185 |
| 1339 | 3300006051 | Ga0075364_10003611 | Ga0075364_1000361111 | 185 |
| 1340 | 3300006051 | Ga0075364_10010836 | Ga0075364_100108365 | 185 |
| 1341 | 3300006051 | Ga0075364_10149669 | Ga0075364_101496692 | 185 |
| 1342 | 3300006177 | Ga0075362_10000293 | Ga0075362_1000029311 | 185 |
| 1343 | 3300006177 | Ga0075362_10006767 | Ga0075362_100067676 | 185 |
| 1344 | 3300006177 | Ga0075362_10007354 | Ga0075362_100073543 | 185 |
| 1345 | 3300006177 | Ga0075362_10060453 | Ga0075362_100604532 | 185 |
| 1346 | 3300006177 | Ga0075362_10355401 | Ga0075362_103554012 | 185 |
| 1347 | 3300006178 | Ga0075367_10001300 | Ga0075367_100013009 | 185 |
| 1348 | 3300006178 | Ga0075367_10001485 | Ga0075367_100014859 | 185 |
| 1349 | 3300006178 | Ga0075367_10031249 | Ga0075367_100312492 | 185 |
| 1350 | 3300006178 | Ga0075367_10074556 | Ga0075367_100745562 | 185 |
| 1351 | 3300006178 | Ga0075367_10183797 | Ga0075367_101837972 | 185 |
| 1352 | 3300006178 | Ga0075367_10248519 | Ga0075367_102485192 | 185 |
| 1353 | 3300006178 | Ga0075367_10302709 | Ga0075367_103027091 | 185 |
| 1354 | 3300006178 | Ga0075367_10307118 | Ga0075367_103071182 | 185 |
| 1355 | 3300006178 | Ga0075367_10622784 | Ga0075367_106227841 | 185 |
| 1356 | 3300006186 | Ga0075369_10000770 | Ga0075369_100007709 | 185 |
| 1357 | 3300006186 | Ga0075369_10097842 | Ga0075369_100978422 | 185 |
| 1358 | 3300006186 | Ga0075369_10225645 | Ga0075369_102256452 | 185 |
| 1359 | 3300006195 | Ga0075366_10067308 | Ga0075366_100673082 | 185 |
| 1360 | 3300006195 | Ga0075366_10084259 | Ga0075366_100842593 | 185 |
| 1361 | 3300006195 | Ga0075366_10245143 | Ga0075366_102451432 | 185 |
| 1362 | 3300006353 | Ga0075370_10011674 | Ga0075370_100116743 | 185 |
| 1363 | 3300006353 | Ga0075370_10018590 | Ga0075370_100185903 | 185 |
| 1364 | 3300006353 | Ga0075370_10085817 | Ga0075370_100858172 | 185 |
| 1365 | 3300006353 | Ga0075370_10112335 | Ga0075370_101123352 | 185 |
| 1366 | 3300006353 | Ga0075370_10437222 | Ga0075370_104372221 | 185 |
| 1367 | 3300006353 | Ga0075370_10480422 | Ga0075370_104804222 | 185 |
| 1368 | 3300006946 | Ga0079104_1000101 | Ga0079104_100010126 | 185 |
| 1369 | 3300006946 | Ga0079104_1003469 | Ga0079104_10034693 | 185 |
| 1370 | 3300006948 | Ga0099826_10000025 | Ga0099826_1000002540 | 185 |
| 1371 | 3300006948 | Ga0099826_10119128 | Ga0099826_101191282 | 185 |
| 1372 | 3300009036 | Ga0105244_10056525 | Ga0105244_100565252 | 185 |
| 1373 | 3300009093 | Ga0105240_10394474 | Ga0105240_103944742 | 185 |
| 1374 | 3300009093 | Ga0105240_10522780 | Ga0105240_105227802 | 185 |
| 1375 | 3300009093 | Ga0105240_10593790 | Ga0105240_105937902 | 185 |
| 1376 | 3300009098 | Ga0105245_11239150 | Ga0105245_112391502 | 185 |
| 1377 | 3300009098 | Ga0105245_11874825 | Ga0105245_118748251 | 185 |
| 1378 | 3300009148 | Ga0105243_10024593 | Ga0105243_100245936 | 185 |
| 1379 | 3300009148 | Ga0105243_10547021 | Ga0105243_105470212 | 185 |
| 1380 | 3300009174 | Ga0105241_10288863 | Ga0105241_102888632 | 185 |
| 1381 | 3300009177 | Ga0105248_10689207 | Ga0105248_106892071 | 185 |
| 1382 | 3300009545 | Ga0105237_10357992 | Ga0105237_103579922 | 185 |
| 1383 | 3300009553 | Ga0105249_10843282 | Ga0105249_108432822 | 185 |
| 1384 | 3300009553 | Ga0105249_10909470 | Ga0105249_109094702 | 185 |
| 1385 | 3300009765 | Ga0123341_1000187 | Ga0123341_100018729 | 185 |
| 1386 | 3300009765 | Ga0123341_1107456 | Ga0123341_11074562 | 185 |
| 1387 | 3300009766 | Ga0123342_1010657 | Ga0123342_10106579 | 185 |
| 1388 | 3300009766 | Ga0123342_1021786 | Ga0123342_10217865 | 185 |
| 1389 | 3300010375 | Ga0105239_11501822 | Ga0105239_115018221 | 185 |
| 1390 | 3300010375 | Ga0105239_12099761 | Ga0105239_120997611 | 185 |
| 1391 | 3300011119 | Ga0105246_10507415 | Ga0105246_105074152 | 185 |
| 1392 | 3300011119 | Ga0105246_10992854 | Ga0105246_109928541 | 185 |
| 1393 | 3300011119 | Ga0105246_11143753 | Ga0105246_111437531 | 185 |
| 1394 | 3300012500 | Ga0157314_1003929 | Ga0157314_10039291 | 185 |
| 1395 | 3300012503 | Ga0157313_1001120 | Ga0157313_10011202 | 185 |
| 1396 | 3300013100 | Ga0157373_10000538 | Ga0157373_100005389 | 185 |
| 1397 | 3300013100 | Ga0157373_10414892 | Ga0157373_104148922 | 185 |
| 1398 | 3300013102 | Ga0157371_10000002 | Ga0157371_10000002242 | 185 |
| 1399 | 3300013102 | Ga0157371_10051193 | Ga0157371_100511933 | 185 |
| 1400 | 3300013104 | Ga0157370_10001468 | Ga0157370_1000146822 | 185 |
| 1401 | 3300013104 | Ga0157370_10002446 | Ga0157370_1000244620 | 185 |
| 1402 | 3300013105 | Ga0157369_10054796 | Ga0157369_100547964 | 185 |
| 1403 | 3300013105 | Ga0157369_10431985 | Ga0157369_104319852 | 185 |
| 1404 | 3300013306 | Ga0163162_10831721 | Ga0163162_108317212 | 185 |
| 1405 | 3300013307 | Ga0157372_10977776 | Ga0157372_109777761 | 185 |
| 1406 | 3300014326 | Ga0157380_10446605 | Ga0157380_104466052 | 185 |
| 1407 | 3300014968 | Ga0157379_10806308 | Ga0157379_108063082 | 185 |
| 1408 | 3300014968 | Ga0157379_11103406 | Ga0157379_111034061 | 185 |
| 1409 | 3300015261 | Ga0182006_1070635 | Ga0182006_10706351 | 185 |
| 1410 | 3300015690 | Ga0183363_1270 | Ga0183363_12705 | 185 |
| 1411 | 3300017792 | Ga0163161_10025594 | Ga0163161_100255946 | 185 |
| 1412 | 3300017792 | Ga0163161_10575580 | Ga0163161_105755802 | 185 |
| 1413 | 3300017792 | Ga0163161_10594470 | Ga0163161_105944702 | 185 |
| 1414 | 3300021320 | Ga0214544_1000132 | Ga0214544_100013277 | 185 |
| 1415 | 3300021321 | Ga0214542_1004982 | Ga0214542_100498223 | 185 |
| 1416 | 3300021321 | Ga0214542_1027376 | Ga0214542_10273764 | 185 |
| 1417 | 3300021327 | Ga0214543_1000008 | Ga0214543_100000824 | 185 |
| 1418 | 3300021327 | Ga0214543_1000102 | Ga0214543_100010229 | 185 |
| 1419 | 3300021377 | Ga0213874_10017735 | Ga0213874_100177351 | 185 |
| 1420 | 3300021384 | Ga0213876_10000074 | Ga0213876_1000007483 | 185 |
| 1421 | 3300022739 | Ga0228711_1000022 | Ga0228711_100002229 | 185 |
| 1422 | 3300022740 | Ga0228710_1000028 | Ga0228710_100002829 | 185 |
| 1423 | 3300025206 | Ga0209435_100009 | Ga0209435_100009430 | 185 |
| 1424 | 3300025207 | Ga0209760_100811 | Ga0209760_1008114 | 185 |
| 1425 | 3300025208 | Ga0209436_100089 | Ga0209436_10008936 | 185 |
| 1426 | 3300025208 | Ga0209436_100658 | Ga0209436_10065810 | 185 |
| 1427 | 3300025208 | Ga0209436_104215 | Ga0209436_1042152 | 185 |
| 1428 | 3300025233 | Ga0209437_100057 | Ga0209437_10005737 | 185 |
| 1429 | 3300025233 | Ga0209437_100902 | Ga0209437_1009028 | 185 |
| 1430 | 3300025245 | Ga0207425_1000034 | Ga0207425_1000034135 | 185 |
| 1431 | 3300025245 | Ga0207425_1001593 | Ga0207425_10015934 | 185 |
| 1432 | 3300025245 | Ga0207425_1004102 | Ga0207425_10041024 | 185 |
| 1433 | 3300025245 | Ga0207425_1019678 | Ga0207425_10196783 | 185 |
| 1434 | 3300025245 | Ga0207425_1043848 | Ga0207425_10438481 | 185 |
| 1435 | 3300025246 | Ga0209646_1000018 | Ga0209646_1000018430 | 185 |
| 1436 | 3300025246 | Ga0209646_1012231 | Ga0209646_10122311 | 185 |
| 1437 | 3300025250 | Ga0209026_1000068 | Ga0209026_1000068172 | 185 |
| 1438 | 3300025250 | Ga0209026_1000228 | Ga0209026_100022829 | 185 |
| 1439 | 3300025254 | Ga0209148_1000069 | Ga0209148_1000069244 | 185 |
| 1440 | 3300025254 | Ga0209148_1007004 | Ga0209148_10070043 | 185 |
| 1441 | 3300025254 | Ga0209148_1021821 | Ga0209148_10218211 | 185 |
| 1442 | 3300025256 | Ga0209759_1000007 | Ga0209759_1000007430 | 185 |
| 1443 | 3300025256 | Ga0209759_1000183 | Ga0209759_100018315 | 185 |
| 1444 | 3300025258 | Ga0209129_1000094 | Ga0209129_100009480 | 185 |
| 1445 | 3300025258 | Ga0209129_1000290 | Ga0209129_100029042 | 185 |
| 1446 | 3300025258 | Ga0209129_1000519 | Ga0209129_10005199 | 185 |
| 1447 | 3300025258 | Ga0209129_1002114 | Ga0209129_10021147 | 185 |
