F496343

General Info

Members Datasets Scaffolds Average Seq Length
2068 1325 1177 362

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1003871|Ga0055524_10038714
Length 433
Sequence MMARWIQFEVRRRALTLSHASAYRFSDDSVGRVSKYYGAASPGAGKLRCNTLNCCIIVQETFGERSLMLIWLVELADHFQFFNLFRYITFRTGAALFTSAMIVFLFGPAMIASLRIRQGKGQPIRADGPQTHFKKAGTPTMGGLMILAGIVVSSLLWADLSSVYVVSTLLVTLGFGAIGFYDDYLKVTKQSDKGFSGKARLGIEFVIAAIAVFFMMQASLSGGPSGSTFGSSVTFPFFKDLIVNLGYFFVLFGGFVIVGAGNAVNLTDGLDGLAIVPVMIAAAAFGLIAYLAGNAVFANYLQIHFVPGTGELAVILGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTVAVAVKHEIVMIIIGGLFVMETLSVIIQVFWFKRTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIIAVILAMVGLSTLKLR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
6 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
7 2509276019 Ensifer aridi TW10 Isolate Nodule
8 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
9 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
13 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
14 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
15 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
16 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
17 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
18 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
19 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
20 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
21 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
22 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
23 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
24 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
25 2512875024 Mesorhizobium loti R88b Isolate Nodule
26 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
27 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
28 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
29 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
30 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
31 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
32 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
33 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
34 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
35 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
36 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
37 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
38 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
39 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
40 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
41 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
42 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
43 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
44 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
45 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
46 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
47 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
48 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
49 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
50 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
51 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
52 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
53 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
54 2516143018 Ensifer sp. BR816 Isolate Nodule
55 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
56 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
57 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
58 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
59 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
60 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
61 2519899620 Rhizobium sp. Pop5 Isolate Nodule
62 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
63 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
64 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
65 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
66 2534681786 Brucella suis 92/29 Isolate Unclassified
67 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
68 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
69 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
70 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
71 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
72 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
73 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
74 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
75 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
76 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
77 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
78 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
79 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
80 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
81 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
82 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
83 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
84 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
85 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
86 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
87 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
88 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
89 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
90 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
91 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
92 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
93 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
94 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
95 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
96 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
97 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
98 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
99 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
100 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
101 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
102 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
103 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
104 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
105 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
106 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
107 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
108 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
109 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
110 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
111 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
112 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
113 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
114 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
115 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
116 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
117 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
118 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
119 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
120 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
121 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
122 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
123 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
124 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
125 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
126 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
127 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
128 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
129 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
130 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
131 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
132 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
133 2643221557 Ensifer sp. Root558 Isolate Unclassified
134 2643221558 Rhizobium sp. Root149 Isolate Unclassified
135 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
136 2643221568 Rhizobium sp. Root564 Isolate Unclassified
137 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
138 2643221582 Rhizobium sp. Root651 Isolate Unclassified
139 2643221583 Caulobacter sp. Root655 Isolate Unclassified
140 2643221584 Caulobacter sp. Root656 Isolate Unclassified
141 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
142 2643221599 Rhizobium sp. Root708 Isolate Unclassified
143 2643221607 Rhizobium sp. Root73 Isolate Unclassified
144 2643221610 Ensifer sp. Root74 Isolate Unclassified
145 2643221618 Ensifer sp. Root231 Isolate Unclassified
146 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
147 2643221626 Ensifer sp. Root31 Isolate Unclassified
148 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
149 2643221629 Devosia sp. Root105 Isolate Unclassified
150 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
151 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
152 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
153 2643221640 Caulobacter sp. Root342 Isolate Unclassified
154 2643221642 Caulobacter sp. Root343 Isolate Unclassified
155 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
156 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
157 2643221655 Ensifer sp. Root1252 Isolate Unclassified
158 2643221659 Ensifer sp. Root127 Isolate Unclassified
159 2643221662 Devosia sp. Root413D1 Isolate Unclassified
160 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
161 2643221668 Ensifer sp. Root423 Isolate Unclassified
162 2643221674 Devosia sp. Root436 Isolate Unclassified
163 2643221675 Ensifer sp. Root1298 Isolate Unclassified
164 2643221680 Ensifer sp. Root1312 Isolate Unclassified
165 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
166 2643221688 Rhizobium sp. Root482 Isolate Unclassified
167 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
168 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
169 2643221693 Rhizobium sp. Root491 Isolate Unclassified
170 2643221698 Ensifer sp. Root142 Isolate Unclassified
171 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
172 2643221712 Ensifer sp. Root258 Isolate Unclassified
173 2643221718 Rhizobium sp. Root268 Isolate Unclassified
174 2643221719 Rhizobium sp. Root274 Isolate Unclassified
175 2643221723 Ensifer sp. Root278 Isolate Unclassified
176 2643221726 Ensifer sp. Root954 Isolate Unclassified
177 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
178 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
179 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
180 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
181 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
182 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
183 2718217882 Rhizobium sp. N741 Isolate Nodule
184 2718217927 Rhizobium sp. N324 Isolate Nodule
185 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
186 2718218009 Rhizobium sp. N561 Isolate Nodule
187 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
188 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
189 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
190 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
191 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
192 2718218363 Rhizobium sp. N113 Isolate Nodule
193 2718218365 Rhizobium sp. N731 Isolate Nodule
194 2718218366 Rhizobium sp. N621 Isolate Nodule
195 2718218423 Rhizobium sp. N941 Isolate Nodule
196 2721755514 Rhizobium sp. N6212 Isolate Nodule
197 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
198 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
199 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
200 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
201 2721755809 Rhizobium sp. N541 Isolate Nodule
202 2721755810 Rhizobium sp. N871 Isolate Nodule
203 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
204 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
205 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
206 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
207 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
208 2728369365 Rhizobium sp. N1341 Isolate Nodule
209 2728369397 Rhizobium sp. N1314 Isolate Nodule
210 2738541293 Rhizobium sp. GV031 Isolate Unclassified
211 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
212 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
213 2738543024 Aminobacter sp. AP02 Isolate Unclassified
214 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
215 2751185800 Brucella pituitosa AA2 Isolate Unclassified
216 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
217 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
218 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
219 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
220 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
221 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
222 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
223 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
224 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
225 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
226 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
227 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
228 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
229 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
230 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
231 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
232 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
233 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
234 2791355256 Rhizobium sp. M10 Isolate Nodule
235 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
236 2791355260 Rhizobium sp. L9 Isolate Nodule
237 2791355261 Rhizobium sp. J15 Isolate Nodule
238 2791355262 Rhizobium sp. M1 Isolate Nodule
239 2791355263 Rhizobium chutanense C5 Isolate Nodule
240 2791355264 Rhizobium sp. S9 Isolate Nodule
241 2791355265 Rhizobium sp. H4 Isolate Nodule
242 2791355266 Rhizobium sp. L43 Isolate Nodule
243 2791355267 Rhizobium sp. L18 Isolate Nodule
244 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
245 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
246 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
247 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
248 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
249 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
250 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
251 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
252 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
253 2802429633 Rhizobium anhuiense J3 Isolate Nodule
254 2802429634 Rhizobium anhuiense S10 Isolate Nodule
255 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
256 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
257 2802429637 Rhizobium anhuiense C15 Isolate Nodule
258 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
259 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
260 2818991435 Caulobacter henricii 536 Isolate Unclassified
261 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
262 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
263 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
264 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
265 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
266 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
267 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
268 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
269 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
270 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
271 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
272 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
273 2838048938 Rhizobium pisi 27/80 Isolate Nodule
274 2838061910 Rhizobium phaseoli L15 Isolate Nodule
275 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
276 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
277 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
278 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
279 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
280 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
281 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
282 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
283 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
284 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
285 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
286 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
287 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
288 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
289 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
290 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
291 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
292 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
293 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
294 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
295 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
296 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
297 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
298 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
299 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
300 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
301 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
302 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
303 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
304 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
305 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
306 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
307 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
308 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
309 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
310 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
311 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
312 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
313 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
314 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
315 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
316 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
317 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
318 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
319 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
320 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
321 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
322 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
323 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
324 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
325 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
326 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
327 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
328 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
329 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
330 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
331 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
332 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
333 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
334 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
335 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
336 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
337 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
338 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
339 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
340 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
341 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
342 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
343 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
344 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
345 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
346 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
347 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
348 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
349 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
350 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
351 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
352 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
353 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
354 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
355 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
356 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
357 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
358 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
359 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
360 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
361 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
362 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
363 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
364 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
365 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
366 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
367 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
368 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
369 2849560528 Caulobacter zeae 410 Isolate Unclassified
370 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
371 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
372 2851153111 Caulobacter radicis 736 Isolate Unclassified
373 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
374 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
375 2854911287 Brucella lupini LUP21 Isolate Unclassified
376 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
377 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
378 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
379 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
380 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
381 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
382 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
383 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
384 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
385 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
386 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
387 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
388 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
389 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
390 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
391 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
392 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
393 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
394 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
395 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
396 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
397 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
398 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
399 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
400 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
401 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
402 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
403 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
404 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
405 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
406 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
407 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
408 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
409 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
410 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
411 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
412 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
413 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
414 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
415 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
416 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
417 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
418 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
419 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
420 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
421 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
422 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
423 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
424 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
425 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
426 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
427 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
428 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
429 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
430 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
431 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
432 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
433 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
434 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
435 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
436 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
437 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
438 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
439 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
440 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
441 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
442 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
443 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
444 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
445 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
446 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
447 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
448 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
449 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
450 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
451 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
452 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
453 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
454 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
455 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
456 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
457 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
458 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
459 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
460 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
461 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
462 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
463 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
464 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
465 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
466 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
467 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
468 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
469 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
470 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
471 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
472 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
473 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
474 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
475 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
476 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
477 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
478 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
479 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
480 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
481 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
482 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
483 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
484 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
485 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
486 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
487 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
488 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
489 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
490 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
491 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
492 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
493 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
494 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
495 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
496 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
497 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
498 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
499 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
500 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
501 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
502 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
503 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
504 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
505 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
506 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
507 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
508 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
509 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
510 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
511 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
512 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
513 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
514 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
515 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
516 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
517 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
518 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
519 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
520 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
521 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
522 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
523 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
524 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
525 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
526 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
527 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
528 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
529 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
530 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
531 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
532 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
533 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
534 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
535 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
536 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
537 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
538 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
539 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
540 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
541 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
542 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
543 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
544 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
545 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
546 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
547 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
548 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
549 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
550 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
551 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
552 2932401849 Devosia sp. 2618 Isolate Rhizosphere
553 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
554 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
555 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
556 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
557 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
558 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
559 2933599457 Rhizobium phaseoli M3 Isolate Nodule
560 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
561 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
562 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
563 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
564 2936381700 Rhizobium chutanense C16 Isolate Unclassified
565 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
566 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
567 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
568 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
569 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
570 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
571 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
572 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
573 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
574 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
575 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
576 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
577 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
578 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
579 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
580 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
581 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
582 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
583 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
584 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
585 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
586 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
587 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
588 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
589 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
590 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
591 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
592 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
593 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
594 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
595 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
596 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
597 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
598 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
599 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
600 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
601 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
602 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
603 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
604 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
605 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
606 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
607 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
608 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
609 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
610 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
611 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
612 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
613 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
614 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
615 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
616 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
617 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
618 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
619 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
620 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
621 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
622 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
623 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
624 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
625 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
626 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
627 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
628 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
629 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
630 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
631 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
632 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
633 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
634 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
635 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
636 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
637 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
638 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
639 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
640 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
641 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
642 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
643 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
644 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
645 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
646 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
647 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
648 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
649 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
650 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
651 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
652 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
653 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
654 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
655 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
656 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
657 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
658 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
659 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
660 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
661 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
662 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
663 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
664 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
665 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
666 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
667 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
668 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
669 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
670 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
671 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
672 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
673 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
674 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
675 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
676 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
677 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
678 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
679 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
680 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
681 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
682 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
683 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
684 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
685 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
686 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
687 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
688 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
689 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
690 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
691 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
692 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
693 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
694 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
695 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
696 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
697 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
698 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
699 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
700 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
701 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
702 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
703 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
704 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
705 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
706 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
707 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
708 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
709 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
710 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
711 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
712 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
713 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
714 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
715 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
716 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
717 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
718 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
719 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
720 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
721 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
722 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
723 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
724 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
725 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
726 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
727 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
728 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
729 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