| 1448 | 3300025258 | Ga0209129_1003585 | Ga0209129_10035854 | 185 |
| 1449 | 3300025258 | Ga0209129_1003749 | Ga0209129_10037496 | 185 |
| 1450 | 3300025258 | Ga0209129_1004237 | Ga0209129_10042374 | 185 |
| 1451 | 3300025261 | Ga0209233_1000030 | Ga0209233_1000030594 | 185 |
| 1452 | 3300025261 | Ga0209233_1000134 | Ga0209233_100013437 | 185 |
| 1453 | 3300025261 | Ga0209233_1000343 | Ga0209233_100034338 | 185 |
| 1454 | 3300025261 | Ga0209233_1016673 | Ga0209233_10166731 | 185 |
| 1455 | 3300025263 | Ga0209565_1016275 | Ga0209565_10162752 | 185 |
| 1456 | 3300025272 | Ga0209455_1000317 | Ga0209455_100031744 | 185 |
| 1457 | 3300025273 | Ga0209673_1000158 | Ga0209673_100015899 | 185 |
| 1458 | 3300025273 | Ga0209673_1000283 | Ga0209673_100028367 | 185 |
| 1459 | 3300025273 | Ga0209673_1000771 | Ga0209673_100077135 | 185 |
| 1460 | 3300025273 | Ga0209673_1001504 | Ga0209673_100150416 | 185 |
| 1461 | 3300025273 | Ga0209673_1003477 | Ga0209673_10034778 | 185 |
| 1462 | 3300025273 | Ga0209673_1003564 | Ga0209673_100356412 | 185 |
| 1463 | 3300025273 | Ga0209673_1003775 | Ga0209673_10037758 | 185 |
| 1464 | 3300025273 | Ga0209673_1004667 | Ga0209673_10046675 | 185 |
| 1465 | 3300025284 | Ga0209130_1000009 | Ga0209130_1000009446 | 185 |
| 1466 | 3300025284 | Ga0209130_1000265 | Ga0209130_100026546 | 185 |
| 1467 | 3300025284 | Ga0209130_1000465 | Ga0209130_10004659 | 185 |
| 1468 | 3300025284 | Ga0209130_1015015 | Ga0209130_10150152 | 185 |
| 1469 | 3300025284 | Ga0209130_1041671 | Ga0209130_10416712 | 185 |
| 1470 | 3300025291 | Ga0209675_1038367 | Ga0209675_10383672 | 185 |
| 1471 | 3300025292 | Ga0209676_1000038 | Ga0209676_1000038291 | 185 |
| 1472 | 3300025292 | Ga0209676_1000539 | Ga0209676_10005393 | 185 |
| 1473 | 3300025292 | Ga0209676_1010592 | Ga0209676_10105922 | 185 |
| 1474 | 3300025292 | Ga0209676_1021463 | Ga0209676_10214633 | 185 |
| 1475 | 3300025292 | Ga0209676_1024037 | Ga0209676_10240372 | 185 |
| 1476 | 3300025292 | Ga0209676_1035340 | Ga0209676_10353401 | 185 |
| 1477 | 3300025294 | Ga0209025_1000184 | Ga0209025_100018490 | 185 |
| 1478 | 3300025294 | Ga0209025_1000245 | Ga0209025_100024582 | 185 |
| 1479 | 3300025294 | Ga0209025_1000581 | Ga0209025_100058151 | 185 |
| 1480 | 3300025294 | Ga0209025_1000725 | Ga0209025_100072532 | 185 |
| 1481 | 3300025294 | Ga0209025_1002093 | Ga0209025_100209312 | 185 |
| 1482 | 3300025294 | Ga0209025_1003260 | Ga0209025_10032609 | 185 |
| 1483 | 3300025294 | Ga0209025_1012441 | Ga0209025_10124415 | 185 |
| 1484 | 3300025294 | Ga0209025_1057164 | Ga0209025_10571642 | 185 |
| 1485 | 3300025295 | Ga0209564_1000381 | Ga0209564_100038150 | 185 |
| 1486 | 3300025295 | Ga0209564_1000960 | Ga0209564_10009609 | 185 |
| 1487 | 3300025295 | Ga0209564_1003061 | Ga0209564_10030619 | 185 |
| 1488 | 3300025295 | Ga0209564_1003163 | Ga0209564_10031639 | 185 |
| 1489 | 3300025295 | Ga0209564_1010609 | Ga0209564_10106093 | 185 |
| 1490 | 3300025297 | Ga0209758_1000159 | Ga0209758_100015990 | 185 |
| 1491 | 3300025297 | Ga0209758_1000265 | Ga0209758_1000265100 | 185 |
| 1492 | 3300025297 | Ga0209758_1000462 | Ga0209758_100046215 | 185 |
| 1493 | 3300025297 | Ga0209758_1001526 | Ga0209758_100152626 | 185 |
| 1494 | 3300025297 | Ga0209758_1002391 | Ga0209758_10023916 | 185 |
| 1495 | 3300025297 | Ga0209758_1002525 | Ga0209758_100252513 | 185 |
| 1496 | 3300025297 | Ga0209758_1008637 | Ga0209758_10086377 | 185 |
| 1497 | 3300025297 | Ga0209758_1028509 | Ga0209758_10285093 | 185 |
| 1498 | 3300025298 | Ga0209050_1004927 | Ga0209050_10049278 | 185 |
| 1499 | 3300025298 | Ga0209050_1006083 | Ga0209050_100608310 | 185 |
| 1500 | 3300025298 | Ga0209050_1007118 | Ga0209050_10071182 | 185 |
| 1501 | 3300025298 | Ga0209050_1008284 | Ga0209050_10082844 | 185 |
| 1502 | 3300025299 | Ga0209256_1000440 | Ga0209256_100044040 | 185 |
| 1503 | 3300025299 | Ga0209256_1000892 | Ga0209256_100089231 | 185 |
| 1504 | 3300025299 | Ga0209256_1001107 | Ga0209256_100110727 | 185 |
| 1505 | 3300025299 | Ga0209256_1006273 | Ga0209256_10062732 | 185 |
| 1506 | 3300025299 | Ga0209256_1014284 | Ga0209256_10142842 | 185 |
| 1507 | 3300025302 | Ga0207426_1000041 | Ga0207426_1000041384 | 185 |
| 1508 | 3300025302 | Ga0207426_1000048 | Ga0207426_100004833 | 185 |
| 1509 | 3300025302 | Ga0207426_1000309 | Ga0207426_100030958 | 185 |
| 1510 | 3300025302 | Ga0207426_1000646 | Ga0207426_10006469 | 185 |
| 1511 | 3300025302 | Ga0207426_1003476 | Ga0207426_10034769 | 185 |
| 1512 | 3300025303 | Ga0209051_1001304 | Ga0209051_100130415 | 185 |
| 1513 | 3300025303 | Ga0209051_1002360 | Ga0209051_100236010 | 185 |
| 1514 | 3300025303 | Ga0209051_1002835 | Ga0209051_10028358 | 185 |
| 1515 | 3300025303 | Ga0209051_1004388 | Ga0209051_10043885 | 185 |
| 1516 | 3300025303 | Ga0209051_1004410 | Ga0209051_10044102 | 185 |
| 1517 | 3300025303 | Ga0209051_1054500 | Ga0209051_10545002 | 185 |
| 1518 | 3300025303 | Ga0209051_1101445 | Ga0209051_11014452 | 185 |
| 1519 | 3300025304 | Ga0209257_1000060 | Ga0209257_100006011 | 185 |
| 1520 | 3300025304 | Ga0209257_1001125 | Ga0209257_10011254 | 185 |
| 1521 | 3300025304 | Ga0209257_1006305 | Ga0209257_100630510 | 185 |
| 1522 | 3300025304 | Ga0209257_1007702 | Ga0209257_10077029 | 185 |
| 1523 | 3300025304 | Ga0209257_1031615 | Ga0209257_10316151 | 185 |
| 1524 | 3300025304 | Ga0209257_1063100 | Ga0209257_10631002 | 185 |
| 1525 | 3300025735 | Ga0207713_1071064 | Ga0207713_10710642 | 185 |
| 1526 | 3300025900 | Ga0207710_10154357 | Ga0207710_101543572 | 185 |
| 1527 | 3300025901 | Ga0207688_10279851 | Ga0207688_102798511 | 185 |
| 1528 | 3300025903 | Ga0207680_10281379 | Ga0207680_102813791 | 185 |
| 1529 | 3300025904 | Ga0207647_10053199 | Ga0207647_100531993 | 185 |
| 1530 | 3300025904 | Ga0207647_10118430 | Ga0207647_101184302 | 185 |
| 1531 | 3300025909 | Ga0207705_10085130 | Ga0207705_100851302 | 185 |
| 1532 | 3300025911 | Ga0207654_10608385 | Ga0207654_106083851 | 185 |
| 1533 | 3300025913 | Ga0207695_10543581 | Ga0207695_105435811 | 185 |
| 1534 | 3300025913 | Ga0207695_10854070 | Ga0207695_108540701 | 185 |
| 1535 | 3300025914 | Ga0207671_10095065 | Ga0207671_100950653 | 185 |
| 1536 | 3300025914 | Ga0207671_10206144 | Ga0207671_102061442 | 185 |
| 1537 | 3300025919 | Ga0207657_10131743 | Ga0207657_101317431 | 185 |
| 1538 | 3300025923 | Ga0207681_10117602 | Ga0207681_101176023 | 185 |
| 1539 | 3300025923 | Ga0207681_10419238 | Ga0207681_104192381 | 185 |
| 1540 | 3300025925 | Ga0207650_10000206 | Ga0207650_1000020654 | 185 |
| 1541 | 3300025927 | Ga0207687_10417212 | Ga0207687_104172122 | 185 |
| 1542 | 3300025931 | Ga0207644_10060751 | Ga0207644_100607514 | 185 |
| 1543 | 3300025932 | Ga0207690_10133448 | Ga0207690_101334483 | 185 |
| 1544 | 3300025932 | Ga0207690_10150289 | Ga0207690_101502891 | 185 |
| 1545 | 3300025936 | Ga0207670_10919524 | Ga0207670_109195241 | 185 |
| 1546 | 3300025938 | Ga0207704_11141340 | Ga0207704_111413401 | 185 |
| 1547 | 3300025941 | Ga0207711_10048402 | Ga0207711_100484024 | 185 |
| 1548 | 3300025949 | Ga0207667_10203312 | Ga0207667_102033122 | 185 |
| 1549 | 3300025961 | Ga0207712_10475390 | Ga0207712_104753901 | 185 |
| 1550 | 3300025972 | Ga0207668_10197804 | Ga0207668_101978042 | 185 |
| 1551 | 3300025981 | Ga0207640_10517991 | Ga0207640_105179911 | 185 |
| 1552 | 3300025981 | Ga0207640_10898440 | Ga0207640_108984401 | 185 |
| 1553 | 3300025986 | Ga0207658_10353083 | Ga0207658_103530832 | 185 |
| 1554 | 3300025986 | Ga0207658_11176451 | Ga0207658_111764511 | 185 |
| 1555 | 3300026041 | Ga0207639_10405333 | Ga0207639_104053332 | 185 |
| 1556 | 3300026067 | Ga0207678_10020346 | Ga0207678_100203465 | 185 |
| 1557 | 3300026067 | Ga0207678_10095428 | Ga0207678_100954282 | 185 |
| 1558 | 3300026078 | Ga0207702_10118579 | Ga0207702_101185793 | 185 |
| 1559 | 3300026078 | Ga0207702_10541531 | Ga0207702_105415311 | 185 |
| 1560 | 3300026095 | Ga0207676_10355690 | Ga0207676_103556902 | 185 |
| 1561 | 3300026118 | Ga0207675_100443710 | Ga0207675_1004437103 | 185 |
| 1562 | 3300026121 | Ga0207683_10061765 | Ga0207683_100617655 | 185 |
| 1563 | 3300026121 | Ga0207683_10458199 | Ga0207683_104581992 | 185 |
| 1564 | 3300026142 | Ga0207698_10039501 | Ga0207698_100395013 | 185 |
| 1565 | 3300027111 | Ga0209281_1000028 | Ga0209281_1000028196 | 185 |
| 1566 | 3300027111 | Ga0209281_1000247 | Ga0209281_100024729 | 185 |
| 1567 | 3300027111 | Ga0209281_1000628 | Ga0209281_100062810 | 185 |
| 1568 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003628 | 185 |
| 1569 | 3300027312 | Ga0209371_1000340 | Ga0209371_10003401 | 185 |
| 1570 | 3300027312 | Ga0209371_1001537 | Ga0209371_10015378 | 185 |
| 1571 | 3300027312 | Ga0209371_1036922 | Ga0209371_10369222 | 185 |
| 1572 | 3300027666 | Ga0209282_1000037 | Ga0209282_1000037106 | 185 |
| 1573 | 3300027666 | Ga0209282_1000130 | Ga0209282_100013040 | 185 |
| 1574 | 3300027666 | Ga0209282_1111015 | Ga0209282_11110152 | 185 |
| 1575 | 3300027866 | Ga0209813_10001200 | Ga0209813_100012005 | 185 |
| 1576 | 3300027876 | Ga0209974_10310239 | Ga0209974_103102391 | 185 |
| 1577 | 3300028379 | Ga0268266_10003518 | Ga0268266_100035189 | 185 |
| 1578 | 3300028379 | Ga0268266_10006863 | Ga0268266_100068639 | 185 |
| 1579 | 3300028379 | Ga0268266_10527024 | Ga0268266_105270242 | 185 |
| 1580 | 3300028379 | Ga0268266_10536901 | Ga0268266_105369011 | 185 |
| 1581 | 3300028379 | Ga0268266_11188042 | Ga0268266_111880421 | 185 |
| 1582 | 3300028379 | Ga0268266_11412693 | Ga0268266_114126931 | 185 |
| 1583 | 3300028794 | Ga0307515_10000017 | Ga0307515_10000017407 | 185 |
| 1584 | 3300028794 | Ga0307515_10046556 | Ga0307515_100465566 | 185 |
| 1585 | 3300028794 | Ga0307515_10071980 | Ga0307515_100719807 | 185 |
| 1586 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004422 | 185 |
| 1587 | 3300030500 | Ga0268256_1000728 | Ga0268256_10007288 | 185 |
| 1588 | 3300030500 | Ga0268256_1041783 | Ga0268256_10417831 | 185 |
| 1589 | 3300030744 | Ga0316181_1064299 | Ga0316181_10642994 | 185 |
| 1590 | 3300031235 | Ga0265330_10129050 | Ga0265330_101290502 | 185 |
| 1591 | 3300031239 | Ga0265328_10000008 | Ga0265328_10000008149 | 185 |
| 1592 | 3300031239 | Ga0265328_10000392 | Ga0265328_1000039218 | 185 |
| 1593 | 3300031239 | Ga0265328_10002235 | Ga0265328_100022353 | 185 |
| 1594 | 3300031239 | Ga0265328_10003144 | Ga0265328_1000314410 | 185 |
| 1595 | 3300031239 | Ga0265328_10005367 | Ga0265328_100053672 | 185 |
| 1596 | 3300031239 | Ga0265328_10064041 | Ga0265328_100640412 | 185 |
| 1597 | 3300031239 | Ga0265328_10109261 | Ga0265328_101092612 | 185 |
| 1598 | 3300031241 | Ga0265325_10010419 | Ga0265325_100104195 | 185 |
| 1599 | 3300031241 | Ga0265325_10072621 | Ga0265325_100726212 | 185 |
| 1600 | 3300031241 | Ga0265325_10174123 | Ga0265325_101741231 | 185 |
| 1601 | 3300031242 | Ga0265329_10023459 | Ga0265329_100234592 | 185 |
| 1602 | 3300031242 | Ga0265329_10033763 | Ga0265329_100337631 | 185 |
| 1603 | 3300031247 | Ga0265340_10015941 | Ga0265340_100159413 | 185 |
| 1604 | 3300031247 | Ga0265340_10063001 | Ga0265340_100630013 | 185 |
| 1605 | 3300031247 | Ga0265340_10070684 | Ga0265340_100706842 | 185 |
| 1606 | 3300031247 | Ga0265340_10090555 | Ga0265340_100905552 | 185 |
| 1607 | 3300031249 | Ga0265339_10043834 | Ga0265339_100438343 | 185 |
| 1608 | 3300031249 | Ga0265339_10045047 | Ga0265339_100450472 | 185 |
| 1609 | 3300031250 | Ga0265331_10000087 | Ga0265331_10000087111 | 185 |
| 1610 | 3300031250 | Ga0265331_10001355 | Ga0265331_100013555 | 185 |
| 1611 | 3300031250 | Ga0265331_10001484 | Ga0265331_100014848 | 185 |
| 1612 | 3300031251 | Ga0265327_10007959 | Ga0265327_100079592 | 185 |
| 1613 | 3300031344 | Ga0265316_10015136 | Ga0265316_100151366 | 185 |
| 1614 | 3300031344 | Ga0265316_10033919 | Ga0265316_100339196 | 185 |
| 1615 | 3300031344 | Ga0265316_10485333 | Ga0265316_104853331 | 185 |
| 1616 | 3300031456 | Ga0307513_10020102 | Ga0307513_100201029 | 185 |
| 1617 | 3300031456 | Ga0307513_10070744 | Ga0307513_100707445 | 185 |
| 1618 | 3300031456 | Ga0307513_10426558 | Ga0307513_104265582 | 185 |
| 1619 | 3300031548 | Ga0307408_100225213 | Ga0307408_1002252132 | 185 |
| 1620 | 3300031548 | Ga0307408_100231278 | Ga0307408_1002312782 | 185 |
| 1621 | 3300031548 | Ga0307408_100698162 | Ga0307408_1006981622 | 185 |
| 1622 | 3300031595 | Ga0265313_10000869 | Ga0265313_1000086930 | 185 |
| 1623 | 3300031595 | Ga0265313_10015451 | Ga0265313_100154516 | 185 |
| 1624 | 3300031595 | Ga0265313_10033239 | Ga0265313_100332393 | 185 |
| 1625 | 3300031595 | Ga0265313_10060026 | Ga0265313_100600262 | 185 |
| 1626 | 3300031711 | Ga0265314_10019522 | Ga0265314_100195225 | 185 |
| 1627 | 3300031711 | Ga0265314_10123433 | Ga0265314_101234332 | 185 |
| 1628 | 3300031712 | Ga0265342_10090293 | Ga0265342_100902932 | 185 |
| 1629 | 3300031712 | Ga0265342_10156815 | Ga0265342_101568151 | 185 |
| 1630 | 3300031731 | Ga0307405_10000088 | Ga0307405_100000888 | 185 |
| 1631 | 3300031824 | Ga0307413_10024596 | Ga0307413_100245964 | 185 |
| 1632 | 3300031824 | Ga0307413_10035838 | Ga0307413_100358381 | 185 |
| 1633 | 3300031852 | Ga0307410_10487774 | Ga0307410_104877741 | 185 |
| 1634 | 3300031901 | Ga0307406_10003431 | Ga0307406_100034317 | 185 |
| 1635 | 3300031901 | Ga0307406_10005469 | Ga0307406_100054697 | 185 |
| 1636 | 3300031901 | Ga0307406_10012491 | Ga0307406_100124916 | 185 |
| 1637 | 3300031911 | Ga0307412_10002438 | Ga0307412_100024388 | 185 |
| 1638 | 3300031911 | Ga0307412_10003535 | Ga0307412_100035359 | 185 |
| 1639 | 3300031911 | Ga0307412_10035030 | Ga0307412_100350303 | 185 |
| 1640 | 3300031911 | Ga0307412_10062171 | Ga0307412_100621713 | 185 |
| 1641 | 3300031911 | Ga0307412_11398152 | Ga0307412_113981521 | 185 |
| 1642 | 3300031967 | Ga0315914_1000002 | Ga0315914_100000229 | 185 |
| 1643 | 3300031995 | Ga0307409_100038419 | Ga0307409_1000384192 | 185 |
| 1644 | 3300032002 | Ga0307416_100143536 | Ga0307416_1001435362 | 185 |
| 1645 | 3300032002 | Ga0307416_101130629 | Ga0307416_1011306292 | 185 |
| 1646 | 3300032002 | Ga0307416_101468116 | Ga0307416_1014681162 | 185 |
| 1647 | 3300032004 | Ga0307414_10025261 | Ga0307414_100252613 | 185 |
| 1648 | 3300032004 | Ga0307414_10043277 | Ga0307414_100432772 | 185 |
| 1649 | 3300032004 | Ga0307414_10198675 | Ga0307414_101986752 | 185 |
| 1650 | 3300032004 | Ga0307414_10231311 | Ga0307414_102313112 | 185 |
| 1651 | 3300032004 | Ga0307414_10272794 | Ga0307414_102727941 | 185 |
| 1652 | 3300032004 | Ga0307414_10368039 | Ga0307414_103680392 | 185 |
| 1653 | 3300032004 | Ga0307414_10622486 | Ga0307414_106224862 | 185 |
| 1654 | 3300032004 | Ga0307414_10647136 | Ga0307414_106471361 | 185 |
| 1655 | 3300032004 | Ga0307414_10742428 | Ga0307414_107424282 | 185 |
| 1656 | 3300032004 | Ga0307414_11005447 | Ga0307414_110054471 | 185 |
| 1657 | 3300032126 | Ga0307415_100954884 | Ga0307415_1009548841 | 185 |
| 1658 | 3300032168 | Ga0316593_10043353 | Ga0316593_100433531 | 185 |
| 1659 | 3300033430 | Ga0315913_1000018 | Ga0315913_100001871 | 185 |
| 1660 | 3300033464 | Ga0315915_1000005 | Ga0315915_100000529 | 185 |
| 1661 | 3300037068 | Ga0373925_0001010 | Ga0373925_0001010_4232_4822 | 185 |
| 1662 | 3300037312 | Ga0395899_0000107 | Ga0395899_0000107_38694_39281 | 185 |
| 1663 | 3300037418 | Ga0395900_0000101 | Ga0395900_0000101_104807_105394 | 185 |
| 1664 | 3300037418 | Ga0395900_0085364 | Ga0395900_0085364_2079_2636 | 185 |
| 1665 | 3300037418 | Ga0395900_0235140 | Ga0395900_0235140_1125_1706 | 185 |