730 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
731 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
732 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
733 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
734 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
735 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
736 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
737 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
738 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
739 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
740 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
741 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
742 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
743 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
744 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
745 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
746 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
747 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
748 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
749 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
750 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
751 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
752 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
753 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
754 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
755 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
756 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
757 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
758 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
759 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
760 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
761 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
762 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
763 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
764 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
765 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
766 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
767 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
768 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
769 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
770 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
771 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
772 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
773 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
774 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
775 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
776 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
777 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
778 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
779 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
780 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
781 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
782 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
783 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
784 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
785 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
786 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
787 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
788 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
789 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
790 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
791 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
792 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
793 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
794 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
795 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
796 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
797 2996887358 Rhizobium sp. R711 Isolate Nodule
798 2996893221 Rhizobium sp. R635 Isolate Nodule
799 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
800 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
801 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
802 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
803 3004167301 Mesorhizobium loti 582 Isolate Unclassified
804 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
805 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
806 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
807 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
808 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
809 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
810 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
811 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
812 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
813 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
814 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
815 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
816 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
817 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
818 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
819 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
820 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
821 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
822 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
823 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
824 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
825 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
826 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
827 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
828 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
829 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
830 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
831 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
832 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
833 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
834 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
835 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
836 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
837 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
838 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
839 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
840 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
841 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
842 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
843 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
844 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
845 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
846 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
847 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
848 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
849 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
850 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
851 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
852 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
853 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
854 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
855 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
856 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
857 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
858 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
859 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
860 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
861 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
862 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
863 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
864 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
865 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
866 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
867 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
868 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
869 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
870 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
871 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
872 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
873 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
874 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
875 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
876 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
877 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
878 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
879 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
880 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
881 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
882 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
883 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
884 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
885 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
886 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
887 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
888 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
889 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
890 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
891 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
892 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
893 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
894 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
895 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
896 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
897 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
898 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
899 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
900 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
901 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
902 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
903 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
904 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
905 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
906 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
907 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
908 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
909 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
910 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
911 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
912 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
913 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
914 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
915 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
916 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
917 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
918 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
919 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
920 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
921 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
922 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
923 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
924 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
925 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
926 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
927 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
928 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
929 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
930 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
931 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
932 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
933 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
934 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
935 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
936 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
937 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
938 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
939 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
940 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
941 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
942 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
943 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
944 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
945 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
946 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
947 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
948 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
949 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
950 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
951 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
952 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
953 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
954 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
955 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
956 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
957 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
958 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
959 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
960 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
961 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
962 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
963 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
964 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
965 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
966 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
967 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
968 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
969 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
970 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
971 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
972 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
973 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
974 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
975 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
976 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
977 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
978 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
979 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
980 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
981 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
982 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
983 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
984 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
985 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
986 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
987 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
988 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
989 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
990 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
991 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
992 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
993 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
994 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
995 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
996 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
997 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
998 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
999 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1000 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1001 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1002 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1003 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1004 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1005 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1006 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1007 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1008 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1009 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1010 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1011 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1012 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1013 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1014 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1015 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1016 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1017 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1018 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1019 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1020 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1021 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1022 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1023 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1024 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1025 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1026 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1027 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1028 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1029 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1030 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1031 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1032 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1033 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
1034 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1035 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1036 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1037 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1038 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
1039 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
1040 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
1041 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
1042 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
1043 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
1044 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
1045 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1046 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1047 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
1048 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1049 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1050 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1051 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1052 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
1053 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
1054 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1055 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
1056 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1057 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
1058 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1059 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1060 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1061 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1062 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1063 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1064 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1065 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1066 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1067 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1068 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1069 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1070 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1071 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1072 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1073 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1074 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1075 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1076 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1077 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1078 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1079 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1080 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1081 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1082 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1083 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1084 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1085 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1086 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1087 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1088 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1089 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1090 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
1091 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1092 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1093 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1094 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1095 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
1096 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
1097 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
1098 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
1099 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
1100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
1101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
1109 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
1110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1194 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
1195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1218 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1219 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1221 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1224 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
1225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1226 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1228 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1229 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1230 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
1231 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1232 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
1233 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1236 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1237 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
1238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1239 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1240 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1241 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1242 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1244 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1245 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1246 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1247 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1248 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1249 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1252 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1255 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1256 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1257 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1258 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
1259 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1260 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1261 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1262 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1263 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1264 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1265 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1266 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1267 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1268 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1269 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1270 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1271 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1272 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1273 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1274 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1275 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1276 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1277 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1278 8005258706 Rhizobium sp. R693 Isolate Nodule
1279 8005275841 Rhizobium sp. N4311 Isolate Nodule
1280 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1281 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1282 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1283 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1284 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1285 8005321885 Rhizobium sp. R72 Isolate Nodule
1286 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1287 8005382845 Rhizobium sp. R634 Isolate Nodule
1288 8005395548 Rhizobium sp. R339 Isolate Nodule
1289 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1290 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1291 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1292 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1293 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1294 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1295 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1296 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1297 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1298 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1299 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1300 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1301 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1302 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1303 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1304 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1305 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1306 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1307 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1308 8018176218 Rhizobium sp. N122 Isolate Nodule
1309 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1310 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1311 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1312 8024501048 Rhizobium sp. H4 Isolate Nodule
1313 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1314 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1315 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1316 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1317 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1318 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1319 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1320 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1321 8056382006 Rhizobium croatiense 13T Isolate Nodule
1322 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1323 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
1324 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1325 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.77
Metatranscriptomes 0.15
Isolates 43.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 13.49
Nodule 31.67
Rhizoplane 2.18
Rhizosphere 39.7
Stem 0
Stem Tuber 0.05
Unclassified 12.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1038538 2162886007 Bacteria 2053
2 JGI24741J21665_1004868 3300001915 Bacteria 2901
3 JGI24740J21852_10000015 3300001979 Bacteria 58951
4 JGI24744J21845_10016419 3300002077 Bacteria 1474
5 JGI25155J39150_1000001 3300002704 Bacteria 354543
6 JGI25156J39149_1000001 3300002705 Bacteria 354557
7 JGI25162J39368_1000366 3300002737 Bacteria 38535
8 JGI25162J39368_1000368 3300002737 Bacteria 38495
9 JGI25154J39366_1000122 3300002738 Bacteria 61892
10 JGI25158J39367_1000038 3300002739 Bacteria 30017
11 JGI25158J39367_1005327 3300002739 Bacteria 1889
12 JGI25157J39369_1000044 3300002741 Bacteria 122466
13 JGI25157J39369_1000787 3300002741 Bacteria 16220
14 JGI25152J39213_1000636 3300002773 Bacteria 18557
15 JGI25152J39213_1002957 3300002773 Bacteria 6047
16 JGI25152J39213_1003042 3300002773 Bacteria 5913
17 JGI25152J39213_1005715 3300002773 Bacteria 3555
18 JGI25150J39212_1000107 3300002774 Bacteria 48306
19 JGI25150J39212_1003012 3300002774 Bacteria 4051
20 JGI25159J45721_1000014 3300002987 Bacteria 147809
21 JGI25159J45721_1000154 3300002987 Bacteria 32025
22 JGI25159J45721_1001072 3300002987 Bacteria 11688
23 JGI25151J46595_10000374 3300003187 Bacteria 46807
24 JGI25151J46595_10000839 3300003187 Bacteria 24488
25 JGI25151J46595_10006464 3300003187 Bacteria 5894
26 JGI25151J46595_10015704 3300003187 Bacteria 3326
27 JGI25406J46586_10014863 3300003203 Bacteria 3298
28 JGI25165J46597_1000015 3300003214 Bacteria 380891
29 JGI25165J46597_1000516 3300003214 Bacteria 36635
30 JGI25165J46597_1001042 3300003214 Bacteria 18102
31 JGI25165J46597_1009070 3300003214 Bacteria 1518
32 JGI25153J46596_10000696 3300003215 Bacteria 20557
33 JGI25153J46596_10023168 3300003215 Bacteria 2269
34 JGI25153J46596_10023978 3300003215 Bacteria 2208
35 JGI25153J46596_10047584 3300003215 Bacteria 1261
36 rootL2_10006964 3300003322 Bacteria 8628
37 rootL2_10022274 3300003322 Bacteria 9241
38 rootL2_10193157 3300003322 Bacteria 2970
39 JGI25160J50197_1000001 3300003354 Bacteria 782301
40 JGI25160J50197_1000020 3300003354 Bacteria 232739
41 JGI25160J50197_1002863 3300003354 Bacteria 7895
42 JGI25160J50197_1030303 3300003354 Bacteria 1412
43 JGI25161J50226_1000001 3300003374 Bacteria 655036
44 JGI25161J50226_1000174 3300003374 Bacteria 43080
45 JGI25161J50226_1001510 3300003374 Bacteria 6891
46 JGI25161J50226_1002239 3300003374 Bacteria 5099
47 Ga0006562J51391_1023353 3300003578 Bacteria 5757
48 Ga0006562J51391_1043939 3300003578 Bacteria 8126
49 Ga0055542_1001274 3300003762 Bacteria 13605
50 Ga0055526_1000597 3300003771 Bacteria 28415
51 Ga0055526_1001490 3300003771 Bacteria 16607
52 Ga0055526_1003506 3300003771 Bacteria 9921
53 Ga0055526_1003741 3300003771 Bacteria 9498
54 Ga0055537_1001473 3300003773 Bacteria 9134
55 Ga0055524_1003871 3300003775 Bacteria 7099
56 Ga0055524_1004279 3300003775 Bacteria 6626
57 Ga0055524_1005006 3300003775 Bacteria 6000
58 Ga0055524_1007099 3300003775 Bacteria 4798
59 Ga0055524_1014345 3300003775 Bacteria 2941
60 Ga0055536_1001187 3300003781 Bacteria 16224
61 Ga0055536_1001275 3300003781 Bacteria 15519
62 Ga0055536_1005415 3300003781 Bacteria 6250
63 Ga0055536_1012576 3300003781 Bacteria 3127
64 Ga0055528_1001199 3300003790 Bacteria 16717
65 Ga0055528_1001734 3300003790 Bacteria 12611
66 Ga0055528_1002830 3300003790 Bacteria 9076
67 Ga0055528_1005558 3300003790 Bacteria 5838
68 Ga0055528_1005775 3300003790 Bacteria 5695
69 Ga0055528_1018688 3300003790 Bacteria 2338
70 Ga0055530_10003980 3300003791 Bacteria 7975
71 Ga0055530_10009807 3300003791 Bacteria 3621
72 Ga0055540_1000929 3300003792 Bacteria 19079
73 Ga0055540_1016839 3300003792 Bacteria 2060
74 Ga0055531_10002881 3300003794 Bacteria 11207
75 Ga0055531_10008539 3300003794 Bacteria 5378
76 Ga0055531_10010959 3300003794 Bacteria 4436
77 Ga0055531_10023750 3300003794 Bacteria 2287
78 Ga0055531_10036493 3300003794 Bacteria 1515
79 Ga0055543_1000003 3300004625 Bacteria 358656
80 Ga0055543_1000047 3300004625 Bacteria 111073
81 Ga0055543_1000500 3300004625 Bacteria 22620
82 Ga0055543_1001281 3300004625 Bacteria 10341
83 Ga0065165_1000013 3300005262 Bacteria 301887
84 Ga0065165_1000068 3300005262 Bacteria 170609
85 Ga0065165_1003894 3300005262 Bacteria 9877
86 Ga0065704_10008543 3300005289 Bacteria 2475
87 Ga0070658_10049567 3300005327 Bacteria 3402
88 Ga0070676_10023523 3300005328 Bacteria 3463
89 Ga0070676_10038717 3300005328 Bacteria 2755
90 Ga0070683_100005576 3300005329 Bacteria 10508
91 Ga0070690_100100785 3300005330 Bacteria 1915
92 Ga0070670_100002993 3300005331 Bacteria 13983
93 Ga0070670_100003032 3300005331 Bacteria 13894
94 Ga0070670_100028366 3300005331 Bacteria 4817
95 Ga0068869_100264930 3300005334 Bacteria 1377
96 Ga0068868_100023793 3300005338 Bacteria 4639
97 Ga0068868_100055855 3300005338 Bacteria 3117
98 Ga0070660_100095702 3300005339 Bacteria 2347
99 Ga0070660_100163494 3300005339 Bacteria 1794
100 Ga0070689_100047479 3300005340 Bacteria 3311
101 Ga0070687_100005675 3300005343 Bacteria 5064
102 Ga0070661_100008418 3300005344 Bacteria 7131
103 Ga0070668_100002911 3300005347 Bacteria 12649
104 Ga0070668_100010616 3300005347 Bacteria 6849
105 Ga0070668_100012891 3300005347 Bacteria 6225
106 Ga0070668_100078199 3300005347 Bacteria 2587
107 Ga0070668_100168933 3300005347 Bacteria 1779
108 Ga0070675_100014504 3300005354 Bacteria 6215
109 Ga0070675_100054361 3300005354 Bacteria 3294
110 Ga0070675_100068867 3300005354 Bacteria 2931
111 Ga0070671_100033702 3300005355 Bacteria 4238
112 Ga0070674_100001105 3300005356 Bacteria 14135
113 Ga0070674_100016809 3300005356 Bacteria 4590
114 Ga0070674_100065860 3300005356 Bacteria 2544
115 Ga0070673_100002651 3300005364 Bacteria 10946
116 Ga0070688_100028395 3300005365 Bacteria 3339
117 Ga0070667_100267968 3300005367 Bacteria 1531
118 Ga0070667_100303778 3300005367 Bacteria 1437
119 Ga0070713_100001844 3300005436 Bacteria 13670
120 Ga0070705_100098636 3300005440 Bacteria 1839
121 Ga0070694_100142608 3300005444 Bacteria 1741
122 Ga0070663_100024934 3300005455 Bacteria 4032
123 Ga0070663_100118538 3300005455 Bacteria 1997
124 Ga0070678_100018307 3300005456 Bacteria 4538
125 Ga0070678_100248634 3300005456 Bacteria 1490
126 Ga0070678_100281065 3300005456 Bacteria 1407
127 Ga0070662_100300083 3300005457 Bacteria 1305
128 Ga0068867_100010186 3300005459 Bacteria 6631
129 Ga0068867_100171488 3300005459 Bacteria 1719
130 Ga0070685_10017126 3300005466 Bacteria 3874
131 Ga0070679_100270265 3300005530 Bacteria 1654
132 Ga0070684_100073099 3300005535 Bacteria 3020
133 Ga0070684_100134470 3300005535 Bacteria 2232
134 Ga0068853_100001593 3300005539 Bacteria 16518
135 Ga0068853_100242359 3300005539 Bacteria 1653
136 Ga0070686_100002414 3300005544 Bacteria 10292
137 Ga0070686_100079093 3300005544 Bacteria 2173
138 Ga0070696_100137933 3300005546 Bacteria 1780
139 Ga0070665_100035316 3300005548 Bacteria 5026
140 Ga0070665_100042535 3300005548 Bacteria 4567
141 Ga0070665_100075267 3300005548 Bacteria 3383
142 Ga0070665_100098125 3300005548 Bacteria 2934
143 Ga0070665_100142921 3300005548 Bacteria 2396
144 Ga0070665_100152121 3300005548 Bacteria 2316
145 Ga0068855_100069226 3300005563 Bacteria 4107
146 Ga0068855_100494933 3300005563 Bacteria 1329
147 Ga0070664_100018666 3300005564 Bacteria 5702
148 Ga0070664_100117821 3300005564 Bacteria 2323
149 Ga0068857_100029006 3300005577 Bacteria 4884
150 Ga0068856_100013130 3300005614 Bacteria 8024
151 Ga0068856_100314614 3300005614 Bacteria 1583
152 Ga0070702_100040085 3300005615 Bacteria 2617
153 Ga0068852_100010318 3300005616 Bacteria 6975
154 Ga0068852_100093576 3300005616 Bacteria 2694
155 Ga0068852_100184323 3300005616 Bacteria 1965
156 Ga0068852_100248618 3300005616 Bacteria 1703
157 Ga0068859_100002560 3300005617 Bacteria 18459
158 Ga0068859_100256800 3300005617 Unclassified 1838
159 Ga0068864_100002913 3300005618 Bacteria 14155
160 Ga0068866_10095286 3300005718 Bacteria 1630
161 Ga0068861_100018208 3300005719 Bacteria 4999
162 Ga0068861_100040524 3300005719 Bacteria 3484
163 Ga0068851_10001703 3300005834 Bacteria 9621
164 Ga0068870_10016476 3300005840 Bacteria 3532
165 Ga0068863_100016803 3300005841 Bacteria 7021
166 Ga0068863_100038880 3300005841 Bacteria 4527
167 Ga0068863_100049068 3300005841 Bacteria 4002
168 Ga0068858_100088823 3300005842 Bacteria 2876
169 Ga0068858_100125185 3300005842 Bacteria 2406
170 Ga0068860_100000183 3300005843 Bacteria 100738
171 Ga0068860_100150648 3300005843 Bacteria 2240
172 Ga0068862_100032639 3300005844 Bacteria 4400
173 Ga0068862_100072962 3300005844 Bacteria 2966
174 Ga0081455_10101948 3300005937 Bacteria 2303
175 Ga0081540_1045519 3300005983 Bacteria 2227
176 Ga0081539_10001091 3300005985 Bacteria 49336
177 Ga0081539_10020691 3300005985 Bacteria 4431
178 Ga0075365_10004585 3300006038 Bacteria 7349
179 Ga0075365_10005814 3300006038 Bacteria 6702
180 Ga0075365_10098168 3300006038 Bacteria 2003
181 Ga0075365_10163928 3300006038 Bacteria 1550
182 Ga0075368_10008483 3300006042 Bacteria 3662
183 Ga0075363_100005871 3300006048 Bacteria 5522
184 Ga0075363_100025123 3300006048 Bacteria 3034
185 Ga0075364_10039752 3300006051 Bacteria 3050
186 Ga0075364_10086268 3300006051 Bacteria 2079
187 Ga0075362_10010664 3300006177 Bacteria 3595
188 Ga0075362_10013866 3300006177 Bacteria 3238
189 Ga0075362_10063214 3300006177 Bacteria 1678
190 Ga0075367_10006519 3300006178 Bacteria 5902
191 Ga0075367_10009312 3300006178 Bacteria 5129
192 Ga0075369_10005462 3300006186 Bacteria 4751
193 Ga0075369_10009967 3300006186 Bacteria 3708
194 Ga0075369_10015627 3300006186 Bacteria 3051
195 Ga0075369_10035613 3300006186 Bacteria 2116
196 Ga0075366_10008655 3300006195 Bacteria 5666
197 Ga0075370_10012603 3300006353 Bacteria 4474
198 Ga0075370_10017996 3300006353 Bacteria 3827
199 Ga0075370_10081836 3300006353 Bacteria 1856
200 Ga0075370_10087140 3300006353 Bacteria 1799
201 Ga0075370_10107335 3300006353 Bacteria 1619
202 Ga0075370_10123037 3300006353 Bacteria 1511
203 Ga0068871_100176497 3300006358 Bacteria 1834
204 Ga0068871_100254352 3300006358 Bacteria 1531
205 Ga0075428_100043000 3300006844 Bacteria 4968
206 Ga0075430_100013382 3300006846 Bacteria 6991
207 Ga0075433_10114709 3300006852 Bacteria 2390
208 Ga0075429_100022586 3300006880 Bacteria 5454
209 Ga0075429_100174417 3300006880 Bacteria 1883
210 Ga0068865_100007748 3300006881 Bacteria 6620
211 Ga0068865_100059929 3300006881 Bacteria 2663
212 Ga0068865_100069159 3300006881 Bacteria 2498
213 Ga0068865_100114373 3300006881 Bacteria 1996
214 Ga0097620_100002560 3300006931 Bacteria 18459
215 Ga0097620_100256807 3300006931 Unclassified 1838
216 Ga0097620_100468647 3300006931 Bacteria 1355
217 Ga0079104_1000193 3300006946 Bacteria 85489
218 Ga0079104_1001253 3300006946 Bacteria 17716
219 Ga0079104_1003360 3300006946 Bacteria 7510
220 Ga0099826_10001254 3300006948 Bacteria 14871
221 Ga0099826_10064039 3300006948 Bacteria 2371
222 Ga0075435_100017580 3300007076 Bacteria 5417
223 Ga0105250_10015698 3300009092 Bacteria 3100
224 Ga0105240_10000041 3300009093 Bacteria 264078
225 Ga0105240_10000076 3300009093 Bacteria 198848
226 Ga0111539_10032300 3300009094 Bacteria 6357
227 Ga0111539_10074239 3300009094 Bacteria 4007
228 Ga0105245_10004544 3300009098 Bacteria 12250
229 Ga0105243_10007500 3300009148 Bacteria 8382
230 Ga0105243_10166001 3300009148 Bacteria 1908
231 Ga0105243_10176018 3300009148 Bacteria 1857
232 Ga0105243_10186964 3300009148 Bacteria 1806
233 Ga0105243_10580402 3300009148 Bacteria 1076
234 Ga0105242_10028628 3300009176 Bacteria 4437
235 Ga0105242_10161244 3300009176 Bacteria 1963
236 Ga0105242_10301588 3300009176 Bacteria 1462
237 Ga0105248_10040139 3300009177 Bacteria 5246
238 Ga0105248_10263764 3300009177 Bacteria 1939
239 Ga0105248_10571246 3300009177 Bacteria 1276
240 Ga0105237_10000226 3300009545 Bacteria 79798
241 Ga0105237_10014016 3300009545 Bacteria 8388
242 Ga0105237_10089906 3300009545 Bacteria 3060
243 Ga0105237_10217388 3300009545 Bacteria 1911
244 Ga0105238_10001971 3300009551 Bacteria 20670
245 Ga0105238_10003533 3300009551 Bacteria 15583
246 Ga0105238_10017174 3300009551 Bacteria 7349
247 Ga0105249_10017238 3300009553 Bacteria 6410
248 Ga0105249_10092252 3300009553 Bacteria 2835
249 Ga0123341_1000007 3300009765 Bacteria 147072
250 Ga0123341_1046896 3300009765 Bacteria 2570
251 Ga0123342_1004784 3300009766 Bacteria 20320
252 Ga0123342_1013992 3300009766 Bacteria 7821
253 Ga0105239_10000641 3300010375 Bacteria 49765
254 Ga0105239_10074698 3300010375 Bacteria 3727
255 Ga0105239_10088268 3300010375 Bacteria 3419
256 Ga0105246_10006723 3300011119 Bacteria 7032
257 Ga0157371_10000017 3300013102 Bacteria 320830
258 Ga0157371_10043374 3300013102 Bacteria 3204
259 Ga0157370_10000455 3300013104 Bacteria 51231
260 Ga0157370_10000461 3300013104 Bacteria 50850
261 Ga0157370_10015013 3300013104 Bacteria 7896
262 Ga0157370_10090223 3300013104 Bacteria 2878
263 Ga0157369_10011166 3300013105 Bacteria 10211
264 Ga0157369_10159016 3300013105 Bacteria 2385
265 Ga0157369_10187316 3300013105 Bacteria 2176
266 Ga0157369_10377473 3300013105 Bacteria 1471
267 Ga0171463_1003 3300013249 Bacteria 695693
268 Ga0157374_10000093 3300013296 Bacteria 84512
269 Ga0157378_10047506 3300013297 Bacteria 3817
270 Ga0157375_10004209 3300013308 Bacteria 12481
271 Ga0157375_10070230 3300013308 Bacteria 3512
272 Ga0157375_10180529 3300013308 Bacteria 2262
273 Ga0157375_10296609 3300013308 Bacteria 1780
274 Ga0157380_10116875 3300014326 Bacteria 2252
275 Ga0157377_10011153 3300014745 Bacteria 4475
276 Ga0157379_10007600 3300014968 Bacteria 9383
277 Ga0157379_10238537 3300014968 Bacteria 1649
278 Ga0157379_10359759 3300014968 Bacteria 1334
279 Ga0157376_10000397 3300014969 Bacteria 28315
280 Ga0182007_10001815 3300015262 Bacteria 11146
281 Ga0182005_1004710 3300015265 Bacteria 4356
282 Ga0183363_1344 3300015690 Bacteria 5568
283 Ga0163161_10006062 3300017792 Bacteria 8380
284 Ga0163161_10164127 3300017792 Bacteria 1695
285 Ga0214544_1001800 3300021320 Bacteria 45046
286 Ga0214542_1000012 3300021321 Bacteria 235800
287 Ga0214543_1000024 3300021327 Bacteria 235745
288 Ga0214543_1000038 3300021327 Bacteria 182106
289 Ga0213876_10012004 3300021384 Unclassified 4615
290 Ga0228711_1000008 3300022739 Bacteria 169893
291 Ga0228710_1000009 3300022740 Bacteria 169770
292 Ga0209435_100012 3300025206 Bacteria 401621
293 Ga0209436_100150 3300025208 Bacteria 33510
294 Ga0209436_101065 3300025208 Bacteria 10387
295 Ga0209436_104522 3300025208 Bacteria 3423
296 Ga0209437_100051 3300025233 Bacteria 392523
297 Ga0209437_100098 3300025233 Bacteria 229766
298 Ga0207425_1000075 3300025245 Bacteria 107452
299 Ga0207425_1002079 3300025245 Bacteria 7430