| 1666 | 3300037418 | Ga0395900_0320341 | Ga0395900_0320341_450_1007 | 185 |
| 1667 | 3300037418 | Ga0395900_1281839 | Ga0395900_1281839_58_621 | 185 |
| 1668 | 3300037466 | Ga0395898_0000043 | Ga0395898_0000043_38722_39309 | 185 |
| 1669 | 3300037466 | Ga0395898_0111816 | Ga0395898_0111816_390_971 | 185 |
| 1670 | 3300037471 | Ga0395905_0000101 | Ga0395905_0000101_38722_39309 | 185 |
| 1671 | 3300037471 | Ga0395905_0009560 | Ga0395905_0009560_5369_5926 | 185 |
| 1672 | 3300037471 | Ga0395905_0031687 | Ga0395905_0031687_1650_2231 | 185 |
| 1673 | 3300037471 | Ga0395905_0080404 | Ga0395905_0080404_875_1432 | 185 |
| 1674 | 3300037471 | Ga0395905_0096247 | Ga0395905_0096247_1681_2238 | 185 |
| 1675 | 3300037853 | Ga0436364_0920022 | Ga0436364_0920022_349_936 | 185 |
| 1676 | 3300038443 | Ga0395901_0000068 | Ga0395901_0000068_38722_39309 | 185 |
| 1677 | 3300038443 | Ga0395901_0017499 | Ga0395901_0017499_6629_7186 | 185 |
| 1678 | 3300038443 | Ga0395901_0073030 | Ga0395901_0073030_1476_2033 | 185 |
| 1679 | 3300038443 | Ga0395901_0720200 | Ga0395901_0720200_157_714 | 185 |
| 1680 | 3300039062 | Ga0400483_117096 | Ga0400483_117096_317_880 | 185 |
| 1681 | 3300039437 | Ga0436365_0669703 | Ga0436365_0669703_548_1105 | 185 |
| 1682 | 3300039437 | Ga0436365_1797099 | Ga0436365_1797099_8673_9233 | 185 |
| 1683 | 3300039447 | Ga0436361_0774089 | Ga0436361_0774089_178_828 | 185 |
| 1684 | 3300039450 | Ga0436363_0693641 | Ga0436363_0693641_1534_2103 | 185 |
| 1685 | 3300039450 | Ga0436363_1325730 | Ga0436363_1325730_654_1307 | 185 |
| 1686 | 3300039450 | Ga0436363_1447886 | Ga0436363_1447886_247_807 | 185 |
| 1687 | 3300039453 | Ga0436362_0302411 | Ga0436362_0302411_63_635 | 185 |
| 1688 | 3300041411 | Ga0439466_0080708 | Ga0439466_0080708_353_910 | 185 |
| 1689 | 3300041413 | Ga0439465_0012626 | Ga0439465_0012626_79_636 | 185 |
| 1690 | 3300041458 | Ga0451798_0152628 | Ga0451798_0152628_83_667 | 185 |
| 1691 | 3300041458 | Ga0451798_0312749 | Ga0451798_0312749_1667_2224 | 185 |
| 1692 | 3300041492 | Ga0451835_0706473 | Ga0451835_0706473_1827_2384 | 185 |
| 1693 | 3300041494 | Ga0451837_1013830 | Ga0451837_1013830_254_811 | 185 |
| 1694 | 3300041496 | Ga0451839_0431211 | Ga0451839_0431211_135_692 | 185 |
| 1695 | 3300041498 | Ga0451841_1367572 | Ga0451841_1367572_203_760 | 185 |
| 1696 | 3300041502 | Ga0451846_65127 | Ga0451846_65127_31_588 | 185 |
| 1697 | 3300041503 | Ga0451847_0708780 | Ga0451847_0708780_1246_1803 | 185 |
| 1698 | 3300041505 | Ga0451849_0224148 | Ga0451849_0224148_127_684 | 185 |
| 1699 | 3300041506 | Ga0451850_39042 | Ga0451850_39042_250_807 | 185 |
| 1700 | 3300041507 | Ga0451851_0590795 | Ga0451851_0590795_1279_1836 | 185 |
| 1701 | 3300041907 | Ga0452268_17051 | Ga0452268_17051_13_570 | 185 |
| 1702 | 3300041916 | Ga0452271_20105 | Ga0452271_20105_181_738 | 185 |
| 1703 | 3300041997 | Ga0439431_0028270 | Ga0439431_0028270_506_1063 | 185 |
| 1704 | 3300042007 | Ga0439449_0006212 | Ga0439449_0006212_202_759 | 185 |
| 1705 | 3300042007 | Ga0439449_0021428 | Ga0439449_0021428_82_639 | 185 |
| 1706 | 3300042013 | Ga0439456_079755 | Ga0439456_079755_124_681 | 185 |
| 1707 | 3300044658 | Ga0466972_0126642 | Ga0466972_0126642_189_746 | 185 |
| 1708 | 3300044683 | Ga0466965_0126003 | Ga0466965_0126003_49_606 | 185 |
| 1709 | 3300044765 | Ga0466970_0056180 | Ga0466970_0056180_1062_1619 | 185 |
| 1710 | 3300045976 | Ga0466967_0735427 | Ga0466967_0735427_182_739 | 185 |
| 1711 | 3300046459 | Ga0495629_0070349 | Ga0495629_0070349_542_1099 | 185 |
| 1712 | 3300046459 | Ga0495629_0461864 | Ga0495629_0461864_190_747 | 185 |
| 1713 | 3300046460 | Ga0495638_0000397 | Ga0495638_0000397_5470_6027 | 185 |
| 1714 | 3300046460 | Ga0495638_0032069 | Ga0495638_0032069_422_982 | 185 |
| 1715 | 3300046460 | Ga0495638_0204001 | Ga0495638_0204001_465_1022 | 185 |
| 1716 | 3300046471 | Ga0495650_0059547 | Ga0495650_0059547_71_628 | 185 |
| 1717 | 3300046476 | Ga0495662_0067394 | Ga0495662_0067394_618_1175 | 185 |
| 1718 | 3300046492 | Ga0495585_0035006 | Ga0495585_0035006_1258_1815 | 185 |
| 1719 | 3300046492 | Ga0495585_0071516 | Ga0495585_0071516_1211_1768 | 185 |
| 1720 | 3300046501 | Ga0495607_0166062 | Ga0495607_0166062_341_898 | 185 |
| 1721 | 3300046506 | Ga0495583_0007197 | Ga0495583_0007197_562_1119 | 185 |
| 1722 | 3300046507 | Ga0495606_0027869 | Ga0495606_0027869_1043_1600 | 185 |
| 1723 | 3300046507 | Ga0495606_0036482 | Ga0495606_0036482_2140_2697 | 185 |
| 1724 | 3300046507 | Ga0495606_0125600 | Ga0495606_0125600_148_705 | 185 |
| 1725 | 3300046507 | Ga0495606_0188043 | Ga0495606_0188043_572_1129 | 185 |
| 1726 | 3300046507 | Ga0495606_0310109 | Ga0495606_0310109_44_601 | 185 |
| 1727 | 3300046512 | Ga0495610_0024722 | Ga0495610_0024722_24_581 | 185 |
| 1728 | 3300046518 | Ga0495631_0010602 | Ga0495631_0010602_3931_4488 | 185 |
| 1729 | 3300046519 | Ga0495632_0003737 | Ga0495632_0003737_5137_5694 | 185 |
| 1730 | 3300046519 | Ga0495632_0090148 | Ga0495632_0090148_63_620 | 185 |
| 1731 | 3300046520 | Ga0495637_0103229 | Ga0495637_0103229_97_654 | 185 |
| 1732 | 3300046522 | Ga0495643_0011844 | Ga0495643_0011844_2371_2928 | 185 |
| 1733 | 3300046522 | Ga0495643_0013228 | Ga0495643_0013228_2129_2686 | 185 |
| 1734 | 3300046522 | Ga0495643_0070443 | Ga0495643_0070443_1180_1737 | 185 |
| 1735 | 3300046522 | Ga0495643_0265724 | Ga0495643_0265724_176_733 | 185 |
| 1736 | 3300046524 | Ga0495648_0228828 | Ga0495648_0228828_203_760 | 185 |
| 1737 | 3300046525 | Ga0495663_0006433 | Ga0495663_0006433_2510_3067 | 185 |
| 1738 | 3300046530 | Ga0495654_0000571 | Ga0495654_0000571_17524_18093 | 185 |
| 1739 | 3300046558 | Ga0495633_0000438 | Ga0495633_0000438_41666_42226 | 185 |
| 1740 | 3300046558 | Ga0495633_0016621 | Ga0495633_0016621_2984_3541 | 185 |
| 1741 | 3300046558 | Ga0495633_0102668 | Ga0495633_0102668_373_930 | 185 |
| 1742 | 3300046616 | Ga0495668_0010444 | Ga0495668_0010444_696_1253 | 185 |
| 1743 | 3300046648 | Ga0495611_0036513 | Ga0495611_0036513_1178_1735 | 185 |
| 1744 | 3300046660 | Ga0495625_0002547 | Ga0495625_0002547_13632_14189 | 185 |
| 1745 | 3300046660 | Ga0495625_0020782 | Ga0495625_0020782_4363_4920 | 185 |
| 1746 | 3300046660 | Ga0495625_0251332 | Ga0495625_0251332_81_638 | 185 |
| 1747 | 3300046660 | Ga0495625_0292968 | Ga0495625_0292968_182_739 | 185 |
| 1748 | 3300046665 | Ga0495661_0047783 | Ga0495661_0047783_110_667 | 185 |
| 1749 | 3300046665 | Ga0495661_0185115 | Ga0495661_0185115_64_621 | 185 |
| 1750 | 3300046690 | Ga0495624_0105980 | Ga0495624_0105980_558_1115 | 185 |
| 1751 | 3300046694 | Ga0495649_0000134 | Ga0495649_0000134_20167_20727 | 185 |
| 1752 | 3300046810 | Ga0495660_0025628 | Ga0495660_0025628_935_1492 | 185 |
| 1753 | 3300047318 | Ga0495636_0045367 | Ga0495636_0045367_1012_1569 | 185 |
| 1754 | 3300047320 | Ga0495672_0009559 | Ga0495672_0009559_1601_2158 | 185 |
| 1755 | 3300047320 | Ga0495672_0295943 | Ga0495672_0295943_39_596 | 185 |
| 1756 | 3300047447 | Ga0495685_194225 | Ga0495685_194225_49_606 | 185 |
| 1757 | 3300047472 | Ga0495686_0046483 | Ga0495686_0046483_1699_2256 | 185 |
| 1758 | 3300047472 | Ga0495686_0152390 | Ga0495686_0152390_739_1296 | 185 |
| 1759 | 3300048088 | Ga0495602_0627029 | Ga0495602_0627029_41_598 | 185 |
| 1760 | 3300048091 | Ga0495626_0040279 | Ga0495626_0040279_1030_1587 | 185 |
| 1761 | 3300048091 | Ga0495626_0083378 | Ga0495626_0083378_79_636 | 185 |
| 1762 | 3300048906 | Ga0496103_0397870 | Ga0496103_0397870_127_684 | 185 |
| 1763 | 3300048907 | Ga0496104_0777668 | Ga0496104_0777668_137_694 | 185 |
| 1764 | 3300048909 | Ga0496106_0001794 | Ga0496106_0001794_7617_8174 | 185 |
| 1765 | 3300048913 | Ga0496110_0688861 | Ga0496110_0688861_339_896 | 185 |
| 1766 | 3300048914 | Ga0496111_0002868 | Ga0496111_0002868_9566_10123 | 185 |
| 1767 | 3300048914 | Ga0496111_0465641 | Ga0496111_0465641_141_698 | 185 |
| 1768 | 3300048915 | Ga0496112_0063240 | Ga0496112_0063240_305_862 | 185 |
| 1769 | 3300048917 | Ga0496114_0233894 | Ga0496114_0233894_420_980 | 185 |
| 1770 | 3300048918 | Ga0496115_0323360 | Ga0496115_0323360_342_902 | 185 |
| 1771 | 3300048919 | Ga0496116_0024906 | Ga0496116_0024906_1206_1763 | 185 |
| 1772 | 3300048919 | Ga0496116_0037404 | Ga0496116_0037404_272_829 | 185 |
| 1773 | 3300048919 | Ga0496116_0044656 | Ga0496116_0044656_1508_2080 | 185 |
| 1774 | 3300048919 | Ga0496116_0292637 | Ga0496116_0292637_12_569 | 185 |
| 1775 | 3300048920 | Ga0496117_0000016 | Ga0496117_0000016_101376_101933 | 185 |
| 1776 | 3300048920 | Ga0496117_0005852 | Ga0496117_0005852_2101_2658 | 185 |
| 1777 | 3300048920 | Ga0496117_0014948 | Ga0496117_0014948_378_935 | 185 |
| 1778 | 3300048920 | Ga0496117_0050674 | Ga0496117_0050674_14_571 | 185 |
| 1779 | 3300048921 | Ga0496118_0005627 | Ga0496118_0005627_8691_9248 | 185 |
| 1780 | 3300048921 | Ga0496118_0016278 | Ga0496118_0016278_1777_2334 | 185 |
| 1781 | 3300048921 | Ga0496118_0056054 | Ga0496118_0056054_489_1046 | 185 |
| 1782 | 3300048921 | Ga0496118_0323745 | Ga0496118_0323745_210_791 | 185 |
| 1783 | 3300048922 | Ga0496119_0023848 | Ga0496119_0023848_716_1273 | 185 |
| 1784 | 3300048922 | Ga0496119_0026449 | Ga0496119_0026449_1261_1818 | 185 |
| 1785 | 3300048922 | Ga0496119_0040525 | Ga0496119_0040525_2287_2844 | 185 |
| 1786 | 3300048922 | Ga0496119_0111375 | Ga0496119_0111375_94_651 | 185 |
| 1787 | 3300048922 | Ga0496119_0172451 | Ga0496119_0172451_308_865 | 185 |
| 1788 | 3300048923 | Ga0496120_0000164 | Ga0496120_0000164_66559_67116 | 185 |
| 1789 | 3300048923 | Ga0496120_0000550 | Ga0496120_0000550_44856_45413 | 185 |
| 1790 | 3300048923 | Ga0496120_0069810 | Ga0496120_0069810_525_1082 | 185 |
| 1791 | 3300048923 | Ga0496120_0077183 | Ga0496120_0077183_954_1511 | 185 |
| 1792 | 3300048924 | Ga0496121_0002925 | Ga0496121_0002925_17397_17954 | 185 |
| 1793 | 3300048924 | Ga0496121_0044960 | Ga0496121_0044960_109_666 | 185 |
| 1794 | 3300048924 | Ga0496121_0080370 | Ga0496121_0080370_844_1401 | 185 |
| 1795 | 3300048924 | Ga0496121_0178702 | Ga0496121_0178702_447_1004 | 185 |
| 1796 | 3300048924 | Ga0496121_0212190 | Ga0496121_0212190_98_655 | 185 |
| 1797 | 3300048924 | Ga0496121_0569806 | Ga0496121_0569806_127_684 | 185 |
| 1798 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_102037_102594 | 185 |
| 1799 | 3300048925 | Ga0496122_0001100 | Ga0496122_0001100_13988_14545 | 185 |
| 1800 | 3300048925 | Ga0496122_0001424 | Ga0496122_0001424_5728_6285 | 185 |
| 1801 | 3300048925 | Ga0496122_0026493 | Ga0496122_0026493_3406_3963 | 185 |
| 1802 | 3300048925 | Ga0496122_0027392 | Ga0496122_0027392_2153_2713 | 185 |
| 1803 | 3300048925 | Ga0496122_0047818 | Ga0496122_0047818_379_936 | 185 |
| 1804 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_102037_102594 | 185 |
| 1805 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1709089_1709646 | 185 |
| 1806 | 3300048926 | Ga0496123_0001129 | Ga0496123_0001129_25961_26518 | 185 |
| 1807 | 3300048926 | Ga0496123_0001147 | Ga0496123_0001147_6501_7058 | 185 |
| 1808 | 3300048926 | Ga0496123_0003982 | Ga0496123_0003982_6475_7035 | 185 |
| 1809 | 3300048926 | Ga0496123_0006102 | Ga0496123_0006102_5012_5569 | 185 |
| 1810 | 3300048926 | Ga0496123_0022124 | Ga0496123_0022124_3440_3997 | 185 |
| 1811 | 3300048926 | Ga0496123_0031999 | Ga0496123_0031999_2688_3245 | 185 |
| 1812 | 3300048927 | Ga0496124_0000094 | Ga0496124_0000094_87921_88478 | 185 |
| 1813 | 3300048927 | Ga0496124_0030277 | Ga0496124_0030277_819_1376 | 185 |
| 1814 | 3300048927 | Ga0496124_0041684 | Ga0496124_0041684_721_1278 | 185 |
| 1815 | 3300048927 | Ga0496124_0113690 | Ga0496124_0113690_259_816 | 185 |
| 1816 | 3300048927 | Ga0496124_0144534 | Ga0496124_0144534_387_944 | 185 |
| 1817 | 3300048927 | Ga0496124_0231818 | Ga0496124_0231818_82_642 | 185 |
| 1818 | 3300048927 | Ga0496124_0239659 | Ga0496124_0239659_125_682 | 185 |
| 1819 | 3300048928 | Ga0496125_0000374 | Ga0496125_0000374_47002_47559 | 185 |
| 1820 | 3300048928 | Ga0496125_0000564 | Ga0496125_0000564_30333_30890 | 185 |
| 1821 | 3300048928 | Ga0496125_0005990 | Ga0496125_0005990_5941_6498 | 185 |
| 1822 | 3300048928 | Ga0496125_0014364 | Ga0496125_0014364_6253_6810 | 185 |
| 1823 | 3300048928 | Ga0496125_0016356 | Ga0496125_0016356_6326_6898 | 185 |
| 1824 | 3300048928 | Ga0496125_0026192 | Ga0496125_0026192_1233_1790 | 185 |
| 1825 | 3300048928 | Ga0496125_0154752 | Ga0496125_0154752_685_1242 | 185 |
| 1826 | 3300048928 | Ga0496125_0234678 | Ga0496125_0234678_513_1070 | 185 |
| 1827 | 3300048929 | Ga0496126_0062938 | Ga0496126_0062938_43_600 | 185 |
| 1828 | 3300048929 | Ga0496126_0125604 | Ga0496126_0125604_521_1078 | 185 |
| 1829 | 3300048929 | Ga0496126_0233414 | Ga0496126_0233414_18_575 | 185 |
| 1830 | 3300049459 | Ga0495678_022706 | Ga0495678_022706_1279_1836 | 185 |
| 1831 | 3300049568 | Ga0501031_0000016 | Ga0501031_0000016_36507_37064 | 185 |
| 1832 | 3300049568 | Ga0501031_0009606 | Ga0501031_0009606_2828_3397 | 185 |
| 1833 | 3300049568 | Ga0501031_0020950 | Ga0501031_0020950_1896_2474 | 185 |
| 1834 | 3300049568 | Ga0501031_0170597 | Ga0501031_0170597_480_1037 | 185 |
| 1835 | 3300049568 | Ga0501031_0179041 | Ga0501031_0179041_75_632 | 185 |
| 1836 | 3300049569 | Ga0501032_0000029 | Ga0501032_0000029_98619_99188 | 185 |
| 1837 | 3300049569 | Ga0501032_0000044 | Ga0501032_0000044_36507_37064 | 185 |
| 1838 | 3300049569 | Ga0501032_0000435 | Ga0501032_0000435_6546_7109 | 185 |
| 1839 | 3300049569 | Ga0501032_0009080 | Ga0501032_0009080_557_1135 | 185 |
| 1840 | 3300049569 | Ga0501032_0031986 | Ga0501032_0031986_1189_1746 | 185 |
| 1841 | 3300049569 | Ga0501032_0035913 | Ga0501032_0035913_1268_1825 | 185 |
| 1842 | 3300049569 | Ga0501032_0084070 | Ga0501032_0084070_316_894 | 185 |
| 1843 | 3300049569 | Ga0501032_0085875 | Ga0501032_0085875_232_789 | 185 |
| 1844 | 3300049569 | Ga0501032_0107664 | Ga0501032_0107664_498_1055 | 185 |
| 1845 | 3300049569 | Ga0501032_0189147 | Ga0501032_0189147_578_1135 | 185 |
| 1846 | 3300049569 | Ga0501032_0324968 | Ga0501032_0324968_152_730 | 185 |
| 1847 | 3300049569 | Ga0501032_0610462 | Ga0501032_0610462_116_673 | 185 |
| 1848 | 3300049570 | Ga0501033_0000052 | Ga0501033_0000052_36181_36738 | 185 |
| 1849 | 3300049570 | Ga0501033_0000168 | Ga0501033_0000168_37203_37772 | 185 |
| 1850 | 3300049570 | Ga0501033_0011017 | Ga0501033_0011017_4804_5361 | 185 |
| 1851 | 3300049570 | Ga0501033_0026324 | Ga0501033_0026324_178_756 | 185 |
| 1852 | 3300049570 | Ga0501033_0053399 | Ga0501033_0053399_1997_2554 | 185 |
| 1853 | 3300049570 | Ga0501033_0109660 | Ga0501033_0109660_12_569 | 185 |
| 1854 | 3300049570 | Ga0501033_0648971 | Ga0501033_0648971_31_588 | 185 |
| 1855 | 3300049571 | Ga0501034_0000212 | Ga0501034_0000212_36507_37064 | 185 |
| 1856 | 3300049571 | Ga0501034_0000434 | Ga0501034_0000434_37204_37773 | 185 |
| 1857 | 3300049571 | Ga0501034_0000675 | Ga0501034_0000675_6099_6656 | 185 |
| 1858 | 3300049571 | Ga0501034_0026045 | Ga0501034_0026045_3977_4534 | 185 |
| 1859 | 3300049571 | Ga0501034_0050235 | Ga0501034_0050235_3220_3777 | 185 |
| 1860 | 3300049571 | Ga0501034_0062180 | Ga0501034_0062180_1594_2151 | 185 |
| 1861 | 3300049571 | Ga0501034_0067777 | Ga0501034_0067777_1917_2474 | 185 |
| 1862 | 3300049571 | Ga0501034_0073976 | Ga0501034_0073976_1010_1630 | 185 |
| 1863 | 3300049571 | Ga0501034_0118813 | Ga0501034_0118813_1957_2514 | 185 |
| 1864 | 3300049571 | Ga0501034_0145726 | Ga0501034_0145726_1373_1936 | 185 |
| 1865 | 3300049571 | Ga0501034_0303946 | Ga0501034_0303946_805_1362 | 185 |