300 Ga0207425_1019409 3300025245 Bacteria 1463
301 Ga0209646_1000026 3300025246 Bacteria 401621
302 Ga0209026_1000014 3300025250 Bacteria 401621
303 Ga0209026_1000025 3300025250 Bacteria 352548
304 Ga0209677_101925 3300025253 Bacteria 8314
305 Ga0209148_1000128 3300025254 Bacteria 179154
306 Ga0209759_1000012 3300025256 Bacteria 401621
307 Ga0209759_1000121 3300025256 Bacteria 138469
308 Ga0209129_1000156 3300025258 Bacteria 107484
309 Ga0209129_1000218 3300025258 Bacteria 66076
310 Ga0209129_1001767 3300025258 Bacteria 11565
311 Ga0209129_1001868 3300025258 Bacteria 11120
312 Ga0209129_1002344 3300025258 Bacteria 9373
313 Ga0209129_1003478 3300025258 Bacteria 6820
314 Ga0209129_1007240 3300025258 Bacteria 3352
315 Ga0209233_1000010 3300025261 Bacteria 1194329
316 Ga0209233_1000095 3300025261 Bacteria 303783
317 Ga0209233_1000113 3300025261 Bacteria 253455
318 Ga0209233_1000427 3300025261 Bacteria 30799
319 Ga0209565_1000118 3300025263 Bacteria 113196
320 Ga0209565_1019270 3300025263 Bacteria 1460
321 Ga0209455_1000127 3300025272 Bacteria 162518
322 Ga0209455_1014510 3300025272 Bacteria 1779
323 Ga0209673_1000010 3300025273 Bacteria 596656
324 Ga0209673_1000117 3300025273 Bacteria 172081
325 Ga0209673_1000151 3300025273 Bacteria 148103
326 Ga0209673_1000863 3300025273 Bacteria 39346
327 Ga0209673_1001685 3300025273 Bacteria 18869
328 Ga0209673_1002134 3300025273 Bacteria 14747
329 Ga0209673_1008788 3300025273 Bacteria 4455
330 Ga0209673_1013220 3300025273 Bacteria 3271
331 Ga0209130_1000003 3300025284 Bacteria 677988
332 Ga0209130_1000020 3300025284 Bacteria 379297
333 Ga0209130_1000034 3300025284 Bacteria 302439
334 Ga0209130_1017817 3300025284 Bacteria 1682
335 Ga0209675_1006073 3300025291 Bacteria 4928
336 Ga0209676_1000038 3300025292 Bacteria 449305
337 Ga0209676_1000128 3300025292 Bacteria 188099
338 Ga0209676_1000151 3300025292 Bacteria 167307
339 Ga0209676_1000482 3300025292 Bacteria 65372
340 Ga0209676_1000644 3300025292 Bacteria 50062
341 Ga0209676_1018885 3300025292 Bacteria 2390
342 Ga0209025_1000070 3300025294 Bacteria 287776
343 Ga0209025_1000140 3300025294 Bacteria 184765
344 Ga0209025_1000314 3300025294 Bacteria 107720
345 Ga0209025_1000506 3300025294 Bacteria 74798
346 Ga0209025_1001869 3300025294 Bacteria 24674
347 Ga0209025_1003183 3300025294 Bacteria 15930
348 Ga0209025_1005193 3300025294 Bacteria 10759
349 Ga0209025_1014241 3300025294 Bacteria 4916
350 Ga0209025_1014979 3300025294 Bacteria 4716
351 Ga0209025_1031047 3300025294 Bacteria 2539
352 Ga0209564_1000013 3300025295 Bacteria 775755
353 Ga0209564_1000647 3300025295 Bacteria 52658
354 Ga0209564_1001780 3300025295 Bacteria 19956
355 Ga0209564_1001993 3300025295 Bacteria 17874
356 Ga0209564_1013012 3300025295 Bacteria 3570
357 Ga0209758_1000413 3300025297 Bacteria 72744
358 Ga0209758_1000655 3300025297 Bacteria 52188
359 Ga0209758_1000758 3300025297 Bacteria 46817
360 Ga0209758_1001882 3300025297 Bacteria 22974
361 Ga0209758_1002154 3300025297 Bacteria 20718
362 Ga0209758_1004734 3300025297 Bacteria 11072
363 Ga0209758_1011908 3300025297 Bacteria 4953
364 Ga0209758_1013333 3300025297 Bacteria 4492
365 Ga0209758_1021031 3300025297 Bacteria 3059
366 Ga0209758_1027881 3300025297 Bacteria 2404
367 Ga0209050_1000646 3300025298 Bacteria 54050
368 Ga0209050_1000908 3300025298 Bacteria 39172
369 Ga0209050_1002863 3300025298 Bacteria 13667
370 Ga0209050_1003757 3300025298 Bacteria 10881
371 Ga0209050_1004392 3300025298 Bacteria 9564
372 Ga0209050_1007987 3300025298 Bacteria 5775
373 Ga0209050_1009729 3300025298 Bacteria 4868
374 Ga0209256_1001653 3300025299 Bacteria 21690
375 Ga0209256_1001736 3300025299 Bacteria 20844
376 Ga0209256_1002069 3300025299 Bacteria 17685
377 Ga0209256_1002712 3300025299 Bacteria 13781
378 Ga0209256_1004803 3300025299 Bacteria 8202
379 Ga0209256_1005804 3300025299 Bacteria 6883
380 Ga0209256_1006089 3300025299 Bacteria 6550
381 Ga0209256_1009099 3300025299 Bacteria 4426
382 Ga0209256_1010510 3300025299 Bacteria 3860
383 Ga0209256_1010871 3300025299 Bacteria 3738
384 Ga0207426_1000006 3300025302 Bacteria 1025969
385 Ga0207426_1000008 3300025302 Bacteria 848730
386 Ga0207426_1000011 3300025302 Bacteria 791203
387 Ga0207426_1000221 3300025302 Bacteria 134756
388 Ga0207426_1000869 3300025302 Bacteria 31530
389 Ga0209051_1000097 3300025303 Bacteria 167378
390 Ga0209051_1000314 3300025303 Bacteria 74316
391 Ga0209051_1001673 3300025303 Bacteria 17872
392 Ga0209051_1006481 3300025303 Bacteria 6589
393 Ga0209051_1009478 3300025303 Bacteria 5014
394 Ga0209051_1023834 3300025303 Bacteria 2534
395 Ga0209257_1000060 3300025304 Bacteria 372267
396 Ga0209257_1000200 3300025304 Bacteria 147538
397 Ga0209257_1000413 3300025304 Bacteria 82516
398 Ga0209257_1001142 3300025304 Bacteria 33931
399 Ga0209257_1002070 3300025304 Bacteria 21158
400 Ga0209257_1003315 3300025304 Bacteria 13958
401 Ga0207697_10031978 3300025315 Bacteria 2153
402 Ga0207656_10000915 3300025321 Bacteria 9617
403 Ga0207656_10079580 3300025321 Bacteria 1470
404 Ga0207653_10037193 3300025885 Bacteria 1587
405 Ga0207688_10015208 3300025901 Bacteria 4175
406 Ga0207688_10047884 3300025901 Bacteria 2388
407 Ga0207647_10004029 3300025904 Bacteria 10951
408 Ga0207645_10001505 3300025907 Bacteria 19088
409 Ga0207645_10007970 3300025907 Bacteria 7431
410 Ga0207643_10060789 3300025908 Bacteria 2157
411 Ga0207654_10076184 3300025911 Bacteria 2007
412 Ga0207707_10246383 3300025912 Bacteria 1553
413 Ga0207695_10000011 3300025913 Bacteria 910221
414 Ga0207695_10000125 3300025913 Bacteria 228810
415 Ga0207671_10000093 3300025914 Bacteria 138939
416 Ga0207671_10029964 3300025914 Bacteria 4061
417 Ga0207671_10066354 3300025914 Bacteria 2686
418 Ga0207662_10009356 3300025918 Bacteria 5388
419 Ga0207662_10033707 3300025918 Bacteria 2986
420 Ga0207657_10040197 3300025919 Bacteria 4147
421 Ga0207649_10003204 3300025920 Bacteria 8973
422 Ga0207681_10006107 3300025923 Bacteria 7386
423 Ga0207681_10075520 3300025923 Bacteria 2364
424 Ga0207694_10043337 3300025924 Bacteria 3473
425 Ga0207694_10137643 3300025924 Bacteria 1962
426 Ga0207650_10000837 3300025925 Bacteria 23356
427 Ga0207650_10011696 3300025925 Bacteria 6047
428 Ga0207650_10073554 3300025925 Bacteria 2574
429 Ga0207659_10059779 3300025926 Bacteria 2741
430 Ga0207687_10127876 3300025927 Bacteria 1910
431 Ga0207700_10011303 3300025928 Bacteria 5686
432 Ga0207690_10165585 3300025932 Bacteria 1652
433 Ga0207706_10244122 3300025933 Bacteria 1570
434 Ga0207686_10087696 3300025934 Bacteria 2047
435 Ga0207686_10118387 3300025934 Bacteria 1799
436 Ga0207709_10151631 3300025935 Bacteria 1606
437 Ga0207670_10034359 3300025936 Bacteria 3276
438 Ga0207670_10054411 3300025936 Bacteria 2700
439 Ga0207669_10007020 3300025937 Bacteria 5182
440 Ga0207669_10046066 3300025937 Bacteria 2574
441 Ga0207669_10130961 3300025937 Bacteria 1723
442 Ga0207704_10004070 3300025938 Bacteria 6664
443 Ga0207704_10098033 3300025938 Bacteria 1946
444 Ga0207691_10009401 3300025940 Bacteria 9388
445 Ga0207691_10018799 3300025940 Bacteria 6546
446 Ga0207691_10030454 3300025940 Bacteria 5042
447 Ga0207691_10131070 3300025940 Bacteria 2215
448 Ga0207691_10293629 3300025940 Bacteria 1397
449 Ga0207711_10013870 3300025941 Bacteria 6693
450 Ga0207711_10039419 3300025941 Bacteria 4019
451 Ga0207689_10079487 3300025942 Bacteria 2695
452 Ga0207661_10013261 3300025944 Bacteria 6017
453 Ga0207661_10042650 3300025944 Bacteria 3578
454 Ga0207661_10045424 3300025944 Bacteria 3477
455 Ga0207679_10049622 3300025945 Bacteria 3063
456 Ga0207667_10057794 3300025949 Bacteria 4070
457 Ga0207667_10123954 3300025949 Bacteria 2662
458 Ga0207667_10417392 3300025949 Bacteria 1365
459 Ga0207651_10002477 3300025960 Bacteria 8806
460 Ga0207712_10050862 3300025961 Bacteria 2895
461 Ga0207668_10005083 3300025972 Bacteria 7743
462 Ga0207668_10005717 3300025972 Bacteria 7327
463 Ga0207668_10018441 3300025972 Bacteria 4391
464 Ga0207668_10237982 3300025972 Bacteria 1471
465 Ga0207640_10058755 3300025981 Bacteria 2535
466 Ga0207640_10072226 3300025981 Bacteria 2327
467 Ga0207658_10068385 3300025986 Bacteria 2680
468 Ga0207658_10132204 3300025986 Bacteria 2007
469 Ga0207658_10238936 3300025986 Bacteria 1538
470 Ga0207658_10302719 3300025986 Bacteria 1378
471 Ga0207677_10201146 3300026023 Bacteria 1583
472 Ga0207703_10224965 3300026035 Bacteria 1679
473 Ga0207639_10001696 3300026041 Bacteria 14874
474 Ga0207639_10082103 3300026041 Bacteria 2554
475 Ga0207678_10112095 3300026067 Bacteria 2327
476 Ga0207678_10118442 3300026067 Bacteria 2260
477 Ga0207708_10008534 3300026075 Bacteria 7583
478 Ga0207641_10030350 3300026088 Bacteria 4478
479 Ga0207641_10040754 3300026088 Bacteria 3890
480 Ga0207641_10121994 3300026088 Bacteria 2327
481 Ga0207641_10294916 3300026088 Bacteria 1530
482 Ga0207648_10009328 3300026089 Bacteria 9403
483 Ga0207676_10367245 3300026095 Bacteria 1336
484 Ga0207675_100049032 3300026118 Bacteria 3943
485 Ga0207675_100065731 3300026118 Bacteria 3390
486 Ga0207683_10049695 3300026121 Bacteria 3672
487 Ga0207683_10057103 3300026121 Bacteria 3426
488 Ga0207683_10167090 3300026121 Bacteria 1991
489 Ga0207683_10219024 3300026121 Bacteria 1734
490 Ga0207698_10020535 3300026142 Bacteria 4548
491 Ga0207698_10080084 3300026142 Bacteria 2630
492 Ga0207698_10262390 3300026142 Bacteria 1588
493 Ga0209281_1000034 3300027111 Bacteria 382562
494 Ga0209281_1000106 3300027111 Bacteria 219666
495 Ga0209281_1000318 3300027111 Bacteria 85039
496 Ga0209371_1000022 3300027312 Bacteria 536342
497 Ga0209371_1003359 3300027312 Bacteria 7858
498 Ga0209371_1012916 3300027312 Bacteria 2383
499 Ga0209282_1000024 3300027666 Bacteria 170348
500 Ga0209282_1000531 3300027666 Bacteria 18489
501 Ga0209282_1045570 3300027666 Bacteria 2564
502 Ga0209813_10019500 3300027866 Bacteria 1886
503 Ga0209974_10009270 3300027876 Bacteria 3342
504 Ga0207428_10005251 3300027907 Bacteria 12103
505 Ga0268266_10025929 3300028379 Bacteria 4987
506 Ga0268266_10030607 3300028379 Bacteria 4572
507 Ga0268266_10105632 3300028379 Bacteria 2488
508 Ga0268266_10116941 3300028379 Bacteria 2369
509 Ga0268266_10378352 3300028379 Bacteria 1335
510 Ga0268265_10046509 3300028380 Bacteria 3244
511 Ga0268265_10057290 3300028380 Bacteria 2969
512 Ga0268265_10163799 3300028380 Bacteria 1892
513 Ga0268264_10000476 3300028381 Bacteria 53780
514 Ga0268264_10099835 3300028381 Bacteria 2520
515 Ga0268264_10118483 3300028381 Bacteria 2330
516 Ga0268264_10185483 3300028381 Bacteria 1892
517 Ga0268264_10196688 3300028381 Bacteria 1841
518 Ga0265337_1001230 3300028556 Bacteria 12964
519 Ga0265337_1002560 3300028556 Bacteria 8271
520 Ga0265337_1003365 3300028556 Bacteria 6955
521 Ga0265319_1000298 3300028563 Bacteria 36808
522 Ga0265319_1002101 3300028563 Bacteria 11157
523 Ga0265319_1002859 3300028563 Bacteria 9227
524 Ga0265319_1003884 3300028563 Bacteria 7624
525 Ga0265319_1007656 3300028563 Bacteria 4822
526 Ga0265319_1008667 3300028563 Bacteria 4426
527 Ga0265319_1010597 3300028563 Bacteria 3835
528 Ga0265319_1010831 3300028563 Bacteria 3778
529 Ga0265319_1024830 3300028563 Bacteria 2152
530 Ga0265334_10006566 3300028573 Bacteria 5007
531 Ga0265334_10019358 3300028573 Bacteria 2801
532 Ga0265334_10041329 3300028573 Bacteria 1803
533 Ga0265318_10000007 3300028577 Bacteria 280699
534 Ga0265318_10000206 3300028577 Bacteria 50931
535 Ga0265318_10001154 3300028577 Bacteria 16401
536 Ga0265318_10002287 3300028577 Bacteria 10299
537 Ga0265318_10002712 3300028577 Bacteria 9292
538 Ga0265318_10003821 3300028577 Bacteria 7464
539 Ga0265318_10039618 3300028577 Bacteria 1797
540 Ga0265323_10006142 3300028653 Bacteria 5065
541 Ga0265323_10024474 3300028653 Bacteria 2294
542 Ga0265323_10034080 3300028653 Bacteria 1882
543 Ga0265322_10006788 3300028654 Bacteria 3360
544 Ga0265322_10007141 3300028654 Bacteria 3271
545 Ga0265336_10001485 3300028666 Bacteria 10650
546 Ga0307515_10001559 3300028794 Bacteria 51153
547 Ga0307515_10001978 3300028794 Bacteria 45366
548 Ga0307515_10007368 3300028794 Bacteria 21770
549 Ga0307515_10031969 3300028794 Bacteria 8742
550 Ga0307515_10141817 3300028794 Bacteria 2572
551 Ga0265338_10001695 3300028800 Bacteria 35004
552 Ga0265338_10003574 3300028800 Bacteria 21714
553 Ga0265338_10051361 3300028800 Bacteria 3712
554 Ga0265324_10011450 3300029957 Bacteria 3378
555 Ga0265324_10024904 3300029957 Bacteria 2124
556 Ga0268256_1000019 3300030500 Bacteria 587949
557 Ga0268256_1003591 3300030500 Bacteria 6913
558 Ga0268256_1012308 3300030500 Bacteria 2652
559 Ga0316181_1196002 3300030744 Bacteria 1668
560 Ga0265330_10003483 3300031235 Bacteria 8204
561 Ga0265330_10004065 3300031235 Bacteria 7503
562 Ga0265332_10004106 3300031238 Bacteria 6910
563 Ga0265328_10000435 3300031239 Bacteria 19580
564 Ga0265328_10019863 3300031239 Bacteria 2577
565 Ga0265320_10000791 3300031240 Bacteria 24071
566 Ga0265320_10001929 3300031240 Bacteria 14642
567 Ga0265320_10002191 3300031240 Bacteria 13736
568 Ga0265320_10002983 3300031240 Bacteria 11569
569 Ga0265320_10003355 3300031240 Bacteria 10800
570 Ga0265320_10005312 3300031240 Bacteria 8288
571 Ga0265320_10007308 3300031240 Bacteria 6865
572 Ga0265320_10010969 3300031240 Bacteria 5358
573 Ga0265320_10018235 3300031240 Bacteria 3871
574 Ga0265320_10033988 3300031240 Bacteria 2599
575 Ga0265325_10013776 3300031241 Bacteria 4592
576 Ga0265325_10029351 3300031241 Bacteria 2957
577 Ga0265329_10000781 3300031242 Bacteria 16177
578 Ga0265340_10018449 3300031247 Bacteria 3598
579 Ga0265331_10002350 3300031250 Bacteria 12860
580 Ga0265331_10013946 3300031250 Bacteria 4298
581 Ga0265331_10018214 3300031250 Bacteria 3647
582 Ga0265327_10000091 3300031251 Bacteria 196369
583 Ga0265327_10002906 3300031251 Bacteria 17180
584 Ga0265327_10004492 3300031251 Bacteria 12323
585 Ga0265327_10028872 3300031251 Bacteria 3163
586 Ga0265316_10005524 3300031344 Bacteria 12265
587 Ga0265316_10033074 3300031344 Bacteria 4215
588 Ga0265316_10156506 3300031344 Bacteria 1705
589 Ga0307513_10010539 3300031456 Bacteria 11570
590 Ga0307513_10056407 3300031456 Bacteria 4194
591 Ga0307513_10091206 3300031456 Bacteria 3106
592 Ga0307408_100060897 3300031548 Bacteria 2753
593 Ga0307408_100233217 3300031548 Bacteria 1509
594 Ga0265313_10003023 3300031595 Bacteria 13985
595 Ga0265313_10003044 3300031595 Bacteria 13917
596 Ga0265313_10003588 3300031595 Bacteria 12478
597 Ga0265313_10004342 3300031595 Bacteria 10967
598 Ga0265313_10007241 3300031595 Bacteria 7629
599 Ga0265313_10015661 3300031595 Bacteria 4402
600 Ga0265313_10026134 3300031595 Bacteria 3081
601 Ga0307508_10001088 3300031616 Bacteria 31450
602 Ga0265314_10002313 3300031711 Bacteria 19685
603 Ga0265314_10003676 3300031711 Bacteria 14722
604 Ga0265314_10005244 3300031711 Bacteria 11743
605 Ga0265314_10005332 3300031711 Bacteria 11633
606 Ga0265314_10098056 3300031711 Bacteria 1891
607 Ga0265314_10116656 3300031711 Bacteria 1688
608 Ga0265342_10002774 3300031712 Bacteria 14839
609 Ga0265342_10011659 3300031712 Bacteria 5998
610 Ga0265342_10014643 3300031712 Bacteria 5199
611 Ga0265342_10014665 3300031712 Bacteria 5194
612 Ga0265342_10023075 3300031712 Bacteria 3944
613 Ga0265342_10058582 3300031712 Bacteria 2277
614 Ga0265342_10058665 3300031712 Bacteria 2275
615 Ga0265342_10059285 3300031712 Bacteria 2261
616 Ga0265342_10089160 3300031712 Bacteria 1770
617 Ga0265342_10111690 3300031712 Bacteria 1546
618 Ga0307405_10000857 3300031731 Bacteria 11991
619 Ga0307410_10228399 3300031852 Bacteria 1436
620 Ga0307406_10013439 3300031901 Bacteria 4689
621 Ga0307412_10000493 3300031911 Bacteria 23544
622 Ga0307412_10173865 3300031911 Bacteria 1613
623 Ga0315914_1000012 3300031967 Bacteria 169896
624 Ga0307416_100469386 3300032002 Bacteria 1316
625 Ga0307414_10020814 3300032004 Bacteria 4097
626 Ga0307414_10054215 3300032004 Bacteria 2800
627 Ga0307414_10061116 3300032004 Bacteria 2667
628 Ga0307414_10125605 3300032004 Bacteria 1981
629 Ga0307414_10163823 3300032004 Bacteria 1769
630 Ga0307414_10318020 3300032004 Bacteria 1324
631 Ga0307415_100054506 3300032126 Bacteria 2730
632 Ga0307510_10186046 3300033180 Bacteria 1632
633 Ga0315913_1000006 3300033430 Bacteria 169893
634 Ga0315915_1000010 3300033464 Bacteria 240214
635 Ga0373931_0091831 3300035691 Bacteria 1693
636 Ga0373927_0000350 3300035695 Bacteria 36173
637 Ga0373925_0015189 3300037068 Bacteria 5567
638 Ga0373925_0098230 3300037068 Bacteria 2247
639 Ga0395899_0000117 3300037312 Bacteria 130159
640 Ga0395899_0000125 3300037312 Bacteria 120964
641 Ga0395899_0000721 3300037312 Bacteria 33125
642 Ga0395899_0011241 3300037312 Bacteria 6858
643 Ga0395899_0014995 3300037312 Bacteria 5912
644 Ga0395900_0000020 3300037418 Bacteria 353500
645 Ga0395900_0010176 3300037418 Bacteria 9621
646 Ga0395900_0012623 3300037418 Bacteria 8641
647 Ga0395900_0032997 3300037418 Bacteria 5328
648 Ga0395900_0037038 3300037418 Bacteria 5030
649 Ga0395900_0111033 3300037418 Bacteria 2816
650 Ga0395898_0000259 3300037466 Bacteria 130131
651 Ga0395898_0017388 3300037466 Bacteria 7346
652 Ga0395905_0000019 3300037471 Bacteria 353500
653 Ga0395905_0005044 3300037471 Bacteria 13597
654 Ga0395905_0021769 3300037471 Bacteria 6063
655 Ga0395905_0054858 3300037471 Bacteria 3729
656 Ga0395905_0071756 3300037471 Bacteria 3246
657 Ga0395905_0099657 3300037471 Bacteria 2728
658 Ga0395905_0130601 3300037471 Bacteria 2362
659 Ga0395901_0000016 3300038443 Bacteria 354008
660 Ga0395901_0196598 3300038443 Bacteria 2114
661 Ga0395901_0279372 3300038443 Bacteria 1735
662 Ga0395901_0315195 3300038443 Bacteria 1619
663 Ga0395901_0386153 3300038443 Bacteria 1440
664 Ga0400483_084393 3300039062 Bacteria 4457
665 Ga0400483_182297 3300039062 Bacteria 2436
666 Ga0400483_251795 3300039062 Bacteria 1621
667 Ga0436365_0266395 3300039437 Bacteria 2349
668 Ga0436365_0842412 3300039437 Bacteria 5014
669 Ga0436365_1369348 3300039437 Bacteria 12178
670 Ga0436361_0688051 3300039447 Bacteria 2348
671 Ga0436361_0974810 3300039447 Bacteria 1082
672 Ga0436361_0998006 3300039447 Bacteria 6806
673 Ga0436361_1208326 3300039447 Bacteria 1994
674 Ga0439436_0005499 3300041404 Bacteria 3879
675 Ga0439465_0002128 3300041413 Bacteria 6513
676 Ga0451791_1547477 3300041451 Bacteria 3717
677 Ga0451841_1414464 3300041498 Bacteria 1833
678 Ga0451849_0897929 3300041505 Bacteria 1561
679 Ga0451851_1171717 3300041507 Bacteria 5736
680 Ga0451853_2936904 3300041512 Bacteria 1754
681 Ga0439443_007170 3300042003 Bacteria 1546
682 Ga0439458_0019877 3300042157 Bacteria 1548
683 Ga0439459_0000950 3300042438 Bacteria 4094
684 Ga0450918_008457 3300042531 Bacteria 1807
685 Ga0451577_0000024 3300042876 Bacteria 411758
686 Ga0451577_0000027 3300042876 Bacteria 397014
687 Ga0451577_0000354 3300042876 Bacteria 85568
688 Ga0451577_0002562 3300042876 Bacteria 21462
689 Ga0451577_0043614 3300042876 Bacteria 4018
690 Ga0451577_0059473 3300042876 Bacteria 3407
691 Ga0451577_0111277 3300042876 Bacteria 2450
692 Ga0451577_0389251 3300042876 Bacteria 1265
693 Ga0453683_0000022 3300044673 Bacteria 269593
694 Ga0453683_0000146 3300044673 Bacteria 103930
695 Ga0453683_0006735 3300044673 Bacteria 7853
696 Ga0453683_0020622 3300044673 Bacteria 4211
697 Ga0453683_0090655 3300044673 Bacteria 1916
698 Ga0453684_0000001 3300044712 Bacteria 2623166
699 Ga0453684_0000154 3300044712 Bacteria 305062
700 Ga0453684_0000213 3300044712 Bacteria 253663
701 Ga0453684_0000846 3300044712 Bacteria 103225
702 Ga0453684_0018498 3300044712 Bacteria 10689
703 Ga0453684_0022207 3300044712 Bacteria 9431
704 Ga0453684_0051650 3300044712 Bacteria 5386
705 Ga0453684_0056828 3300044712 Bacteria 5072
706 Ga0453684_0133152 3300044712 Bacteria 2980
707 Ga0453684_0135017 3300044712 Bacteria 2956
708 Ga0453684_0139638 3300044712 Bacteria 2896
709 Ga0453684_0239025 3300044712 Bacteria 2092
710 Ga0466968_0040355 3300044735 Bacteria 1968
711 Ga0466970_0005945 3300044765 Bacteria 6083
712 Ga0466957_0066171 3300044842 Bacteria 2227
713 Ga0466960_0022200 3300044901 Bacteria 2835
714 Ga0466960_0022279 3300044901 Bacteria 2831
715 Ga0451576_0000032 3300045051 Bacteria 397014
716 Ga0451576_0000175 3300045051 Bacteria 161976
717 Ga0451576_0000443 3300045051 Bacteria 94447
718 Ga0451576_0002775 3300045051 Bacteria 25283
719 Ga0451576_0003405 3300045051 Bacteria 21917
720 Ga0451576_0007566 3300045051 Bacteria 12948
721 Ga0451576_0011426 3300045051 Bacteria 10088
722 Ga0451576_0013758 3300045051 Bacteria 9039
723 Ga0451576_0073549 3300045051 Bacteria 3557
724 Ga0451576_0341613 3300045051 Bacteria 1567
725 Ga0466967_0031036 3300045976 Bacteria 4494
726 Ga0495627_000769 3300046453 Bacteria 23843
727 Ga0495590_0001675 3300046457 Bacteria 9433
728 Ga0495638_0001181 3300046460 Bacteria 25058
729 Ga0495638_0005170 3300046460 Bacteria 9758
730 Ga0495638_0006604 3300046460 Bacteria 8427
731 Ga0495638_0008934 3300046460 Bacteria 7066
732 Ga0495638_0025692 3300046460 Bacteria 3824
733 Ga0495638_0030182 3300046460 Bacteria 3491
734 Ga0495638_0065339 3300046460 Bacteria 2240
735 Ga0495638_0084370 3300046460 Bacteria 1922
736 Ga0495650_0000237 3300046471 Bacteria 110872
737 Ga0495605_0001952 3300046474 Bacteria 13095
738 Ga0495583_0000001 3300046506 Bacteria 811973
739 Ga0495610_0000407 3300046512 Bacteria 44093
740 Ga0495610_0001969 3300046512 Bacteria 17628
741 Ga0495610_0003529 3300046512 Bacteria 12123
742 Ga0495610_0003825 3300046512 Bacteria 11469
743 Ga0495610_0028351 3300046512 Bacteria 2962
744 Ga0495610_0097095 3300046512 Bacteria 1326
745 Ga0495616_0000109 3300046513 Bacteria 71495
746 Ga0495616_0072627 3300046513 Bacteria 1661
747 Ga0495616_0086043 3300046513 Bacteria 1496
748 Ga0495620_0028963 3300046515 Bacteria 2569
749 Ga0495620_0034736 3300046515 Bacteria 2275
750 Ga0495628_0065316 3300046516 Bacteria 2847
751 Ga0495630_0011311 3300046517 Bacteria 6455
752 Ga0495630_0058273 3300046517 Bacteria 2895
753 Ga0495631_0001848 3300046518 Bacteria 12498
754 Ga0495631_0003360 3300046518 Bacteria 8775
755 Ga0495631_0034754 3300046518 Bacteria 2258
756 Ga0495632_0003529 3300046519 Bacteria 11059
757 Ga0495632_0005104 3300046519 Bacteria 8775
758 Ga0495637_0003364 3300046520 Bacteria 8508
759 Ga0495643_0002725 3300046522 Bacteria 13593
760 Ga0495643_0002802 3300046522 Bacteria 13314
761 Ga0495648_0000509 3300046524 Bacteria 41858
762 Ga0495663_0019216 3300046525 Bacteria 1954
763 Ga0495654_0000110 3300046530 Bacteria 93042
764 Ga0495654_0000249 3300046530 Bacteria 49711
765 Ga0495587_0055372 3300046536 Bacteria 2336
766 Ga0495597_0018011 3300046542 Bacteria 3318
767 Ga0495597_0048517 3300046542 Bacteria 1878
768 Ga0495633_0002890 3300046558 Bacteria 11772
769 Ga0495633_0009054 3300046558 Bacteria 5536
770 Ga0495633_0112870 3300046558 Bacteria 1260
771 Ga0495668_0000037 3300046616 Bacteria 233981
772 Ga0495668_0003688 3300046616 Bacteria 11306
773 Ga0495625_0000284 3300046660 Bacteria 78635
774 Ga0495625_0001387 3300046660 Bacteria 29722
775 Ga0495625_0002396 3300046660 Bacteria 20344
776 Ga0495625_0009397 3300046660 Bacteria 8184
777 Ga0495625_0016011 3300046660 Bacteria 5912
778 Ga0495649_0000649 3300046694 Bacteria 28270
779 Ga0495589_0008352 3300046794 Bacteria 5410
780 Ga0495600_0161865 3300046809 Bacteria 1446
781 Ga0495660_0072773 3300046810 Bacteria 1819
782 Ga0495604_0039341 3300047317 Bacteria 3717
783 Ga0495636_0107141 3300047318 Bacteria 1227
784 Ga0495674_0008997 3300047319 Bacteria 9488
785 Ga0495672_0003205 3300047320 Bacteria 14223
786 Ga0495672_0009178 3300047320 Bacteria 7202
787 Ga0495673_0000156 3300047469 Bacteria 118831
788 Ga0495673_0001785 3300047469 Bacteria 16335
789 Ga0495684_0010387 3300047471 Bacteria 7200
790 Ga0495686_0000025 3300047472 Bacteria 388098
791 Ga0495686_0002042 3300047472 Bacteria 19884
792 Ga0495686_0002729 3300047472 Bacteria 16131
793 Ga0495686_0039677 3300047472 Bacteria 3006
794 Ga0495686_0071479 3300047472 Bacteria 2135
795 Ga0495686_0074730 3300047472 Bacteria 2079
796 Ga0496100_0024136 3300048903 Bacteria 3704
797 Ga0496100_0043880 3300048903 Bacteria 2861
798 Ga0496100_0053196 3300048903 Bacteria 2636
799 Ga0496101_0006593 3300048904 Bacteria 7481
800 Ga0496101_0007333 3300048904 Bacteria 7139
801 Ga0496101_0227588 3300048904 Bacteria 1449
802 Ga0496102_0011027 3300048905 Bacteria 7786
803 Ga0496103_0049797 3300048906 Bacteria 2591
804 Ga0496104_0028708 3300048907 Bacteria 5156
805 Ga0496105_0003076 3300048908 Bacteria 12259
806 Ga0496105_0048040 3300048908 Bacteria 3523
807 Ga0496106_0000982 3300048909 Bacteria 20805
808 Ga0496106_0006952 3300048909 Bacteria 8365
809 Ga0496106_0168989 3300048909 Bacteria 1732
810 Ga0496107_0000864 3300048910 Bacteria 17818
811 Ga0496107_0000914 3300048910 Bacteria 17392
812 Ga0496107_0019454 3300048910 Bacteria 4790
813 Ga0496108_0000529 3300048911 Bacteria 29960
814 Ga0496108_0098416 3300048911 Bacteria 2493
815 Ga0496108_0221932 3300048911 Bacteria 1642
816 Ga0496109_0100563 3300048912 Bacteria 2683
817 Ga0496109_0193465 3300048912 Bacteria 1911
818 Ga0496109_0243579 3300048912 Bacteria 1692
819 Ga0496110_0158482 3300048913 Bacteria 2051
820 Ga0496112_0182082 3300048915 Bacteria 2065
821 Ga0496112_0222368 3300048915 Bacteria 1844
822 Ga0496113_0256304 3300048916 Bacteria 1397
823 Ga0496114_0000962 3300048917 Bacteria 21556
824 Ga0496114_0023493 3300048917 Bacteria 5031
825 Ga0496115_0003066 3300048918 Bacteria 11999
826 Ga0496115_0013897 3300048918 Bacteria 6093
827 Ga0496115_0037401 3300048918 Bacteria 3846
828 Ga0496116_0000142 3300048919 Bacteria 150342
829 Ga0496116_0009760 3300048919 Bacteria 8146
830 Ga0496116_0011061 3300048919 Bacteria 7507
831 Ga0496116_0029217 3300048919 Bacteria 3978
832 Ga0496116_0051921 3300048919 Bacteria 2719
833 Ga0496117_0000002 3300048920 Bacteria 2483758
834 Ga0496117_0001574 3300048920 Bacteria 32408
835 Ga0496117_0004520 3300048920 Bacteria 15278
836 Ga0496117_0012510 3300048920 Bacteria 7471
837 Ga0496118_0000087 3300048921 Bacteria 176693
838 Ga0496118_0003357 3300048921 Bacteria 20255
839 Ga0496118_0126311 3300048921 Bacteria 1654
840 Ga0496119_0005947 3300048922 Bacteria 11472
841 Ga0496119_0011964 3300048922 Bacteria 7109
842 Ga0496119_0022330 3300048922 Bacteria 4535
843 Ga0496119_0033726 3300048922 Bacteria 3387
844 Ga0496120_0000413 3300048923 Bacteria 68125
845 Ga0496120_0001104 3300048923 Bacteria 35202
846 Ga0496120_0017315 3300048923 Bacteria 4677
847 Ga0496120_0020008 3300048923 Bacteria 4265
848 Ga0496121_0000003 3300048924 Bacteria 1191431
849 Ga0496121_0001116 3300048924 Bacteria 47237
850 Ga0496121_0002536 3300048924 Bacteria 27686
851 Ga0496121_0004530 3300048924 Bacteria 18596
852 Ga0496121_0084672 3300048924 Bacteria 2499
853 Ga0496122_0000004 3300048925 Bacteria 645283
854 Ga0496122_0000190 3300048925 Bacteria 140376
855 Ga0496122_0000215 3300048925 Bacteria 128810
856 Ga0496122_0008959 3300048925 Bacteria 10641
857 Ga0496122_0010294 3300048925 Bacteria 9677
858 Ga0496122_0033581 3300048925 Bacteria 4216
859 Ga0496122_0040083 3300048925 Bacteria 3728
860 Ga0496122_0040321 3300048925 Bacteria 3713
861 Ga0496122_0047411 3300048925 Bacteria 3317
862 Ga0496122_0067097 3300048925 Bacteria 2586
863 Ga0496122_0132461 3300048925 Bacteria 1580
864 Ga0496123_0000007 3300048926 Bacteria 645283
865 Ga0496123_0000306 3300048926 Bacteria 95266
866 Ga0496123_0000336 3300048926 Bacteria 89161
867 Ga0496123_0013645 3300048926 Bacteria 6797
868 Ga0496123_0016026 3300048926 Bacteria 6112
869 Ga0496123_0027463 3300048926 Bacteria 4238
870 Ga0496123_0059789 3300048926 Bacteria 2461
871 Ga0496124_0001040 3300048927 Bacteria 43813
872 Ga0496124_0006855 3300048927 Bacteria 12267
873 Ga0496124_0008840 3300048927 Bacteria 10458
874 Ga0496124_0011355 3300048927 Bacteria 8905
875 Ga0496124_0015066 3300048927 Bacteria 7434
876 Ga0496124_0017201 3300048927 Bacteria 6826
877 Ga0496124_0017234 3300048927 Bacteria 6814
878 Ga0496124_0031646 3300048927 Bacteria 4681
879 Ga0496124_0100368 3300048927 Bacteria 2346
880 Ga0496124_0149850 3300048927 Bacteria 1831
881 Ga0496125_0000039 3300048928 Bacteria 318665
882 Ga0496125_0000248 3300048928 Bacteria 110840
883 Ga0496125_0006049 3300048928 Bacteria 13230
884 Ga0496125_0092061 3300048928 Bacteria 2268
885 Ga0496125_0213966 3300048928 Bacteria 1249
886 Ga0496126_0000866 3300048929 Bacteria 53241
887 Ga0496126_0001294 3300048929 Bacteria 39967
888 Ga0496126_0003703 3300048929 Bacteria 19064
889 Ga0496126_0014931 3300048929 Bacteria 7831
890 Ga0496126_0061773 3300048929 Bacteria 3364
891 Ga0496126_0226154 3300048929 Bacteria 1569
892 Ga0495678_003521 3300049459 Bacteria 9623
893 Ga0501031_0000036 3300049568 Bacteria 73760
894 Ga0501031_0021717 3300049568 Bacteria 4184
895 Ga0501031_0029115 3300049568 Bacteria 3602
896 Ga0501032_0000075 3300049569 Bacteria 84153
897 Ga0501032_0000100 3300049569 Bacteria 73505
898 Ga0501032_0001723 3300049569 Bacteria 17307
899 Ga0501032_0001737 3300049569 Bacteria 17232
900 Ga0501032_0002103 3300049569 Bacteria 15705
901 Ga0501032_0056351 3300049569 Bacteria 2642
902 Ga0501032_0058728 3300049569 Bacteria 2582
903 Ga0501032_0104903 3300049569 Bacteria 1873
904 Ga0501033_0000088 3300049570 Bacteria 87638
905 Ga0501033_0001181 3300049570 Bacteria 23577
906 Ga0501033_0001862 3300049570 Bacteria 18338
907 Ga0501033_0002110 3300049570 Bacteria 17214
908 Ga0501033_0004600 3300049570 Bacteria 11057
909 Ga0501033_0087085 3300049570 Bacteria 2286
910 Ga0501034_0000397 3300049571 Bacteria 73511
911 Ga0501034_0001558 3300049571 Bacteria 30010
912 Ga0501034_0003857 3300049571 Bacteria 16894
913 Ga0501034_0013251 3300049571 Bacteria 8494
914 Ga0501034_0041258 3300049571 Bacteria 4669
915 Ga0501034_0062289 3300049571 Bacteria 3746
916 Ga0501034_0084135 3300049571 Bacteria 3183
917 Ga0501034_0086446 3300049571 Bacteria 3136
918 Ga0501034_0086879 3300049571 Bacteria 3127
919 Ga0501034_0191331 3300049571 Bacteria 2008
920 Ga0501034_0284546 3300049571 Bacteria 1592
921 Ga0501036_0000056 3300049572 Bacteria 73511
922 Ga0501036_0000398 3300049572 Bacteria 30616
923 Ga0501036_0003168 3300049572 Bacteria 13129
924 Ga0501036_0022832 3300049572 Bacteria 5267
925 Ga0501036_0060537 3300049572 Bacteria 3208
926 Ga0501036_0067948 3300049572 Bacteria 3015
927 Ga0501036_0189269 3300049572 Bacteria 1732
928 Ga0501036_0308564 3300049572 Bacteria 1323
929 Ga0501037_0000021 3300049573 Bacteria 150037
930 Ga0501037_0000119 3300049573 Bacteria 73510
931 Ga0501037_0000181 3300049573 Bacteria 58438
932 Ga0501037_0001490 3300049573 Bacteria 17106
933 Ga0501037_0022441 3300049573 Bacteria 4669
934 Ga0501038_0000032 3300049574 Bacteria 131432
935 Ga0501038_0000098 3300049574 Bacteria 73471
936 Ga0501038_0001105 3300049574 Bacteria 24439
937 Ga0501038_0032793 3300049574 Bacteria 4578
938 Ga0501038_0053162 3300049574 Bacteria 3488
939 Ga0501039_0000013 3300049575 Bacteria 234418
940 Ga0501039_0000025 3300049575 Bacteria 152236
941 Ga0501039_0009216 3300049575 Bacteria 7521
942 Ga0501039_0029009 3300049575 Bacteria 4260
943 Ga0501039_0063883 3300049575 Bacteria 2852
944 Ga0501039_0134403 3300049575 Bacteria 1942
945 Ga0501040_0006707 3300049576 Bacteria 7467
946 Ga0501040_0022820 3300049576 Bacteria 4193
947 Ga0501040_0106566 3300049576 Bacteria 1958
948 Ga0501040_0199928 3300049576 Bacteria 1419
949 Ga0501042_0008324 3300049578 Bacteria 6837
950 Ga0501042_0021347 3300049578 Bacteria 4511
951 Ga0501042_0061785 3300049578 Bacteria 2676
952 Ga0501042_0128070 3300049578 Bacteria 1829
953 Ga0501042_0194362 3300049578 Bacteria 1463
954 Ga0501043_0000008 3300049579 Bacteria 223654
955 Ga0501043_0002291 3300049579 Bacteria 16234
956 Ga0501043_0004109 3300049579 Bacteria 11886
957 Ga0501043_0009292 3300049579 Bacteria 7725
958 Ga0501043_0013809 3300049579 Bacteria 6319
959 Ga0501043_0021406 3300049579 Bacteria 5069
960 Ga0501043_0029609 3300049579 Bacteria 4302
961 Ga0501043_0046072 3300049579 Bacteria 3428
962 Ga0501043_0163416 3300049579 Bacteria 1739
963 Ga0501046_0000796 3300049580 Bacteria 30570
964 Ga0501046_0003329 3300049580 Bacteria 14773
965 Ga0501046_0004770 3300049580 Bacteria 12232
966 Ga0501046_0132190 3300049580 Bacteria 1892
967 Ga0501046_0143187 3300049580 Bacteria 1807
968 Ga0501047_0001349 3300049581 Bacteria 24106
969 Ga0501047_0004591 3300049581 Bacteria 12985
970 Ga0501047_0006856 3300049581 Bacteria 10703
971 Ga0501047_0007284 3300049581 Bacteria 10401
972 Ga0501047_0009767 3300049581 Bacteria 9069
973 Ga0501047_0014505 3300049581 Bacteria 7494
974 Ga0501047_0031934 3300049581 Bacteria 5081
975 Ga0501047_0032382 3300049581 Bacteria 5046
976 Ga0501047_0051975 3300049581 Bacteria 3960
977 Ga0501047_0079750 3300049581 Bacteria 3147
978 Ga0501047_0100203 3300049581 Bacteria 2776
979 Ga0501047_0125892 3300049581 Bacteria 2442
980 Ga0501047_0154168 3300049581 Bacteria 2171
981 Ga0501047_0186682 3300049581 Bacteria 1938
982 Ga0501048_0001499 3300049582 Bacteria 17673
983 Ga0501048_0055597 3300049582 Bacteria 2809
984 Ga0501048_0151484 3300049582 Bacteria 1640
985 Ga0501048_0286447 3300049582 Bacteria 1171
986 Ga0501067_0011338 3300049583 Bacteria 4937
987 Ga0501067_0035321 3300049583 Bacteria 2775
988 Ga0501068_0010703 3300049584 Bacteria 5157
989 Ga0501068_0022112 3300049584 Bacteria 3716
990 Ga0501068_0043794 3300049584 Bacteria 2693
991 Ga0501068_0081653 3300049584 Bacteria 1985
992 Ga0501068_0132289 3300049584 Bacteria 1560
993 Ga0501068_0154471 3300049584 Bacteria 1444
994 Ga0501069_0000028 3300049585 Bacteria 106038
995 Ga0501069_0070269 3300049585 Bacteria 1961
996 Ga0501069_0094575 3300049585 Bacteria 1691
997 Ga0501070_0000208 3300049586 Bacteria 55386
998 Ga0501070_0000264 3300049586 Bacteria 49510
999 Ga0501070_0002017 3300049586 Bacteria 17837
1000 Ga0501070_0011937 3300049586 Bacteria 7337
1001 Ga0501070_0038239 3300049586 Bacteria 4004
1002 Ga0501070_0064702 3300049586 Bacteria 3028
1003 Ga0501070_0247854 3300049586 Bacteria 1457
1004 Ga0501071_0015623 3300049587 Bacteria 5212
1005 Ga0501071_0026908 3300049587 Bacteria 4042
1006 Ga0501071_0129555 3300049587 Bacteria 1873
1007 Ga0501071_0172254 3300049587 Bacteria 1620
1008 Ga0501071_0305027 3300049587 Bacteria 1207
1009 Ga0501072_0006570 3300049588 Bacteria 8854
1010 Ga0501072_0110393 3300049588 Bacteria 2189
1011 Ga0501072_0119994 3300049588 Bacteria 2095
1012 Ga0501072_0156423 3300049588 Bacteria 1817
1013 Ga0501073_0001991 3300049589 Bacteria 15236
1014 Ga0501073_0017923 3300049589 Bacteria 5122
1015 Ga0501074_0000016 3300049590 Bacteria 78666
1016 Ga0501074_0006671 3300049590 Bacteria 8338
1017 Ga0501074_0064103 3300049590 Bacteria 2646
1018 Ga0501074_0182621 3300049590 Bacteria 1496
1019 Ga0501074_0266137 3300049590 Bacteria 1218
1020 Ga0501075_0005584 3300049591 Bacteria 8603
1021 Ga0501075_0117059 3300049591 Bacteria 2026
1022 Ga0501075_0125926 3300049591 Bacteria 1950
1023 Ga0501076_0094212 3300049592 Bacteria 2411
1024 Ga0501076_0147835 3300049592 Bacteria 1911
1025 Ga0501076_0427094 3300049592 Bacteria 1090
1026 Ga0501077_0018272 3300049593 Bacteria 4436
1027 Ga0501077_0080859 3300049593 Bacteria 2058
1028 Ga0501077_0083851 3300049593 Bacteria 2020
1029 Ga0501238_002317 3300049671 Bacteria 2265
1030 Ga0501079_0013164 3300049741 Bacteria 6305
1031 Ga0501080_0000065 3300049742 Bacteria 69171
1032 Ga0501080_0000515 3300049742 Bacteria 30480
1033 Ga0501080_0002532 3300049742 Bacteria 15995
1034 Ga0501080_0018343 3300049742 Bacteria 6477
1035 Ga0501080_0044577 3300049742 Bacteria 4129
1036 Ga0501080_0067657 3300049742 Bacteria 3322
1037 Ga0501080_0131816 3300049742 Bacteria 2314
1038 Ga0501081_0007123 3300049743 Bacteria 7267
1039 Ga0501081_0038321 3300049743 Bacteria 3274
1040 Ga0501083_0000482 3300049744 Bacteria 25555
1041 Ga0501083_0001671 3300049744 Bacteria 15142
1042 Ga0501083_0007197 3300049744 Bacteria 7902
1043 Ga0501083_0030737 3300049744 Bacteria 3687
1044 Ga0501083_0042867 3300049744 Bacteria 3067
1045 Ga0501083_0047820 3300049744 Bacteria 2889
1046 Ga0501083_0069870 3300049744 Bacteria 2336
1047 Ga0501083_0220879 3300049744 Bacteria 1234
1048 Ga0501035_0000011 3300049822 Bacteria 305794
1049 Ga0501035_0000053 3300049822 Bacteria 142860
1050 Ga0501035_0000085 3300049822 Bacteria 116189
1051 Ga0501035_0000584 3300049822 Bacteria 40265
1052 Ga0501035_0001564 3300049822 Bacteria 23277
1053 Ga0501035_0001865 3300049822 Bacteria 21239
1054 Ga0501035_0002030 3300049822 Bacteria 20177
1055 Ga0501035_0002594 3300049822 Bacteria 17645
1056 Ga0501035_0017631 3300049822 Bacteria 6587
1057 Ga0501035_0026972 3300049822 Bacteria 5253
1058 Ga0501035_0051433 3300049822 Bacteria 3689
1059 Ga0501035_0121609 3300049822 Bacteria 2282
1060 Ga0501035_0167383 3300049822 Bacteria 1900
1061 Ga0501035_0178021 3300049822 Bacteria 1833
1062 Ga0501035_0245654 3300049822 Bacteria 1521
1063 Ga0501044_0000011 3300049823 Bacteria 257385
1064 Ga0501044_0000206 3300049823 Bacteria 75006
1065 Ga0501044_0000214 3300049823 Bacteria 73483
1066 Ga0501044_0003350 3300049823 Bacteria 18063
1067 Ga0501044_0014012 3300049823 Bacteria 8659
1068 Ga0501044_0021514 3300049823 Bacteria 6879
1069 Ga0501044_0029188 3300049823 Bacteria 5817
1070 Ga0501044_0032189 3300049823 Bacteria 5513
1071 Ga0501044_0041808 3300049823 Bacteria 4771
1072 Ga0501044_0130899 3300049823 Bacteria 2503
1073 Ga0501044_0259986 3300049823 Bacteria 1674
1074 Ga0501044_0261060 3300049823 Bacteria 1670
1075 Ga0501044_0261644 3300049823 Bacteria 1668
1076 Ga0501045_0045184 3300049824 Bacteria 3207
1077 Ga0501045_0098913 3300049824 Bacteria 2158
1078 nmdc:mga03683_1625_c2 3300050489 Bacteria 1824
1079 nmdc:mga03683_61655_c1 3300050489 Bacteria 1587
1080 nmdc:mga03n38_11236_c1 3300050490 Bacteria 3328
1081 nmdc:mga03n38_12796_c1 3300050490 Bacteria 3168
1082 nmdc:mga03n38_49203_c1 3300050490 Bacteria 1873
1083 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
1084 nmdc:mga00v17_3914_c1 3300050491 Bacteria 7681
1085 nmdc:mga00v17_639_c1 3300050491 Bacteria 19367
1086 nmdc:mga00v17_74517_c1 3300050491 Bacteria 2109
1087 nmdc:mga0yw44_291_c1 3300050492 Bacteria 17253
1088 nmdc:mga0k408_143212_c1 3300050493 Bacteria 1422
1089 nmdc:mga0k408_14483_c1 3300050493 Bacteria 3435
1090 nmdc:mga0k408_48746_c1 3300050493 Bacteria 2451
1091 nmdc:mga0k408_74905_c1 3300050493 Bacteria 1977
1092 nmdc:mga06z11_32566_c1 3300050494 Bacteria 2543
1093 nmdc:mga06z11_6219_c1 3300050494 Bacteria 4838
1094 nmdc:mga06z11_91404_c1 3300050494 Bacteria 1653
1095 nmdc:mga07m45_11234_c1 3300050496 Bacteria 4701
1096 nmdc:mga07m45_85941_c1 3300050496 Bacteria 1799
1097 nmdc:mga05p37_204559_c1 3300050507 Bacteria 2389
1098 nmdc:mga05p37_695355_c1 3300050507 Bacteria 1131
1099 nmdc:mga09592_142995_c1 3300050508 Bacteria 2062
1100 nmdc:mga09592_264916_c1 3300050508 Bacteria 1491
1101 nmdc:mga0qj67_87777_c1 3300050509 Bacteria 2497
1102 nmdc:mga06r32_100635_c1 3300050510 Bacteria 2836
1103 nmdc:mga0rr50_142263_c1 3300050513 Bacteria 1931
1104 nmdc:mga08x19_261471_c1 3300050514 Bacteria 1196
1105 nmdc:mga0a205_8555_c1 3300050515 Bacteria 9308
1106 nmdc:mga0sz30_1084_c1 3300050516 Bacteria 9781
1107 nmdc:mga0sz30_2810_c1 3300050516 Bacteria 6216
1108 nmdc:mga0sz30_32753_c1 3300050516 Bacteria 2157
1109 Ga0495601_0037547 3300053077 Bacteria 3029
1110 Ga0500610_0007910 3300053079 Bacteria 4595
1111 Ga0500578_0000134 3300053086 Bacteria 89131
1112 Ga0500578_0041968 3300053086 Bacteria 2937
1113 Ga0500643_000992 3300053087 Bacteria 17440
1114 Ga0500643_042891 3300053087 Bacteria 1321
1115 Ga0500644_0000618 3300053088 Bacteria 13280
1116 Ga0500644_0004179 3300053088 Bacteria 3601
1117 Ga0500651_0027106 3300053093 Bacteria 3602
1118 Ga0500641_0001998 3300053096 Bacteria 7231
1119 Ga0500554_043963 3300053102 Bacteria 1382
1120 Ga0500556_0001416 3300053104 Bacteria 10332
1121 Ga0500560_000083 3300053107 Bacteria 9237
1122 Ga0500562_000545 3300053108 Bacteria 9127
1123 Ga0500572_001610 3300053111 Bacteria 5961
1124 Ga0500594_0000319 3300053118 Bacteria 10752
1125 Ga0500594_0034655 3300053118 Bacteria 1350
1126 Ga0500597_061909 3300053120 Bacteria 1609
1127 Ga0500608_000259 3300053122 Bacteria 20696
1128 Ga0500608_044527 3300053122 Bacteria 2131
1129 Ga0500614_003099 3300053123 Bacteria 3614
1130 Ga0500618_000314 3300053125 Bacteria 35813
1131 Ga0500618_000677 3300053125 Bacteria 20060
1132 Ga0500618_009330 3300053125 Bacteria 2682
1133 Ga0500618_016011 3300053125 Bacteria 1884
1134 Ga0500658_0000526 3300053134 Bacteria 16212
1135 Ga0500559_0000307 3300053136 Bacteria 37126
1136 Ga0500559_0002861 3300053136 Bacteria 8722
1137 Ga0500559_0020295 3300053136 Bacteria 2809
1138 Ga0500561_0000098 3300053137 Bacteria 16671
1139 Ga0500564_000155 3300053138 Bacteria 17869
1140 Ga0500568_0000093 3300053139 Bacteria 83403
1141 Ga0500573_0019055 3300053140 Bacteria 3924
1142 Ga0500577_0000256 3300053142 Bacteria 13913
1143 Ga0500590_003631 3300053148 Bacteria 7157
1144 Ga0500604_0056608 3300053151 Bacteria 1222
1145 Ga0500616_0000277 3300053153 Bacteria 76399
1146 Ga0500616_0001018 3300053153 Bacteria 29841
1147 Ga0500616_0001109 3300053153 Bacteria 27847
1148 Ga0500616_0012776 3300053153 Bacteria 4902
1149 Ga0500616_0025011 3300053153 Bacteria 3313
1150 Ga0500616_0044112 3300053153 Bacteria 2380
1151 Ga0500616_0062010 3300053153 Bacteria 1933
1152 Ga0500620_000576 3300053155 Bacteria 6304
1153 Ga0500622_0000458 3300053156 Bacteria 38693
1154 Ga0500622_0000627 3300053156 Bacteria 31781
1155 Ga0500622_0004784 3300053156 Bacteria 8325
1156 Ga0500622_0009618 3300053156 Bacteria 5342
1157 Ga0500622_0019462 3300053156 Bacteria 3605
1158 Ga0500622_0035314 3300053156 Bacteria 2616
1159 Ga0500624_005531 3300053157 Bacteria 1682
1160 Ga0500627_0072248 3300053158 Bacteria 1529
1161 Ga0500627_0075524 3300053158 Bacteria 1497
1162 Ga0500627_0093577 3300053158 Bacteria 1346
1163 Ga0500634_0000041 3300053161 Bacteria 59177
1164 Ga0500634_0000261 3300053161 Bacteria 16846
1165 Ga0500636_0000180 3300053177 Bacteria 33813
1166 Ga0500645_001032 3300053730 Bacteria 15600
1167 Ga0500645_001323 3300053730 Bacteria 12840
1168 Ga0501084_0004414 3300054114 Bacteria 11476
1169 Ga0501084_0035642 3300054114 Bacteria 4159
1170 Ga0501084_0159408 3300054114 Bacteria 1903
1171 Ga0501084_0243561 3300054114 Bacteria 1518
1172 Ga0587068_009854 3300059641 Bacteria 1414
1173 Ga0501082_0019524 3300060353 Bacteria 5844
1174 Ga0501082_0030438 3300060353 Bacteria 4651
1175 Ga0501082_0045872 3300060353 Bacteria 3768
1176 Ga0530510_0033362 3300061734 Bacteria 3707
1177 Ga0530510_0089281 3300061734 Bacteria 2247