| 1866 | 3300049571 | Ga0501034_0394511 | Ga0501034_0394511_280_837 | 185 |
| 1867 | 3300049571 | Ga0501034_0431702 | Ga0501034_0431702_263_820 | 185 |
| 1868 | 3300049571 | Ga0501034_0470139 | Ga0501034_0470139_137_694 | 185 |
| 1869 | 3300049571 | Ga0501034_0574674 | Ga0501034_0574674_206_763 | 185 |
| 1870 | 3300049571 | Ga0501034_0652964 | Ga0501034_0652964_192_749 | 185 |
| 1871 | 3300049571 | Ga0501034_0754298 | Ga0501034_0754298_296_853 | 185 |
| 1872 | 3300049571 | Ga0501034_0876318 | Ga0501034_0876318_105_683 | 185 |
| 1873 | 3300049571 | Ga0501034_0999344 | Ga0501034_0999344_40_618 | 185 |
| 1874 | 3300049572 | Ga0501036_0000022 | Ga0501036_0000022_73733_74290 | 185 |
| 1875 | 3300049572 | Ga0501036_0000533 | Ga0501036_0000533_17294_17863 | 185 |
| 1876 | 3300049572 | Ga0501036_0049068 | Ga0501036_0049068_883_1440 | 185 |
| 1877 | 3300049572 | Ga0501036_0508579 | Ga0501036_0508579_162_719 | 185 |
| 1878 | 3300049573 | Ga0501037_0000049 | Ga0501037_0000049_83883_84461 | 185 |
| 1879 | 3300049573 | Ga0501037_0000052 | Ga0501037_0000052_36507_37064 | 185 |
| 1880 | 3300049573 | Ga0501037_0000335 | Ga0501037_0000335_31583_32152 | 185 |
| 1881 | 3300049573 | Ga0501037_0044673 | Ga0501037_0044673_57_614 | 185 |
| 1882 | 3300049573 | Ga0501037_0074156 | Ga0501037_0074156_478_1035 | 185 |
| 1883 | 3300049573 | Ga0501037_0101319 | Ga0501037_0101319_412_969 | 185 |
| 1884 | 3300049573 | Ga0501037_0133986 | Ga0501037_0133986_627_1184 | 185 |
| 1885 | 3300049573 | Ga0501037_0157477 | Ga0501037_0157477_114_671 | 185 |
| 1886 | 3300049573 | Ga0501037_0191340 | Ga0501037_0191340_57_614 | 185 |
| 1887 | 3300049573 | Ga0501037_0286244 | Ga0501037_0286244_330_908 | 185 |
| 1888 | 3300049573 | Ga0501037_0295876 | Ga0501037_0295876_135_713 | 185 |
| 1889 | 3300049574 | Ga0501038_0000044 | Ga0501038_0000044_73869_74426 | 185 |
| 1890 | 3300049574 | Ga0501038_0000275 | Ga0501038_0000275_11345_11914 | 185 |
| 1891 | 3300049574 | Ga0501038_0084357 | Ga0501038_0084357_671_1228 | 185 |
| 1892 | 3300049574 | Ga0501038_0190158 | Ga0501038_0190158_551_1108 | 185 |
| 1893 | 3300049574 | Ga0501038_0212096 | Ga0501038_0212096_232_789 | 185 |
| 1894 | 3300049574 | Ga0501038_0291543 | Ga0501038_0291543_403_960 | 185 |
| 1895 | 3300049574 | Ga0501038_0309624 | Ga0501038_0309624_302_859 | 185 |
| 1896 | 3300049575 | Ga0501039_0000040 | Ga0501039_0000040_82667_83236 | 185 |
| 1897 | 3300049575 | Ga0501039_0000042 | Ga0501039_0000042_38719_39276 | 185 |
| 1898 | 3300049575 | Ga0501039_0237677 | Ga0501039_0237677_232_789 | 185 |
| 1899 | 3300049575 | Ga0501039_0439392 | Ga0501039_0439392_335_892 | 185 |
| 1900 | 3300049575 | Ga0501039_0482240 | Ga0501039_0482240_286_843 | 185 |
| 1901 | 3300049576 | Ga0501040_0103312 | Ga0501040_0103312_679_1236 | 185 |
| 1902 | 3300049576 | Ga0501040_0141414 | Ga0501040_0141414_71_628 | 185 |
| 1903 | 3300049578 | Ga0501042_0129112 | Ga0501042_0129112_56_613 | 185 |
| 1904 | 3300049579 | Ga0501043_0000006 | Ga0501043_0000006_149838_150416 | 185 |
| 1905 | 3300049579 | Ga0501043_0000054 | Ga0501043_0000054_31499_32056 | 185 |
| 1906 | 3300049579 | Ga0501043_0000236 | Ga0501043_0000236_17735_18304 | 185 |
| 1907 | 3300049579 | Ga0501043_0013995 | Ga0501043_0013995_1043_1621 | 185 |
| 1908 | 3300049579 | Ga0501043_0054340 | Ga0501043_0054340_1110_1667 | 185 |
| 1909 | 3300049579 | Ga0501043_0131977 | Ga0501043_0131977_498_1061 | 185 |
| 1910 | 3300049579 | Ga0501043_0138189 | Ga0501043_0138189_1020_1577 | 185 |
| 1911 | 3300049579 | Ga0501043_0270670 | Ga0501043_0270670_639_1196 | 185 |
| 1912 | 3300049579 | Ga0501043_0298880 | Ga0501043_0298880_442_999 | 185 |
| 1913 | 3300049579 | Ga0501043_0321123 | Ga0501043_0321123_59_637 | 185 |
| 1914 | 3300049579 | Ga0501043_0398511 | Ga0501043_0398511_114_671 | 185 |
| 1915 | 3300049579 | Ga0501043_0782297 | Ga0501043_0782297_49_606 | 185 |
| 1916 | 3300049579 | Ga0501043_0825108 | Ga0501043_0825108_100_657 | 185 |
| 1917 | 3300049580 | Ga0501046_0019865 | Ga0501046_0019865_1011_1580 | 185 |
| 1918 | 3300049580 | Ga0501046_0135926 | Ga0501046_0135926_349_906 | 185 |
| 1919 | 3300049580 | Ga0501046_0380901 | Ga0501046_0380901_437_994 | 185 |
| 1920 | 3300049581 | Ga0501047_0000838 | Ga0501047_0000838_9077_9634 | 185 |
| 1921 | 3300049581 | Ga0501047_0009345 | Ga0501047_0009345_1902_2480 | 185 |
| 1922 | 3300049581 | Ga0501047_0039981 | Ga0501047_0039981_749_1306 | 185 |
| 1923 | 3300049581 | Ga0501047_0045832 | Ga0501047_0045832_2411_2980 | 185 |
| 1924 | 3300049581 | Ga0501047_0070750 | Ga0501047_0070750_221_778 | 185 |
| 1925 | 3300049581 | Ga0501047_0081264 | Ga0501047_0081264_439_996 | 185 |
| 1926 | 3300049581 | Ga0501047_0096030 | Ga0501047_0096030_1303_1860 | 185 |
| 1927 | 3300049581 | Ga0501047_0123404 | Ga0501047_0123404_1451_2029 | 185 |
| 1928 | 3300049581 | Ga0501047_0143198 | Ga0501047_0143198_1584_2141 | 185 |
| 1929 | 3300049581 | Ga0501047_0183726 | Ga0501047_0183726_529_1086 | 185 |
| 1930 | 3300049581 | Ga0501047_0302382 | Ga0501047_0302382_129_686 | 185 |
| 1931 | 3300049581 | Ga0501047_0335137 | Ga0501047_0335137_607_1218 | 185 |
| 1932 | 3300049582 | Ga0501048_0431877 | Ga0501048_0431877_14_571 | 185 |
| 1933 | 3300049583 | Ga0501067_0001248 | Ga0501067_0001248_11226_11783 | 185 |
| 1934 | 3300049583 | Ga0501067_0003119 | Ga0501067_0003119_236_799 | 185 |
| 1935 | 3300049583 | Ga0501067_0004746 | Ga0501067_0004746_380_937 | 185 |
| 1936 | 3300049583 | Ga0501067_0055009 | Ga0501067_0055009_1318_1875 | 185 |
| 1937 | 3300049583 | Ga0501067_0069494 | Ga0501067_0069494_116_673 | 185 |
| 1938 | 3300049583 | Ga0501067_0214054 | Ga0501067_0214054_173_751 | 185 |
| 1939 | 3300049583 | Ga0501067_0307199 | Ga0501067_0307199_22_582 | 185 |
| 1940 | 3300049583 | Ga0501067_0325059 | Ga0501067_0325059_281_838 | 185 |
| 1941 | 3300049583 | Ga0501067_0361412 | Ga0501067_0361412_143_700 | 185 |
| 1942 | 3300049584 | Ga0501068_0007310 | Ga0501068_0007310_3509_4072 | 185 |
| 1943 | 3300049584 | Ga0501068_0216057 | Ga0501068_0216057_392_949 | 185 |
| 1944 | 3300049584 | Ga0501068_0344231 | Ga0501068_0344231_377_934 | 185 |
| 1945 | 3300049585 | Ga0501069_0000141 | Ga0501069_0000141_787_1365 | 185 |
| 1946 | 3300049585 | Ga0501069_0013189 | Ga0501069_0013189_2866_3423 | 185 |
| 1947 | 3300049585 | Ga0501069_0084971 | Ga0501069_0084971_1027_1584 | 185 |
| 1948 | 3300049585 | Ga0501069_0112182 | Ga0501069_0112182_68_625 | 185 |
| 1949 | 3300049585 | Ga0501069_0217062 | Ga0501069_0217062_243_800 | 185 |
| 1950 | 3300049586 | Ga0501070_0000081 | Ga0501070_0000081_49680_50258 | 185 |
| 1951 | 3300049586 | Ga0501070_0000254 | Ga0501070_0000254_3956_4534 | 185 |
| 1952 | 3300049586 | Ga0501070_0005587 | Ga0501070_0005587_5884_6441 | 185 |
| 1953 | 3300049586 | Ga0501070_0064518 | Ga0501070_0064518_1173_1751 | 185 |
| 1954 | 3300049586 | Ga0501070_0069657 | Ga0501070_0069657_383_940 | 185 |
| 1955 | 3300049586 | Ga0501070_0088763 | Ga0501070_0088763_1574_2152 | 185 |
| 1956 | 3300049586 | Ga0501070_0108673 | Ga0501070_0108673_255_812 | 185 |
| 1957 | 3300049586 | Ga0501070_0126634 | Ga0501070_0126634_1026_1604 | 185 |
| 1958 | 3300049586 | Ga0501070_0159445 | Ga0501070_0159445_1029_1586 | 185 |
| 1959 | 3300049586 | Ga0501070_0207403 | Ga0501070_0207403_1015_1572 | 185 |
| 1960 | 3300049586 | Ga0501070_0213963 | Ga0501070_0213963_924_1481 | 185 |
| 1961 | 3300049586 | Ga0501070_0224883 | Ga0501070_0224883_419_976 | 185 |
| 1962 | 3300049586 | Ga0501070_0405989 | Ga0501070_0405989_342_899 | 185 |
| 1963 | 3300049586 | Ga0501070_0639216 | Ga0501070_0639216_17_595 | 185 |
| 1964 | 3300049587 | Ga0501071_0043325 | Ga0501071_0043325_1150_1728 | 185 |
| 1965 | 3300049587 | Ga0501071_0134976 | Ga0501071_0134976_630_1187 | 185 |
| 1966 | 3300049587 | Ga0501071_0889993 | Ga0501071_0889993_23_580 | 185 |
| 1967 | 3300049588 | Ga0501072_0121254 | Ga0501072_0121254_633_1196 | 185 |
| 1968 | 3300049588 | Ga0501072_0429892 | Ga0501072_0429892_100_657 | 185 |
| 1969 | 3300049588 | Ga0501072_0624195 | Ga0501072_0624195_109_669 | 185 |
| 1970 | 3300049589 | Ga0501073_0000019 | Ga0501073_0000019_71228_71791 | 185 |
| 1971 | 3300049589 | Ga0501073_0015418 | Ga0501073_0015418_1172_1729 | 185 |
| 1972 | 3300049589 | Ga0501073_0019232 | Ga0501073_0019232_2665_3222 | 185 |
| 1973 | 3300049589 | Ga0501073_0026648 | Ga0501073_0026648_1648_2205 | 185 |
| 1974 | 3300049589 | Ga0501073_0071790 | Ga0501073_0071790_744_1301 | 185 |
| 1975 | 3300049589 | Ga0501073_0128800 | Ga0501073_0128800_580_1137 | 185 |
| 1976 | 3300049589 | Ga0501073_0157634 | Ga0501073_0157634_561_1118 | 185 |
| 1977 | 3300049589 | Ga0501073_0362758 | Ga0501073_0362758_421_978 | 185 |
| 1978 | 3300049590 | Ga0501074_0000011 | Ga0501074_0000011_29181_29759 | 185 |
| 1979 | 3300049590 | Ga0501074_0029334 | Ga0501074_0029334_144_701 | 185 |
| 1980 | 3300049590 | Ga0501074_0199990 | Ga0501074_0199990_327_884 | 185 |
| 1981 | 3300049590 | Ga0501074_0409747 | Ga0501074_0409747_11_568 | 185 |
| 1982 | 3300049590 | Ga0501074_0541464 | Ga0501074_0541464_166_723 | 185 |
| 1983 | 3300049592 | Ga0501076_0126748 | Ga0501076_0126748_1486_2043 | 185 |
| 1984 | 3300049593 | Ga0501077_0000035 | Ga0501077_0000035_62475_63038 | 185 |
| 1985 | 3300049593 | Ga0501077_0041346 | Ga0501077_0041346_425_982 | 185 |
| 1986 | 3300049593 | Ga0501077_0057700 | Ga0501077_0057700_641_1198 | 185 |
| 1987 | 3300049593 | Ga0501077_0616935 | Ga0501077_0616935_36_683 | 185 |
| 1988 | 3300049741 | Ga0501079_0142963 | Ga0501079_0142963_1221_1778 | 185 |
| 1989 | 3300049741 | Ga0501079_0700156 | Ga0501079_0700156_208_765 | 185 |
| 1990 | 3300049742 | Ga0501080_0000582 | Ga0501080_0000582_21792_22370 | 185 |
| 1991 | 3300049742 | Ga0501080_0005452 | Ga0501080_0005452_4564_5124 | 185 |
| 1992 | 3300049742 | Ga0501080_0025036 | Ga0501080_0025036_3613_4170 | 185 |
| 1993 | 3300049742 | Ga0501080_0029481 | Ga0501080_0029481_2974_3531 | 185 |
| 1994 | 3300049742 | Ga0501080_0099925 | Ga0501080_0099925_64_642 | 185 |
| 1995 | 3300049742 | Ga0501080_0107954 | Ga0501080_0107954_1262_1840 | 185 |
| 1996 | 3300049742 | Ga0501080_0145057 | Ga0501080_0145057_276_833 | 185 |
| 1997 | 3300049742 | Ga0501080_0146315 | Ga0501080_0146315_1020_1577 | 185 |
| 1998 | 3300049742 | Ga0501080_0186994 | Ga0501080_0186994_640_1197 | 185 |
| 1999 | 3300049742 | Ga0501080_0480481 | Ga0501080_0480481_433_990 | 185 |
| 2000 | 3300049742 | Ga0501080_0621599 | Ga0501080_0621599_313_870 | 185 |
| 2001 | 3300049742 | Ga0501080_0674999 | Ga0501080_0674999_121_678 | 185 |
| 2002 | 3300049743 | Ga0501081_1013335 | Ga0501081_1013335_53_610 | 185 |
| 2003 | 3300049744 | Ga0501083_0002722 | Ga0501083_0002722_9731_10291 | 185 |
| 2004 | 3300049744 | Ga0501083_0002864 | Ga0501083_0002864_2144_2701 | 185 |
| 2005 | 3300049744 | Ga0501083_0003672 | Ga0501083_0003672_9920_10498 | 185 |
| 2006 | 3300049744 | Ga0501083_0004693 | Ga0501083_0004693_8027_8584 | 185 |
| 2007 | 3300049744 | Ga0501083_0048536 | Ga0501083_0048536_1011_1568 | 185 |
| 2008 | 3300049744 | Ga0501083_0060795 | Ga0501083_0060795_1207_1764 | 185 |
| 2009 | 3300049744 | Ga0501083_0077252 | Ga0501083_0077252_1413_1970 | 185 |
| 2010 | 3300049744 | Ga0501083_0223140 | Ga0501083_0223140_240_797 | 185 |
| 2011 | 3300049744 | Ga0501083_0254278 | Ga0501083_0254278_85_642 | 185 |
| 2012 | 3300049744 | Ga0501083_0298190 | Ga0501083_0298190_84_641 | 185 |
| 2013 | 3300049758 | Ga0501241_025024 | Ga0501241_025024_333_890 | 185 |
| 2014 | 3300049776 | Ga0501280_001991 | Ga0501280_001991_1267_1824 | 185 |
| 2015 | 3300049822 | Ga0501035_0000068 | Ga0501035_0000068_1767_2345 | 185 |
| 2016 | 3300049822 | Ga0501035_0000095 | Ga0501035_0000095_73715_74272 | 185 |
| 2017 | 3300049822 | Ga0501035_0000557 | Ga0501035_0000557_9032_9601 | 185 |
| 2018 | 3300049822 | Ga0501035_0004674 | Ga0501035_0004674_1927_2505 | 185 |
| 2019 | 3300049822 | Ga0501035_0010601 | Ga0501035_0010601_6617_7174 | 185 |
| 2020 | 3300049822 | Ga0501035_0024027 | Ga0501035_0024027_4804_5361 | 185 |
| 2021 | 3300049822 | Ga0501035_0036936 | Ga0501035_0036936_1591_2148 | 185 |
| 2022 | 3300049822 | Ga0501035_0122679 | Ga0501035_0122679_318_896 | 185 |
| 2023 | 3300049822 | Ga0501035_0331737 | Ga0501035_0331737_522_1079 | 185 |
| 2024 | 3300049823 | Ga0501044_0000082 | Ga0501044_0000082_84010_84588 | 185 |
| 2025 | 3300049823 | Ga0501044_0000091 | Ga0501044_0000091_36962_37519 | 185 |
| 2026 | 3300049823 | Ga0501044_0002199 | Ga0501044_0002199_21684_22247 | 185 |
| 2027 | 3300049823 | Ga0501044_0020085 | Ga0501044_0020085_957_1535 | 185 |
| 2028 | 3300049823 | Ga0501044_0020231 | Ga0501044_0020231_1413_1991 | 185 |
| 2029 | 3300049823 | Ga0501044_0031213 | Ga0501044_0031213_3937_4494 | 185 |
| 2030 | 3300049823 | Ga0501044_0032766 | Ga0501044_0032766_3997_4554 | 185 |
| 2031 | 3300049823 | Ga0501044_0049026 | Ga0501044_0049026_3761_4330 | 185 |
| 2032 | 3300049823 | Ga0501044_0073302 | Ga0501044_0073302_1548_2105 | 185 |
| 2033 | 3300049823 | Ga0501044_0083450 | Ga0501044_0083450_1331_1909 | 185 |
| 2034 | 3300049823 | Ga0501044_0211824 | Ga0501044_0211824_851_1408 | 185 |
| 2035 | 3300049823 | Ga0501044_0229990 | Ga0501044_0229990_608_1165 | 185 |
| 2036 | 3300049823 | Ga0501044_0359888 | Ga0501044_0359888_168_725 | 185 |
| 2037 | 3300049823 | Ga0501044_0964401 | Ga0501044_0964401_43_600 | 185 |
| 2038 | 3300049824 | Ga0501045_0024565 | Ga0501045_0024565_2054_2611 | 185 |
| 2039 | 3300049824 | Ga0501045_0176570 | Ga0501045_0176570_439_996 | 185 |
| 2040 | 3300050489 | nmdc:mga03683_59901_c1 | nmdc:mga03683_59901_c1_367_924 | 185 |
| 2041 | 3300050490 | nmdc:mga03n38_168036_c1 | nmdc:mga03n38_168036_c1_198_755 | 185 |
| 2042 | 3300050490 | nmdc:mga03n38_2162_c1 | nmdc:mga03n38_2162_c1_3431_3988 | 185 |
| 2043 | 3300050490 | nmdc:mga03n38_71667_c1 | nmdc:mga03n38_71667_c1_106_777 | 185 |
| 2044 | 3300050490 | nmdc:mga03n38_98276_c1 | nmdc:mga03n38_98276_c1_835_1392 | 185 |
| 2045 | 3300050491 | nmdc:mga00v17_13_c1 | nmdc:mga00v17_13_c1_977_1534 | 185 |
| 2046 | 3300050491 | nmdc:mga00v17_268670_c1 | nmdc:mga00v17_268670_c1_193_864 | 185 |
| 2047 | 3300050491 | nmdc:mga00v17_27_c2 | nmdc:mga00v17_27_c2_5934_6491 | 185 |
| 2048 | 3300050491 | nmdc:mga00v17_50366_c1 | nmdc:mga00v17_50366_c1_1367_1924 | 185 |
| 2049 | 3300050491 | nmdc:mga00v17_70873_c1 | nmdc:mga00v17_70873_c1_364_924 | 185 |
| 2050 | 3300050492 | nmdc:mga0yw44_147119_c1 | nmdc:mga0yw44_147119_c1_752_1309 | 185 |
| 2051 | 3300050492 | nmdc:mga0yw44_19066_c1 | nmdc:mga0yw44_19066_c1_2327_2884 | 185 |
| 2052 | 3300050492 | nmdc:mga0yw44_3221_c1 | nmdc:mga0yw44_3221_c1_3624_4181 | 185 |
| 2053 | 3300050492 | nmdc:mga0yw44_44476_c1 | nmdc:mga0yw44_44476_c1_355_912 | 185 |
| 2054 | 3300050492 | nmdc:mga0yw44_76857_c1 | nmdc:mga0yw44_76857_c1_748_1305 | 185 |
| 2055 | 3300050493 | nmdc:mga0k408_134222_c2 | nmdc:mga0k408_134222_c2_346_903 | 185 |
| 2056 | 3300050493 | nmdc:mga0k408_4447_c1 | nmdc:mga0k408_4447_c1_548_1105 | 185 |
| 2057 | 3300050494 | nmdc:mga06z11_1915_c1 | nmdc:mga06z11_1915_c1_1768_2325 | 185 |
| 2058 | 3300050494 | nmdc:mga06z11_206948_c1 | nmdc:mga06z11_206948_c1_572_1129 | 185 |
| 2059 | 3300050494 | nmdc:mga06z11_272774_c1 | nmdc:mga06z11_272774_c1_183_740 | 185 |
| 2060 | 3300050494 | nmdc:mga06z11_326017_c1 | nmdc:mga06z11_326017_c1_199_870 | 185 |
| 2061 | 3300050494 | nmdc:mga06z11_43138_c1 | nmdc:mga06z11_43138_c1_1107_1664 | 185 |