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0004591 Ga0501047_0004591_15_938 282
2 3300009553 Ga0105249_10092252 Ga0105249_100922523 289
3 iso_pu_bacteria 8004395343 8004400655 299
4 3300009148 Ga0105243_10166001 Ga0105243_101660012 305
5 3300009148 Ga0105243_10580402 Ga0105243_105804021 305
6 3300009176 Ga0105242_10028628 Ga0105242_100286282 305
7 3300009176 Ga0105242_10301588 Ga0105242_103015882 305
8 3300009177 Ga0105248_10263764 Ga0105248_102637641 305
9 3300011119 Ga0105246_10006723 Ga0105246_100067235 305
10 3300013308 Ga0157375_10296609 Ga0157375_102966092 305
11 3300014745 Ga0157377_10011153 Ga0157377_100111533 305
12 3300048912 Ga0496109_0193465 Ga0496109_0193465_683_1669 305
13 3300048913 Ga0496110_0158482 Ga0496110_0158482_441_1427 305
14 3300049578 Ga0501042_0128070 Ga0501042_0128070_34_1017 305
15 3300050508 nmdc:mga09592_142995_c1 nmdc:mga09592_142995_c1_182_1165 305
16 3300053087 Ga0500643_042891 Ga0500643_042891_19_981 309
17 3300053125 Ga0500618_016011 Ga0500618_016011_896_1873 314
18 3300002077 JGI24744J21845_10016419 JGI24744J21845_100164192 316
19 3300005328 Ga0070676_10038717 Ga0070676_100387172 316
20 3300005331 Ga0070670_100003032 Ga0070670_10000303212 316
21 3300005334 Ga0068869_100264930 Ga0068869_1002649302 316
22 3300005338 Ga0068868_100023793 Ga0068868_1000237934 316
23 3300005340 Ga0070689_100047479 Ga0070689_1000474793 316
24 3300005347 Ga0070668_100168933 Ga0070668_1001689332 316
25 3300005354 Ga0070675_100014504 Ga0070675_1000145044 316
26 3300005356 Ga0070674_100001105 Ga0070674_1000011056 316
27 3300005356 Ga0070674_100065860 Ga0070674_1000658602 316
28 3300005365 Ga0070688_100028395 Ga0070688_1000283952 316
29 3300005456 Ga0070678_100018307 Ga0070678_1000183073 316
30 3300005456 Ga0070678_100281065 Ga0070678_1002810652 316
31 3300005466 Ga0070685_10017126 Ga0070685_100171262 316
32 3300005544 Ga0070686_100002414 Ga0070686_1000024142 316
33 3300005548 Ga0070665_100098125 Ga0070665_1000981253 316
34 3300005564 Ga0070664_100018666 Ga0070664_1000186663 316
35 3300005577 Ga0068857_100029006 Ga0068857_1000290063 316
36 3300005615 Ga0070702_100040085 Ga0070702_1000400852 316
37 3300005618 Ga0068864_100002913 Ga0068864_1000029132 316
38 3300005840 Ga0068870_10016476 Ga0068870_100164762 316
39 3300005937 Ga0081455_10101948 Ga0081455_101019482 316
40 3300006358 Ga0068871_100254352 Ga0068871_1002543522 316
41 3300006844 Ga0075428_100043000 Ga0075428_1000430002 316
42 3300006846 Ga0075430_100013382 Ga0075430_1000133823 316
43 3300006852 Ga0075433_10114709 Ga0075433_101147092 316
44 3300006880 Ga0075429_100022586 Ga0075429_1000225864 316
45 3300006880 Ga0075429_100174417 Ga0075429_1001744172 316
46 3300006881 Ga0068865_100059929 Ga0068865_1000599292 316
47 3300007076 Ga0075435_100017580 Ga0075435_1000175804 316
48 3300009094 Ga0111539_10032300 Ga0111539_100323003 316
49 3300009098 Ga0105245_10004544 Ga0105245_1000454412 316
50 3300025901 Ga0207688_10015208 Ga0207688_100152084 316
51 3300025907 Ga0207645_10007970 Ga0207645_100079706 316
52 3300025908 Ga0207643_10060789 Ga0207643_100607892 316
53 3300025918 Ga0207662_10033707 Ga0207662_100337073 316
54 3300025925 Ga0207650_10011696 Ga0207650_100116964 316
55 3300025925 Ga0207650_10073554 Ga0207650_100735542 316
56 3300025927 Ga0207687_10127876 Ga0207687_101278762 316
57 3300025933 Ga0207706_10244122 Ga0207706_102441222 316
58 3300025934 Ga0207686_10087696 Ga0207686_100876962 316
59 3300025935 Ga0207709_10151631 Ga0207709_101516312 316
60 3300025937 Ga0207669_10007020 Ga0207669_100070202 316
61 3300025940 Ga0207691_10293629 Ga0207691_102936292 316
62 3300025942 Ga0207689_10079487 Ga0207689_100794872 316
63 3300025944 Ga0207661_10042650 Ga0207661_100426502 316
64 3300026035 Ga0207703_10224965 Ga0207703_102249652 316
65 3300026088 Ga0207641_10294916 Ga0207641_102949162 316
66 3300026121 Ga0207683_10049695 Ga0207683_100496952 316
67 3300026121 Ga0207683_10219024 Ga0207683_102190242 316
68 3300027907 Ga0207428_10005251 Ga0207428_100052513 316
69 3300048911 Ga0496108_0221932 Ga0496108_0221932_571_1590 316
70 3300049568 Ga0501031_0021717 Ga0501031_0021717_2063_3079 316
71 3300049568 Ga0501031_0029115 Ga0501031_0029115_1539_2555 316
72 3300049572 Ga0501036_0003168 Ga0501036_0003168_9797_10813 316
73 3300049572 Ga0501036_0067948 Ga0501036_0067948_789_1805 316
74 3300049574 Ga0501038_0032793 Ga0501038_0032793_2384_3400 316
75 3300049575 Ga0501039_0029009 Ga0501039_0029009_2647_3663 316
76 3300049575 Ga0501039_0063883 Ga0501039_0063883_793_1809 316
77 3300049575 Ga0501039_0134403 Ga0501039_0134403_667_1686 316
78 3300049576 Ga0501040_0006707 Ga0501040_0006707_5774_6790 316
79 3300049576 Ga0501040_0022820 Ga0501040_0022820_976_1992 316
80 3300049578 Ga0501042_0021347 Ga0501042_0021347_812_1828 316
81 3300049578 Ga0501042_0194362 Ga0501042_0194362_432_1448 316
82 3300049579 Ga0501043_0021406 Ga0501043_0021406_425_1441 316
83 3300049580 Ga0501046_0003329 Ga0501046_0003329_622_1638 316
84 3300049582 Ga0501048_0286447 Ga0501048_0286447_70_1086 316
85 3300049583 Ga0501067_0035321 Ga0501067_0035321_920_1936 316
86 3300049584 Ga0501068_0010703 Ga0501068_0010703_2553_3569 316
87 3300049584 Ga0501068_0022112 Ga0501068_0022112_521_1537 316
88 3300049584 Ga0501068_0132289 Ga0501068_0132289_131_1147 316
89 3300049585 Ga0501069_0070269 Ga0501069_0070269_430_1446 316
90 3300049587 Ga0501071_0015623 Ga0501071_0015623_3001_4017 316
91 3300049587 Ga0501071_0172254 Ga0501071_0172254_31_1047 316
92 3300049588 Ga0501072_0006570 Ga0501072_0006570_5134_6150 316
93 3300049588 Ga0501072_0110393 Ga0501072_0110393_467_1480 316
94 3300049588 Ga0501072_0156423 Ga0501072_0156423_245_1261 316
95 3300049590 Ga0501074_0006671 Ga0501074_0006671_1507_2523 316
96 3300049590 Ga0501074_0182621 Ga0501074_0182621_459_1475 316
97 3300049591 Ga0501075_0005584 Ga0501075_0005584_5746_6762 316
98 3300049591 Ga0501075_0117059 Ga0501075_0117059_544_1563 316
99 3300049591 Ga0501075_0125926 Ga0501075_0125926_43_1059 316
100 3300049592 Ga0501076_0094212 Ga0501076_0094212_1123_2142 316
101 3300049592 Ga0501076_0147835 Ga0501076_0147835_420_1427 316
102 3300049592 Ga0501076_0427094 Ga0501076_0427094_31_1047 316
103 3300049593 Ga0501077_0018272 Ga0501077_0018272_2498_3514 316
104 3300049593 Ga0501077_0080859 Ga0501077_0080859_1012_2028 316
105 3300049741 Ga0501079_0013164 Ga0501079_0013164_4094_5110 316
106 3300049742 Ga0501080_0067657 Ga0501080_0067657_1260_2276 316
107 3300049743 Ga0501081_0007123 Ga0501081_0007123_2387_3403 316
108 3300049743 Ga0501081_0038321 Ga0501081_0038321_1044_2060 316
109 3300049822 Ga0501035_0017631 Ga0501035_0017631_4212_5228 316
110 3300049824 Ga0501045_0045184 Ga0501045_0045184_1539_2555 316
111 3300050507 nmdc:mga05p37_204559_c1 nmdc:mga05p37_204559_c1_1361_2377 316
112 3300050507 nmdc:mga05p37_695355_c1 nmdc:mga05p37_695355_c1_60_1076 316
113 3300050508 nmdc:mga09592_264916_c1 nmdc:mga09592_264916_c1_378_1391 316
114 3300050509 nmdc:mga0qj67_87777_c1 nmdc:mga0qj67_87777_c1_192_1205 316
115 3300050510 nmdc:mga06r32_100635_c1 nmdc:mga06r32_100635_c1_535_1548 316
116 3300050513 nmdc:mga0rr50_142263_c1 nmdc:mga0rr50_142263_c1_762_1778 316
117 3300050514 nmdc:mga08x19_261471_c1 nmdc:mga08x19_261471_c1_16_1032 316
118 3300050515 nmdc:mga0a205_8555_c1 nmdc:mga0a205_8555_c1_402_1418 316
119 3300054114 Ga0501084_0004414 Ga0501084_0004414_2504_3520 316
120 3300054114 Ga0501084_0035642 Ga0501084_0035642_1786_2802 316
121 3300054114 Ga0501084_0243561 Ga0501084_0243561_456_1469 316
122 3300060353 Ga0501082_0019524 Ga0501082_0019524_3073_4089 316
123 3300060353 Ga0501082_0045872 Ga0501082_0045872_500_1516 316
124 3300061734 Ga0530510_0033362 Ga0530510_0033362_1758_2774 316
125 iso_pu_bacteria 2869234852 2869240035 320
126 iso_pu_bacteria 2977971508 2977976288 320
127 3300005354 Ga0070675_100054361 Ga0070675_1000543611 327
128 3300048915 Ga0496112_0182082 Ga0496112_0182082_986_2041 327
129 3300028577 Ga0265318_10039618 Ga0265318_100396182 331
130 3300039447 Ga0436361_0974810 Ga0436361_0974810_35_1063 331
131 3300048903 Ga0496100_0043880 Ga0496100_0043880_578_1708 334
132 3300048904 Ga0496101_0007333 Ga0496101_0007333_160_1290 334
133 3300048917 Ga0496114_0000962 Ga0496114_0000962_12771_13901 334
134 3300048918 Ga0496115_0037401 Ga0496115_0037401_562_1692 334
135 3300044712 Ga0453684_0239025 Ga0453684_0239025_877_2073 335
136 3300005617 Ga0068859_100256800 Ga0068859_1002568002 337
137 3300006931 Ga0097620_100256807 Ga0097620_1002568072 337
138 3300025940 Ga0207691_10030454 Ga0207691_100304545 337
139 3300005331 Ga0070670_100028366 Ga0070670_1000283662 338
140 3300028800 Ga0265338_10001695 Ga0265338_1000169526 339
141 3300001979 JGI24740J21852_10000015 JGI24740J21852_1000001539 340
142 3300002737 JGI25162J39368_1000368 JGI25162J39368_100036824 340
143 3300003214 JGI25165J46597_1000516 JGI25165J46597_100051610 340
144 3300003322 rootL2_10006964 rootL2_100069645 340
145 3300005614 Ga0068856_100013130 Ga0068856_1000131304 340
146 3300006931 Ga0097620_100468647 Ga0097620_1004686472 340
147 3300025233 Ga0209437_100098 Ga0209437_100098171 340
148 3300025261 Ga0209233_1000095 Ga0209233_1000095288 340
149 3300025272 Ga0209455_1014510 Ga0209455_10145102 340
150 3300048925 Ga0496122_0010294 Ga0496122_0010294_2186_3307 340
151 3300003322 rootL2_10022274 rootL2_100222744 341
152 3300006177 Ga0075362_10013866 Ga0075362_100138663 341
153 3300028563 Ga0265319_1007656 Ga0265319_10076563 341
154 3300028577 Ga0265318_10000206 Ga0265318_1000020611 341
155 3300031235 Ga0265330_10003483 Ga0265330_100034834 341
156 3300031238 Ga0265332_10004106 Ga0265332_100041065 341
157 3300031239 Ga0265328_10000435 Ga0265328_100004355 341
158 3300031240 Ga0265320_10002191 Ga0265320_1000219110 341
159 3300031242 Ga0265329_10000781 Ga0265329_1000078112 341
160 3300031344 Ga0265316_10005524 Ga0265316_100055247 341
161 3300031595 Ga0265313_10015661 Ga0265313_100156614 341
162 3300031711 Ga0265314_10005244 Ga0265314_100052443 341
163 3300031712 Ga0265342_10002774 Ga0265342_100027744 341
164 3300048927 Ga0496124_0100368 Ga0496124_0100368_1247_2305 341
165 3300050489 nmdc:mga03683_1625_c2 nmdc:mga03683_1625_c2_566_1744 341
166 iso_pu_bacteria 646564506 646814839 341
167 3300002737 JGI25162J39368_1000366 JGI25162J39368_100036626 342
168 3300003214 JGI25165J46597_1001042 JGI25165J46597_100104211 342
169 3300003791 Ga0055530_10003980 Ga0055530_100039806 342
170 3300025233 Ga0209437_100051 Ga0209437_100051331 342
171 3300025261 Ga0209233_1000113 Ga0209233_100011312 342
172 3300025298 Ga0209050_1000908 Ga0209050_100090811 342
173 3300032004 Ga0307414_10163823 Ga0307414_101638232 342
174 3300039437 Ga0436365_0842412 Ga0436365_0842412_1027_2127 342
175 3300046558 Ga0495633_0002890 Ga0495633_0002890_2711_3820 342
176 3300053153 Ga0500616_0001109 Ga0500616_0001109_11014_12147 342
177 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001289 343
178 3300002705 JGI25156J39149_1000001 JGI25156J39149_100000144 343
179 3300002738 JGI25154J39366_1000122 JGI25154J39366_100012213 343
180 3300002741 JGI25157J39369_1000044 JGI25157J39369_100004443 343
181 3300003214 JGI25165J46597_1009070 JGI25165J46597_10090702 343
182 3300005548 Ga0070665_100042535 Ga0070665_1000425353 343
183 3300005616 Ga0068852_100248618 Ga0068852_1002486182 343
184 3300006353 Ga0075370_10017996 Ga0075370_100179963 343
185 3300009093 Ga0105240_10000076 Ga0105240_10000076158 343
186 3300009148 Ga0105243_10176018 Ga0105243_101760182 343
187 3300009545 Ga0105237_10000226 Ga0105237_1000022637 343
188 3300010375 Ga0105239_10000641 Ga0105239_100006419 343
189 3300013104 Ga0157370_10000455 Ga0157370_1000045539 343
190 3300013105 Ga0157369_10377473 Ga0157369_103774731 343
191 3300015262 Ga0182007_10001815 Ga0182007_1000181510 343
192 3300015265 Ga0182005_1004710 Ga0182005_10047102 343
193 3300025206 Ga0209435_100012 Ga0209435_100012340 343
194 3300025246 Ga0209646_1000026 Ga0209646_1000026340 343
195 3300025250 Ga0209026_1000014 Ga0209026_1000014340 343
196 3300025253 Ga0209677_101925 Ga0209677_1019254 343
197 3300025256 Ga0209759_1000012 Ga0209759_1000012340 343
198 3300025261 Ga0209233_1000427 Ga0209233_10004277 343
199 3300025913 Ga0207695_10000011 Ga0207695_1000001143 343
200 3300025914 Ga0207671_10000093 Ga0207671_1000009389 343
201 3300025981 Ga0207640_10072226 Ga0207640_100722262 343
202 3300026142 Ga0207698_10262390 Ga0207698_102623902 343
203 3300028379 Ga0268266_10030607 Ga0268266_100306072 343
204 3300028563 Ga0265319_1002859 Ga0265319_10028594 343
205 3300031250 Ga0265331_10002350 Ga0265331_1000235010 343
206 3300031344 Ga0265316_10156506 Ga0265316_101565062 343
207 3300031712 Ga0265342_10059285 Ga0265342_100592853 343
208 3300039062 Ga0400483_084393 Ga0400483_084393_695_1780 343
209 3300044765 Ga0466970_0005945 Ga0466970_0005945_3866_4987 343
210 3300044842 Ga0466957_0066171 Ga0466957_0066171_1033_2154 343
211 3300045976 Ga0466967_0031036 Ga0466967_0031036_2074_3195 343
212 3300048919 Ga0496116_0009760 Ga0496116_0009760_1487_2608 343
213 3300048920 Ga0496117_0001574 Ga0496117_0001574_12741_13862 343
214 3300048921 Ga0496118_0003357 Ga0496118_0003357_1354_2475 343
215 3300048922 Ga0496119_0022330 Ga0496119_0022330_1446_2567 343
216 3300048923 Ga0496120_0020008 Ga0496120_0020008_686_1807 343
217 3300048924 Ga0496121_0002536 Ga0496121_0002536_24656_25777 343
218 3300048925 Ga0496122_0047411 Ga0496122_0047411_2037_3158 343
219 3300048927 Ga0496124_0149850 Ga0496124_0149850_449_1570 343
220 3300048929 Ga0496126_0061773 Ga0496126_0061773_2034_3155 343
221 3300053153 Ga0500616_0062010 Ga0500616_0062010_411_1517 343
222 3300005344 Ga0070661_100008418 Ga0070661_1000084186 344
223 3300005539 Ga0068853_100001593 Ga0068853_1000015939 344
224 3300005616 Ga0068852_100093576 Ga0068852_1000935761 344
225 3300005834 Ga0068851_10001703 Ga0068851_100017033 344
226 3300009545 Ga0105237_10089906 Ga0105237_100899062 344
227 3300009551 Ga0105238_10017174 Ga0105238_100171743 344
228 3300010375 Ga0105239_10074698 Ga0105239_100746983 344
229 3300025321 Ga0207656_10000915 Ga0207656_100009157 344
230 3300025914 Ga0207671_10066354 Ga0207671_100663542 344
231 3300025920 Ga0207649_10003204 Ga0207649_100032043 344
232 3300025924 Ga0207694_10137643 Ga0207694_101376432 344
233 3300025981 Ga0207640_10058755 Ga0207640_100587552 344
234 3300026041 Ga0207639_10001696 Ga0207639_100016969 344
235 3300026142 Ga0207698_10020535 Ga0207698_100205353 344
236 3300050493 nmdc:mga0k408_74905_c1 nmdc:mga0k408_74905_c1_832_1965 344
237 3300053102 Ga0500554_043963 Ga0500554_043963_17_1084 344
238 3300028379 Ga0268266_10378352 Ga0268266_103783521 345
239 3300031712 Ga0265342_10014643 Ga0265342_100146432 345
240 3300026095 Ga0207676_10367245 Ga0207676_103672451 346
241 3300039447 Ga0436361_0998006 Ga0436361_0998006_511_1623 346
242 3300044712 Ga0453684_0139638 Ga0453684_0139638_1100_2350 346
243 3300049583 Ga0501067_0011338 Ga0501067_0011338_1979_3064 347
244 3300005843 Ga0068860_100000183 Ga0068860_10000018398 348
245 3300028381 Ga0268264_10000476 Ga0268264_1000047645 348
246 3300028563 Ga0265319_1010597 Ga0265319_10105972 348
247 3300031240 Ga0265320_10010969 Ga0265320_100109692 348
248 3300053122 Ga0500608_000259 Ga0500608_000259_6956_8068 348
249 3300005544 Ga0070686_100079093 Ga0070686_1000790931 350
250 3300005616 Ga0068852_100184323 Ga0068852_1001843232 350
251 3300005617 Ga0068859_100002560 Ga0068859_10000256010 350
252 3300005719 Ga0068861_100018208 Ga0068861_1000182082 350
253 3300006931 Ga0097620_100002560 Ga0097620_10000256010 350
254 3300009551 Ga0105238_10003533 Ga0105238_1000353311 350
255 3300025949 Ga0207667_10057794 Ga0207667_100577943 350
256 3300026023 Ga0207677_10201146 Ga0207677_102011462 350
257 3300026041 Ga0207639_10082103 Ga0207639_100821031 350
258 3300026118 Ga0207675_100049032 Ga0207675_1000490324 350
259 3300031712 Ga0265342_10058665 Ga0265342_100586652 350
260 iso_pu_bacteria 2643221574 2643884313 350
261 iso_pu_bacteria 2643221663 2644352792 350
262 iso_pu_bacteria 2643221699 2644548737 350
263 iso_pu_bacteria 2928972540 2928972901 350
264 iso_pu_bacteria 2941485952 2941486787 350
265 iso_pu_bacteria 2977240413 2977242681 350
266 3300005328 Ga0070676_10023523 Ga0070676_100235232 351
267 3300005329 Ga0070683_100005576 Ga0070683_1000055762 351
268 3300005330 Ga0070690_100100785 Ga0070690_1001007852 351
269 3300005338 Ga0068868_100055855 Ga0068868_1000558552 351
270 3300005343 Ga0070687_100005675 Ga0070687_1000056752 351
271 3300005347 Ga0070668_100002911 Ga0070668_10000291111 351
272 3300005354 Ga0070675_100068867 Ga0070675_1000688672 351
273 3300005364 Ga0070673_100002651 Ga0070673_1000026514 351
274 3300005367 Ga0070667_100267968 Ga0070667_1002679682 351
275 3300005444 Ga0070694_100142608 Ga0070694_1001426082 351
276 3300005459 Ga0068867_100010186 Ga0068867_1000101864 351
277 3300005535 Ga0070684_100073099 Ga0070684_1000730992 351
278 3300005616 Ga0068852_100010318 Ga0068852_1000103185 351
279 3300005719 Ga0068861_100040524 Ga0068861_1000405241 351
280 3300005841 Ga0068863_100016803 Ga0068863_1000168032 351
281 3300005842 Ga0068858_100088823 Ga0068858_1000888231 351
282 3300006881 Ga0068865_100007748 Ga0068865_1000077485 351
283 3300009094 Ga0111539_10074239 Ga0111539_100742393 351
284 3300009148 Ga0105243_10186964 Ga0105243_101869642 351
285 3300013297 Ga0157378_10047506 Ga0157378_100475062 351
286 3300013308 Ga0157375_10180529 Ga0157375_101805292 351
287 3300025315 Ga0207697_10031978 Ga0207697_100319782 351
288 3300025321 Ga0207656_10079580 Ga0207656_100795802 351
289 3300025885 Ga0207653_10037193 Ga0207653_100371932 351
290 3300025901 Ga0207688_10047884 Ga0207688_100478842 351
291 3300025907 Ga0207645_10001505 Ga0207645_1000150514 351
292 3300025918 Ga0207662_10009356 Ga0207662_100093564 351
293 3300025923 Ga0207681_10006107 Ga0207681_100061073 351
294 3300025926 Ga0207659_10059779 Ga0207659_100597792 351
295 3300025936 Ga0207670_10034359 Ga0207670_100343592 351
296 3300025936 Ga0207670_10054411 Ga0207670_100544112 351
297 3300025937 Ga0207669_10046066 Ga0207669_100460662 351
298 3300025938 Ga0207704_10004070 Ga0207704_100040702 351
299 3300025940 Ga0207691_10009401 Ga0207691_100094015 351
300 3300025940 Ga0207691_10018799 Ga0207691_100187992 351
301 3300025944 Ga0207661_10013261 Ga0207661_100132614 351
302 3300025960 Ga0207651_10002477 Ga0207651_100024772 351
303 3300025972 Ga0207668_10018441 Ga0207668_100184413 351
304 3300026075 Ga0207708_10008534 Ga0207708_100085342 351
305 3300026088 Ga0207641_10040754 Ga0207641_100407542 351
306 3300026089 Ga0207648_10009328 Ga0207648_100093286 351
307 3300026118 Ga0207675_100065731 Ga0207675_1000657313 351
308 3300026142 Ga0207698_10080084 Ga0207698_100800842 351
309 3300028381 Ga0268264_10185483 Ga0268264_101854832 351
310 3300037068 Ga0373925_0098230 Ga0373925_0098230_521_1651 351
311 3300042876 Ga0451577_0000027 Ga0451577_0000027_120488_121738 351
312 3300042876 Ga0451577_0002562 Ga0451577_0002562_19945_21195 351
313 3300042876 Ga0451577_0059473 Ga0451577_0059473_725_1975 351
314 3300044673 Ga0453683_0000022 Ga0453683_0000022_252852_254102 351
315 3300044673 Ga0453683_0000146 Ga0453683_0000146_96849_98099 351
316 3300044673 Ga0453683_0020622 Ga0453683_0020622_2024_3274 351
317 3300044673 Ga0453683_0090655 Ga0453683_0090655_135_1385 351
318 3300044712 Ga0453684_0000154 Ga0453684_0000154_28536_29786 351
319 3300044712 Ga0453684_0000213 Ga0453684_0000213_209119_210369 351
320 3300044712 Ga0453684_0000846 Ga0453684_0000846_69725_70975 351
321 3300044712 Ga0453684_0133152 Ga0453684_0133152_199_1449 351
322 3300044712 Ga0453684_0135017 Ga0453684_0135017_852_2102 351
323 3300045051 Ga0451576_0000032 Ga0451576_0000032_275277_276527 351
324 3300045051 Ga0451576_0000175 Ga0451576_0000175_128476_129726 351
325 3300045051 Ga0451576_0011426 Ga0451576_0011426_6209_7459 351
326 3300045051 Ga0451576_0013758 Ga0451576_0013758_1880_3130 351
327 3300045051 Ga0451576_0341613 Ga0451576_0341613_287_1417 351
328 3300046517 Ga0495630_0011311 Ga0495630_0011311_2462_3592 351
329 3300047319 Ga0495674_0008997 Ga0495674_0008997_902_2032 351
330 3300047472 Ga0495686_0000025 Ga0495686_0000025_206589_207728 351
331 3300048904 Ga0496101_0227588 Ga0496101_0227588_301_1431 351
332 3300048911 Ga0496108_0098416 Ga0496108_0098416_177_1307 351
333 3300048912 Ga0496109_0100563 Ga0496109_0100563_1448_2578 351
334 3300053077 Ga0495601_0037547 Ga0495601_0037547_1416_2546 351
335 iso_pu_bacteria 2503198000 2503201572 351
336 iso_pu_bacteria 2508501122 2509108400 351
337 iso_pu_bacteria 2508501123 2509113171 351
338 iso_pu_bacteria 2508501127 2509143270 351
339 iso_pu_bacteria 2509276018 2509367789 351
340 iso_pu_bacteria 2509276019 2509376467 351
341 iso_pu_bacteria 2509276021 2509392060 351
342 iso_pu_bacteria 2509276022 2509396344 351
343 iso_pu_bacteria 2509276033 2509445651 351
344 iso_pu_bacteria 2509276033 2509447048 351
345 iso_pu_bacteria 2510065019 2510133950 351
346 iso_pu_bacteria 2510065057 2510306451 351
347 iso_pu_bacteria 2510065059 2510315465 351
348 iso_pu_bacteria 2510461069 2510841899 351
349 iso_pu_bacteria 2510461076 2510895368 351
350 iso_pu_bacteria 2510917020 2511125297 351
351 iso_pu_bacteria 2510917022 2511135397 351
352 iso_pu_bacteria 2510917026 2511170666 351
353 iso_pu_bacteria 2510917028 2511187050 351
354 iso_pu_bacteria 2510917030 2511199024 351
355 iso_pu_bacteria 2511231027 2511389852 351
356 iso_pu_bacteria 2511231052 2511502241 351
357 iso_pu_bacteria 2512047086 2512533614 351
358 iso_pu_bacteria 2512875016 2512931458 351
359 iso_pu_bacteria 2512875024 2512959292 351
360 iso_pu_bacteria 2512875026 2512970697 351
361 iso_pu_bacteria 2513237084 2513567977 351
362 iso_pu_bacteria 2513237085 2513576937 351
363 iso_pu_bacteria 2513237086 2513584387 351
364 iso_pu_bacteria 2513237088 2513596470 351
365 iso_pu_bacteria 2513237089 2513604259 351
366 iso_pu_bacteria 2513237090 2513612757 351
367 iso_pu_bacteria 2513237091 2513618801 351
368 iso_pu_bacteria 2513237093 2513633391 351
369 iso_pu_bacteria 2513237103 2513708053 351
370 iso_pu_bacteria 2513237138 2513865595 351
371 iso_pu_bacteria 2513237140 2513884408 351
372 iso_pu_bacteria 2513237143 2513905006 351
373 iso_pu_bacteria 2513237144 2513909006 351
374 iso_pu_bacteria 2513237146 2513925388 351
375 iso_pu_bacteria 2513237156 2513986828 351
376 iso_pu_bacteria 2513237159 2514001507 351
377 iso_pu_bacteria 2513237160 2514006392 351
378 iso_pu_bacteria 2513237162 2514020012 351
379 iso_pu_bacteria 2513237164 2514033662 351
380 iso_pu_bacteria 2513237305 2514421513 351
381 iso_pu_bacteria 2513237351 2514589234 351
382 iso_pu_bacteria 2515075009 2515112999 351
383 iso_pu_bacteria 2515154107 2515609017 351
384 iso_pu_bacteria 2515154113 2515638509 351
385 iso_pu_bacteria 2515154114 2515640958 351
386 iso_pu_bacteria 2515154116 2515655360 351
387 iso_pu_bacteria 2515154134 2515739477 351
388 iso_pu_bacteria 2516143018 2516204141 351
389 iso_pu_bacteria 2516653046 2516893620 351
390 iso_pu_bacteria 2516653077 2517036699 351
391 iso_pu_bacteria 2516653085 2517077058 351
392 iso_pu_bacteria 2517093000 2517095826 351
393 iso_pu_bacteria 2517287029 2517407398 351
394 iso_pu_bacteria 2517487022 2517570332 351
395 iso_pu_bacteria 2519899620 2520380516 351
396 iso_pu_bacteria 2523231067 2523470734 351
397 iso_pu_bacteria 2524023207 2524448559 351
398 iso_pu_bacteria 2524023209 2524459584 351
399 iso_pu_bacteria 2529292951 2530645958 351
400 iso_pu_bacteria 2534681786 2535485134 351
401 iso_pu_bacteria 2534681796 2535516861 351
402 iso_pu_bacteria 2537561587 2537875438 351
403 iso_pu_bacteria 2551306084 2551674547 351
404 iso_pu_bacteria 2551306084 2551677928 351
405 iso_pu_bacteria 2551306085 2551687741 351
406 iso_pu_bacteria 2551306086 2551691430 351
407 iso_pu_bacteria 2551306087 2551700538 351
408 iso_pu_bacteria 2551306089 2551715573 351
409 iso_pu_bacteria 2551306090 2551715884 351
410 iso_pu_bacteria 2551306091 2551725515 351
411 iso_pu_bacteria 2551306092 2551732308 351
412 iso_pu_bacteria 2551306093 2551741369 351
413 iso_pu_bacteria 2554235003 2554248228 351
414 iso_pu_bacteria 2558860100 2558864466 351
415 iso_pu_bacteria 2558860242 2559295344 351
416 iso_pu_bacteria 2558860983 2561468375 351
417 iso_pu_bacteria 2582581279 2585150026 351
418 iso_pu_bacteria 2582581280 2585154817 351
419 iso_pu_bacteria 2582581283 2585166344 351
420 iso_pu_bacteria 2582581293 2585198588 351
421 iso_pu_bacteria 2582581294 2585202275 351
422 iso_pu_bacteria 2582581298 2585222827 351
423 iso_pu_bacteria 2582581299 2585231738 351
424 iso_pu_bacteria 2582581304 2585255079 351
425 iso_pu_bacteria 2582581306 2585267428 351
426 iso_pu_bacteria 2582581307 2585271134 351
427 iso_pu_bacteria 2582581308 2585277478 351
428 iso_pu_bacteria 2582581315 2585323338 351
429 iso_pu_bacteria 2582581316 2585331480 351
430 iso_pu_bacteria 2582581865 2585386496 351
431 iso_pu_bacteria 2582581866 2585393252 351
432 iso_pu_bacteria 2582581867 2585402402 351
433 iso_pu_bacteria 2585427526 2585527438 351
434 iso_pu_bacteria 2585427527 2585535105 351
435 iso_pu_bacteria 2585427528 2585538179 351
436 iso_pu_bacteria 2585427529 2585545410 351
437 iso_pu_bacteria 2585427530 2585555955 351
438 iso_pu_bacteria 2585427531 2585558858 351
439 iso_pu_bacteria 2585427590 2585822911 351
440 iso_pu_bacteria 2585427593 2585836128 351
441 iso_pu_bacteria 2585427594 2585843222 351
442 iso_pu_bacteria 2585427608 2585898240 351
443 iso_pu_bacteria 2585427609 2585904172 351
444 iso_pu_bacteria 2585427633 2585996199 351
445 iso_pu_bacteria 2585427634 2586000809 351
446 iso_pu_bacteria 2585428106 2587919248 351
447 iso_pu_bacteria 2585428125 2587980711 351
448 iso_pu_bacteria 2588253730 2588517296 351
449 iso_pu_bacteria 2597489875 2597813196 351
450 iso_pu_bacteria 2599185156 2599331747 351
451 iso_pu_bacteria 2599185170 2599417304 351
452 iso_pu_bacteria 2599185210 2599601656 351
453 iso_pu_bacteria 2599185236 2599721916 351
454 iso_pu_bacteria 2599185301 2599936717 351
455 iso_pu_bacteria 2599185352 2600194389 351
456 iso_pu_bacteria 2600254933 2600374363 351
457 iso_pu_bacteria 2600255279 2601610084 351
458 iso_pu_bacteria 2600255308 2601746859 351
459 iso_pu_bacteria 2615840624 2616293369 351
460 iso_pu_bacteria 2615840626 2616308953 351
461 iso_pu_bacteria 2615840698 2616554224 351
462 iso_pu_bacteria 2617270742 2617384722 351
463 iso_pu_bacteria 2643221545 2643748030 351
464 iso_pu_bacteria 2643221550 2643771085 351
465 iso_pu_bacteria 2643221551 2643776089 351
466 iso_pu_bacteria 2643221552 2643781629 351
467 iso_pu_bacteria 2643221555 2643794536 351
468 iso_pu_bacteria 2643221557 2643803092 351
469 iso_pu_bacteria 2643221558 2643811536 351
470 iso_pu_bacteria 2643221564 2643840044 351
471 iso_pu_bacteria 2643221568 2643856775 351
472 iso_pu_bacteria 2643221582 2643920348 351
473 iso_pu_bacteria 2643221583 2643923688 351
474 iso_pu_bacteria 2643221584 2643928304 351
475 iso_pu_bacteria 2643221595 2643984435 351
476 iso_pu_bacteria 2643221599 2644003162 351
477 iso_pu_bacteria 2643221607 2644050523 351
478 iso_pu_bacteria 2643221618 2644107283 351
479 iso_pu_bacteria 2643221623 2644129350 351
480 iso_pu_bacteria 2643221626 2644150849 351
481 iso_pu_bacteria 2643221627 2644153292 351
482 iso_pu_bacteria 2643221629 2644166900 351
483 iso_pu_bacteria 2643221634 2644193504 351
484 iso_pu_bacteria 2643221636 2644205751 351
485 iso_pu_bacteria 2643221637 2644209033 351
486 iso_pu_bacteria 2643221640 2644225077 351
487 iso_pu_bacteria 2643221642 2644232385 351
488 iso_pu_bacteria 2643221643 2644238684 351
489 iso_pu_bacteria 2643221653 2644298666 351
490 iso_pu_bacteria 2643221655 2644308678 351
491 iso_pu_bacteria 2643221659 2644335496 351
492 iso_pu_bacteria 2643221662 2644349414 351
493 iso_pu_bacteria 2643221674 2644411240 351
494 iso_pu_bacteria 2643221686 2644483441 351
495 iso_pu_bacteria 2643221688 2644492026 351
496 iso_pu_bacteria 2643221689 2644499652 351
497 iso_pu_bacteria 2643221691 2644508073 351
498 iso_pu_bacteria 2643221693 2644521962 351
499 iso_pu_bacteria 2643221698 2644539901 351
500 iso_pu_bacteria 2643221712 2644614619 351
501 iso_pu_bacteria 2643221718 2644652563 351
502 iso_pu_bacteria 2643221719 2644656895 351
503 iso_pu_bacteria 2643221723 2644676083 351
504 iso_pu_bacteria 2657244999 2657681557 351
505 iso_pu_bacteria 2667528174 2671111434 351
506 iso_pu_bacteria 2687453392 2688598478 351
507 iso_pu_bacteria 2690316117 2692315545 351
508 iso_pu_bacteria 2693429783 2694632941 351
509 iso_pu_bacteria 2693429784 2694636024 351
510 iso_pu_bacteria 2718217882 2719181801 351
511 iso_pu_bacteria 2718217927 2719386404 351
512 iso_pu_bacteria 2718217997 2719666152 351
513 iso_pu_bacteria 2718218009 2719732465 351
514 iso_pu_bacteria 2718218199 2720492572 351
515 iso_pu_bacteria 2718218232 2720614007 351
516 iso_pu_bacteria 2718218233 2720620812 351
517 iso_pu_bacteria 2718218235 2720632137 351
518 iso_pu_bacteria 2718218269 2720775865 351
519 iso_pu_bacteria 2718218363 2721147892 351
520 iso_pu_bacteria 2718218365 2721159343 351
521 iso_pu_bacteria 2718218366 2721164728 351
522 iso_pu_bacteria 2718218423 2721400108 351
523 iso_pu_bacteria 2721755514 2722840898 351
524 iso_pu_bacteria 2721755556 2723027469 351
525 iso_pu_bacteria 2721755684 2723561088 351
526 iso_pu_bacteria 2721755685 2723567684 351
527 iso_pu_bacteria 2721755686 2723575413 351
528 iso_pu_bacteria 2721755809 2724038921 351
529 iso_pu_bacteria 2721755810 2724045221 351
530 iso_pu_bacteria 2721755819 2724090472 351
531 iso_pu_bacteria 2721755822 2724104949 351
532 iso_pu_bacteria 2721755823 2724110808 351
533 iso_pu_bacteria 2724679232 2725952566 351
534 iso_pu_bacteria 2728369352 2730108405 351
535 iso_pu_bacteria 2728369365 2730165036 351
536 iso_pu_bacteria 2728369397 2730298975 351
537 iso_pu_bacteria 2738541293 2738800080 351
538 iso_pu_bacteria 2738541317 2738947339 351
539 iso_pu_bacteria 2738541333 2739032836 351
540 iso_pu_bacteria 2738543024 2739307196 351
541 iso_pu_bacteria 2738543031 2739349055 351
542 iso_pu_bacteria 2751185800 2753359761 351
543 iso_pu_bacteria 2751185821 2753462024 351
544 iso_pu_bacteria 2756170246 2756675433 351
545 iso_pu_bacteria 2757320392 2757569730 351
546 iso_pu_bacteria 2758568016 2758642022 351
547 iso_pu_bacteria 2765235802 2765464618 351
548 iso_pu_bacteria 2765235942 2766065864 351
549 iso_pu_bacteria 2767802442 2770195438 351
550 iso_pu_bacteria 2775506902 2776270625 351
551 iso_pu_bacteria 2775506904 2776280552 351
552 iso_pu_bacteria 2775507049 2776913920 351
553 iso_pu_bacteria 2775507266 2778175411 351
554 iso_pu_bacteria 2791355048 2792460022 351
555 iso_pu_bacteria 2791355082 2792585131 351
556 iso_pu_bacteria 2791355091 2792620775 351
557 iso_pu_bacteria 2791355092 2792626134 351
558 iso_pu_bacteria 2791355094 2792639070 351
559 iso_pu_bacteria 2791355123 2792749274 351
560 iso_pu_bacteria 2791355253 2793280308 351
561 iso_pu_bacteria 2791355256 2793294442 351
562 iso_pu_bacteria 2791355259 2793314548 351
563 iso_pu_bacteria 2791355260 2793320376 351
564 iso_pu_bacteria 2791355261 2793329545 351
565 iso_pu_bacteria 2791355262 2793334485 351
566 iso_pu_bacteria 2791355263 2793339202 351
567 iso_pu_bacteria 2791355264 2793348875 351
568 iso_pu_bacteria 2791355265 2793351837 351
569 iso_pu_bacteria 2791355266 2793362589 351
570 iso_pu_bacteria 2791355267 2793368879 351
571 iso_pu_bacteria 2802428858 2802720027 351
572 iso_pu_bacteria 2802428859 2802727040 351
573 iso_pu_bacteria 2802428860 2802731957 351
574 iso_pu_bacteria 2802428861 2802739288 351
575 iso_pu_bacteria 2802428862 2802745731 351
576 iso_pu_bacteria 2802428863 2802752332 351
577 iso_pu_bacteria 2802429268 2804752748 351
578 iso_pu_bacteria 2802429605 2805928806 351
579 iso_pu_bacteria 2802429606 2805935088 351
580 iso_pu_bacteria 2802429633 2806043816 351
581 iso_pu_bacteria 2802429634 2806050253 351
582 iso_pu_bacteria 2802429635 2806057069 351
583 iso_pu_bacteria 2802429636 2806064451 351
584 iso_pu_bacteria 2802429637 2806071718 351
585 iso_pu_bacteria 2808606387 2808987922 351
586 iso_pu_bacteria 2818991272 2819241408 351
587 iso_pu_bacteria 2818991435 2819539371 351
588 iso_pu_bacteria 2818991439 2819559057 351
589 iso_pu_bacteria 2818991448 2819609144 351
590 iso_pu_bacteria 2818991453 2819637628 351
591 iso_pu_bacteria 2818991454 2819647755 351
592 iso_pu_bacteria 2818991461 2819684907 351
593 iso_pu_bacteria 2821123053 2821127494 351
594 iso_pu_bacteria 2837678835 2837683132 351
595 iso_pu_bacteria 2838016132 2838017658 351
596 iso_pu_bacteria 2838022645 2838027541 351
597 iso_pu_bacteria 2838029111 2838029810 351
598 iso_pu_bacteria 2838035591 2838038496 351
599 iso_pu_bacteria 2838042994 2838043963 351
600 iso_pu_bacteria 2838048938 2838054391 351
601 iso_pu_bacteria 2838061910 2838068020 351
602 iso_pu_bacteria 2838068647 2838070148 351
603 iso_pu_bacteria 2838074704 2838076863 351
604 iso_pu_bacteria 2838661181 2838661593 351
605 iso_pu_bacteria 2838668709 2838670355 351
606 iso_pu_bacteria 2838675328 2838675781 351
607 iso_pu_bacteria 2838680041 2838683473 351
608 iso_pu_bacteria 2838686498 2838687060 351
609 iso_pu_bacteria 2838694306 2838697584 351
610 iso_pu_bacteria 2838701080 2838702726 351
611 iso_pu_bacteria 2838707686 2838710700 351
612 iso_pu_bacteria 2838714209 2838714663 351
613 iso_pu_bacteria 2838719591 2838721536 351
614 iso_pu_bacteria 2838724970 2838725423 351
615 iso_pu_bacteria 2838729681 2838729967 351
616 iso_pu_bacteria 2838736955 2838738018 351
617 iso_pu_bacteria 2838742623 2838743018 351
618 iso_pu_bacteria 2839993093 2839997030 351
619 iso_pu_bacteria 2840764183 2840767418 351
620 iso_pu_bacteria 2840878972 2840882920 351
621 iso_pu_bacteria 2841734538 2841739234 351
622 iso_pu_bacteria 2841840854 2841841613 351
623 iso_pu_bacteria 2841846520 2841848488 351
624 iso_pu_bacteria 2841851746 2841852504 351
625 iso_pu_bacteria 2841859092 2841862119 351
626 iso_pu_bacteria 2841864319 2841870777 351
627 iso_pu_bacteria 2842077413 2842078873 351
628 iso_pu_bacteria 2842110456 2842113275 351
629 iso_pu_bacteria 2842118031 2842118617 351
630 iso_pu_bacteria 2842124991 2842125481 351
631 iso_pu_bacteria 2842130223 2842130676 351
632 iso_pu_bacteria 2842140634 2842141391 351
633 iso_pu_bacteria 2842146304 2842148016 351
634 iso_pu_bacteria 2842152218 2842154154 351
635 iso_pu_bacteria 2842156927 2842158036 351
636 iso_pu_bacteria 2842163707 2842168800 351
637 iso_pu_bacteria 2842170452 2842170907 351
638 iso_pu_bacteria 2842175837 2842177774 351
639 iso_pu_bacteria 2842180545 2842181655 351
640 iso_pu_bacteria 2842187318 2842187772 351
641 iso_pu_bacteria 2842192696 2842197352 351
642 iso_pu_bacteria 2842198810 2842203551 351
643 iso_pu_bacteria 2842205361 2842205485 351
644 iso_pu_bacteria 2842211629 2842212083 351
645 iso_pu_bacteria 2842217011 2842217931 351
646 iso_pu_bacteria 2842224351 2842226298 351
647 iso_pu_bacteria 2842229732 2842230294 351
648 iso_pu_bacteria 2842237096 2842240529 351
649 iso_pu_bacteria 2842243621 2842244196 351
650 iso_pu_bacteria 2842250916 2842253082 351
651 iso_pu_bacteria 2842257432 2842257718 351
652 iso_pu_bacteria 2842264693 2842266261 351
653 iso_pu_bacteria 2842271015 2842271402 351
654 iso_pu_bacteria 2842278818 2842278942 351
655 iso_pu_bacteria 2842285085 2842285606 351
656 iso_pu_bacteria 2842291075 2842292535 351
657 iso_pu_bacteria 2842298080 2842301365 351
658 iso_pu_bacteria 2842304105 2842305030 351
659 iso_pu_bacteria 2842311132 2842314918 351
660 iso_pu_bacteria 2842317721 2842320704 351
661 iso_pu_bacteria 2842341865 2842346453 351
662 iso_pu_bacteria 2842357229 2842357902 351
663 iso_pu_bacteria 2842363717 2842368968 351
664 iso_pu_bacteria 2842370503 2842374104 351
665 iso_pu_bacteria 2842377471 2842378933 351
666 iso_pu_bacteria 2842384541 2842385128 351
667 iso_pu_bacteria 2842395702 2842399889 351
668 iso_pu_bacteria 2842402390 2842402966 351
669 iso_pu_bacteria 2842409023 2842409662 351
670 iso_pu_bacteria 2842415677 2842416313 351
671 iso_pu_bacteria 2842422224 2842423762 351
672 iso_pu_bacteria 2842428310 2842430724 351
673 iso_pu_bacteria 2842434925 2842437289 351
674 iso_pu_bacteria 2842441272 2842443659 351
675 iso_pu_bacteria 2842447887 2842454046 351
676 iso_pu_bacteria 2842462802 2842464867 351
677 iso_pu_bacteria 2842469257 2842471907 351
678 iso_pu_bacteria 2842475841 2842476905 351
679 iso_pu_bacteria 2842482326 2842484565 351
680 iso_pu_bacteria 2842489311 2842491972 351
681 iso_pu_bacteria 2842495871 2842496832 351
682 iso_pu_bacteria 2842502639 2842503338 351
683 iso_pu_bacteria 2842509118 2842511134 351
684 iso_pu_bacteria 2842515876 2842518903 351
685 iso_pu_bacteria 2842521101 2842521810 351
686 iso_pu_bacteria 2842871566 2842871953 351
687 iso_pu_bacteria 2842922631 2842924152 351
688 iso_pu_bacteria 2843744320 2843744386 351
689 iso_pu_bacteria 2844002411 2844007389 351
690 iso_pu_bacteria 2844009547 2844013740 351
691 iso_pu_bacteria 2844454524 2844458427 351
692 iso_pu_bacteria 2847417321 2847419393 351
693 iso_pu_bacteria 2847670302 2847675645 351
694 iso_pu_bacteria 2847686936 2847692287 351
695 iso_pu_bacteria 2848992105 2848994420 351
696 iso_pu_bacteria 2849560528 2849564970 351
697 iso_pu_bacteria 2849573788 2849575094 351
698 iso_pu_bacteria 2850079185 2850081463 351
699 iso_pu_bacteria 2851153111 2851155861 351
700 iso_pu_bacteria 2852387548 2852390220 351
701 iso_pu_bacteria 2854896431 2854899584 351
702 iso_pu_bacteria 2854911287 2854912413 351
703 iso_pu_bacteria 2854916844 2854918409 351
704 iso_pu_bacteria 2855020534 2855020588 351
705 iso_pu_bacteria 2855825444 2855826340 351
706 iso_pu_bacteria 2855839649 2855841730 351
707 iso_pu_bacteria 2855872281 2855872525 351
708 iso_pu_bacteria 2856314179 2856319531 351
709 iso_pu_bacteria 2856320880 2856323881 351
710 iso_pu_bacteria 2856328259 2856331131 351
711 iso_pu_bacteria 2856334872 2856340755 351
712 iso_pu_bacteria 2856342000 2856342650 351
713 iso_pu_bacteria 2856349417 2856354045 351
714 iso_pu_bacteria 2856364286 2856369494 351
715 iso_pu_bacteria 2857349434 2857351117 351
716 iso_pu_bacteria 2857504554 2857507522 351
717 iso_pu_bacteria 2857516855 2857517439 351
718 iso_pu_bacteria 2857531043 2857536493 351
719 iso_pu_bacteria 2858800743 2858802515 351
720 iso_pu_bacteria 2869162929 2869166907 351
721 iso_pu_bacteria 2869169390 2869174539 351
722 iso_pu_bacteria 2869256925 2869260259 351
723 iso_pu_bacteria 2869264136 2869269370 351
724 iso_pu_bacteria 2869271264 2869271486 351
725 iso_pu_bacteria 2869278585 2869284967 351
726 iso_pu_bacteria 2869285874 2869286152 351
727 iso_pu_bacteria 2871429161 2871434585 351
728 iso_pu_bacteria 2871451962 2871453250 351
729 iso_pu_bacteria 2871459585 2871460638 351
730 iso_pu_bacteria 2871466892 2871470740 351
731 iso_pu_bacteria 2871474448 2871480407 351
732 iso_pu_bacteria 2871481445 2871483511 351
733 iso_pu_bacteria 2871488783 2871494511 351
734 iso_pu_bacteria 2871495908 2871501364 351
735 iso_pu_bacteria 2874102143 2874106811 351
736 iso_pu_bacteria 2874109183 2874114180 351
737 iso_pu_bacteria 2874116593 2874122274 351
738 iso_pu_bacteria 2874123672 2874130635 351
739 iso_pu_bacteria 2874131515 2874136679 351
740 iso_pu_bacteria 2874139085 2874145909 351
741 iso_pu_bacteria 2874146452 2874149790 351
742 iso_pu_bacteria 2874155637 2874158049 351
743 iso_pu_bacteria 2874162495 2874167498 351
744 iso_pu_bacteria 2874168670 2874169896 351
745 iso_pu_bacteria 2876363079 2876368437 351
746 iso_pu_bacteria 2876369609 2876370175 351
747 iso_pu_bacteria 2876377896 2876379100 351
748 iso_pu_bacteria 2876386047 2876389924 351
749 iso_pu_bacteria 2876392853 2876398476 351
750 iso_pu_bacteria 2876399893 2876406348 351
751 iso_pu_bacteria 2876406927 2876413086 351
752 iso_pu_bacteria 2876413966 2876416253 351
753 iso_pu_bacteria 2876420981 2876425732 351
754 iso_pu_bacteria 2878035449 2878040766 351
755 iso_pu_bacteria 2878730984 2878732486 351
756 iso_pu_bacteria 2878738818 2878745252 351
757 iso_pu_bacteria 2878745973 2878751718 351
758 iso_pu_bacteria 2878753008 2878758907 351
759 iso_pu_bacteria 2878760144 2878765344 351
760 iso_pu_bacteria 2878767105 2878773051 351
761 iso_pu_bacteria 2878774303 2878778577 351
762 iso_pu_bacteria 2878781027 2878788151 351
763 iso_pu_bacteria 2878788777 2878794326 351
764 iso_pu_bacteria 2881147464 2881151552 351
765 iso_pu_bacteria 2881155292 2881155339 351
766 iso_pu_bacteria 2881161766 2881167567 351
767 iso_pu_bacteria 2881845957 2881847108 351
768 iso_pu_bacteria 2881853255 2881856829 351
769 iso_pu_bacteria 2881861095 2881868528 351
770 iso_pu_bacteria 2882632389 2882636306 351
771 iso_pu_bacteria 2884960567 2884960839 351
772 iso_pu_bacteria 2885305155 2885309468 351
773 iso_pu_bacteria 2885312484 2885317953 351
774 iso_pu_bacteria 2885318864 2885321636 351
775 iso_pu_bacteria 2885326080 2885331652 351
776 iso_pu_bacteria 2885334103 2885338390 351
777 iso_pu_bacteria 2888337043 2888339462 351
778 iso_pu_bacteria 2888343758 2888346857 351
779 iso_pu_bacteria 2888350351 2888355792 351
780 iso_pu_bacteria 2889010040 2889010733 351
781 iso_pu_bacteria 2889016732 2889017572 351
782 iso_pu_bacteria 2889790730 2889795441 351
783 iso_pu_bacteria 2889914905 2889919456 351
784 iso_pu_bacteria 2891048133 2891050861 351
785 iso_pu_bacteria 2891373044 2891373343 351
786 iso_pu_bacteria 2894652903 2894655995 351
787 iso_pu_bacteria 2894817345 2894820354 351
788 iso_pu_bacteria 2896384573 2896389030 351
789 iso_pu_bacteria 2898329390 2898332412 351
790 iso_pu_bacteria 2899275550 2899276210 351
791 iso_pu_bacteria 2899792073 2899796057 351
792 iso_pu_bacteria 2899803654 2899807273 351
793 iso_pu_bacteria 2899845264 2899850635 351
794 iso_pu_bacteria 2903448605 2903451358 351
795 iso_pu_bacteria 2903492973 2903503854 351
796 iso_pu_bacteria 2903492973 2903504663 351
797 iso_pu_bacteria 2903521522 2903527436 351
798 iso_pu_bacteria 2903528002 2903533890 351
799 iso_pu_bacteria 2903540706 2903546175 351
800 iso_pu_bacteria 2904578770 2904580621 351
801 iso_pu_bacteria 2904659560 2904665031 351
802 iso_pu_bacteria 2906308376 2906314116 351
803 iso_pu_bacteria 2906321335 2906327282 351
804 iso_pu_bacteria 2906328253 2906329975 351
805 iso_pu_bacteria 2906354277 2906359653 351
806 iso_pu_bacteria 2906363423 2906364059 351
807 iso_pu_bacteria 2906378014 2906378136 351
808 iso_pu_bacteria 2906393657 2906399236 351
809 iso_pu_bacteria 2906401398 2906403577 351
810 iso_pu_bacteria 2906408224 2906414030 351
811 iso_pu_bacteria 2906414383 2906420251 351
812 iso_pu_bacteria 2913295892 2913299315 351
813 iso_pu_bacteria 2913308742 2913312563 351
814 iso_pu_bacteria 2915650412 2915653152 351
815 iso_pu_bacteria 2915980308 2915981439 351
816 iso_pu_bacteria 2915986958 2915991443 351
817 iso_pu_bacteria 2915993759 2915998700 351
818 iso_pu_bacteria 2916007675 2916011657 351
819 iso_pu_bacteria 2916014648 2916020777 351
820 iso_pu_bacteria 2916021584 2916024958 351
821 iso_pu_bacteria 2916028427 2916033771 351
822 iso_pu_bacteria 2916035215 2916037866 351
823 iso_pu_bacteria 2916041962 2916045334 351
824 iso_pu_bacteria 2916048683 2916049042 351
825 iso_pu_bacteria 2916055098 2916055720 351
826 iso_pu_bacteria 2916061851 2916064904 351
827 iso_pu_bacteria 2916068649 2916073995 351
828 iso_pu_bacteria 2916076590 2916082598 351
829 iso_pu_bacteria 2919100787 2919107662 351
830 iso_pu_bacteria 2919114240 2919114701 351
831 iso_pu_bacteria 2919119836 2919121662 351
832 iso_pu_bacteria 2919166419 2919169238 351
833 iso_pu_bacteria 2919171160 2919174715 351
834 iso_pu_bacteria 2919408235 2919409975 351
835 iso_pu_bacteria 2920760137 2920761524 351
836 iso_pu_bacteria 2920822456 2920825210 351
837 iso_pu_bacteria 2921201388 2921203052 351
838 iso_pu_bacteria 2921208531 2921211112 351
839 iso_pu_bacteria 2921237296 2921240930 351
840 iso_pu_bacteria 2921244191 2921246774 351
841 iso_pu_bacteria 2921250672 2921252086 351
842 iso_pu_bacteria 2921257292 2921261407 351
843 iso_pu_bacteria 2921263974 2921266209 351
844 iso_pu_bacteria 2921282425 2921287975 351
845 iso_pu_bacteria 2921289301 2921290956 351
846 iso_pu_bacteria 2921296804 2921301760 351
847 iso_pu_bacteria 2922130491 2922132552 351
848 iso_pu_bacteria 2922158528 2922162868 351
849 iso_pu_bacteria 2922172374 2922174252 351
850 iso_pu_bacteria 2922185730 2922188142 351
851 iso_pu_bacteria 2923556063 2923558568 351
852 iso_pu_bacteria 2924144063 2924146754 351
853 iso_pu_bacteria 2924150972 2924157992 351
854 iso_pu_bacteria 2924158325 2924159274 351
855 iso_pu_bacteria 2924165586 2924169160 351
856 iso_pu_bacteria 2924172951 2924174569 351
857 iso_pu_bacteria 2924179722 2924183000 351
858 iso_pu_bacteria 2924186466 2924192711 351
859 iso_pu_bacteria 2924193448 2924195384 351
860 iso_pu_bacteria 2924200457 2924203325 351
861 iso_pu_bacteria 2924207177 2924210744 351
862 iso_pu_bacteria 2924221636 2924223294 351
863 iso_pu_bacteria 2924228884 2924230520 351
864 iso_pu_bacteria 2924710171 2924711103 351
865 iso_pu_bacteria 2924718760 2924719241 351
866 iso_pu_bacteria 2924726620 2924728545 351
867 iso_pu_bacteria 2924733363 2924736404 351
868 iso_pu_bacteria 2924741084 2924745874 351
869 iso_pu_bacteria 2924754689 2924757252 351
870 iso_pu_bacteria 2924762789 2924764213 351
871 iso_pu_bacteria 2924776078 2924783389 351
872 iso_pu_bacteria 2924784321 2924789111 351
873 iso_pu_bacteria 2926754445 2926755717 351
874 iso_pu_bacteria 2926760298 2926762832 351
875 iso_pu_bacteria 2928521798 2928523877 351
876 iso_pu_bacteria 2928531327 2928534176 351
877 iso_pu_bacteria 2929138655 2929140866 351
878 iso_pu_bacteria 2932401849 2932402717 351
879 iso_pu_bacteria 2933006813 2933008799 351
880 iso_pu_bacteria 2933011516 2933014923 351
881 iso_pu_bacteria 2933016740 2933022326 351
882 iso_pu_bacteria 2933570622 2933570838 351
883 iso_pu_bacteria 2933586486 2933588669 351
884 iso_pu_bacteria 2933594066 2933596600 351
885 iso_pu_bacteria 2933599457 2933600954 351
886 iso_pu_bacteria 2935894831 2935897031 351
887 iso_pu_bacteria 2935901341 2935901964 351
888 iso_pu_bacteria 2936367885 2936372043 351
889 iso_pu_bacteria 2936375103 2936379906 351
890 iso_pu_bacteria 2936381700 2936382810 351
891 iso_pu_bacteria 2936996657 2937000704 351
892 iso_pu_bacteria 2937002841 2937004560 351
893 iso_pu_bacteria 2937009748 2937011196 351
894 iso_pu_bacteria 2937016420 2937019825 351
895 iso_pu_bacteria 2937023124 2937024582 351
896 iso_pu_bacteria 2937029754 2937030285 351
897 iso_pu_bacteria 2937036028 2937042667 351
898 iso_pu_bacteria 2937042894 2937045538 351
899 iso_pu_bacteria 2937056579 2937063572 351
900 iso_pu_bacteria 2937063883 2937067772 351
901 iso_pu_bacteria 2937071275 2937074389 351
902 iso_pu_bacteria 2937078374 2937080277 351
903 iso_pu_bacteria 2937084907 2937086024 351
904 iso_pu_bacteria 2937091812 2937097219 351
905 iso_pu_bacteria 2937098957 2937103037 351
906 iso_pu_bacteria 2937106411 2937113299 351
907 iso_pu_bacteria 2937113482 2937116146 351
908 iso_pu_bacteria 2937119839 2937121983 351
909 iso_pu_bacteria 2937126314 2937128824 351
910 iso_pu_bacteria 2937813078 2937815774 351
911 iso_pu_bacteria 2937822353 2937824500 351
912 iso_pu_bacteria 2937836603 2937838186 351
913 iso_pu_bacteria 2937843397 2937848002 351
914 iso_pu_bacteria 2937848649 2937853146 351
915 iso_pu_bacteria 2937861824 2937861988 351
916 iso_pu_bacteria 2937868953 2937873176 351
917 iso_pu_bacteria 2937877337 2937882088 351
918 iso_pu_bacteria 2937891427 2937896103 351
919 iso_pu_bacteria 2937972304 2937978549 351
920 iso_pu_bacteria 2937994558 2938000033 351
921 iso_pu_bacteria 2941499720 2941502141 351
922 iso_pu_bacteria 2954011201 2954012821 351
923 iso_pu_bacteria 2957375807 2957376386 351
924 iso_pu_bacteria 2957382221 2957384279 351
925 iso_pu_bacteria 2957388812 2957390742 351
926 iso_pu_bacteria 2957395598 2957395898 351
927 iso_pu_bacteria 2957402308 2957404504 351
928 iso_pu_bacteria 2957408893 2957412091 351
929 iso_pu_bacteria 2957415311 2957421207 351
930 iso_pu_bacteria 2957422303 2957425697 351
931 iso_pu_bacteria 2957430029 2957431714 351
932 iso_pu_bacteria 2957437181 2957438172 351
933 iso_pu_bacteria 2957443900 2957446910 351
934 iso_pu_bacteria 2957450854 2957453752 351
935 iso_pu_bacteria 2957457609 2957461623 351
936 iso_pu_bacteria 2957464669 2957467046 351
937 iso_pu_bacteria 2957471148 2957476390 351
938 iso_pu_bacteria 2957478035 2957479606 351
939 iso_pu_bacteria 2957484790 2957490464 351
940 iso_pu_bacteria 2957491536 2957494105 351
941 iso_pu_bacteria 2957498199 2957503308 351
942 iso_pu_bacteria 2957505466 2957510612 351
943 iso_pu_bacteria 2958034702 2958040669 351
944 iso_pu_bacteria 2958041894 2958051248 351
945 iso_pu_bacteria 2958041894 2958056751 351
946 iso_pu_bacteria 2958064165 2958064272 351
947 iso_pu_bacteria 2958071322 2958078163 351
948 iso_pu_bacteria 2958084443 2958089210 351
949 iso_pu_bacteria 2958100919 2958104767 351
950 iso_pu_bacteria 2958108152 2958114548 351
951 iso_pu_bacteria 2958115193 2958118491 351
952 iso_pu_bacteria 2958122699 2958125318 351
953 iso_pu_bacteria 2958130278 2958130551 351
954 iso_pu_bacteria 2958144490 2958147255 351
955 iso_pu_bacteria 2958158011 2958163201 351
956 iso_pu_bacteria 2958165035 2958170497 351
957 iso_pu_bacteria 2958172287 2958175705 351
958 iso_pu_bacteria 2958179912 2958184756 351
959 iso_pu_bacteria 2960584000 2960585416 351
960 iso_pu_bacteria 2960591022 2960592085 351
961 iso_pu_bacteria 2960597568 2960599995 351
962 iso_pu_bacteria 2960603979 2960610587 351
963 iso_pu_bacteria 2960610863 2960612318 351
964 iso_pu_bacteria 2960617483 2960620462 351
965 iso_pu_bacteria 2960624210 2960624483 351
966 iso_pu_bacteria 2960631154 2960632045 351
967 iso_pu_bacteria 2960637947 2960644126 351
968 iso_pu_bacteria 2960645483 2960648417 351
969 iso_pu_bacteria 2960652885 2960656528 351
970 iso_pu_bacteria 2960660292 2960665569 351
971 iso_pu_bacteria 2960667422 2960669656 351
972 iso_pu_bacteria 2960674078 2960675162 351
973 iso_pu_bacteria 2960680706 2960681620 351
974 iso_pu_bacteria 2960687367 2960691470 351
975 iso_pu_bacteria 2960693952 2960694804 351
976 iso_pu_bacteria 2961077736 2961082923 351
977 iso_pu_bacteria 2961114664 2961120032 351
978 iso_pu_bacteria 2961127735 2961133893 351
979 iso_pu_bacteria 2961136820 2961141066 351
980 iso_pu_bacteria 2961163497 2961168952 351
981 iso_pu_bacteria 2961170736 2961176014 351
982 iso_pu_bacteria 2963644680 2963647755 351
983 iso_pu_bacteria 2964607997 2964609782 351
984 iso_pu_bacteria 2964615318 2964617750 351
985 iso_pu_bacteria 2964621998 2964623635 351
986 iso_pu_bacteria 2964628898 2964632584 351
987 iso_pu_bacteria 2964636051 2964640821 351
988 iso_pu_bacteria 2964643177 2964645688 351
989 iso_pu_bacteria 2964649959 2964651553 351
990 iso_pu_bacteria 2964656573 2964660523 351
991 iso_pu_bacteria 2964663802 2964666925 351
992 iso_pu_bacteria 2964670856 2964674439 351
993 iso_pu_bacteria 2964678106 2964682872 351
994 iso_pu_bacteria 2964685014 2964688480 351
995 iso_pu_bacteria 2964691889 2964692477 351
996 iso_pu_bacteria 2964698721 2964701645 351
997 iso_pu_bacteria 2964705432 2964711095 351
998 iso_pu_bacteria 2964712639 2964715162 351
999 iso_pu_bacteria 2964719344 2964720676 351
1000 iso_pu_bacteria 2965018300 2965024239 351
1001 iso_pu_bacteria 2965025482 2965031520 351
1002 iso_pu_bacteria 2965040258 2965044323 351
1003 iso_pu_bacteria 2965062239 2965065029 351
1004 iso_pu_bacteria 2965089291 2965089869 351
1005 iso_pu_bacteria 2965102966 2965109472 351
1006 iso_pu_bacteria 2967664464 2967666383 351
1007 iso_pu_bacteria 2967671571 2967678416 351
1008 iso_pu_bacteria 2967678726 2967684428 351
1009 iso_pu_bacteria 2967686174 2967689718 351
1010 iso_pu_bacteria 2967693043 2967694641 351
1011 iso_pu_bacteria 2967699805 2967705098 351
1012 iso_pu_bacteria 2967706974 2967708619 351
1013 iso_pu_bacteria 2967714385 2967714872 351
1014 iso_pu_bacteria 2967721400 2967726126 351
1015 iso_pu_bacteria 2967728569 2967728996 351
1016 iso_pu_bacteria 2967735183 2967737145 351
1017 iso_pu_bacteria 2967742019 2967742552 351
1018 iso_pu_bacteria 2967748971 2967751605 351
1019 iso_pu_bacteria 2967755722 2967760015 351
1020 iso_pu_bacteria 2967762386 2967767512 351
1021 iso_pu_bacteria 2967769361 2967772123 351
1022 iso_pu_bacteria 2967775926 2967782237 351
1023 iso_pu_bacteria 2967996073 2968001902 351
1024 iso_pu_bacteria 2968003550 2968009074 351
1025 iso_pu_bacteria 2968016561 2968018409 351
1026 iso_pu_bacteria 2968083720 2968090388 351
1027 iso_pu_bacteria 2968091066 2968096396 351
1028 iso_pu_bacteria 2968097103 2968098897 351
1029 iso_pu_bacteria 2968110612 2968116389 351
1030 iso_pu_bacteria 2968117919 2968120664 351
1031 iso_pu_bacteria 2968128360 2968129216 351
1032 iso_pu_bacteria 2968138860 2968144246 351
1033 iso_pu_bacteria 2968171901 2968177346 351
1034 iso_pu_bacteria 2970019648 2970021064 351
1035 iso_pu_bacteria 2970026789 2970028346 351
1036 iso_pu_bacteria 2970033650 2970040287 351
1037 iso_pu_bacteria 2970040964 2970042637 351
1038 iso_pu_bacteria 2970047711 2970050968 351
1039 iso_pu_bacteria 2970054988 2970056698 351
1040 iso_pu_bacteria 2970061556 2970067140 351
1041 iso_pu_bacteria 2970068827 2970071584 351
1042 iso_pu_bacteria 2970076120 2970078260 351
1043 iso_pu_bacteria 2970082768 2970085242 351
1044 iso_pu_bacteria 2970088815 2970092544 351
1045 iso_pu_bacteria 2970095765 2970102158 351
1046 iso_pu_bacteria 2970102677 2970108001 351
1047 iso_pu_bacteria 2970109326 2970110706 351
1048 iso_pu_bacteria 2970116247 2970117352 351
1049 iso_pu_bacteria 2970122695 2970125825 351
1050 iso_pu_bacteria 2970129317 2970131168 351
1051 iso_pu_bacteria 2970136068 2970136290 351
1052 iso_pu_bacteria 2970143518 2970146731 351
1053 iso_pu_bacteria 2970149975 2970151618 351
1054 iso_pu_bacteria 2970156795 2970159565 351
1055 iso_pu_bacteria 2970164137 2970166980 351
1056 iso_pu_bacteria 2970170962 2970174240 351
1057 iso_pu_bacteria 2970177841 2970180822 351
1058 iso_pu_bacteria 2970184632 2970189167 351
1059 iso_pu_bacteria 2970191845 2970193597 351
1060 iso_pu_bacteria 2970469710 2970471417 351
1061 iso_pu_bacteria 2970489779 2970491081 351
1062 iso_pu_bacteria 2970503327 2970508680 351
1063 iso_pu_bacteria 2970510686 2970514661 351
1064 iso_pu_bacteria 2970524798 2970528627 351
1065 iso_pu_bacteria 2970540015 2970544737 351
1066 iso_pu_bacteria 2970547951 2970552481 351
1067 iso_pu_bacteria 2970554993 2970560192 351
1068 iso_pu_bacteria 2970593180 2970599582 351
1069 iso_pu_bacteria 2970619444 2970626921 351
1070 iso_pu_bacteria 2977516862 2977519113 351
1071 iso_pu_bacteria 2977523885 2977526326 351
1072 iso_pu_bacteria 2977530762 2977534058 351
1073 iso_pu_bacteria 2977537788 2977539623 351
1074 iso_pu_bacteria 2977544691 2977546357 351
1075 iso_pu_bacteria 2977551784 2977558429 351
1076 iso_pu_bacteria 2977558990 2977564450 351
1077 iso_pu_bacteria 2977565890 2977567662 351
1078 iso_pu_bacteria 2977572785 2977575749 351
1079 iso_pu_bacteria 2977579622 2977582000 351
1080 iso_pu_bacteria 2977821940 2977827447 351
1081 iso_pu_bacteria 2977843712 2977846009 351
1082 iso_pu_bacteria 2977851361 2977856227 351
1083 iso_pu_bacteria 2977858184 2977863739 351
1084 iso_pu_bacteria 2977864932 2977867050 351
1085 iso_pu_bacteria 2977872689 2977876246 351
1086 iso_pu_bacteria 2977907340 2977909454 351
1087 iso_pu_bacteria 2977915119 2977919450 351
1088 iso_pu_bacteria 2977922695 2977924262 351
1089 iso_pu_bacteria 2977935797 2977939894 351
1090 iso_pu_bacteria 2977942078 2977942784 351
1091 iso_pu_bacteria 2977950692 2977956252 351
1092 iso_pu_bacteria 2977957713 2977962017 351
1093 iso_pu_bacteria 2978969890 2978974614 351
1094 iso_pu_bacteria 2979089926 2979094675 351
1095 iso_pu_bacteria 2979095461 2979100760 351
1096 iso_pu_bacteria 2979100975 2979103910 351
1097 iso_pu_bacteria 2979710463 2979711960 351
1098 iso_pu_bacteria 2979779861 2979785522 351
1099 iso_pu_bacteria 2979793036 2979795003 351
1100 iso_pu_bacteria 2979808191 2979811672 351
1101 iso_pu_bacteria 2984509177 2984511523 351
1102 iso_pu_bacteria 2984518228 2984522116 351
1103 iso_pu_bacteria 2984537506 2984541415 351
1104 iso_pu_bacteria 2984587000 2984589935 351
1105 iso_pu_bacteria 2984601300 2984603692 351
1106 iso_pu_bacteria 2987636660 2987638302 351
1107 iso_pu_bacteria 2987652177 2987654540 351
1108 iso_pu_bacteria 2987659509 2987664983 351
1109 iso_pu_bacteria 2987666974 2987669208 351
1110 iso_pu_bacteria 2987673487 2987677056 351
1111 iso_pu_bacteria 2989349275 2989349667 351
1112 iso_pu_bacteria 2989771324 2989774282 351
1113 iso_pu_bacteria 2989776772 2989779201 351
1114 iso_pu_bacteria 2995392953 2995393038 351
1115 iso_pu_bacteria 2996310559 2996314041 351
1116 iso_pu_bacteria 2996336353 2996339129 351
1117 iso_pu_bacteria 2996341866 2996347296 351
1118 iso_pu_bacteria 2996348954 2996350206 351
1119 iso_pu_bacteria 2996386984 2996388062 351
1120 iso_pu_bacteria 2996887358 2996889043 351
1121 iso_pu_bacteria 2996893221 2996894336 351
1122 iso_pu_bacteria 3000017691 3000017841 351
1123 iso_pu_bacteria 3000135777 3000140624 351
1124 iso_pu_bacteria 3002141150 3002144752 351
1125 iso_pu_bacteria 3003930520 3003934061 351
1126 iso_pu_bacteria 3004167301 3004168942 351
1127 iso_pu_bacteria 3004188549 3004194040 351
1128 iso_pu_bacteria 3004203850 3004205454 351
1129 iso_pu_bacteria 3004211236 3004215997 351
1130 iso_pu_bacteria 3004218560 3004223747 351
1131 iso_pu_bacteria 3004232784 3004234590 351
1132 iso_pu_bacteria 3004239961 3004246936 351
1133 iso_pu_bacteria 3004248173 3004248454 351
1134 iso_pu_bacteria 3004268573 3004274981 351
1135 iso_pu_bacteria 3004275668 3004276904 351
1136 iso_pu_bacteria 3004334049 3004334313 351
1137 iso_pu_bacteria 3005409236 3005414605 351
1138 iso_pu_bacteria 3005416602 3005419475 351
1139 iso_pu_bacteria 3005445848 3005448441 351
1140 iso_pu_bacteria 3005452660 3005454631 351
1141 iso_pu_bacteria 637000159 637074562 351
1142 iso_pu_bacteria 639633055 639649183 351
1143 iso_pu_bacteria 643692032 643826309 351
1144 iso_pu_bacteria 648276728 648739209 351
1145 iso_pu_bacteria 649633066 649873004 351
1146 iso_pu_bacteria 650716007 650740554 351
1147 iso_pu_bacteria 8002285264 8002289009 351
1148 iso_pu_bacteria 8003570095 8003571619 351
1149 iso_pu_bacteria 8003992118 8003994163 351
1150 iso_pu_bacteria 8003999396 8004001795 351
1151 iso_pu_bacteria 8004300914 8004301568 351
1152 iso_pu_bacteria 8004374579 8004380428 351
1153 iso_pu_bacteria 8004387939 8004393606 351
1154 iso_pu_bacteria 8004445564 8004452029 351
1155 iso_pu_bacteria 8004633249 8004636154 351
1156 iso_pu_bacteria 8004640170 8004640782 351
1157 iso_pu_bacteria 8004695233 8004700453 351
1158 iso_pu_bacteria 8004703790 8004709393 351
1159 iso_pu_bacteria 8004714634 8004720374 351
1160 iso_pu_bacteria 8004727605 8004734807 351
1161 iso_pu_bacteria 8005246636 8005248763 351
1162 iso_pu_bacteria 8005258706 8005260300 351
1163 iso_pu_bacteria 8005275841 8005281201 351
1164 iso_pu_bacteria 8005282627 8005283263 351
1165 iso_pu_bacteria 8005289223 8005293631 351
1166 iso_pu_bacteria 8005301065 8005303116 351
1167 iso_pu_bacteria 8005307578 8005312825 351
1168 iso_pu_bacteria 8005314921 8005316766 351
1169 iso_pu_bacteria 8005321885 8005323570 351
1170 iso_pu_bacteria 8005376324 8005380919 351
1171 iso_pu_bacteria 8005382845 8005389131 351
1172 iso_pu_bacteria 8005395548 8005396111 351
1173 iso_pu_bacteria 8005430974 8005435148 351
1174 iso_pu_bacteria 8005460587 8005463678 351
1175 iso_pu_bacteria 8005484373 8005489192 351
1176 iso_pu_bacteria 8005497431 8005500890 351
1177 iso_pu_bacteria 8005542996 8005545613 351
1178 iso_pu_bacteria 8005556819 8005557024 351
1179 iso_pu_bacteria 8005563573 8005567984 351
1180 iso_pu_bacteria 8005570704 8005573471 351
1181 iso_pu_bacteria 8005619151 8005622263 351
1182 iso_pu_bacteria 8005626139 8005632257 351
1183 iso_pu_bacteria 8005645114 8005648132 351
1184 iso_pu_bacteria 8005658619 8005659034 351
1185 iso_pu_bacteria 8005668836 8005672307 351
1186 iso_pu_bacteria 8005682033 8005682894 351
1187 iso_pu_bacteria 8005688590 8005692116 351
1188 iso_pu_bacteria 8005695170 8005697391 351
1189 iso_pu_bacteria 8018127388 8018134085 351
1190 iso_pu_bacteria 8018150411 8018153223 351
1191 iso_pu_bacteria 8018163183 8018164635 351
1192 iso_pu_bacteria 8018176218 8018181334 351
1193 iso_pu_bacteria 8023680758 8023683177 351
1194 iso_pu_bacteria 8024479707 8024482872 351
1195 iso_pu_bacteria 8024486573 8024488022 351
1196 iso_pu_bacteria 8024501048 8024504414 351
1197 iso_pu_bacteria 8045864390 8045864586 351
1198 iso_pu_bacteria 8046767195 8046771928 351
1199 iso_pu_bacteria 8049293176 8049295317 351
1200 iso_pu_bacteria 8054460903 8054462970 351
1201 iso_pu_bacteria 8054558443 8054562932 351
1202 iso_pu_bacteria 8055431914 8055432765 351
1203 iso_pu_bacteria 8055617313 8055620816 351
1204 iso_pu_bacteria 8056375014 8056375925 351
1205 iso_pu_bacteria 8056382006 8056386716 351
1206 iso_pu_bacteria 8056875544 8056877302 351
1207 iso_pu_bacteria 8057132660 8057134959 351
1208 iso_pu_bacteria 8057575449 8057575742 351
1209 iso_pu_bacteria 8057874678 8057877683 351
1210 3300013296 Ga0157374_10000093 Ga0157374_1000009355 352
1211 3300014969 Ga0157376_10000397 Ga0157376_100003972 352
1212 3300053730 Ga0500645_001032 Ga0500645_001032_7069_8175 352
1213 3300005841 Ga0068863_100049068 Ga0068863_1000490682 353
1214 3300009093 Ga0105240_10000041 Ga0105240_1000004111 353
1215 3300010375 Ga0105239_10088268 Ga0105239_100882682 353
1216 3300021384 Ga0213876_10012004 Ga0213876_100120043 353
1217 3300026088 Ga0207641_10121994 Ga0207641_101219942 353
1218 3300037312 Ga0395899_0011241 Ga0395899_0011241_2026_3111 353
1219 3300039437 Ga0436365_0266395 Ga0436365_0266395_1031_2131 353
1220 3300039437 Ga0436365_1369348 Ga0436365_1369348_3038_4150 353
1221 3300046516 Ga0495628_0065316 Ga0495628_0065316_269_1369 353
1222 3300046517 Ga0495630_0058273 Ga0495630_0058273_568_1668 353
1223 3300047471 Ga0495684_0010387 Ga0495684_0010387_5674_6774 353
1224 3300049571 Ga0501034_0013251 Ga0501034_0013251_2278_3423 353
1225 3300049571 Ga0501034_0084135 Ga0501034_0084135_258_1334 353
1226 3300049573 Ga0501037_0022441 Ga0501037_0022441_80_1225 353
1227 3300049574 Ga0501038_0053162 Ga0501038_0053162_999_2144 353
1228 3300049579 Ga0501043_0009292 Ga0501043_0009292_3054_4199 353
1229 3300049581 Ga0501047_0032382 Ga0501047_0032382_62_1207 353
1230 3300049582 Ga0501048_0055597 Ga0501048_0055597_201_1298 353
1231 3300049589 Ga0501073_0001991 Ga0501073_0001991_11821_12966 353
1232 3300049590 Ga0501074_0266137 Ga0501074_0266137_19_1164 353
1233 3300049742 Ga0501080_0002532 Ga0501080_0002532_4556_5701 353
1234 3300049744 Ga0501083_0220879 Ga0501083_0220879_19_1164 353
1235 3300049822 Ga0501035_0026972 Ga0501035_0026972_3505_4650 353
1236 3300049823 Ga0501044_0261060 Ga0501044_0261060_126_1271 353
1237 3300060353 Ga0501082_0030438 Ga0501082_0030438_652_1797 353
1238 iso_pu_bacteria 2965110997 2965117692 353
1239 3300003322 rootL2_10193157 rootL2_101931572 354
1240 3300003578 Ga0006562J51391_1043939 Ga0006562J51391_10439397 354
1241 3300003781 Ga0055536_1001275 Ga0055536_10012752 354
1242 3300003794 Ga0055531_10023750 Ga0055531_100237502 354
1243 3300005436 Ga0070713_100001844 Ga0070713_10000184414 354
1244 3300005530 Ga0070679_100270265 Ga0070679_1002702651 354
1245 3300005563 Ga0068855_100494933 Ga0068855_1004949331 354
1246 3300005614 Ga0068856_100314614 Ga0068856_1003146141 354
1247 3300006051 Ga0075364_10039752 Ga0075364_100397522 354
1248 3300009545 Ga0105237_10217388 Ga0105237_102173882 354
1249 3300013102 Ga0157371_10043374 Ga0157371_100433742 354
1250 3300013104 Ga0157370_10015013 Ga0157370_100150134 354
1251 3300013105 Ga0157369_10011166 Ga0157369_100111665 354
1252 3300014968 Ga0157379_10238537 Ga0157379_102385372 354
1253 3300025292 Ga0209676_1000038 Ga0209676_1000038440 354
1254 3300025292 Ga0209676_1000644 Ga0209676_100064427 354
1255 3300025298 Ga0209050_1009729 Ga0209050_10097292 354
1256 3300025304 Ga0209257_1000060 Ga0209257_1000060160 354
1257 3300025913 Ga0207695_10000125 Ga0207695_1000012557 354
1258 3300025928 Ga0207700_10011303 Ga0207700_100113034 354
1259 3300025944 Ga0207661_10045424 Ga0207661_100454243 354
1260 3300025949 Ga0207667_10417392 Ga0207667_104173921 354
1261 3300028556 Ga0265337_1001230 Ga0265337_10012304 354
1262 3300028556 Ga0265337_1002560 Ga0265337_10025602 354
1263 3300028556 Ga0265337_1003365 Ga0265337_10033651 354
1264 3300028563 Ga0265319_1000298 Ga0265319_100029827 354
1265 3300028563 Ga0265319_1002101 Ga0265319_10021016 354
1266 3300028563 Ga0265319_1003884 Ga0265319_10038844 354
1267 3300028563 Ga0265319_1008667 Ga0265319_10086672 354
1268 3300028563 Ga0265319_1010831 Ga0265319_10108312 354
1269 3300028563 Ga0265319_1024830 Ga0265319_10248302 354
1270 3300028573 Ga0265334_10006566 Ga0265334_100065664 354
1271 3300028573 Ga0265334_10019358 Ga0265334_100193582 354
1272 3300028573 Ga0265334_10041329 Ga0265334_100413292 354
1273 3300028577 Ga0265318_10000007 Ga0265318_1000000724 354
1274 3300028577 Ga0265318_10001154 Ga0265318_1000115413 354
1275 3300028577 Ga0265318_10002287 Ga0265318_100022879 354
1276 3300028577 Ga0265318_10002712 Ga0265318_100027126 354
1277 3300028577 Ga0265318_10003821 Ga0265318_100038212 354
1278 3300028653 Ga0265323_10006142 Ga0265323_100061423 354
1279 3300028653 Ga0265323_10024474 Ga0265323_100244742 354
1280 3300028653 Ga0265323_10034080 Ga0265323_100340802 354
1281 3300028654 Ga0265322_10006788 Ga0265322_100067882 354
1282 3300028654 Ga0265322_10007141 Ga0265322_100071412 354
1283 3300028666 Ga0265336_10001485 Ga0265336_100014857 354
1284 3300028794 Ga0307515_10141817 Ga0307515_101418172 354
1285 3300028800 Ga0265338_10003574 Ga0265338_100035745 354
1286 3300028800 Ga0265338_10051361 Ga0265338_100513613 354
1287 3300029957 Ga0265324_10011450 Ga0265324_100114502 354
1288 3300029957 Ga0265324_10024904 Ga0265324_100249042 354
1289 3300031235 Ga0265330_10004065 Ga0265330_100040653 354
1290 3300031239 Ga0265328_10019863 Ga0265328_100198633 354
1291 3300031240 Ga0265320_10000791 Ga0265320_100007916 354
1292 3300031240 Ga0265320_10001929 Ga0265320_100019297 354
1293 3300031240 Ga0265320_10002983 Ga0265320_100029833 354
1294 3300031240 Ga0265320_10003355 Ga0265320_100033556 354
1295 3300031240 Ga0265320_10005312 Ga0265320_100053125 354
1296 3300031240 Ga0265320_10007308 Ga0265320_100073083 354
1297 3300031240 Ga0265320_10018235 Ga0265320_100182353 354
1298 3300031240 Ga0265320_10033988 Ga0265320_100339882 354
1299 3300031241 Ga0265325_10013776 Ga0265325_100137764 354
1300 3300031250 Ga0265331_10013946 Ga0265331_100139464 354
1301 3300031250 Ga0265331_10018214 Ga0265331_100182144 354
1302 3300031251 Ga0265327_10000091 Ga0265327_1000009116 354
1303 3300031251 Ga0265327_10002906 Ga0265327_1000290613 354
1304 3300031251 Ga0265327_10004492 Ga0265327_100044924 354
1305 3300031251 Ga0265327_10028872 Ga0265327_100288722 354
1306 3300031344 Ga0265316_10033074 Ga0265316_100330742 354
1307 3300031595 Ga0265313_10003023 Ga0265313_100030235 354
1308 3300031595 Ga0265313_10003044 Ga0265313_100030442 354
1309 3300031595 Ga0265313_10004342 Ga0265313_100043427 354
1310 3300031595 Ga0265313_10007241 Ga0265313_100072412 354
1311 3300031595 Ga0265313_10026134 Ga0265313_100261343 354
1312 3300031616 Ga0307508_10001088 Ga0307508_100010889 354
1313 3300031711 Ga0265314_10002313 Ga0265314_100023136 354
1314 3300031711 Ga0265314_10003676 Ga0265314_1000367610 354
1315 3300031711 Ga0265314_10005332 Ga0265314_100053324 354
1316 3300031711 Ga0265314_10098056 Ga0265314_100980562 354
1317 3300031712 Ga0265342_10011659 Ga0265342_100116593 354
1318 3300031712 Ga0265342_10023075 Ga0265342_100230752 354
1319 3300031712 Ga0265342_10058582 Ga0265342_100585822 354
1320 3300031712 Ga0265342_10089160 Ga0265342_100891601 354
1321 3300031712 Ga0265342_10111690 Ga0265342_101116902 354
1322 3300031901 Ga0307406_10013439 Ga0307406_100134392 354
1323 3300032004 Ga0307414_10020814 Ga0307414_100208142 354
1324 3300032004 Ga0307414_10054215 Ga0307414_100542152 354
1325 3300032004 Ga0307414_10061116 Ga0307414_100611162 354
1326 3300032004 Ga0307414_10125605 Ga0307414_101256052 354
1327 3300033180 Ga0307510_10186046 Ga0307510_101860462 354
1328 3300035691 Ga0373931_0091831 Ga0373931_0091831_167_1282 354
1329 3300037312 Ga0395899_0000125 Ga0395899_0000125_93349_94458 354
1330 3300039447 Ga0436361_0688051 Ga0436361_0688051_1175_2287 354
1331 3300039447 Ga0436361_1208326 Ga0436361_1208326_172_1284 354
1332 3300042876 Ga0451577_0000024 Ga0451577_0000024_214439_215554 354
1333 3300042876 Ga0451577_0000354 Ga0451577_0000354_7510_8625 354
1334 3300042876 Ga0451577_0043614 Ga0451577_0043614_1425_2507 354
1335 3300042876 Ga0451577_0111277 Ga0451577_0111277_11_1126 354
1336 3300042876 Ga0451577_0389251 Ga0451577_0389251_136_1251 354
1337 3300044673 Ga0453683_0006735 Ga0453683_0006735_5229_6344 354
1338 3300044712 Ga0453684_0000001 Ga0453684_0000001_831085_832209 354
1339 3300044712 Ga0453684_0018498 Ga0453684_0018498_6139_7254 354
1340 3300044712 Ga0453684_0022207 Ga0453684_0022207_1192_2274 354
1341 3300044712 Ga0453684_0051650 Ga0453684_0051650_2065_3180 354
1342 3300044712 Ga0453684_0056828 Ga0453684_0056828_1772_2887 354
1343 3300045051 Ga0451576_0000443 Ga0451576_0000443_93254_94369 354
1344 3300045051 Ga0451576_0002775 Ga0451576_0002775_10801_11916 354
1345 3300045051 Ga0451576_0003405 Ga0451576_0003405_12934_14046 354
1346 3300045051 Ga0451576_0007566 Ga0451576_0007566_9432_10547 354
1347 3300045051 Ga0451576_0073549 Ga0451576_0073549_650_1765 354
1348 3300046694 Ga0495649_0000649 Ga0495649_0000649_11214_12323 354
1349 3300048925 Ga0496122_0040321 Ga0496122_0040321_218_1327 354
1350 3300048926 Ga0496123_0013645 Ga0496123_0013645_5655_6764 354
1351 3300048928 Ga0496125_0092061 Ga0496125_0092061_961_2070 354
1352 3300049569 Ga0501032_0001723 Ga0501032_0001723_587_1702 354
1353 3300049569 Ga0501032_0002103 Ga0501032_0002103_3004_4119 354
1354 3300049570 Ga0501033_0001181 Ga0501033_0001181_17363_18484 354
1355 3300049570 Ga0501033_0004600 Ga0501033_0004600_8739_9854 354
1356 3300049572 Ga0501036_0022832 Ga0501036_0022832_1051_2166 354
1357 3300049572 Ga0501036_0189269 Ga0501036_0189269_21_1136 354
1358 3300049573 Ga0501037_0001490 Ga0501037_0001490_8633_9748 354
1359 3300049574 Ga0501038_0001105 Ga0501038_0001105_9073_10188 354
1360 3300049575 Ga0501039_0009216 Ga0501039_0009216_2911_4026 354
1361 3300049578 Ga0501042_0008324 Ga0501042_0008324_2937_4052 354
1362 3300049579 Ga0501043_0029609 Ga0501043_0029609_1143_2258 354
1363 3300049579 Ga0501043_0163416 Ga0501043_0163416_102_1223 354
1364 3300049580 Ga0501046_0000796 Ga0501046_0000796_10501_11622 354
1365 3300049580 Ga0501046_0004770 Ga0501046_0004770_8248_9363 354
1366 3300049580 Ga0501046_0132190 Ga0501046_0132190_462_1577 354
1367 3300049580 Ga0501046_0143187 Ga0501046_0143187_406_1521 354
1368 3300049581 Ga0501047_0006856 Ga0501047_0006856_5629_6744 354
1369 3300049581 Ga0501047_0007284 Ga0501047_0007284_1042_2157 354
1370 3300049581 Ga0501047_0031934 Ga0501047_0031934_714_1835 354
1371 3300049581 Ga0501047_0125892 Ga0501047_0125892_769_1884 354
1372 3300049581 Ga0501047_0186682 Ga0501047_0186682_151_1272 354
1373 3300049582 Ga0501048_0001499 Ga0501048_0001499_6115_7230 354
1374 3300049744 Ga0501083_0001671 Ga0501083_0001671_630_1784 354
1375 3300049744 Ga0501083_0047820 Ga0501083_0047820_38_1153 354
1376 3300049822 Ga0501035_0002594 Ga0501035_0002594_5629_6744 354
1377 3300049822 Ga0501035_0121609 Ga0501035_0121609_307_1428 354
1378 3300049822 Ga0501035_0245654 Ga0501035_0245654_75_1190 354
1379 3300049823 Ga0501044_0000206 Ga0501044_0000206_33131_34246 354
1380 3300049823 Ga0501044_0003350 Ga0501044_0003350_5629_6744 354
1381 3300049823 Ga0501044_0032189 Ga0501044_0032189_1780_2895 354
1382 3300049823 Ga0501044_0041808 Ga0501044_0041808_713_1834 354
1383 3300050491 nmdc:mga00v17_74517_c1 nmdc:mga00v17_74517_c1_543_1622 354
1384 3300053088 Ga0500644_0004179 Ga0500644_0004179_1692_2801 354
1385 3300053093 Ga0500651_0027106 Ga0500651_0027106_360_1469 354
1386 3300053096 Ga0500641_0001998 Ga0500641_0001998_1502_2614 354
1387 3300053140 Ga0500573_0019055 Ga0500573_0019055_891_2000 354
1388 3300053156 Ga0500622_0019462 Ga0500622_0019462_1488_2597 354
1389 2162886007 SwRhRL2b_contig_1038538 SwRhRL2b_0044.00006730 355
1390 3300001915 JGI24741J21665_1004868 JGI24741J21665_10048682 355
1391 3300002739 JGI25158J39367_1000038 JGI25158J39367_100003812 355
1392 3300002739 JGI25158J39367_1005327 JGI25158J39367_10053272 355
1393 3300002741 JGI25157J39369_1000787 JGI25157J39369_100078711 355
1394 3300002773 JGI25152J39213_1000636 JGI25152J39213_10006368 355
1395 3300002773 JGI25152J39213_1002957 JGI25152J39213_10029574 355
1396 3300002773 JGI25152J39213_1003042 JGI25152J39213_10030423 355
1397 3300002773 JGI25152J39213_1005715 JGI25152J39213_10057152 355
1398 3300002774 JGI25150J39212_1000107 JGI25150J39212_100010710 355
1399 3300002774 JGI25150J39212_1003012 JGI25150J39212_10030122 355
1400 3300002987 JGI25159J45721_1000014 JGI25159J45721_100001453 355
1401 3300002987 JGI25159J45721_1000154 JGI25159J45721_10001542 355
1402 3300002987 JGI25159J45721_1001072 JGI25159J45721_10010724 355
1403 3300003187 JGI25151J46595_10000374 JGI25151J46595_1000037436 355
1404 3300003187 JGI25151J46595_10000839 JGI25151J46595_100008398 355
1405 3300003187 JGI25151J46595_10006464 JGI25151J46595_100064643 355
1406 3300003187 JGI25151J46595_10015704 JGI25151J46595_100157042 355
1407 3300003203 JGI25406J46586_10014863 JGI25406J46586_100148632 355
1408 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015151 355
1409 3300003215 JGI25153J46596_10000696 JGI25153J46596_100006966 355
1410 3300003215 JGI25153J46596_10023168 JGI25153J46596_100231682 355
1411 3300003215 JGI25153J46596_10023978 JGI25153J46596_100239782 355
1412 3300003215 JGI25153J46596_10047584 JGI25153J46596_100475841 355
1413 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001657 355
1414 3300003354 JGI25160J50197_1000020 JGI25160J50197_100002053 355
1415 3300003354 JGI25160J50197_1002863 JGI25160J50197_10028632 355
1416 3300003354 JGI25160J50197_1030303 JGI25160J50197_10303032 355
1417 3300003374 JGI25161J50226_1000001 JGI25161J50226_100000196 355
1418 3300003374 JGI25161J50226_1000174 JGI25161J50226_100017434 355
1419 3300003374 JGI25161J50226_1001510 JGI25161J50226_10015105 355
1420 3300003374 JGI25161J50226_1002239 JGI25161J50226_10022393 355
1421 3300003578 Ga0006562J51391_1023353 Ga0006562J51391_10233534 355
1422 3300003762 Ga0055542_1001274 Ga0055542_10012742 355
1423 3300003771 Ga0055526_1000597 Ga0055526_100059721 355
1424 3300003771 Ga0055526_1001490 Ga0055526_10014907 355
1425 3300003771 Ga0055526_1003506 Ga0055526_10035062 355
1426 3300003771 Ga0055526_1003741 Ga0055526_10037417 355
1427 3300003773 Ga0055537_1001473 Ga0055537_10014735 355
1428 3300003775 Ga0055524_1003871 Ga0055524_10038714 355
1429 3300003775 Ga0055524_1004279 Ga0055524_10042796 355
1430 3300003775 Ga0055524_1005006 Ga0055524_10050062 355
1431 3300003775 Ga0055524_1007099 Ga0055524_10070993 355
1432 3300003775 Ga0055524_1014345 Ga0055524_10143452 355
1433 3300003781 Ga0055536_1001187 Ga0055536_100118712 355
1434 3300003781 Ga0055536_1005415 Ga0055536_10054155 355
1435 3300003781 Ga0055536_1012576 Ga0055536_10125762 355
1436 3300003790 Ga0055528_1001199 Ga0055528_10011998 355
1437 3300003790 Ga0055528_1001734 Ga0055528_100173410 355
1438 3300003790 Ga0055528_1002830 Ga0055528_10028309 355
1439 3300003790 Ga0055528_1005558 Ga0055528_10055585 355
1440 3300003790 Ga0055528_1005775 Ga0055528_10057755 355
1441 3300003790 Ga0055528_1018688 Ga0055528_10186882 355
1442 3300003791 Ga0055530_10009807 Ga0055530_100098073 355
1443 3300003792 Ga0055540_1000929 Ga0055540_100092911 355
1444 3300003792 Ga0055540_1016839 Ga0055540_10168391 355
1445 3300003794 Ga0055531_10002881 Ga0055531_100028813 355
1446 3300003794 Ga0055531_10008539 Ga0055531_100085392 355
1447 3300003794 Ga0055531_10010959 Ga0055531_100109594 355
1448 3300003794 Ga0055531_10036493 Ga0055531_100364932 355
1449 3300004625 Ga0055543_1000003 Ga0055543_1000003112 355
1450 3300004625 Ga0055543_1000047 Ga0055543_100004745 355
1451 3300004625 Ga0055543_1000500 Ga0055543_10005008 355
1452 3300004625 Ga0055543_1001281 Ga0055543_10012817 355
1453 3300005262 Ga0065165_1000013 Ga0065165_1000013167 355
1454 3300005262 Ga0065165_1000068 Ga0065165_100006857 355
1455 3300005262 Ga0065165_1003894 Ga0065165_10038943 355
1456 3300005289 Ga0065704_10008543 Ga0065704_100085432 355
1457 3300005327 Ga0070658_10049567 Ga0070658_100495673 355
1458 3300005331 Ga0070670_100002993 Ga0070670_10000299311 355
1459 3300005339 Ga0070660_100095702 Ga0070660_1000957022 355
1460 3300005339 Ga0070660_100163494 Ga0070660_1001634942 355
1461 3300005347 Ga0070668_100010616 Ga0070668_1000106165 355
1462 3300005347 Ga0070668_100012891 Ga0070668_1000128914 355
1463 3300005347 Ga0070668_100078199 Ga0070668_1000781992 355
1464 3300005355 Ga0070671_100033702 Ga0070671_1000337023 355
1465 3300005356 Ga0070674_100016809 Ga0070674_1000168094 355
1466 3300005367 Ga0070667_100303778 Ga0070667_1003037782 355
1467 3300005440 Ga0070705_100098636 Ga0070705_1000986362 355
1468 3300005455 Ga0070663_100024934 Ga0070663_1000249342 355
1469 3300005455 Ga0070663_100118538 Ga0070663_1001185382 355
1470 3300005456 Ga0070678_100248634 Ga0070678_1002486342 355
1471 3300005457 Ga0070662_100300083 Ga0070662_1003000831 355
1472 3300005459 Ga0068867_100171488 Ga0068867_1001714882 355
1473 3300005535 Ga0070684_100134470 Ga0070684_1001344702 355
1474 3300005539 Ga0068853_100242359 Ga0068853_1002423592 355
1475 3300005546 Ga0070696_100137933 Ga0070696_1001379332 355
1476 3300005548 Ga0070665_100035316 Ga0070665_1000353163 355
1477 3300005548 Ga0070665_100075267 Ga0070665_1000752673 355
1478 3300005548 Ga0070665_100142921 Ga0070665_1001429212 355
1479 3300005548 Ga0070665_100152121 Ga0070665_1001521212 355
1480 3300005563 Ga0068855_100069226 Ga0068855_1000692263 355
1481 3300005564 Ga0070664_100117821 Ga0070664_1001178212 355
1482 3300005718 Ga0068866_10095286 Ga0068866_100952862 355
1483 3300005841 Ga0068863_100038880 Ga0068863_1000388802 355
1484 3300005842 Ga0068858_100125185 Ga0068858_1001251852 355
1485 3300005843 Ga0068860_100150648 Ga0068860_1001506482 355
1486 3300005844 Ga0068862_100032639 Ga0068862_1000326393 355
1487 3300005844 Ga0068862_100072962 Ga0068862_1000729622 355
1488 3300005983 Ga0081540_1045519 Ga0081540_10455192 355
1489 3300005985 Ga0081539_10001091 Ga0081539_1000109139 355
1490 3300005985 Ga0081539_10020691 Ga0081539_100206912 355
1491 3300006038 Ga0075365_10004585 Ga0075365_100045852 355
1492 3300006038 Ga0075365_10005814 Ga0075365_100058142 355
1493 3300006038 Ga0075365_10098168 Ga0075365_100981682 355
1494 3300006038 Ga0075365_10163928 Ga0075365_101639282 355
1495 3300006042 Ga0075368_10008483 Ga0075368_100084832 355
1496 3300006048 Ga0075363_100005871 Ga0075363_1000058714 355
1497 3300006048 Ga0075363_100025123 Ga0075363_1000251232 355
1498 3300006051 Ga0075364_10086268 Ga0075364_100862681 355
1499 3300006177 Ga0075362_10010664 Ga0075362_100106642 355
1500 3300006177 Ga0075362_10063214 Ga0075362_100632142 355
1501 3300006178 Ga0075367_10006519 Ga0075367_100065194 355
1502 3300006178 Ga0075367_10009312 Ga0075367_100093121 355
1503 3300006186 Ga0075369_10005462 Ga0075369_100054622 355
1504 3300006186 Ga0075369_10009967 Ga0075369_100099673 355
1505 3300006186 Ga0075369_10015627 Ga0075369_100156272 355
1506 3300006186 Ga0075369_10035613 Ga0075369_100356132 355
1507 3300006195 Ga0075366_10008655 Ga0075366_100086553 355
1508 3300006353 Ga0075370_10012603 Ga0075370_100126033 355
1509 3300006353 Ga0075370_10081836 Ga0075370_100818362 355
1510 3300006353 Ga0075370_10087140 Ga0075370_100871402 355
1511 3300006353 Ga0075370_10107335 Ga0075370_101073352 355
1512 3300006353 Ga0075370_10123037 Ga0075370_101230372 355
1513 3300006358 Ga0068871_100176497 Ga0068871_1001764972 355
1514 3300006881 Ga0068865_100069159 Ga0068865_1000691592 355
1515 3300006881 Ga0068865_100114373 Ga0068865_1001143732 355
1516 3300006946 Ga0079104_1000193 Ga0079104_100019365 355
1517 3300006946 Ga0079104_1001253 Ga0079104_10012539 355
1518 3300006946 Ga0079104_1003360 Ga0079104_10033604 355
1519 3300006948 Ga0099826_10001254 Ga0099826_1000125410 355
1520 3300006948 Ga0099826_10064039 Ga0099826_100640392 355
1521 3300009092 Ga0105250_10015698 Ga0105250_100156981 355
1522 3300009148 Ga0105243_10007500 Ga0105243_100075004 355
1523 3300009176 Ga0105242_10161244 Ga0105242_101612442 355
1524 3300009177 Ga0105248_10040139 Ga0105248_100401393 355
1525 3300009177 Ga0105248_10571246 Ga0105248_105712461 355
1526 3300009545 Ga0105237_10014016 Ga0105237_100140166 355
1527 3300009551 Ga0105238_10001971 Ga0105238_1000197111 355
1528 3300009553 Ga0105249_10017238 Ga0105249_100172384 355
1529 3300009765 Ga0123341_1000007 Ga0123341_100000787 355
1530 3300009765 Ga0123341_1046896 Ga0123341_10468962 355
1531 3300009766 Ga0123342_1004784 Ga0123342_100478413 355
1532 3300009766 Ga0123342_1013992 Ga0123342_10139922 355
1533 3300013102 Ga0157371_10000017 Ga0157371_1000001753 355
1534 3300013104 Ga0157370_10000461 Ga0157370_1000046127 355
1535 3300013104 Ga0157370_10090223 Ga0157370_100902232 355
1536 3300013105 Ga0157369_10159016 Ga0157369_101590162 355
1537 3300013105 Ga0157369_10187316 Ga0157369_101873162 355
1538 3300013249 Ga0171463_1003 Ga0171463_1003168 355
1539 3300013308 Ga0157375_10004209 Ga0157375_1000420910 355
1540 3300013308 Ga0157375_10070230 Ga0157375_100702303 355
1541 3300014326 Ga0157380_10116875 Ga0157380_101168752 355
1542 3300014968 Ga0157379_10007600 Ga0157379_100076005 355
1543 3300014968 Ga0157379_10359759 Ga0157379_103597591 355
1544 3300015690 Ga0183363_1344 Ga0183363_13443 355
1545 3300017792 Ga0163161_10006062 Ga0163161_100060627 355
1546 3300017792 Ga0163161_10164127 Ga0163161_101641272 355
1547 3300021320 Ga0214544_1001800 Ga0214544_100180019 355
1548 3300021321 Ga0214542_1000012 Ga0214542_100001291 355
1549 3300021327 Ga0214543_1000024 Ga0214543_100002492 355
1550 3300021327 Ga0214543_1000038 Ga0214543_100003870 355
1551 3300022739 Ga0228711_1000008 Ga0228711_100000841 355
1552 3300022740 Ga0228710_1000009 Ga0228710_100000940 355
1553 3300025208 Ga0209436_100150 Ga0209436_10015024 355
1554 3300025208 Ga0209436_101065 Ga0209436_1010656 355
1555 3300025208 Ga0209436_104522 Ga0209436_1045222 355
1556 3300025245 Ga0207425_1000075 Ga0207425_100007562 355
1557 3300025245 Ga0207425_1002079 Ga0207425_10020793 355
1558 3300025245 Ga0207425_1019409 Ga0207425_10194092 355
1559 3300025250 Ga0209026_1000025 Ga0209026_1000025166 355
1560 3300025254 Ga0209148_1000128 Ga0209148_100012823 355
1561 3300025256 Ga0209759_1000121 Ga0209759_100012166 355
1562 3300025258 Ga0209129_1000156 Ga0209129_100015636 355
1563 3300025258 Ga0209129_1000218 Ga0209129_10002182 355
1564 3300025258 Ga0209129_1001767 Ga0209129_10017674 355
1565 3300025258 Ga0209129_1001868 Ga0209129_10018682 355
1566 3300025258 Ga0209129_1002344 Ga0209129_10023447 355
1567 3300025258 Ga0209129_1003478 Ga0209129_10034784 355
1568 3300025258 Ga0209129_1007240 Ga0209129_10072402 355
1569 3300025261 Ga0209233_1000010 Ga0209233_1000010249 355
1570 3300025263 Ga0209565_1000118 Ga0209565_100011831 355
1571 3300025263 Ga0209565_1019270 Ga0209565_10192702 355
1572 3300025272 Ga0209455_1000127 Ga0209455_1000127137 355
1573 3300025273 Ga0209673_1000010 Ga0209673_1000010210 355
1574 3300025273 Ga0209673_1000117 Ga0209673_100011784 355
1575 3300025273 Ga0209673_1000151 Ga0209673_100015167 355
1576 3300025273 Ga0209673_1000863 Ga0209673_100086326 355
1577 3300025273 Ga0209673_1001685 Ga0209673_10016857 355
1578 3300025273 Ga0209673_1002134 Ga0209673_10021347 355
1579 3300025273 Ga0209673_1008788 Ga0209673_10087883 355
1580 3300025273 Ga0209673_1013220 Ga0209673_10132202 355
1581 3300025284 Ga0209130_1000003 Ga0209130_1000003120 355
1582 3300025284 Ga0209130_1000020 Ga0209130_1000020256 355
1583 3300025284 Ga0209130_1000034 Ga0209130_1000034162 355
1584 3300025284 Ga0209130_1017817 Ga0209130_10178172 355
1585 3300025291 Ga0209675_1006073 Ga0209675_10060732 355
1586 3300025292 Ga0209676_1000128 Ga0209676_100012847 355
1587 3300025292 Ga0209676_1000151 Ga0209676_100015161 355
1588 3300025292 Ga0209676_1000482 Ga0209676_100048241 355
1589 3300025292 Ga0209676_1018885 Ga0209676_10188852 355
1590 3300025294 Ga0209025_1000070 Ga0209025_1000070241 355
1591 3300025294 Ga0209025_1000140 Ga0209025_100014074 355
1592 3300025294 Ga0209025_1000314 Ga0209025_100031424 355
1593 3300025294 Ga0209025_1000506 Ga0209025_10005067 355
1594 3300025294 Ga0209025_1001869 Ga0209025_100186917 355
1595 3300025294 Ga0209025_1003183 Ga0209025_100318312 355
1596 3300025294 Ga0209025_1005193 Ga0209025_10051934 355
1597 3300025294 Ga0209025_1014241 Ga0209025_10142415 355
1598 3300025294 Ga0209025_1014979 Ga0209025_10149792 355
1599 3300025294 Ga0209025_1031047 Ga0209025_10310471 355
1600 3300025295 Ga0209564_1000013 Ga0209564_1000013161 355
1601 3300025295 Ga0209564_1000647 Ga0209564_100064716 355
1602 3300025295 Ga0209564_1001780 Ga0209564_100178011 355
1603 3300025295 Ga0209564_1001993 Ga0209564_100199312 355
1604 3300025295 Ga0209564_1013012 Ga0209564_10130122 355
1605 3300025297 Ga0209758_1000413 Ga0209758_100041336 355
1606 3300025297 Ga0209758_1000655 Ga0209758_10006557 355
1607 3300025297 Ga0209758_1000758 Ga0209758_10007587 355
1608 3300025297 Ga0209758_1001882 Ga0209758_100188213 355
1609 3300025297 Ga0209758_1002154 Ga0209758_10021547 355
1610 3300025297 Ga0209758_1004734 Ga0209758_10047344 355
1611 3300025297 Ga0209758_1011908 Ga0209758_10119082 355
1612 3300025297 Ga0209758_1013333 Ga0209758_10133333 355
1613 3300025297 Ga0209758_1021031 Ga0209758_10210313 355
1614 3300025297 Ga0209758_1027881 Ga0209758_10278812 355
1615 3300025298 Ga0209050_1000646 Ga0209050_100064628 355
1616 3300025298 Ga0209050_1002863 Ga0209050_10028636 355
1617 3300025298 Ga0209050_1003757 Ga0209050_10037577 355
1618 3300025298 Ga0209050_1004392 Ga0209050_10043922 355
1619 3300025298 Ga0209050_1007987 Ga0209050_10079874 355
1620 3300025299 Ga0209256_1001653 Ga0209256_100165313 355
1621 3300025299 Ga0209256_1001736 Ga0209256_100173613 355
1622 3300025299 Ga0209256_1002069 Ga0209256_100206910 355
1623 3300025299 Ga0209256_1002712 Ga0209256_10027129 355
1624 3300025299 Ga0209256_1004803 Ga0209256_10048035 355
1625 3300025299 Ga0209256_1005804 Ga0209256_10058042 355
1626 3300025299 Ga0209256_1006089 Ga0209256_10060892 355
1627 3300025299 Ga0209256_1009099 Ga0209256_10090994 355
1628 3300025299 Ga0209256_1010510 Ga0209256_10105103 355
1629 3300025299 Ga0209256_1010871 Ga0209256_10108712 355
1630 3300025302 Ga0207426_1000006 Ga0207426_1000006535 355
1631 3300025302 Ga0207426_1000008 Ga0207426_1000008324 355
1632 3300025302 Ga0207426_1000011 Ga0207426_1000011659 355
1633 3300025302 Ga0207426_1000221 Ga0207426_1000221123 355
1634 3300025302 Ga0207426_1000869 Ga0207426_10008698 355
1635 3300025303 Ga0209051_1000097 Ga0209051_100009758 355
1636 3300025303 Ga0209051_1000314 Ga0209051_100031426 355
1637 3300025303 Ga0209051_1001673 Ga0209051_100167314 355
1638 3300025303 Ga0209051_1006481 Ga0209051_10064815 355
1639 3300025303 Ga0209051_1009478 Ga0209051_10094783 355
1640 3300025303 Ga0209051_1023834 Ga0209051_10238342 355
1641 3300025304 Ga0209257_1000200 Ga0209257_100020025 355
1642 3300025304 Ga0209257_1000413 Ga0209257_100041313 355
1643 3300025304 Ga0209257_1001142 Ga0209257_100114222 355
1644 3300025304 Ga0209257_1002070 Ga0209257_10020708 355
1645 3300025304 Ga0209257_1003315 Ga0209257_10033152 355
1646 3300025904 Ga0207647_10004029 Ga0207647_100040293 355
1647 3300025911 Ga0207654_10076184 Ga0207654_100761842 355
1648 3300025912 Ga0207707_10246383 Ga0207707_102463831 355
1649 3300025914 Ga0207671_10029964 Ga0207671_100299643 355
1650 3300025919 Ga0207657_10040197 Ga0207657_100401973 355
1651 3300025923 Ga0207681_10075520 Ga0207681_100755202 355
1652 3300025924 Ga0207694_10043337 Ga0207694_100433373 355
1653 3300025925 Ga0207650_10000837 Ga0207650_100008374 355
1654 3300025932 Ga0207690_10165585 Ga0207690_101655851 355
1655 3300025934 Ga0207686_10118387 Ga0207686_101183872 355
1656 3300025937 Ga0207669_10130961 Ga0207669_101309612 355
1657 3300025938 Ga0207704_10098033 Ga0207704_100980332 355
1658 3300025940 Ga0207691_10131070 Ga0207691_101310702 355
1659 3300025941 Ga0207711_10013870 Ga0207711_100138702 355
1660 3300025941 Ga0207711_10039419 Ga0207711_100394193 355
1661 3300025945 Ga0207679_10049622 Ga0207679_100496222 355
1662 3300025949 Ga0207667_10123954 Ga0207667_101239542 355
1663 3300025961 Ga0207712_10050862 Ga0207712_100508623 355
1664 3300025972 Ga0207668_10005083 Ga0207668_100050833 355
1665 3300025972 Ga0207668_10005717 Ga0207668_100057174 355
1666 3300025972 Ga0207668_10237982 Ga0207668_102379822 355
1667 3300025986 Ga0207658_10068385 Ga0207658_100683852 355
1668 3300025986 Ga0207658_10132204 Ga0207658_101322042 355
1669 3300025986 Ga0207658_10238936 Ga0207658_102389362 355
1670 3300025986 Ga0207658_10302719 Ga0207658_103027191 355
1671 3300026067 Ga0207678_10112095 Ga0207678_101120952 355
1672 3300026067 Ga0207678_10118442 Ga0207678_101184422 355
1673 3300026088 Ga0207641_10030350 Ga0207641_100303503 355
1674 3300026121 Ga0207683_10057103 Ga0207683_100571034 355
1675 3300026121 Ga0207683_10167090 Ga0207683_101670902 355
1676 3300027111 Ga0209281_1000034 Ga0209281_100003465 355
1677 3300027111 Ga0209281_1000106 Ga0209281_1000106191 355
1678 3300027111 Ga0209281_1000318 Ga0209281_100031828 355
1679 3300027312 Ga0209371_1000022 Ga0209371_100002281 355
1680 3300027312 Ga0209371_1003359 Ga0209371_10033593 355
1681 3300027312 Ga0209371_1012916 Ga0209371_10129161 355
1682 3300027666 Ga0209282_1000024 Ga0209282_1000024122 355
1683 3300027666 Ga0209282_1000531 Ga0209282_10005311 355
1684 3300027666 Ga0209282_1045570 Ga0209282_10455702 355
1685 3300027866 Ga0209813_10019500 Ga0209813_100195002 355
1686 3300027876 Ga0209974_10009270 Ga0209974_100092702 355
1687 3300028379 Ga0268266_10025929 Ga0268266_100259292 355
1688 3300028379 Ga0268266_10105632 Ga0268266_101056322 355
1689 3300028379 Ga0268266_10116941 Ga0268266_101169412 355
1690 3300028380 Ga0268265_10046509 Ga0268265_100465092 355
1691 3300028380 Ga0268265_10057290 Ga0268265_100572902 355
1692 3300028380 Ga0268265_10163799 Ga0268265_101637992 355
1693 3300028381 Ga0268264_10099835 Ga0268264_100998352 355
1694 3300028381 Ga0268264_10118483 Ga0268264_101184832 355
1695 3300028381 Ga0268264_10196688 Ga0268264_101966882 355
1696 3300028794 Ga0307515_10001559 Ga0307515_1000155930 355
1697 3300028794 Ga0307515_10001978 Ga0307515_1000197817 355
1698 3300028794 Ga0307515_10007368 Ga0307515_1000736813 355
1699 3300028794 Ga0307515_10031969 Ga0307515_100319697 355
1700 3300030500 Ga0268256_1000019 Ga0268256_1000019439 355
1701 3300030500 Ga0268256_1003591 Ga0268256_10035913 355
1702 3300030500 Ga0268256_1012308 Ga0268256_10123082 355
1703 3300030744 Ga0316181_1196002 Ga0316181_11960022 355
1704 3300031241 Ga0265325_10029351 Ga0265325_100293513 355
1705 3300031247 Ga0265340_10018449 Ga0265340_100184493 355
1706 3300031456 Ga0307513_10010539 Ga0307513_100105393 355
1707 3300031456 Ga0307513_10056407 Ga0307513_100564073 355
1708 3300031456 Ga0307513_10091206 Ga0307513_100912062 355
1709 3300031548 Ga0307408_100060897 Ga0307408_1000608972 355
1710 3300031548 Ga0307408_100233217 Ga0307408_1002332172 355
1711 3300031595 Ga0265313_10003588 Ga0265313_100035888 355
1712 3300031711 Ga0265314_10116656 Ga0265314_101166562 355
1713 3300031712 Ga0265342_10014665 Ga0265342_100146655 355
1714 3300031731 Ga0307405_10000857 Ga0307405_100008579 355
1715 3300031852 Ga0307410_10228399 Ga0307410_102283992 355
1716 3300031911 Ga0307412_10000493 Ga0307412_100004932 355
1717 3300031911 Ga0307412_10173865 Ga0307412_101738652 355
1718 3300031967 Ga0315914_1000012 Ga0315914_100001241 355
1719 3300032002 Ga0307416_100469386 Ga0307416_1004693861 355
1720 3300032004 Ga0307414_10318020 Ga0307414_103180201 355
1721 3300032126 Ga0307415_100054506 Ga0307415_1000545063 355
1722 3300033430 Ga0315913_1000006 Ga0315913_100000641 355
1723 3300033464 Ga0315915_1000010 Ga0315915_1000010224 355
1724 3300035695 Ga0373927_0000350 Ga0373927_0000350_26888_27988 355
1725 3300037068 Ga0373925_0015189 Ga0373925_0015189_2818_3918 355
1726 3300037312 Ga0395899_0000117 Ga0395899_0000117_34726_35808 355
1727 3300037312 Ga0395899_0000721 Ga0395899_0000721_4427_5515 355
1728 3300037312 Ga0395899_0014995 Ga0395899_0014995_2347_3417 355
1729 3300037418 Ga0395900_0000020 Ga0395900_0000020_34726_35808 355
1730 3300037418 Ga0395900_0010176 Ga0395900_0010176_247_1347 355
1731 3300037418 Ga0395900_0012623 Ga0395900_0012623_6843_7913 355
1732 3300037418 Ga0395900_0032997 Ga0395900_0032997_1490_2572 355
1733 3300037418 Ga0395900_0037038 Ga0395900_0037038_3665_4753 355
1734 3300037418 Ga0395900_0111033 Ga0395900_0111033_1699_2769 355
1735 3300037466 Ga0395898_0000259 Ga0395898_0000259_34726_35808 355
1736 3300037466 Ga0395898_0017388 Ga0395898_0017388_859_1947 355
1737 3300037471 Ga0395905_0000019 Ga0395905_0000019_317693_318775 355
1738 3300037471 Ga0395905_0005044 Ga0395905_0005044_9917_11017 355
1739 3300037471 Ga0395905_0021769 Ga0395905_0021769_4219_5301 355
1740 3300037471 Ga0395905_0054858 Ga0395905_0054858_1931_3001 355
1741 3300037471 Ga0395905_0071756 Ga0395905_0071756_148_1230 355
1742 3300037471 Ga0395905_0099657 Ga0395905_0099657_271_1371 355
1743 3300037471 Ga0395905_0130601 Ga0395905_0130601_47_1117 355
1744 3300038443 Ga0395901_0000016 Ga0395901_0000016_35234_36316 355
1745 3300038443 Ga0395901_0196598 Ga0395901_0196598_729_1799 355
1746 3300038443 Ga0395901_0279372 Ga0395901_0279372_404_1486 355
1747 3300038443 Ga0395901_0315195 Ga0395901_0315195_370_1458 355
1748 3300038443 Ga0395901_0386153 Ga0395901_0386153_22_1104 355
1749 3300039062 Ga0400483_182297 Ga0400483_182297_294_1415 355
1750 3300039062 Ga0400483_251795 Ga0400483_251795_499_1581 355
1751 3300041404 Ga0439436_0005499 Ga0439436_0005499_2726_3826 355
1752 3300041413 Ga0439465_0002128 Ga0439465_0002128_5171_6271 355
1753 3300041451 Ga0451791_1547477 Ga0451791_1547477_1292_2392 355
1754 3300041498 Ga0451841_1414464 Ga0451841_1414464_668_1768 355
1755 3300041505 Ga0451849_0897929 Ga0451849_0897929_95_1195 355
1756 3300041507 Ga0451851_1171717 Ga0451851_1171717_3972_5072 355
1757 3300041512 Ga0451853_2936904 Ga0451853_2936904_199_1314 355
1758 3300042003 Ga0439443_007170 Ga0439443_007170_235_1350 355
1759 3300042157 Ga0439458_0019877 Ga0439458_0019877_344_1426 355
1760 3300042438 Ga0439459_0000950 Ga0439459_0000950_2640_3755 355
1761 3300042531 Ga0450918_008457 Ga0450918_008457_324_1424 355
1762 3300044735 Ga0466968_0040355 Ga0466968_0040355_270_1373 355
1763 3300044901 Ga0466960_0022200 Ga0466960_0022200_1075_2145 355
1764 3300044901 Ga0466960_0022279 Ga0466960_0022279_495_1577 355
1765 3300046453 Ga0495627_000769 Ga0495627_000769_22313_23428 355
1766 3300046457 Ga0495590_0001675 Ga0495590_0001675_5804_6919 355
1767 3300046460 Ga0495638_0001181 Ga0495638_0001181_22492_23592 355
1768 3300046460 Ga0495638_0005170 Ga0495638_0005170_2046_3161 355
1769 3300046460 Ga0495638_0006604 Ga0495638_0006604_2127_3239 355
1770 3300046460 Ga0495638_0008934 Ga0495638_0008934_2027_3127 355
1771 3300046460 Ga0495638_0025692 Ga0495638_0025692_2151_3266 355
1772 3300046460 Ga0495638_0030182 Ga0495638_0030182_457_1539 355
1773 3300046460 Ga0495638_0065339 Ga0495638_0065339_642_1757 355
1774 3300046460 Ga0495638_0084370 Ga0495638_0084370_392_1492 355
1775 3300046471 Ga0495650_0000237 Ga0495650_0000237_40088_41203 355
1776 3300046474 Ga0495605_0001952 Ga0495605_0001952_6563_7663 355
1777 3300046506 Ga0495583_0000001 Ga0495583_0000001_744732_745847 355
1778 3300046512 Ga0495610_0000407 Ga0495610_0000407_2283_3398 355
1779 3300046512 Ga0495610_0001969 Ga0495610_0001969_5016_6116 355
1780 3300046512 Ga0495610_0003529 Ga0495610_0003529_2893_4008 355
1781 3300046512 Ga0495610_0003825 Ga0495610_0003825_7870_8970 355
1782 3300046512 Ga0495610_0028351 Ga0495610_0028351_1251_2351 355
1783 3300046512 Ga0495610_0097095 Ga0495610_0097095_92_1174 355
1784 3300046513 Ga0495616_0000109 Ga0495616_0000109_24663_25778 355
1785 3300046513 Ga0495616_0072627 Ga0495616_0072627_122_1237 355
1786 3300046513 Ga0495616_0086043 Ga0495616_0086043_80_1180 355
1787 3300046515 Ga0495620_0028963 Ga0495620_0028963_406_1521 355
1788 3300046515 Ga0495620_0034736 Ga0495620_0034736_426_1526 355
1789 3300046518 Ga0495631_0001848 Ga0495631_0001848_1556_2671 355
1790 3300046518 Ga0495631_0003360 Ga0495631_0003360_1429_2529 355
1791 3300046518 Ga0495631_0034754 Ga0495631_0034754_254_1354 355
1792 3300046519 Ga0495632_0003529 Ga0495632_0003529_9590_10705 355
1793 3300046519 Ga0495632_0005104 Ga0495632_0005104_1411_2511 355
1794 3300046520 Ga0495637_0003364 Ga0495637_0003364_1398_2513 355
1795 3300046522 Ga0495643_0002725 Ga0495643_0002725_11324_12424 355
1796 3300046522 Ga0495643_0002802 Ga0495643_0002802_12078_13178 355
1797 3300046524 Ga0495648_0000509 Ga0495648_0000509_34939_36051 355
1798 3300046525 Ga0495663_0019216 Ga0495663_0019216_388_1503 355
1799 3300046530 Ga0495654_0000110 Ga0495654_0000110_60331_61431 355
1800 3300046530 Ga0495654_0000249 Ga0495654_0000249_7061_8176 355
1801 3300046536 Ga0495587_0055372 Ga0495587_0055372_1006_2106 355
1802 3300046542 Ga0495597_0018011 Ga0495597_0018011_426_1526 355
1803 3300046542 Ga0495597_0048517 Ga0495597_0048517_439_1551 355
1804 3300046558 Ga0495633_0009054 Ga0495633_0009054_2414_3514 355
1805 3300046558 Ga0495633_0112870 Ga0495633_0112870_68_1168 355
1806 3300046616 Ga0495668_0000037 Ga0495668_0000037_167184_168296 355
1807 3300046616 Ga0495668_0003688 Ga0495668_0003688_1870_2985 355
1808 3300046660 Ga0495625_0000284 Ga0495625_0000284_11419_12534 355
1809 3300046660 Ga0495625_0001387 Ga0495625_0001387_24698_25798 355
1810 3300046660 Ga0495625_0002396 Ga0495625_0002396_16011_17126 355
1811 3300046660 Ga0495625_0009397 Ga0495625_0009397_6918_8033 355
1812 3300046660 Ga0495625_0016011 Ga0495625_0016011_4008_5108 355
1813 3300046794 Ga0495589_0008352 Ga0495589_0008352_2891_4006 355
1814 3300046809 Ga0495600_0161865 Ga0495600_0161865_126_1226 355
1815 3300046810 Ga0495660_0072773 Ga0495660_0072773_123_1223 355
1816 3300047317 Ga0495604_0039341 Ga0495604_0039341_1977_3077 355
1817 3300047318 Ga0495636_0107141 Ga0495636_0107141_75_1175 355
1818 3300047320 Ga0495672_0003205 Ga0495672_0003205_2544_3689 355
1819 3300047320 Ga0495672_0009178 Ga0495672_0009178_3049_4164 355
1820 3300047469 Ga0495673_0000156 Ga0495673_0000156_45020_46135 355
1821 3300047469 Ga0495673_0001785 Ga0495673_0001785_14402_15514 355
1822 3300047472 Ga0495686_0002042 Ga0495686_0002042_16551_17666 355
1823 3300047472 Ga0495686_0002729 Ga0495686_0002729_12246_13346 355
1824 3300047472 Ga0495686_0039677 Ga0495686_0039677_1509_2609 355
1825 3300047472 Ga0495686_0071479 Ga0495686_0071479_587_1687 355
1826 3300047472 Ga0495686_0074730 Ga0495686_0074730_626_1726 355
1827 3300048903 Ga0496100_0024136 Ga0496100_0024136_1907_2992 355
1828 3300048903 Ga0496100_0053196 Ga0496100_0053196_1377_2462 355
1829 3300048904 Ga0496101_0006593 Ga0496101_0006593_4377_5462 355
1830 3300048905 Ga0496102_0011027 Ga0496102_0011027_382_1467 355
1831 3300048906 Ga0496103_0049797 Ga0496103_0049797_1086_2171 355
1832 3300048907 Ga0496104_0028708 Ga0496104_0028708_429_1514 355
1833 3300048908 Ga0496105_0003076 Ga0496105_0003076_550_1635 355
1834 3300048908 Ga0496105_0048040 Ga0496105_0048040_1663_2748 355
1835 3300048909 Ga0496106_0000982 Ga0496106_0000982_13340_14440 355
1836 3300048909 Ga0496106_0006952 Ga0496106_0006952_4406_5521 355
1837 3300048909 Ga0496106_0168989 Ga0496106_0168989_484_1569 355
1838 3300048910 Ga0496107_0000864 Ga0496107_0000864_5392_6477 355
1839 3300048910 Ga0496107_0000914 Ga0496107_0000914_1901_3016 355
1840 3300048910 Ga0496107_0019454 Ga0496107_0019454_1533_2618 355
1841 3300048911 Ga0496108_0000529 Ga0496108_0000529_17796_18866 355
1842 3300048912 Ga0496109_0243579 Ga0496109_0243579_224_1309 355
1843 3300048915 Ga0496112_0222368 Ga0496112_0222368_313_1395 355
1844 3300048916 Ga0496113_0256304 Ga0496113_0256304_91_1176 355
1845 3300048917 Ga0496114_0023493 Ga0496114_0023493_3775_4860 355
1846 3300048918 Ga0496115_0003066 Ga0496115_0003066_3874_4989 355
1847 3300048918 Ga0496115_0013897 Ga0496115_0013897_446_1531 355
1848 3300048919 Ga0496116_0000142 Ga0496116_0000142_97666_98766 355
1849 3300048919 Ga0496116_0011061 Ga0496116_0011061_3793_4893 355
1850 3300048919 Ga0496116_0029217 Ga0496116_0029217_1481_2581 355
1851 3300048919 Ga0496116_0051921 Ga0496116_0051921_59_1159 355
1852 3300048920 Ga0496117_0000002 Ga0496117_0000002_474967_476067 355
1853 3300048920 Ga0496117_0004520 Ga0496117_0004520_1999_3099 355
1854 3300048920 Ga0496117_0012510 Ga0496117_0012510_1078_2178 355
1855 3300048921 Ga0496118_0000087 Ga0496118_0000087_86526_87626 355
1856 3300048921 Ga0496118_0126311 Ga0496118_0126311_487_1587 355
1857 3300048922 Ga0496119_0005947 Ga0496119_0005947_3214_4314 355
1858 3300048922 Ga0496119_0011964 Ga0496119_0011964_4747_5829 355
1859 3300048922 Ga0496119_0033726 Ga0496119_0033726_1558_2658 355
1860 3300048923 Ga0496120_0000413 Ga0496120_0000413_9894_10994 355
1861 3300048923 Ga0496120_0001104 Ga0496120_0001104_9472_10554 355
1862 3300048923 Ga0496120_0017315 Ga0496120_0017315_2911_4011 355
1863 3300048924 Ga0496121_0000003 Ga0496121_0000003_386453_387553 355
1864 3300048924 Ga0496121_0001116 Ga0496121_0001116_33908_35008 355
1865 3300048924 Ga0496121_0004530 Ga0496121_0004530_2796_3911 355
1866 3300048924 Ga0496121_0084672 Ga0496121_0084672_546_1628 355
1867 3300048925 Ga0496122_0000004 Ga0496122_0000004_113791_114891 355
1868 3300048925 Ga0496122_0000190 Ga0496122_0000190_128435_129535 355
1869 3300048925 Ga0496122_0000215 Ga0496122_0000215_45511_46614 355
1870 3300048925 Ga0496122_0008959 Ga0496122_0008959_7416_8516 355
1871 3300048925 Ga0496122_0033581 Ga0496122_0033581_1123_2223 355
1872 3300048925 Ga0496122_0040083 Ga0496122_0040083_1158_2258 355
1873 3300048925 Ga0496122_0067097 Ga0496122_0067097_573_1655 355
1874 3300048925 Ga0496122_0132461 Ga0496122_0132461_228_1328 355
1875 3300048926 Ga0496123_0000007 Ga0496123_0000007_113791_114891 355
1876 3300048926 Ga0496123_0000306 Ga0496123_0000306_82197_83300 355
1877 3300048926 Ga0496123_0000336 Ga0496123_0000336_12431_13531 355
1878 3300048926 Ga0496123_0016026 Ga0496123_0016026_3815_4915 355
1879 3300048926 Ga0496123_0027463 Ga0496123_0027463_89_1189 355
1880 3300048926 Ga0496123_0059789 Ga0496123_0059789_188_1288 355
1881 3300048927 Ga0496124_0001040 Ga0496124_0001040_11811_12911 355
1882 3300048927 Ga0496124_0006855 Ga0496124_0006855_3308_4408 355
1883 3300048927 Ga0496124_0008840 Ga0496124_0008840_4851_5951 355
1884 3300048927 Ga0496124_0011355 Ga0496124_0011355_3733_4833 355
1885 3300048927 Ga0496124_0015066 Ga0496124_0015066_1648_2748 355
1886 3300048927 Ga0496124_0017201 Ga0496124_0017201_303_1415 355
1887 3300048927 Ga0496124_0017234 Ga0496124_0017234_1842_2942 355
1888 3300048927 Ga0496124_0031646 Ga0496124_0031646_760_1863 355
1889 3300048928 Ga0496125_0000039 Ga0496125_0000039_165091_166191 355
1890 3300048928 Ga0496125_0000248 Ga0496125_0000248_97156_98256 355
1891 3300048928 Ga0496125_0006049 Ga0496125_0006049_2937_4037 355
1892 3300048928 Ga0496125_0213966 Ga0496125_0213966_157_1239 355
1893 3300048929 Ga0496126_0000866 Ga0496126_0000866_12464_13564 355
1894 3300048929 Ga0496126_0001294 Ga0496126_0001294_11948_13048 355
1895 3300048929 Ga0496126_0003703 Ga0496126_0003703_16695_17807 355
1896 3300048929 Ga0496126_0014931 Ga0496126_0014931_1551_2651 355
1897 3300048929 Ga0496126_0226154 Ga0496126_0226154_218_1303 355
1898 3300049459 Ga0495678_003521 Ga0495678_003521_6129_7244 355
1899 3300049568 Ga0501031_0000036 Ga0501031_0000036_62572_63654 355
1900 3300049569 Ga0501032_0000075 Ga0501032_0000075_67878_68960 355
1901 3300049569 Ga0501032_0000100 Ga0501032_0000100_10151_11233 355
1902 3300049569 Ga0501032_0001737 Ga0501032_0001737_104_1186 355
1903 3300049569 Ga0501032_0056351 Ga0501032_0056351_1040_2140 355
1904 3300049569 Ga0501032_0058728 Ga0501032_0058728_981_2081 355
1905 3300049569 Ga0501032_0104903 Ga0501032_0104903_681_1763 355
1906 3300049570 Ga0501033_0000088 Ga0501033_0000088_62273_63355 355
1907 3300049570 Ga0501033_0001862 Ga0501033_0001862_11622_12722 355
1908 3300049570 Ga0501033_0002110 Ga0501033_0002110_5877_6959 355
1909 3300049570 Ga0501033_0087085 Ga0501033_0087085_594_1676 355
1910 3300049571 Ga0501034_0000397 Ga0501034_0000397_10157_11239 355
1911 3300049571 Ga0501034_0001558 Ga0501034_0001558_2045_3127 355
1912 3300049571 Ga0501034_0003857 Ga0501034_0003857_5586_6668 355
1913 3300049571 Ga0501034_0041258 Ga0501034_0041258_1205_2290 355
1914 3300049571 Ga0501034_0062289 Ga0501034_0062289_715_1815 355
1915 3300049571 Ga0501034_0086446 Ga0501034_0086446_1903_2988 355
1916 3300049571 Ga0501034_0086879 Ga0501034_0086879_1813_2898 355
1917 3300049571 Ga0501034_0191331 Ga0501034_0191331_71_1156 355
1918 3300049571 Ga0501034_0284546 Ga0501034_0284546_282_1382 355
1919 3300049572 Ga0501036_0000056 Ga0501036_0000056_10157_11239 355
1920 3300049572 Ga0501036_0000398 Ga0501036_0000398_19533_20615 355
1921 3300049572 Ga0501036_0060537 Ga0501036_0060537_837_1919 355
1922 3300049572 Ga0501036_0308564 Ga0501036_0308564_136_1236 355
1923 3300049573 Ga0501037_0000021 Ga0501037_0000021_80752_81834 355
1924 3300049573 Ga0501037_0000119 Ga0501037_0000119_10156_11238 355
1925 3300049573 Ga0501037_0000181 Ga0501037_0000181_24456_25538 355
1926 3300049574 Ga0501038_0000032 Ga0501038_0000032_62473_63555 355
1927 3300049574 Ga0501038_0000098 Ga0501038_0000098_10130_11212 355
1928 3300049575 Ga0501039_0000013 Ga0501039_0000013_62273_63355 355
1929 3300049575 Ga0501039_0000025 Ga0501039_0000025_76742_77824 355
1930 3300049576 Ga0501040_0106566 Ga0501040_0106566_598_1680 355
1931 3300049576 Ga0501040_0199928 Ga0501040_0199928_229_1314 355
1932 3300049578 Ga0501042_0061785 Ga0501042_0061785_690_1775 355
1933 3300049579 Ga0501043_0000008 Ga0501043_0000008_52173_53255 355
1934 3300049579 Ga0501043_0002291 Ga0501043_0002291_10133_11215 355
1935 3300049579 Ga0501043_0004109 Ga0501043_0004109_808_1890 355
1936 3300049579 Ga0501043_0013809 Ga0501043_0013809_773_1873 355
1937 3300049579 Ga0501043_0046072 Ga0501043_0046072_1294_2376 355
1938 3300049581 Ga0501047_0001349 Ga0501047_0001349_9813_10895 355
1939 3300049581 Ga0501047_0009767 Ga0501047_0009767_4260_5342 355
1940 3300049581 Ga0501047_0014505 Ga0501047_0014505_4967_6049 355
1941 3300049581 Ga0501047_0051975 Ga0501047_0051975_2290_3375 355
1942 3300049581 Ga0501047_0079750 Ga0501047_0079750_539_1621 355
1943 3300049581 Ga0501047_0100203 Ga0501047_0100203_333_1433 355
1944 3300049581 Ga0501047_0154168 Ga0501047_0154168_497_1579 355
1945 3300049582 Ga0501048_0151484 Ga0501048_0151484_497_1579 355
1946 3300049584 Ga0501068_0043794 Ga0501068_0043794_1553_2635 355
1947 3300049584 Ga0501068_0081653 Ga0501068_0081653_93_1175 355
1948 3300049584 Ga0501068_0154471 Ga0501068_0154471_57_1157 355
1949 3300049585 Ga0501069_0000028 Ga0501069_0000028_78732_79814 355
1950 3300049585 Ga0501069_0094575 Ga0501069_0094575_326_1408 355
1951 3300049586 Ga0501070_0000208 Ga0501070_0000208_6316_7398 355
1952 3300049586 Ga0501070_0000264 Ga0501070_0000264_7693_8775 355
1953 3300049586 Ga0501070_0002017 Ga0501070_0002017_16131_17213 355
1954 3300049586 Ga0501070_0011937 Ga0501070_0011937_2567_3649 355
1955 3300049586 Ga0501070_0038239 Ga0501070_0038239_2175_3290 355
1956 3300049586 Ga0501070_0064702 Ga0501070_0064702_704_1786 355
1957 3300049586 Ga0501070_0247854 Ga0501070_0247854_106_1188 355
1958 3300049587 Ga0501071_0026908 Ga0501071_0026908_1824_2906 355
1959 3300049587 Ga0501071_0129555 Ga0501071_0129555_243_1325 355
1960 3300049587 Ga0501071_0305027 Ga0501071_0305027_62_1144 355
1961 3300049588 Ga0501072_0119994 Ga0501072_0119994_77_1222 355
1962 3300049589 Ga0501073_0017923 Ga0501073_0017923_2670_3752 355
1963 3300049590 Ga0501074_0000016 Ga0501074_0000016_61471_62553 355
1964 3300049590 Ga0501074_0064103 Ga0501074_0064103_517_1599 355
1965 3300049593 Ga0501077_0083851 Ga0501077_0083851_742_1827 355
1966 3300049671 Ga0501238_002317 Ga0501238_002317_491_1606 355
1967 3300049742 Ga0501080_0000065 Ga0501080_0000065_20294_21376 355
1968 3300049742 Ga0501080_0000515 Ga0501080_0000515_18838_19920 355
1969 3300049742 Ga0501080_0018343 Ga0501080_0018343_3730_4830 355
1970 3300049742 Ga0501080_0044577 Ga0501080_0044577_2679_3761 355
1971 3300049742 Ga0501080_0131816 Ga0501080_0131816_458_1528 355
1972 3300049744 Ga0501083_0000482 Ga0501083_0000482_24370_25452 355
1973 3300049744 Ga0501083_0007197 Ga0501083_0007197_6016_7101 355
1974 3300049744 Ga0501083_0030737 Ga0501083_0030737_574_1719 355
1975 3300049744 Ga0501083_0042867 Ga0501083_0042867_1211_2356 355
1976 3300049744 Ga0501083_0069870 Ga0501083_0069870_1127_2227 355
1977 3300049822 Ga0501035_0000011 Ga0501035_0000011_16147_17229 355
1978 3300049822 Ga0501035_0000053 Ga0501035_0000053_79506_80588 355
1979 3300049822 Ga0501035_0000085 Ga0501035_0000085_42784_43866 355
1980 3300049822 Ga0501035_0000584 Ga0501035_0000584_6226_7326 355
1981 3300049822 Ga0501035_0001564 Ga0501035_0001564_8477_9559 355
1982 3300049822 Ga0501035_0001865 Ga0501035_0001865_7412_8494 355
1983 3300049822 Ga0501035_0002030 Ga0501035_0002030_10172_11254 355
1984 3300049822 Ga0501035_0051433 Ga0501035_0051433_1397_2479 355
1985 3300049822 Ga0501035_0167383 Ga0501035_0167383_155_1237 355
1986 3300049822 Ga0501035_0178021 Ga0501035_0178021_378_1478 355
1987 3300049823 Ga0501044_0000011 Ga0501044_0000011_37461_38543 355
1988 3300049823 Ga0501044_0000214 Ga0501044_0000214_62273_63355 355
1989 3300049823 Ga0501044_0014012 Ga0501044_0014012_926_2008 355
1990 3300049823 Ga0501044_0021514 Ga0501044_0021514_5337_6419 355
1991 3300049823 Ga0501044_0029188 Ga0501044_0029188_3639_4721 355
1992 3300049823 Ga0501044_0130899 Ga0501044_0130899_1081_2166 355
1993 3300049823 Ga0501044_0259986 Ga0501044_0259986_269_1369 355
1994 3300049823 Ga0501044_0261644 Ga0501044_0261644_266_1366 355
1995 3300049824 Ga0501045_0098913 Ga0501045_0098913_117_1199 355
1996 3300050489 nmdc:mga03683_61655_c1 nmdc:mga03683_61655_c1_443_1543 355
1997 3300050490 nmdc:mga03n38_11236_c1 nmdc:mga03n38_11236_c1_269_1369 355
1998 3300050490 nmdc:mga03n38_12796_c1 nmdc:mga03n38_12796_c1_1617_2699 355
1999 3300050490 nmdc:mga03n38_49203_c1 nmdc:mga03n38_49203_c1_754_1839 355
2000 3300050491 nmdc:mga00v17_12_c1 nmdc:mga00v17_12_c1_22818_23918 355
2001 3300050491 nmdc:mga00v17_3914_c1 nmdc:mga00v17_3914_c1_2914_4014 355
2002 3300050491 nmdc:mga00v17_639_c1 nmdc:mga00v17_639_c1_12438_13538 355
2003 3300050492 nmdc:mga0yw44_291_c1 nmdc:mga0yw44_291_c1_9698_10798 355
2004 3300050493 nmdc:mga0k408_143212_c1 nmdc:mga0k408_143212_c1_79_1179 355
2005 3300050493 nmdc:mga0k408_14483_c1 nmdc:mga0k408_14483_c1_458_1558 355
2006 3300050493 nmdc:mga0k408_48746_c1 nmdc:mga0k408_48746_c1_608_1720 355
2007 3300050494 nmdc:mga06z11_32566_c1 nmdc:mga06z11_32566_c1_375_1475 355
2008 3300050494 nmdc:mga06z11_6219_c1 nmdc:mga06z11_6219_c1_1874_2974 355
2009 3300050494 nmdc:mga06z11_91404_c1 nmdc:mga06z11_91404_c1_127_1209 355
2010 3300050496 nmdc:mga07m45_11234_c1 nmdc:mga07m45_11234_c1_2197_3279 355
2011 3300050496 nmdc:mga07m45_85941_c1 nmdc:mga07m45_85941_c1_103_1188 355
2012 3300050516 nmdc:mga0sz30_1084_c1 nmdc:mga0sz30_1084_c1_1242_2342 355
2013 3300050516 nmdc:mga0sz30_2810_c1 nmdc:mga0sz30_2810_c1_4755_5867 355
2014 3300050516 nmdc:mga0sz30_32753_c1 nmdc:mga0sz30_32753_c1_454_1536 355
2015 3300053079 Ga0500610_0007910 Ga0500610_0007910_2087_3187 355
2016 3300053086 Ga0500578_0000134 Ga0500578_0000134_12877_13992 355
2017 3300053086 Ga0500578_0041968 Ga0500578_0041968_1765_2865 355
2018 3300053087 Ga0500643_000992 Ga0500643_000992_2751_3863 355
2019 3300053088 Ga0500644_0000618 Ga0500644_0000618_5099_6211 355
2020 3300053104 Ga0500556_0001416 Ga0500556_0001416_8212_9327 355
2021 3300053107 Ga0500560_000083 Ga0500560_000083_4581_5681 355
2022 3300053108 Ga0500562_000545 Ga0500562_000545_4319_5434 355
2023 3300053111 Ga0500572_001610 Ga0500572_001610_3509_4609 355
2024 3300053118 Ga0500594_0000319 Ga0500594_0000319_7219_8334 355
2025 3300053118 Ga0500594_0034655 Ga0500594_0034655_232_1332 355
2026 3300053120 Ga0500597_061909 Ga0500597_061909_47_1174 355
2027 3300053122 Ga0500608_044527 Ga0500608_044527_474_1574 355
2028 3300053123 Ga0500614_003099 Ga0500614_003099_927_2042 355
2029 3300053125 Ga0500618_000314 Ga0500618_000314_10661_11761 355
2030 3300053125 Ga0500618_000677 Ga0500618_000677_7022_8122 355
2031 3300053125 Ga0500618_009330 Ga0500618_009330_1386_2489 355
2032 3300053134 Ga0500658_0000526 Ga0500658_0000526_10122_11222 355
2033 3300053136 Ga0500559_0000307 Ga0500559_0000307_28992_30107 355
2034 3300053136 Ga0500559_0002861 Ga0500559_0002861_3432_4532 355
2035 3300053136 Ga0500559_0020295 Ga0500559_0020295_186_1301 355
2036 3300053137 Ga0500561_0000098 Ga0500561_0000098_9960_11060 355
2037 3300053138 Ga0500564_000155 Ga0500564_000155_5031_6143 355
2038 3300053139 Ga0500568_0000093 Ga0500568_0000093_38156_39238 355
2039 3300053142 Ga0500577_0000256 Ga0500577_0000256_10047_11162 355
2040 3300053148 Ga0500590_003631 Ga0500590_003631_5583_6683 355
2041 3300053151 Ga0500604_0056608 Ga0500604_0056608_31_1113 355
2042 3300053153 Ga0500616_0000277 Ga0500616_0000277_27267_28370 355
2043 3300053153 Ga0500616_0001018 Ga0500616_0001018_27311_28411 355
2044 3300053153 Ga0500616_0012776 Ga0500616_0012776_1331_2416 355
2045 3300053153 Ga0500616_0025011 Ga0500616_0025011_1775_2875 355
2046 3300053153 Ga0500616_0044112 Ga0500616_0044112_1041_2156 355
2047 3300053155 Ga0500620_000576 Ga0500620_000576_1395_2477 355
2048 3300053156 Ga0500622_0000458 Ga0500622_0000458_24381_25481 355
2049 3300053156 Ga0500622_0000627 Ga0500622_0000627_4370_5470 355
2050 3300053156 Ga0500622_0004784 Ga0500622_0004784_6083_7198 355
2051 3300053156 Ga0500622_0009618 Ga0500622_0009618_3855_4967 355
2052 3300053156 Ga0500622_0035314 Ga0500622_0035314_712_1827 355
2053 3300053157 Ga0500624_005531 Ga0500624_005531_524_1624 355
2054 3300053158 Ga0500627_0072248 Ga0500627_0072248_42_1157 355
2055 3300053158 Ga0500627_0075524 Ga0500627_0075524_99_1181 355
2056 3300053158 Ga0500627_0093577 Ga0500627_0093577_170_1270 355
2057 3300053161 Ga0500634_0000041 Ga0500634_0000041_46494_47579 355
2058 3300053161 Ga0500634_0000261 Ga0500634_0000261_3401_4501 355
2059 3300053177 Ga0500636_0000180 Ga0500636_0000180_16346_17446 355
2060 3300053730 Ga0500645_001323 Ga0500645_001323_10181_11296 355
2061 3300054114 Ga0501084_0159408 Ga0501084_0159408_564_1649 355
2062 3300059641 Ga0587068_009854 Ga0587068_009854_105_1205 355
2063 3300061734 Ga0530510_0089281 Ga0530510_0089281_442_1527 355
2064 iso_pu_bacteria 2643221610 2644063454 355
2065 iso_pu_bacteria 2643221668 2644374737 355
2066 iso_pu_bacteria 2643221675 2644414217 355
2067 iso_pu_bacteria 2643221680 2644447745 355
2068 iso_pu_bacteria 2643221726 2644690218 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10555

MraY_sig1

Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1

135

147

0.96

PF00953

Glycos_transf_4

Glycosyl transferase family 4

165

358

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cxr-assembly4.cif.gz_D crystal structure of mray bound to a sphaerimicin analogue 0.9632 23 351
6oyz-assembly4.cif.gz_D crystal structure of mray bound to capuramycin 0.9563 20 351
6oyz-assembly2.cif.gz_C crystal structure of mray bound to capuramycin 0.9557 24 351
6oz6-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9539 24 351
6oyz-assembly1.cif.gz_A crystal structure of mray bound to capuramycin 0.9538 20 351
ID Description Score Start End Superfamily
af_P0CC63_1_145_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3877 96 245 1.10.287.3510
af_P0ADJ8_1_145_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3589 166 277 1.20.1250.20
4p18E00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3579 184 250 1.20.1260.10
af_P0CC63_1_145_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3168 96 245 1.10.287.3510
af_A4QN56_306_560_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3018 100 350 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V6UUB9-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9948 198 353 GO:0005886
GO:0008963
GO:0009252
GO:0046872
GO:0071555
AF-A0A3S1VV32-F1-model_v4 deleted 0.9933 184 336
AF-A0A2X3HJK8-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9931 197 353 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0051992
GO:0071555
AF-A0A431JKN2-F1-model_v4 deleted 0.9911 1 322
AF-A0A6N6S6W3-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9906 173 348 GO:0005886
GO:0008963
GO:0009252
GO:0046872
GO:0051992
GO:0071555

Feature Viewer

pLDDT pTM Quality
90.57 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map