| 2062 | 3300050494 | nmdc:mga06z11_597420_c1 | nmdc:mga06z11_597420_c1_57_614 | 185 |
| 2063 | 3300050494 | nmdc:mga06z11_82691_c1 | nmdc:mga06z11_82691_c1_361_918 | 185 |
| 2064 | 3300050495 | nmdc:mga04h51_161881_c1 | nmdc:mga04h51_161881_c1_150_821 | 185 |
| 2065 | 3300050496 | nmdc:mga07m45_145356_c1 | nmdc:mga07m45_145356_c1_401_958 | 185 |
| 2066 | 3300050496 | nmdc:mga07m45_26378_c1 | nmdc:mga07m45_26378_c1_1626_2183 | 185 |
| 2067 | 3300050496 | nmdc:mga07m45_353596_c1 | nmdc:mga07m45_353596_c1_132_803 | 185 |
| 2068 | 3300050516 | nmdc:mga0sz30_144_c1 | nmdc:mga0sz30_144_c1_7086_7643 | 185 |
| 2069 | 3300050516 | nmdc:mga0sz30_16819_c1 | nmdc:mga0sz30_16819_c1_1595_2152 | 185 |
| 2070 | 3300050516 | nmdc:mga0sz30_3454_c1 | nmdc:mga0sz30_3454_c1_4439_4996 | 185 |
| 2071 | 3300050516 | nmdc:mga0sz30_72679_c2 | nmdc:mga0sz30_72679_c2_12_569 | 185 |
| 2072 | 3300053079 | Ga0500610_0019125 | Ga0500610_0019125_2693_3250 | 185 |
| 2073 | 3300053085 | Ga0495619_0643357 | Ga0495619_0643357_133_690 | 185 |
| 2074 | 3300053087 | Ga0500643_023639 | Ga0500643_023639_667_1224 | 185 |
| 2075 | 3300053088 | Ga0500644_0004259 | Ga0500644_0004259_1799_2359 | 185 |
| 2076 | 3300053088 | Ga0500644_0104460 | Ga0500644_0104460_25_582 | 185 |
| 2077 | 3300053093 | Ga0500651_0004289 | Ga0500651_0004289_2582_3142 | 185 |
| 2078 | 3300053093 | Ga0500651_0043132 | Ga0500651_0043132_1230_1790 | 185 |
| 2079 | 3300053118 | Ga0500594_0001379 | Ga0500594_0001379_82_639 | 185 |
| 2080 | 3300053119 | Ga0500595_104570 | Ga0500595_104570_177_734 | 185 |
| 2081 | 3300053134 | Ga0500658_0000770 | Ga0500658_0000770_7702_8259 | 185 |
| 2082 | 3300053137 | Ga0500561_0000316 | Ga0500561_0000316_3351_3908 | 185 |
| 2083 | 3300053139 | Ga0500568_0000232 | Ga0500568_0000232_31531_32103 | 185 |
| 2084 | 3300053139 | Ga0500568_0002531 | Ga0500568_0002531_2214_2771 | 185 |
| 2085 | 3300053139 | Ga0500568_0004124 | Ga0500568_0004124_3790_4347 | 185 |
| 2086 | 3300053140 | Ga0500573_0114773 | Ga0500573_0114773_52_612 | 185 |
| 2087 | 3300053151 | Ga0500604_0027954 | Ga0500604_0027954_381_938 | 185 |
| 2088 | 3300053153 | Ga0500616_0002417 | Ga0500616_0002417_9364_9921 | 185 |
| 2089 | 3300053153 | Ga0500616_0003618 | Ga0500616_0003618_2134_2691 | 185 |
| 2090 | 3300053153 | Ga0500616_0016515 | Ga0500616_0016515_1509_2066 | 185 |
| 2091 | 3300053153 | Ga0500616_0040621 | Ga0500616_0040621_1250_1807 | 185 |
| 2092 | 3300053156 | Ga0500622_0001821 | Ga0500622_0001821_7871_8428 | 185 |
| 2093 | 3300053157 | Ga0500624_000169 | Ga0500624_000169_17439_17996 | 185 |
| 2094 | 3300053158 | Ga0500627_0067430 | Ga0500627_0067430_973_1530 | 185 |
| 2095 | 3300053160 | Ga0500633_0001269 | Ga0500633_0001269_93_650 | 185 |
| 2096 | 3300054114 | Ga0501084_0011010 | Ga0501084_0011010_4011_4568 | 185 |
| 2097 | 3300054114 | Ga0501084_0126094 | Ga0501084_0126094_871_1428 | 185 |
| 2098 | 3300054114 | Ga0501084_0296332 | Ga0501084_0296332_659_1216 | 185 |
| 2099 | 3300054114 | Ga0501084_0419458 | Ga0501084_0419458_478_1035 | 185 |
| 2100 | 3300054114 | Ga0501084_0450168 | Ga0501084_0450168_41_598 | 185 |
| 2101 | 3300054114 | Ga0501084_0822704 | Ga0501084_0822704_84_641 | 185 |
| 2102 | 3300054114 | Ga0501084_0840652 | Ga0501084_0840652_55_612 | 185 |
| 2103 | 3300054114 | Ga0501084_0847638 | Ga0501084_0847638_193_750 | 185 |
| 2104 | 3300059510 | Ga0587090_026817 | Ga0587090_026817_121_678 | 185 |
| 2105 | 3300059639 | Ga0587062_021177 | Ga0587062_021177_100_657 | 185 |
| 2106 | 3300059641 | Ga0587068_007676 | Ga0587068_007676_738_1295 | 185 |
| 2107 | 3300059643 | Ga0587072_001125 | Ga0587072_001125_1752_2309 | 185 |
| 2108 | 3300060353 | Ga0501082_0001935 | Ga0501082_0001935_2395_2955 | 185 |
| 2109 | 3300060353 | Ga0501082_0008096 | Ga0501082_0008096_6018_6575 | 185 |
| 2110 | 3300060353 | Ga0501082_0012643 | Ga0501082_0012643_5783_6361 | 185 |
| 2111 | 3300060353 | Ga0501082_0025508 | Ga0501082_0025508_2878_3435 | 185 |
| 2112 | 3300060353 | Ga0501082_0050904 | Ga0501082_0050904_1384_1941 | 185 |
| 2113 | 3300060353 | Ga0501082_0237644 | Ga0501082_0237644_289_867 | 185 |
| 2114 | 3300060353 | Ga0501082_0284231 | Ga0501082_0284231_664_1221 | 185 |
| 2115 | 3300060353 | Ga0501082_0616415 | Ga0501082_0616415_41_598 | 185 |
| 2116 | 3300060353 | Ga0501082_0661721 | Ga0501082_0661721_300_857 | 185 |
| 2117 | 3300060353 | Ga0501082_1193747 | Ga0501082_1193747_33_590 | 185 |
| 2118 | iso_pu_bacteria | 2856320880 | 2856322729 | 185 |
| 2119 | iso_pu_bacteria | 2856349417 | 2856351513 | 185 |
| 2120 | iso_pu_bacteria | 2856356410 | 2856356981 | 185 |
| 2121 | iso_pu_bacteria | 2871488783 | 2871489952 | 185 |
| 2122 | iso_pu_bacteria | 2878753008 | 2878754482 | 185 |
| 2123 | iso_pu_bacteria | 2881845957 | 2881847390 | 185 |
| 2124 | iso_pu_bacteria | 2881853255 | 2881856121 | 185 |
| 2125 | iso_pu_bacteria | 2881861095 | 2881864936 | 185 |
| 2126 | iso_pu_bacteria | 2882912400 | 2882913161 | 185 |
| 2127 | iso_pu_bacteria | 2885318864 | 2885318952 | 185 |
| 2128 | iso_pu_bacteria | 2885342637 | 2885350019 | 185 |
| 2129 | iso_pu_bacteria | 2885350715 | 2885354958 | 185 |
| 2130 | iso_pu_bacteria | 2903492973 | 2903497687 | 185 |
| 2131 | iso_pu_bacteria | 2924718760 | 2924720507 | 185 |
| 2132 | iso_pu_bacteria | 2924784321 | 2924790130 | 185 |
| 2133 | iso_pu_bacteria | 2961127735 | 2961134757 | 185 |
| 2134 | iso_pu_bacteria | 2961170736 | 2961171912 | 185 |
| 2135 | iso_pu_bacteria | 2967996073 | 2967997019 | 185 |
| 2136 | iso_pu_bacteria | 2968003550 | 2968005080 | 185 |
| 2137 | iso_pu_bacteria | 2970503327 | 2970504510 | 185 |
| 2138 | iso_pu_bacteria | 2977821940 | 2977823699 | 185 |
| 2139 | iso_pu_bacteria | 2977828996 | 2977833145 | 185 |
| 2140 | iso_pu_bacteria | 2977864932 | 2977866787 | 185 |
| 2141 | iso_pu_bacteria | 2979808191 | 2979809147 | 185 |
| 2142 | iso_pu_bacteria | 3002141150 | 3002141193 | 185 |
| 2143 | iso_pu_bacteria | 8004374579 | 8004376058 | 185 |
| 2144 | iso_pu_bacteria | 8055617313 | 8055618890 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8f43-assembly1.cif.gz_A | hnh nuclease domain from g. stearothermophilus cas9, k597a mutant | 0.8227 | 83 | 141 |
| 6j9n-assembly1.cif.gz_A | nmehnh+acriic3 | 0.8016 | 83 | 141 |
| 5vgb-assembly1.cif.gz_A | crystal structure of nmecas9 hnh domain bound to anti-crispr acriic1 | 0.7897 | 83 | 141 |
| 7ovb-assembly1.cif.gz_C | l. pneumophila type iv coupling complex (t4cc) with density for doty n-terminal and middle domains | 0.7719 | 86 | 129 |
| 4h9d-assembly1.cif.gz_A | crystal structure of mn-dependent gme hnh nicking endonuclease from geobacter metallireducens gs-15, northeast structural genomics consortium (nesg) target gmr87 | 0.7481 | 85 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8LMG0_22_125_1.10.30.50 | Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; | 0.9619 | 103 | 136 | 1.10.30.50 |
| af_I1MTW9_33_119_1.10.30.50 | Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; | 0.9568 | 103 | 137 | 1.10.30.50 |
| af_P71806_355_434_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8595 | 86 | 133 | 2.30.29.30 |
| 2qgpB00 | Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; | 0.7334 | 89 | 142 | 1.10.30.50 |
| af_I1MTU7_87_181_1.10.30.50 | Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; | 0.727 | 105 | 160 | 1.10.30.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1HRD6-F1-model_v4 | deleted | 0.9876 | 86 | 142 |
|
| AF-A0A355QQL5-F1-model_v4 | deleted | 0.9779 | 80 | 185 |
|
| AF-A0A3D2L8Y0-F1-model_v4 | HNH endonuclease | 0.9682 | 74 | 152 |
GO:0004519
|
| AF-A0A2H1HV63-F1-model_v4 | HNH endonuclease | 0.961 | 78 | 159 |
GO:0004519
|
| AF-A0A355QQL5-F1-model_v4 | deleted | 0.9602 | 80 | 185 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar