F496343
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2068 | 1325 | 1177 | 362 |
Family's Representative Sequence
| Representative Sequence | 3300003775|Ga0055524_1003871|Ga0055524_10038714 |
| Length | 433 |
| Sequence | MMARWIQFEVRRRALTLSHASAYRFSDDSVGRVSKYYGAASPGAGKLRCNTLNCCIIVQETFGERSLMLIWLVELADHFQFFNLFRYITFRTGAALFTSAMIVFLFGPAMIASLRIRQGKGQPIRADGPQTHFKKAGTPTMGGLMILAGIVVSSLLWADLSSVYVVSTLLVTLGFGAIGFYDDYLKVTKQSDKGFSGKARLGIEFVIAAIAVFFMMQASLSGGPSGSTFGSSVTFPFFKDLIVNLGYFFVLFGGFVIVGAGNAVNLTDGLDGLAIVPVMIAAAAFGLIAYLAGNAVFANYLQIHFVPGTGELAVILGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTVAVAVKHEIVMIIIGGLFVMETLSVIIQVFWFKRTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIIAVILAMVGLSTLKLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 6 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 7 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 8 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 9 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 10 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 11 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 12 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 13 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 14 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 15 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 16 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 17 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 18 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 19 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 20 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 21 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 22 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 23 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 24 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 25 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 26 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 27 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 28 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 29 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 30 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 31 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 32 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 33 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 34 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 35 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 36 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 37 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 38 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 39 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 40 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 41 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 42 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 43 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 44 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 45 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 46 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 47 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 48 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 49 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 50 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 51 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 52 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 53 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 54 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 55 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 56 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 57 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 58 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 59 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 60 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 61 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 62 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 63 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 64 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 65 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 66 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 67 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 68 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 69 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 70 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 71 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 72 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 73 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 74 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 75 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 76 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 77 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 78 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 79 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 80 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 81 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 82 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 83 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 84 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 85 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 86 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 87 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 88 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 89 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 90 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 91 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 92 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 93 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 94 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 95 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 96 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 97 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 98 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 99 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 100 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 101 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 102 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 103 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 104 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 105 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 106 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 107 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 108 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 109 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 110 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 111 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 112 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 113 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 114 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 115 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 116 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 117 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 118 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 119 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 120 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 121 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 122 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 123 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 124 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 125 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 126 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 127 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 128 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 129 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 130 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 131 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 132 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 133 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 134 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 135 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 136 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 137 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 138 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 139 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 140 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 141 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 142 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 143 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 144 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 145 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 146 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 147 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 148 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 149 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 150 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 151 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 152 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 153 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 154 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 155 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 156 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 157 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 158 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 159 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 160 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 161 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 162 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 163 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 164 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 165 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 166 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 167 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 168 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 169 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 170 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 171 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 172 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 173 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 174 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 175 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 176 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 177 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 178 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 179 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 180 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 181 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 182 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 183 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 184 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 185 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 186 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 187 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 188 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 189 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 190 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 191 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 192 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 193 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 194 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 195 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 196 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 197 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 198 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 199 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 200 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 201 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 202 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 203 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 204 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 205 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 206 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 207 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 208 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 209 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 210 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 211 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 212 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 213 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 214 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 215 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 216 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 217 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 218 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 219 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 220 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 221 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 222 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 223 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 224 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 225 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 226 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 227 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 228 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 229 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 230 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 231 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 232 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 233 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 234 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 235 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 236 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 237 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 238 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 239 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 240 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 241 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 242 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 243 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 244 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 245 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 246 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 247 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 248 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 249 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 250 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 251 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 252 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 253 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 254 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 255 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 256 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 257 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 258 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 259 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 260 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 261 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 262 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 263 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 264 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 265 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 266 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 267 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 268 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 269 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 270 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 271 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 272 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 273 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 274 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 275 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 276 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 277 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 278 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 279 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 280 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 281 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 282 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 283 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 284 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 285 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 286 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 287 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 288 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 289 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 290 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 291 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 292 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 293 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 294 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 295 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 296 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 297 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 298 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 299 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 300 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 301 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 302 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 303 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 304 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 305 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 306 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 307 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 308 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 309 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 310 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 311 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 312 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 313 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 314 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 315 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 316 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 317 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 318 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 319 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 320 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 321 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 322 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 323 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 324 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 325 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 326 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 327 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 328 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 329 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 330 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 331 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 332 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 333 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 334 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 335 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 336 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 337 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 338 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 339 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 340 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 341 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 342 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 343 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 344 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 345 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 346 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 347 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 348 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 349 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 350 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 351 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 352 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 353 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 354 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 355 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 356 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 357 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 358 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 359 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 360 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 361 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 362 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 363 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 364 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 365 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 366 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 367 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 368 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 369 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 370 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 371 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 372 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 373 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 374 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 375 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 376 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 377 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 378 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 379 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 380 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 381 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 382 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 383 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 384 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 385 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 386 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 387 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 388 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 389 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 390 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 391 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 392 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 393 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 394 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 395 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 396 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 397 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 398 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 399 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 400 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 401 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 402 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 403 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 404 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 405 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 406 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 407 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 408 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 409 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 410 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 411 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 412 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 413 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 414 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 415 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 416 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 417 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 418 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 419 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 420 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 421 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 422 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 423 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 424 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 425 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 426 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 427 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 428 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 429 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 430 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 431 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 432 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 433 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 434 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 435 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 436 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 437 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 438 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 439 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 440 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 441 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 442 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 443 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 444 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 445 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 446 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 447 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 448 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 449 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 450 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 451 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 452 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 453 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 454 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 455 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 456 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 457 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 458 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 459 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 460 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 461 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 462 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 463 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 464 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 465 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 466 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 467 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 468 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 469 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 470 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 471 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 472 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 473 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 474 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 475 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 476 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 477 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 478 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 479 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 480 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 481 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 482 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 483 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 484 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 485 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 486 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 487 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 488 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 489 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 490 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 491 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 492 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 493 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 494 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 495 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 496 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 497 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 498 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 499 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 500 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 501 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 502 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 503 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 504 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 505 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 506 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 507 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 508 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 509 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 510 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 511 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 512 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 513 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 514 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 515 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 516 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 517 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 518 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 519 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 520 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 521 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 522 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 523 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 524 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 525 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 526 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 527 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 528 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 529 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 530 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 531 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 532 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 533 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 534 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 535 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 536 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 537 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 538 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 539 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 540 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 541 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 542 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 543 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 544 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 545 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 546 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 547 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 548 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 549 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 550 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 551 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 552 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 553 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 554 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 555 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 556 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 557 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 558 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 559 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 560 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 561 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 562 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 563 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 564 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 565 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 566 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 567 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 568 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 569 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 570 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 571 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 572 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 573 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 574 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 575 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 576 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 577 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 578 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 579 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 580 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 581 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 582 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 583 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 584 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 585 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 586 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 587 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 588 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 589 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 590 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 591 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 592 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 593 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 594 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 595 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 596 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 597 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 598 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 599 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 600 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 601 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 602 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 603 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 604 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 605 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 606 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 607 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 608 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 609 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 610 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 611 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 612 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 613 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 614 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 615 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 616 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 617 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 618 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 619 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 620 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 621 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 622 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 623 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 624 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 625 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 626 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 627 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 628 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 629 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 630 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 631 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 632 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 633 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 634 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 635 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 636 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 637 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 638 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 639 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 640 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 641 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 642 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 643 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 644 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 645 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 646 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 647 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 648 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 649 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 650 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 651 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 652 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 653 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 654 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 655 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 656 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 657 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 658 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 659 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 660 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 661 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 662 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 663 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 664 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 665 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 666 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 667 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 668 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 669 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 670 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 671 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 672 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 673 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 674 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 675 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 676 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 677 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 678 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 679 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 680 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 681 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 682 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 683 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 684 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 685 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 686 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 687 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 688 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 689 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 690 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 691 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 692 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 693 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 694 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 695 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 696 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 697 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 698 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 699 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 700 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 701 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 702 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 703 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 704 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 705 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 706 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 707 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 708 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 709 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 710 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 711 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 712 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 713 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 714 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 715 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 716 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 717 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 718 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 719 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 720 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 721 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 722 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 723 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 724 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 725 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 726 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 727 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 728 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 729 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 730 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 731 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 732 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 733 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 734 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 735 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 736 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 737 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 738 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 739 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 740 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 741 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 742 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 743 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 744 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 745 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 746 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 747 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 748 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 749 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 750 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 751 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 752 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 753 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 754 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 755 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 756 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 757 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 758 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 759 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 760 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 761 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 762 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 763 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 764 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 765 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 766 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 767 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 768 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 769 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 770 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 771 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 772 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 773 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 774 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 775 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 776 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 777 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 778 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 779 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 780 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 781 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 782 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 783 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 784 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 785 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 786 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 787 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 788 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 789 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 790 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 791 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 792 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 793 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 794 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 795 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 796 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 797 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 798 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 799 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 800 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 801 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 802 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 803 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 804 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 805 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 806 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 807 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 808 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 809 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 810 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 811 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 812 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 813 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 814 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 815 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 816 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 817 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 818 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 819 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 820 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 821 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 822 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 823 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 824 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 825 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 826 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 827 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 828 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 829 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 830 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 831 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 832 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 833 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 834 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 835 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 836 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 837 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 838 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 839 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 840 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 841 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 842 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 843 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 844 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 845 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 846 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 847 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 848 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 849 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 850 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 851 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 852 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 853 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 854 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 855 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 856 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 857 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 858 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 859 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 860 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 861 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 862 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 863 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 864 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 865 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 866 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 867 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 868 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 869 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 870 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 871 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 872 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 873 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 874 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 875 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 876 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 877 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 878 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 879 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 880 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 881 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 882 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 883 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 884 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 885 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 886 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 887 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 888 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 889 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 890 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 891 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 892 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 893 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 894 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 895 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 896 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 897 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 898 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 899 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 900 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 901 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 902 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 903 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 904 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 905 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 906 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 907 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 908 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 909 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 910 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 911 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 912 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 913 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 914 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 915 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 916 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 917 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 918 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 919 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 920 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 921 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 922 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 923 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 924 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 925 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 926 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 927 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 928 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 929 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 930 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 931 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 932 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 933 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 934 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 935 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 936 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 937 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 938 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 939 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 940 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 941 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 942 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 943 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 944 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 945 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 946 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 947 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 948 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 949 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 950 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 951 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 952 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 953 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 954 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 955 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 956 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 957 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 958 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 959 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 960 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 961 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 962 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 963 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 964 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 965 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 966 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 967 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 968 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 969 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 970 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 971 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 972 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 973 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 974 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 975 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 976 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 977 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 978 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 979 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 980 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 981 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 982 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 983 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 984 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 985 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 986 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 987 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 988 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 989 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 990 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 991 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 992 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 993 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 994 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 995 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 996 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 997 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 998 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 999 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1000 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1001 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1002 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1003 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1004 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1005 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1006 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1007 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1008 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1009 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1010 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1011 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1012 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1013 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1014 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1015 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1016 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1017 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1018 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1019 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1020 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1021 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1022 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1023 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1024 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1025 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1026 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1027 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1028 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1029 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 1030 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1031 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 1032 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1033 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1034 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 1035 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1036 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1037 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1038 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 1039 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 1040 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 1041 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 1042 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 1043 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 1044 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 1045 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 1046 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 1047 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 1048 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 1049 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 1050 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 1051 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 1052 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 1053 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 1054 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 1055 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 1056 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 1057 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 1058 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 1059 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 1060 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 1061 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 1062 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 1063 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 1064 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 1065 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 1066 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 1067 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 1068 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 1069 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 1070 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1071 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 1072 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 1073 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 1074 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 1075 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1076 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1077 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 1078 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 1079 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1080 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1081 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1082 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1083 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1084 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1085 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 1086 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 1087 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 1088 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 1089 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1090 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 1091 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 1092 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 1093 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1094 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 1095 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 1096 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 1097 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 1098 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 1099 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 1100 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 1101 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 1102 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 1103 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1104 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 1105 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1106 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 1107 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 1108 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 1109 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 1110 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1111 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 1112 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1113 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1114 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1115 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1116 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1117 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 1118 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 1119 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1120 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1121 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 1122 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1123 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1124 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 1125 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1126 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1127 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 1128 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1129 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1130 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1131 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1132 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 1133 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1134 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1135 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1136 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 1137 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1138 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1139 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 1140 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1141 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1142 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1143 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1145 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1149 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1154 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1155 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1156 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1157 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1158 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1159 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1160 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1161 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1162 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1163 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1164 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1165 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1166 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1167 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1168 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1169 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1170 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1171 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1174 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1175 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1176 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1177 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1178 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1179 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1180 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1181 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1182 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1183 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1184 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1185 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1187 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1188 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1189 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1190 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1191 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1192 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1193 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1194 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 1195 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1196 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1197 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1198 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1199 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1201 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1202 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1203 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1204 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1205 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1206 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1207 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1208 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1209 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1210 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 1211 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 1212 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 1213 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1214 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 1215 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 1216 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1217 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1218 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 1219 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1220 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1221 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 1222 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1223 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 1224 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 1225 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 1226 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1227 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1228 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 1229 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1230 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 1231 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1232 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 1233 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1234 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1235 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1236 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1237 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 1238 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1239 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1240 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1241 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1242 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1243 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1244 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1245 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1246 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1247 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1248 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1249 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1250 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1251 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1252 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1253 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1254 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1255 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1256 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1257 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1258 | 646564506 | Arcobacter nitrofigilis DSM 7299 | Isolate | Unclassified |
| 1259 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1260 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1261 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1262 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1263 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1264 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1265 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1266 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1267 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1268 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1269 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1270 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1271 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1272 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1273 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1274 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1275 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1276 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1277 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1278 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1279 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1280 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1281 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1282 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1283 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1284 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1285 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1286 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1287 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1288 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1289 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1290 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1291 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1292 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1293 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1294 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1295 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1296 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1297 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1298 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1299 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1300 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1301 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1302 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1303 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1304 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1305 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1306 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1307 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1308 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1309 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1310 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1311 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1312 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1313 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1314 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1315 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1316 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1317 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1318 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1319 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1320 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1321 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1322 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1323 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
| 1324 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1325 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 56.77 |
| Metatranscriptomes | 0.15 |
| Isolates | 43.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 13.49 |
| Nodule | 31.67 |
| Rhizoplane | 2.18 |
| Rhizosphere | 39.7 |
| Stem | 0 |
| Stem Tuber | 0.05 |
| Unclassified | 12.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1038538 | 2162886007 | Bacteria | 2053 |
| 2 | JGI24741J21665_1004868 | 3300001915 | Bacteria | 2901 |
| 3 | JGI24740J21852_10000015 | 3300001979 | Bacteria | 58951 |
| 4 | JGI24744J21845_10016419 | 3300002077 | Bacteria | 1474 |
| 5 | JGI25155J39150_1000001 | 3300002704 | Bacteria | 354543 |
| 6 | JGI25156J39149_1000001 | 3300002705 | Bacteria | 354557 |
| 7 | JGI25162J39368_1000366 | 3300002737 | Bacteria | 38535 |
| 8 | JGI25162J39368_1000368 | 3300002737 | Bacteria | 38495 |
| 9 | JGI25154J39366_1000122 | 3300002738 | Bacteria | 61892 |
| 10 | JGI25158J39367_1000038 | 3300002739 | Bacteria | 30017 |
| 11 | JGI25158J39367_1005327 | 3300002739 | Bacteria | 1889 |
| 12 | JGI25157J39369_1000044 | 3300002741 | Bacteria | 122466 |
| 13 | JGI25157J39369_1000787 | 3300002741 | Bacteria | 16220 |
| 14 | JGI25152J39213_1000636 | 3300002773 | Bacteria | 18557 |
| 15 | JGI25152J39213_1002957 | 3300002773 | Bacteria | 6047 |
| 16 | JGI25152J39213_1003042 | 3300002773 | Bacteria | 5913 |
| 17 | JGI25152J39213_1005715 | 3300002773 | Bacteria | 3555 |
| 18 | JGI25150J39212_1000107 | 3300002774 | Bacteria | 48306 |
| 19 | JGI25150J39212_1003012 | 3300002774 | Bacteria | 4051 |
| 20 | JGI25159J45721_1000014 | 3300002987 | Bacteria | 147809 |
| 21 | JGI25159J45721_1000154 | 3300002987 | Bacteria | 32025 |
| 22 | JGI25159J45721_1001072 | 3300002987 | Bacteria | 11688 |
| 23 | JGI25151J46595_10000374 | 3300003187 | Bacteria | 46807 |
| 24 | JGI25151J46595_10000839 | 3300003187 | Bacteria | 24488 |
| 25 | JGI25151J46595_10006464 | 3300003187 | Bacteria | 5894 |
| 26 | JGI25151J46595_10015704 | 3300003187 | Bacteria | 3326 |
| 27 | JGI25406J46586_10014863 | 3300003203 | Bacteria | 3298 |
| 28 | JGI25165J46597_1000015 | 3300003214 | Bacteria | 380891 |
| 29 | JGI25165J46597_1000516 | 3300003214 | Bacteria | 36635 |
| 30 | JGI25165J46597_1001042 | 3300003214 | Bacteria | 18102 |
| 31 | JGI25165J46597_1009070 | 3300003214 | Bacteria | 1518 |
| 32 | JGI25153J46596_10000696 | 3300003215 | Bacteria | 20557 |
| 33 | JGI25153J46596_10023168 | 3300003215 | Bacteria | 2269 |
| 34 | JGI25153J46596_10023978 | 3300003215 | Bacteria | 2208 |
| 35 | JGI25153J46596_10047584 | 3300003215 | Bacteria | 1261 |
| 36 | rootL2_10006964 | 3300003322 | Bacteria | 8628 |
| 37 | rootL2_10022274 | 3300003322 | Bacteria | 9241 |
| 38 | rootL2_10193157 | 3300003322 | Bacteria | 2970 |
| 39 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 40 | JGI25160J50197_1000020 | 3300003354 | Bacteria | 232739 |
| 41 | JGI25160J50197_1002863 | 3300003354 | Bacteria | 7895 |
| 42 | JGI25160J50197_1030303 | 3300003354 | Bacteria | 1412 |
| 43 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 44 | JGI25161J50226_1000174 | 3300003374 | Bacteria | 43080 |
| 45 | JGI25161J50226_1001510 | 3300003374 | Bacteria | 6891 |
| 46 | JGI25161J50226_1002239 | 3300003374 | Bacteria | 5099 |
| 47 | Ga0006562J51391_1023353 | 3300003578 | Bacteria | 5757 |
| 48 | Ga0006562J51391_1043939 | 3300003578 | Bacteria | 8126 |
| 49 | Ga0055542_1001274 | 3300003762 | Bacteria | 13605 |
| 50 | Ga0055526_1000597 | 3300003771 | Bacteria | 28415 |
| 51 | Ga0055526_1001490 | 3300003771 | Bacteria | 16607 |
| 52 | Ga0055526_1003506 | 3300003771 | Bacteria | 9921 |
| 53 | Ga0055526_1003741 | 3300003771 | Bacteria | 9498 |
| 54 | Ga0055537_1001473 | 3300003773 | Bacteria | 9134 |
| 55 | Ga0055524_1003871 | 3300003775 | Bacteria | 7099 |
| 56 | Ga0055524_1004279 | 3300003775 | Bacteria | 6626 |
| 57 | Ga0055524_1005006 | 3300003775 | Bacteria | 6000 |
| 58 | Ga0055524_1007099 | 3300003775 | Bacteria | 4798 |
| 59 | Ga0055524_1014345 | 3300003775 | Bacteria | 2941 |
| 60 | Ga0055536_1001187 | 3300003781 | Bacteria | 16224 |
| 61 | Ga0055536_1001275 | 3300003781 | Bacteria | 15519 |
| 62 | Ga0055536_1005415 | 3300003781 | Bacteria | 6250 |
| 63 | Ga0055536_1012576 | 3300003781 | Bacteria | 3127 |
| 64 | Ga0055528_1001199 | 3300003790 | Bacteria | 16717 |
| 65 | Ga0055528_1001734 | 3300003790 | Bacteria | 12611 |
| 66 | Ga0055528_1002830 | 3300003790 | Bacteria | 9076 |
| 67 | Ga0055528_1005558 | 3300003790 | Bacteria | 5838 |
| 68 | Ga0055528_1005775 | 3300003790 | Bacteria | 5695 |
| 69 | Ga0055528_1018688 | 3300003790 | Bacteria | 2338 |
| 70 | Ga0055530_10003980 | 3300003791 | Bacteria | 7975 |
| 71 | Ga0055530_10009807 | 3300003791 | Bacteria | 3621 |
| 72 | Ga0055540_1000929 | 3300003792 | Bacteria | 19079 |
| 73 | Ga0055540_1016839 | 3300003792 | Bacteria | 2060 |
| 74 | Ga0055531_10002881 | 3300003794 | Bacteria | 11207 |
| 75 | Ga0055531_10008539 | 3300003794 | Bacteria | 5378 |
| 76 | Ga0055531_10010959 | 3300003794 | Bacteria | 4436 |
| 77 | Ga0055531_10023750 | 3300003794 | Bacteria | 2287 |
| 78 | Ga0055531_10036493 | 3300003794 | Bacteria | 1515 |
| 79 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 80 | Ga0055543_1000047 | 3300004625 | Bacteria | 111073 |
| 81 | Ga0055543_1000500 | 3300004625 | Bacteria | 22620 |
| 82 | Ga0055543_1001281 | 3300004625 | Bacteria | 10341 |
| 83 | Ga0065165_1000013 | 3300005262 | Bacteria | 301887 |
| 84 | Ga0065165_1000068 | 3300005262 | Bacteria | 170609 |
| 85 | Ga0065165_1003894 | 3300005262 | Bacteria | 9877 |
| 86 | Ga0065704_10008543 | 3300005289 | Bacteria | 2475 |
| 87 | Ga0070658_10049567 | 3300005327 | Bacteria | 3402 |
| 88 | Ga0070676_10023523 | 3300005328 | Bacteria | 3463 |
| 89 | Ga0070676_10038717 | 3300005328 | Bacteria | 2755 |
| 90 | Ga0070683_100005576 | 3300005329 | Bacteria | 10508 |
| 91 | Ga0070690_100100785 | 3300005330 | Bacteria | 1915 |
| 92 | Ga0070670_100002993 | 3300005331 | Bacteria | 13983 |
| 93 | Ga0070670_100003032 | 3300005331 | Bacteria | 13894 |
| 94 | Ga0070670_100028366 | 3300005331 | Bacteria | 4817 |
| 95 | Ga0068869_100264930 | 3300005334 | Bacteria | 1377 |
| 96 | Ga0068868_100023793 | 3300005338 | Bacteria | 4639 |
| 97 | Ga0068868_100055855 | 3300005338 | Bacteria | 3117 |
| 98 | Ga0070660_100095702 | 3300005339 | Bacteria | 2347 |
| 99 | Ga0070660_100163494 | 3300005339 | Bacteria | 1794 |
| 100 | Ga0070689_100047479 | 3300005340 | Bacteria | 3311 |
| 101 | Ga0070687_100005675 | 3300005343 | Bacteria | 5064 |
| 102 | Ga0070661_100008418 | 3300005344 | Bacteria | 7131 |
| 103 | Ga0070668_100002911 | 3300005347 | Bacteria | 12649 |
| 104 | Ga0070668_100010616 | 3300005347 | Bacteria | 6849 |
| 105 | Ga0070668_100012891 | 3300005347 | Bacteria | 6225 |
| 106 | Ga0070668_100078199 | 3300005347 | Bacteria | 2587 |
| 107 | Ga0070668_100168933 | 3300005347 | Bacteria | 1779 |
| 108 | Ga0070675_100014504 | 3300005354 | Bacteria | 6215 |
| 109 | Ga0070675_100054361 | 3300005354 | Bacteria | 3294 |
| 110 | Ga0070675_100068867 | 3300005354 | Bacteria | 2931 |
| 111 | Ga0070671_100033702 | 3300005355 | Bacteria | 4238 |
| 112 | Ga0070674_100001105 | 3300005356 | Bacteria | 14135 |
| 113 | Ga0070674_100016809 | 3300005356 | Bacteria | 4590 |
| 114 | Ga0070674_100065860 | 3300005356 | Bacteria | 2544 |
| 115 | Ga0070673_100002651 | 3300005364 | Bacteria | 10946 |
| 116 | Ga0070688_100028395 | 3300005365 | Bacteria | 3339 |
| 117 | Ga0070667_100267968 | 3300005367 | Bacteria | 1531 |
| 118 | Ga0070667_100303778 | 3300005367 | Bacteria | 1437 |
| 119 | Ga0070713_100001844 | 3300005436 | Bacteria | 13670 |
| 120 | Ga0070705_100098636 | 3300005440 | Bacteria | 1839 |
| 121 | Ga0070694_100142608 | 3300005444 | Bacteria | 1741 |
| 122 | Ga0070663_100024934 | 3300005455 | Bacteria | 4032 |
| 123 | Ga0070663_100118538 | 3300005455 | Bacteria | 1997 |
| 124 | Ga0070678_100018307 | 3300005456 | Bacteria | 4538 |
| 125 | Ga0070678_100248634 | 3300005456 | Bacteria | 1490 |
| 126 | Ga0070678_100281065 | 3300005456 | Bacteria | 1407 |
| 127 | Ga0070662_100300083 | 3300005457 | Bacteria | 1305 |
| 128 | Ga0068867_100010186 | 3300005459 | Bacteria | 6631 |
| 129 | Ga0068867_100171488 | 3300005459 | Bacteria | 1719 |
| 130 | Ga0070685_10017126 | 3300005466 | Bacteria | 3874 |
| 131 | Ga0070679_100270265 | 3300005530 | Bacteria | 1654 |
| 132 | Ga0070684_100073099 | 3300005535 | Bacteria | 3020 |
| 133 | Ga0070684_100134470 | 3300005535 | Bacteria | 2232 |
| 134 | Ga0068853_100001593 | 3300005539 | Bacteria | 16518 |
| 135 | Ga0068853_100242359 | 3300005539 | Bacteria | 1653 |
| 136 | Ga0070686_100002414 | 3300005544 | Bacteria | 10292 |
| 137 | Ga0070686_100079093 | 3300005544 | Bacteria | 2173 |
| 138 | Ga0070696_100137933 | 3300005546 | Bacteria | 1780 |
| 139 | Ga0070665_100035316 | 3300005548 | Bacteria | 5026 |
| 140 | Ga0070665_100042535 | 3300005548 | Bacteria | 4567 |
| 141 | Ga0070665_100075267 | 3300005548 | Bacteria | 3383 |
| 142 | Ga0070665_100098125 | 3300005548 | Bacteria | 2934 |
| 143 | Ga0070665_100142921 | 3300005548 | Bacteria | 2396 |
| 144 | Ga0070665_100152121 | 3300005548 | Bacteria | 2316 |
| 145 | Ga0068855_100069226 | 3300005563 | Bacteria | 4107 |
| 146 | Ga0068855_100494933 | 3300005563 | Bacteria | 1329 |
| 147 | Ga0070664_100018666 | 3300005564 | Bacteria | 5702 |
| 148 | Ga0070664_100117821 | 3300005564 | Bacteria | 2323 |
| 149 | Ga0068857_100029006 | 3300005577 | Bacteria | 4884 |
| 150 | Ga0068856_100013130 | 3300005614 | Bacteria | 8024 |
| 151 | Ga0068856_100314614 | 3300005614 | Bacteria | 1583 |
| 152 | Ga0070702_100040085 | 3300005615 | Bacteria | 2617 |
| 153 | Ga0068852_100010318 | 3300005616 | Bacteria | 6975 |
| 154 | Ga0068852_100093576 | 3300005616 | Bacteria | 2694 |
| 155 | Ga0068852_100184323 | 3300005616 | Bacteria | 1965 |
| 156 | Ga0068852_100248618 | 3300005616 | Bacteria | 1703 |
| 157 | Ga0068859_100002560 | 3300005617 | Bacteria | 18459 |
| 158 | Ga0068859_100256800 | 3300005617 | Unclassified | 1838 |
| 159 | Ga0068864_100002913 | 3300005618 | Bacteria | 14155 |
| 160 | Ga0068866_10095286 | 3300005718 | Bacteria | 1630 |
| 161 | Ga0068861_100018208 | 3300005719 | Bacteria | 4999 |
| 162 | Ga0068861_100040524 | 3300005719 | Bacteria | 3484 |
| 163 | Ga0068851_10001703 | 3300005834 | Bacteria | 9621 |
| 164 | Ga0068870_10016476 | 3300005840 | Bacteria | 3532 |
| 165 | Ga0068863_100016803 | 3300005841 | Bacteria | 7021 |
| 166 | Ga0068863_100038880 | 3300005841 | Bacteria | 4527 |
| 167 | Ga0068863_100049068 | 3300005841 | Bacteria | 4002 |
| 168 | Ga0068858_100088823 | 3300005842 | Bacteria | 2876 |
| 169 | Ga0068858_100125185 | 3300005842 | Bacteria | 2406 |
| 170 | Ga0068860_100000183 | 3300005843 | Bacteria | 100738 |
| 171 | Ga0068860_100150648 | 3300005843 | Bacteria | 2240 |
| 172 | Ga0068862_100032639 | 3300005844 | Bacteria | 4400 |
| 173 | Ga0068862_100072962 | 3300005844 | Bacteria | 2966 |
| 174 | Ga0081455_10101948 | 3300005937 | Bacteria | 2303 |
| 175 | Ga0081540_1045519 | 3300005983 | Bacteria | 2227 |
| 176 | Ga0081539_10001091 | 3300005985 | Bacteria | 49336 |
| 177 | Ga0081539_10020691 | 3300005985 | Bacteria | 4431 |
| 178 | Ga0075365_10004585 | 3300006038 | Bacteria | 7349 |
| 179 | Ga0075365_10005814 | 3300006038 | Bacteria | 6702 |
| 180 | Ga0075365_10098168 | 3300006038 | Bacteria | 2003 |
| 181 | Ga0075365_10163928 | 3300006038 | Bacteria | 1550 |
| 182 | Ga0075368_10008483 | 3300006042 | Bacteria | 3662 |
| 183 | Ga0075363_100005871 | 3300006048 | Bacteria | 5522 |
| 184 | Ga0075363_100025123 | 3300006048 | Bacteria | 3034 |
| 185 | Ga0075364_10039752 | 3300006051 | Bacteria | 3050 |
| 186 | Ga0075364_10086268 | 3300006051 | Bacteria | 2079 |
| 187 | Ga0075362_10010664 | 3300006177 | Bacteria | 3595 |
| 188 | Ga0075362_10013866 | 3300006177 | Bacteria | 3238 |
| 189 | Ga0075362_10063214 | 3300006177 | Bacteria | 1678 |
| 190 | Ga0075367_10006519 | 3300006178 | Bacteria | 5902 |
| 191 | Ga0075367_10009312 | 3300006178 | Bacteria | 5129 |
| 192 | Ga0075369_10005462 | 3300006186 | Bacteria | 4751 |
| 193 | Ga0075369_10009967 | 3300006186 | Bacteria | 3708 |
| 194 | Ga0075369_10015627 | 3300006186 | Bacteria | 3051 |
| 195 | Ga0075369_10035613 | 3300006186 | Bacteria | 2116 |
| 196 | Ga0075366_10008655 | 3300006195 | Bacteria | 5666 |
| 197 | Ga0075370_10012603 | 3300006353 | Bacteria | 4474 |
| 198 | Ga0075370_10017996 | 3300006353 | Bacteria | 3827 |
| 199 | Ga0075370_10081836 | 3300006353 | Bacteria | 1856 |
| 200 | Ga0075370_10087140 | 3300006353 | Bacteria | 1799 |
| 201 | Ga0075370_10107335 | 3300006353 | Bacteria | 1619 |
| 202 | Ga0075370_10123037 | 3300006353 | Bacteria | 1511 |
| 203 | Ga0068871_100176497 | 3300006358 | Bacteria | 1834 |
| 204 | Ga0068871_100254352 | 3300006358 | Bacteria | 1531 |
| 205 | Ga0075428_100043000 | 3300006844 | Bacteria | 4968 |
| 206 | Ga0075430_100013382 | 3300006846 | Bacteria | 6991 |
| 207 | Ga0075433_10114709 | 3300006852 | Bacteria | 2390 |
| 208 | Ga0075429_100022586 | 3300006880 | Bacteria | 5454 |
| 209 | Ga0075429_100174417 | 3300006880 | Bacteria | 1883 |
| 210 | Ga0068865_100007748 | 3300006881 | Bacteria | 6620 |
| 211 | Ga0068865_100059929 | 3300006881 | Bacteria | 2663 |
| 212 | Ga0068865_100069159 | 3300006881 | Bacteria | 2498 |
| 213 | Ga0068865_100114373 | 3300006881 | Bacteria | 1996 |
| 214 | Ga0097620_100002560 | 3300006931 | Bacteria | 18459 |
| 215 | Ga0097620_100256807 | 3300006931 | Unclassified | 1838 |
| 216 | Ga0097620_100468647 | 3300006931 | Bacteria | 1355 |
| 217 | Ga0079104_1000193 | 3300006946 | Bacteria | 85489 |
| 218 | Ga0079104_1001253 | 3300006946 | Bacteria | 17716 |
| 219 | Ga0079104_1003360 | 3300006946 | Bacteria | 7510 |
| 220 | Ga0099826_10001254 | 3300006948 | Bacteria | 14871 |
| 221 | Ga0099826_10064039 | 3300006948 | Bacteria | 2371 |
| 222 | Ga0075435_100017580 | 3300007076 | Bacteria | 5417 |
| 223 | Ga0105250_10015698 | 3300009092 | Bacteria | 3100 |
| 224 | Ga0105240_10000041 | 3300009093 | Bacteria | 264078 |
| 225 | Ga0105240_10000076 | 3300009093 | Bacteria | 198848 |
| 226 | Ga0111539_10032300 | 3300009094 | Bacteria | 6357 |
| 227 | Ga0111539_10074239 | 3300009094 | Bacteria | 4007 |
| 228 | Ga0105245_10004544 | 3300009098 | Bacteria | 12250 |
| 229 | Ga0105243_10007500 | 3300009148 | Bacteria | 8382 |
| 230 | Ga0105243_10166001 | 3300009148 | Bacteria | 1908 |
| 231 | Ga0105243_10176018 | 3300009148 | Bacteria | 1857 |
| 232 | Ga0105243_10186964 | 3300009148 | Bacteria | 1806 |
| 233 | Ga0105243_10580402 | 3300009148 | Bacteria | 1076 |
| 234 | Ga0105242_10028628 | 3300009176 | Bacteria | 4437 |
| 235 | Ga0105242_10161244 | 3300009176 | Bacteria | 1963 |
| 236 | Ga0105242_10301588 | 3300009176 | Bacteria | 1462 |
| 237 | Ga0105248_10040139 | 3300009177 | Bacteria | 5246 |
| 238 | Ga0105248_10263764 | 3300009177 | Bacteria | 1939 |
| 239 | Ga0105248_10571246 | 3300009177 | Bacteria | 1276 |
| 240 | Ga0105237_10000226 | 3300009545 | Bacteria | 79798 |
| 241 | Ga0105237_10014016 | 3300009545 | Bacteria | 8388 |
| 242 | Ga0105237_10089906 | 3300009545 | Bacteria | 3060 |
| 243 | Ga0105237_10217388 | 3300009545 | Bacteria | 1911 |
| 244 | Ga0105238_10001971 | 3300009551 | Bacteria | 20670 |
| 245 | Ga0105238_10003533 | 3300009551 | Bacteria | 15583 |
| 246 | Ga0105238_10017174 | 3300009551 | Bacteria | 7349 |
| 247 | Ga0105249_10017238 | 3300009553 | Bacteria | 6410 |
| 248 | Ga0105249_10092252 | 3300009553 | Bacteria | 2835 |
| 249 | Ga0123341_1000007 | 3300009765 | Bacteria | 147072 |
| 250 | Ga0123341_1046896 | 3300009765 | Bacteria | 2570 |
| 251 | Ga0123342_1004784 | 3300009766 | Bacteria | 20320 |
| 252 | Ga0123342_1013992 | 3300009766 | Bacteria | 7821 |
| 253 | Ga0105239_10000641 | 3300010375 | Bacteria | 49765 |
| 254 | Ga0105239_10074698 | 3300010375 | Bacteria | 3727 |
| 255 | Ga0105239_10088268 | 3300010375 | Bacteria | 3419 |
| 256 | Ga0105246_10006723 | 3300011119 | Bacteria | 7032 |
| 257 | Ga0157371_10000017 | 3300013102 | Bacteria | 320830 |
| 258 | Ga0157371_10043374 | 3300013102 | Bacteria | 3204 |
| 259 | Ga0157370_10000455 | 3300013104 | Bacteria | 51231 |
| 260 | Ga0157370_10000461 | 3300013104 | Bacteria | 50850 |
| 261 | Ga0157370_10015013 | 3300013104 | Bacteria | 7896 |
| 262 | Ga0157370_10090223 | 3300013104 | Bacteria | 2878 |
| 263 | Ga0157369_10011166 | 3300013105 | Bacteria | 10211 |
| 264 | Ga0157369_10159016 | 3300013105 | Bacteria | 2385 |
| 265 | Ga0157369_10187316 | 3300013105 | Bacteria | 2176 |
| 266 | Ga0157369_10377473 | 3300013105 | Bacteria | 1471 |
| 267 | Ga0171463_1003 | 3300013249 | Bacteria | 695693 |
| 268 | Ga0157374_10000093 | 3300013296 | Bacteria | 84512 |
| 269 | Ga0157378_10047506 | 3300013297 | Bacteria | 3817 |
| 270 | Ga0157375_10004209 | 3300013308 | Bacteria | 12481 |
| 271 | Ga0157375_10070230 | 3300013308 | Bacteria | 3512 |
| 272 | Ga0157375_10180529 | 3300013308 | Bacteria | 2262 |
| 273 | Ga0157375_10296609 | 3300013308 | Bacteria | 1780 |
| 274 | Ga0157380_10116875 | 3300014326 | Bacteria | 2252 |
| 275 | Ga0157377_10011153 | 3300014745 | Bacteria | 4475 |
| 276 | Ga0157379_10007600 | 3300014968 | Bacteria | 9383 |
| 277 | Ga0157379_10238537 | 3300014968 | Bacteria | 1649 |
| 278 | Ga0157379_10359759 | 3300014968 | Bacteria | 1334 |
| 279 | Ga0157376_10000397 | 3300014969 | Bacteria | 28315 |
| 280 | Ga0182007_10001815 | 3300015262 | Bacteria | 11146 |
| 281 | Ga0182005_1004710 | 3300015265 | Bacteria | 4356 |
| 282 | Ga0183363_1344 | 3300015690 | Bacteria | 5568 |
| 283 | Ga0163161_10006062 | 3300017792 | Bacteria | 8380 |
| 284 | Ga0163161_10164127 | 3300017792 | Bacteria | 1695 |
| 285 | Ga0214544_1001800 | 3300021320 | Bacteria | 45046 |
| 286 | Ga0214542_1000012 | 3300021321 | Bacteria | 235800 |
| 287 | Ga0214543_1000024 | 3300021327 | Bacteria | 235745 |
| 288 | Ga0214543_1000038 | 3300021327 | Bacteria | 182106 |
| 289 | Ga0213876_10012004 | 3300021384 | Unclassified | 4615 |
| 290 | Ga0228711_1000008 | 3300022739 | Bacteria | 169893 |
| 291 | Ga0228710_1000009 | 3300022740 | Bacteria | 169770 |
| 292 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 293 | Ga0209436_100150 | 3300025208 | Bacteria | 33510 |
| 294 | Ga0209436_101065 | 3300025208 | Bacteria | 10387 |
| 295 | Ga0209436_104522 | 3300025208 | Bacteria | 3423 |
| 296 | Ga0209437_100051 | 3300025233 | Bacteria | 392523 |
| 297 | Ga0209437_100098 | 3300025233 | Bacteria | 229766 |
| 298 | Ga0207425_1000075 | 3300025245 | Bacteria | 107452 |
| 299 | Ga0207425_1002079 | 3300025245 | Bacteria | 7430 |
| 300 | Ga0207425_1019409 | 3300025245 | Bacteria | 1463 |
| 301 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 302 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 303 | Ga0209026_1000025 | 3300025250 | Bacteria | 352548 |
| 304 | Ga0209677_101925 | 3300025253 | Bacteria | 8314 |
| 305 | Ga0209148_1000128 | 3300025254 | Bacteria | 179154 |
| 306 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 307 | Ga0209759_1000121 | 3300025256 | Bacteria | 138469 |
| 308 | Ga0209129_1000156 | 3300025258 | Bacteria | 107484 |
| 309 | Ga0209129_1000218 | 3300025258 | Bacteria | 66076 |
| 310 | Ga0209129_1001767 | 3300025258 | Bacteria | 11565 |
| 311 | Ga0209129_1001868 | 3300025258 | Bacteria | 11120 |
| 312 | Ga0209129_1002344 | 3300025258 | Bacteria | 9373 |
| 313 | Ga0209129_1003478 | 3300025258 | Bacteria | 6820 |
| 314 | Ga0209129_1007240 | 3300025258 | Bacteria | 3352 |
| 315 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 316 | Ga0209233_1000095 | 3300025261 | Bacteria | 303783 |
| 317 | Ga0209233_1000113 | 3300025261 | Bacteria | 253455 |
| 318 | Ga0209233_1000427 | 3300025261 | Bacteria | 30799 |
| 319 | Ga0209565_1000118 | 3300025263 | Bacteria | 113196 |
| 320 | Ga0209565_1019270 | 3300025263 | Bacteria | 1460 |
| 321 | Ga0209455_1000127 | 3300025272 | Bacteria | 162518 |
| 322 | Ga0209455_1014510 | 3300025272 | Bacteria | 1779 |
| 323 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 324 | Ga0209673_1000117 | 3300025273 | Bacteria | 172081 |
| 325 | Ga0209673_1000151 | 3300025273 | Bacteria | 148103 |
| 326 | Ga0209673_1000863 | 3300025273 | Bacteria | 39346 |
| 327 | Ga0209673_1001685 | 3300025273 | Bacteria | 18869 |
| 328 | Ga0209673_1002134 | 3300025273 | Bacteria | 14747 |
| 329 | Ga0209673_1008788 | 3300025273 | Bacteria | 4455 |
| 330 | Ga0209673_1013220 | 3300025273 | Bacteria | 3271 |
| 331 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 332 | Ga0209130_1000020 | 3300025284 | Bacteria | 379297 |
| 333 | Ga0209130_1000034 | 3300025284 | Bacteria | 302439 |
| 334 | Ga0209130_1017817 | 3300025284 | Bacteria | 1682 |
| 335 | Ga0209675_1006073 | 3300025291 | Bacteria | 4928 |
| 336 | Ga0209676_1000038 | 3300025292 | Bacteria | 449305 |
| 337 | Ga0209676_1000128 | 3300025292 | Bacteria | 188099 |
| 338 | Ga0209676_1000151 | 3300025292 | Bacteria | 167307 |
| 339 | Ga0209676_1000482 | 3300025292 | Bacteria | 65372 |
| 340 | Ga0209676_1000644 | 3300025292 | Bacteria | 50062 |
| 341 | Ga0209676_1018885 | 3300025292 | Bacteria | 2390 |
| 342 | Ga0209025_1000070 | 3300025294 | Bacteria | 287776 |
| 343 | Ga0209025_1000140 | 3300025294 | Bacteria | 184765 |
| 344 | Ga0209025_1000314 | 3300025294 | Bacteria | 107720 |
| 345 | Ga0209025_1000506 | 3300025294 | Bacteria | 74798 |
| 346 | Ga0209025_1001869 | 3300025294 | Bacteria | 24674 |
| 347 | Ga0209025_1003183 | 3300025294 | Bacteria | 15930 |
| 348 | Ga0209025_1005193 | 3300025294 | Bacteria | 10759 |
| 349 | Ga0209025_1014241 | 3300025294 | Bacteria | 4916 |
| 350 | Ga0209025_1014979 | 3300025294 | Bacteria | 4716 |
| 351 | Ga0209025_1031047 | 3300025294 | Bacteria | 2539 |
| 352 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 353 | Ga0209564_1000647 | 3300025295 | Bacteria | 52658 |
| 354 | Ga0209564_1001780 | 3300025295 | Bacteria | 19956 |
| 355 | Ga0209564_1001993 | 3300025295 | Bacteria | 17874 |
| 356 | Ga0209564_1013012 | 3300025295 | Bacteria | 3570 |
| 357 | Ga0209758_1000413 | 3300025297 | Bacteria | 72744 |
| 358 | Ga0209758_1000655 | 3300025297 | Bacteria | 52188 |
| 359 | Ga0209758_1000758 | 3300025297 | Bacteria | 46817 |
| 360 | Ga0209758_1001882 | 3300025297 | Bacteria | 22974 |
| 361 | Ga0209758_1002154 | 3300025297 | Bacteria | 20718 |
| 362 | Ga0209758_1004734 | 3300025297 | Bacteria | 11072 |
| 363 | Ga0209758_1011908 | 3300025297 | Bacteria | 4953 |
| 364 | Ga0209758_1013333 | 3300025297 | Bacteria | 4492 |
| 365 | Ga0209758_1021031 | 3300025297 | Bacteria | 3059 |
| 366 | Ga0209758_1027881 | 3300025297 | Bacteria | 2404 |
| 367 | Ga0209050_1000646 | 3300025298 | Bacteria | 54050 |
| 368 | Ga0209050_1000908 | 3300025298 | Bacteria | 39172 |
| 369 | Ga0209050_1002863 | 3300025298 | Bacteria | 13667 |
| 370 | Ga0209050_1003757 | 3300025298 | Bacteria | 10881 |
| 371 | Ga0209050_1004392 | 3300025298 | Bacteria | 9564 |
| 372 | Ga0209050_1007987 | 3300025298 | Bacteria | 5775 |
| 373 | Ga0209050_1009729 | 3300025298 | Bacteria | 4868 |
| 374 | Ga0209256_1001653 | 3300025299 | Bacteria | 21690 |
| 375 | Ga0209256_1001736 | 3300025299 | Bacteria | 20844 |
| 376 | Ga0209256_1002069 | 3300025299 | Bacteria | 17685 |
| 377 | Ga0209256_1002712 | 3300025299 | Bacteria | 13781 |
| 378 | Ga0209256_1004803 | 3300025299 | Bacteria | 8202 |
| 379 | Ga0209256_1005804 | 3300025299 | Bacteria | 6883 |
| 380 | Ga0209256_1006089 | 3300025299 | Bacteria | 6550 |
| 381 | Ga0209256_1009099 | 3300025299 | Bacteria | 4426 |
| 382 | Ga0209256_1010510 | 3300025299 | Bacteria | 3860 |
| 383 | Ga0209256_1010871 | 3300025299 | Bacteria | 3738 |
| 384 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 385 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 386 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 387 | Ga0207426_1000221 | 3300025302 | Bacteria | 134756 |
| 388 | Ga0207426_1000869 | 3300025302 | Bacteria | 31530 |
| 389 | Ga0209051_1000097 | 3300025303 | Bacteria | 167378 |
| 390 | Ga0209051_1000314 | 3300025303 | Bacteria | 74316 |
| 391 | Ga0209051_1001673 | 3300025303 | Bacteria | 17872 |
| 392 | Ga0209051_1006481 | 3300025303 | Bacteria | 6589 |
| 393 | Ga0209051_1009478 | 3300025303 | Bacteria | 5014 |
| 394 | Ga0209051_1023834 | 3300025303 | Bacteria | 2534 |
| 395 | Ga0209257_1000060 | 3300025304 | Bacteria | 372267 |
| 396 | Ga0209257_1000200 | 3300025304 | Bacteria | 147538 |
| 397 | Ga0209257_1000413 | 3300025304 | Bacteria | 82516 |
| 398 | Ga0209257_1001142 | 3300025304 | Bacteria | 33931 |
| 399 | Ga0209257_1002070 | 3300025304 | Bacteria | 21158 |
| 400 | Ga0209257_1003315 | 3300025304 | Bacteria | 13958 |
| 401 | Ga0207697_10031978 | 3300025315 | Bacteria | 2153 |
| 402 | Ga0207656_10000915 | 3300025321 | Bacteria | 9617 |
| 403 | Ga0207656_10079580 | 3300025321 | Bacteria | 1470 |
| 404 | Ga0207653_10037193 | 3300025885 | Bacteria | 1587 |
| 405 | Ga0207688_10015208 | 3300025901 | Bacteria | 4175 |
| 406 | Ga0207688_10047884 | 3300025901 | Bacteria | 2388 |
| 407 | Ga0207647_10004029 | 3300025904 | Bacteria | 10951 |
| 408 | Ga0207645_10001505 | 3300025907 | Bacteria | 19088 |
| 409 | Ga0207645_10007970 | 3300025907 | Bacteria | 7431 |
| 410 | Ga0207643_10060789 | 3300025908 | Bacteria | 2157 |
| 411 | Ga0207654_10076184 | 3300025911 | Bacteria | 2007 |
| 412 | Ga0207707_10246383 | 3300025912 | Bacteria | 1553 |
| 413 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 414 | Ga0207695_10000125 | 3300025913 | Bacteria | 228810 |
| 415 | Ga0207671_10000093 | 3300025914 | Bacteria | 138939 |
| 416 | Ga0207671_10029964 | 3300025914 | Bacteria | 4061 |
| 417 | Ga0207671_10066354 | 3300025914 | Bacteria | 2686 |
| 418 | Ga0207662_10009356 | 3300025918 | Bacteria | 5388 |
| 419 | Ga0207662_10033707 | 3300025918 | Bacteria | 2986 |
| 420 | Ga0207657_10040197 | 3300025919 | Bacteria | 4147 |
| 421 | Ga0207649_10003204 | 3300025920 | Bacteria | 8973 |
| 422 | Ga0207681_10006107 | 3300025923 | Bacteria | 7386 |
| 423 | Ga0207681_10075520 | 3300025923 | Bacteria | 2364 |
| 424 | Ga0207694_10043337 | 3300025924 | Bacteria | 3473 |
| 425 | Ga0207694_10137643 | 3300025924 | Bacteria | 1962 |
| 426 | Ga0207650_10000837 | 3300025925 | Bacteria | 23356 |
| 427 | Ga0207650_10011696 | 3300025925 | Bacteria | 6047 |
| 428 | Ga0207650_10073554 | 3300025925 | Bacteria | 2574 |
| 429 | Ga0207659_10059779 | 3300025926 | Bacteria | 2741 |
| 430 | Ga0207687_10127876 | 3300025927 | Bacteria | 1910 |
| 431 | Ga0207700_10011303 | 3300025928 | Bacteria | 5686 |
| 432 | Ga0207690_10165585 | 3300025932 | Bacteria | 1652 |
| 433 | Ga0207706_10244122 | 3300025933 | Bacteria | 1570 |
| 434 | Ga0207686_10087696 | 3300025934 | Bacteria | 2047 |
| 435 | Ga0207686_10118387 | 3300025934 | Bacteria | 1799 |
| 436 | Ga0207709_10151631 | 3300025935 | Bacteria | 1606 |
| 437 | Ga0207670_10034359 | 3300025936 | Bacteria | 3276 |
| 438 | Ga0207670_10054411 | 3300025936 | Bacteria | 2700 |
| 439 | Ga0207669_10007020 | 3300025937 | Bacteria | 5182 |
| 440 | Ga0207669_10046066 | 3300025937 | Bacteria | 2574 |
| 441 | Ga0207669_10130961 | 3300025937 | Bacteria | 1723 |
| 442 | Ga0207704_10004070 | 3300025938 | Bacteria | 6664 |
| 443 | Ga0207704_10098033 | 3300025938 | Bacteria | 1946 |
| 444 | Ga0207691_10009401 | 3300025940 | Bacteria | 9388 |
| 445 | Ga0207691_10018799 | 3300025940 | Bacteria | 6546 |
| 446 | Ga0207691_10030454 | 3300025940 | Bacteria | 5042 |
| 447 | Ga0207691_10131070 | 3300025940 | Bacteria | 2215 |
| 448 | Ga0207691_10293629 | 3300025940 | Bacteria | 1397 |
| 449 | Ga0207711_10013870 | 3300025941 | Bacteria | 6693 |
| 450 | Ga0207711_10039419 | 3300025941 | Bacteria | 4019 |
| 451 | Ga0207689_10079487 | 3300025942 | Bacteria | 2695 |
| 452 | Ga0207661_10013261 | 3300025944 | Bacteria | 6017 |
| 453 | Ga0207661_10042650 | 3300025944 | Bacteria | 3578 |
| 454 | Ga0207661_10045424 | 3300025944 | Bacteria | 3477 |
| 455 | Ga0207679_10049622 | 3300025945 | Bacteria | 3063 |
| 456 | Ga0207667_10057794 | 3300025949 | Bacteria | 4070 |
| 457 | Ga0207667_10123954 | 3300025949 | Bacteria | 2662 |
| 458 | Ga0207667_10417392 | 3300025949 | Bacteria | 1365 |
| 459 | Ga0207651_10002477 | 3300025960 | Bacteria | 8806 |
| 460 | Ga0207712_10050862 | 3300025961 | Bacteria | 2895 |
| 461 | Ga0207668_10005083 | 3300025972 | Bacteria | 7743 |
| 462 | Ga0207668_10005717 | 3300025972 | Bacteria | 7327 |
| 463 | Ga0207668_10018441 | 3300025972 | Bacteria | 4391 |
| 464 | Ga0207668_10237982 | 3300025972 | Bacteria | 1471 |
| 465 | Ga0207640_10058755 | 3300025981 | Bacteria | 2535 |
| 466 | Ga0207640_10072226 | 3300025981 | Bacteria | 2327 |
| 467 | Ga0207658_10068385 | 3300025986 | Bacteria | 2680 |
| 468 | Ga0207658_10132204 | 3300025986 | Bacteria | 2007 |
| 469 | Ga0207658_10238936 | 3300025986 | Bacteria | 1538 |
| 470 | Ga0207658_10302719 | 3300025986 | Bacteria | 1378 |
| 471 | Ga0207677_10201146 | 3300026023 | Bacteria | 1583 |
| 472 | Ga0207703_10224965 | 3300026035 | Bacteria | 1679 |
| 473 | Ga0207639_10001696 | 3300026041 | Bacteria | 14874 |
| 474 | Ga0207639_10082103 | 3300026041 | Bacteria | 2554 |
| 475 | Ga0207678_10112095 | 3300026067 | Bacteria | 2327 |
| 476 | Ga0207678_10118442 | 3300026067 | Bacteria | 2260 |
| 477 | Ga0207708_10008534 | 3300026075 | Bacteria | 7583 |
| 478 | Ga0207641_10030350 | 3300026088 | Bacteria | 4478 |
| 479 | Ga0207641_10040754 | 3300026088 | Bacteria | 3890 |
| 480 | Ga0207641_10121994 | 3300026088 | Bacteria | 2327 |
| 481 | Ga0207641_10294916 | 3300026088 | Bacteria | 1530 |
| 482 | Ga0207648_10009328 | 3300026089 | Bacteria | 9403 |
| 483 | Ga0207676_10367245 | 3300026095 | Bacteria | 1336 |
| 484 | Ga0207675_100049032 | 3300026118 | Bacteria | 3943 |
| 485 | Ga0207675_100065731 | 3300026118 | Bacteria | 3390 |
| 486 | Ga0207683_10049695 | 3300026121 | Bacteria | 3672 |
| 487 | Ga0207683_10057103 | 3300026121 | Bacteria | 3426 |
| 488 | Ga0207683_10167090 | 3300026121 | Bacteria | 1991 |
| 489 | Ga0207683_10219024 | 3300026121 | Bacteria | 1734 |
| 490 | Ga0207698_10020535 | 3300026142 | Bacteria | 4548 |
| 491 | Ga0207698_10080084 | 3300026142 | Bacteria | 2630 |
| 492 | Ga0207698_10262390 | 3300026142 | Bacteria | 1588 |
| 493 | Ga0209281_1000034 | 3300027111 | Bacteria | 382562 |
| 494 | Ga0209281_1000106 | 3300027111 | Bacteria | 219666 |
| 495 | Ga0209281_1000318 | 3300027111 | Bacteria | 85039 |
| 496 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 497 | Ga0209371_1003359 | 3300027312 | Bacteria | 7858 |
| 498 | Ga0209371_1012916 | 3300027312 | Bacteria | 2383 |
| 499 | Ga0209282_1000024 | 3300027666 | Bacteria | 170348 |
| 500 | Ga0209282_1000531 | 3300027666 | Bacteria | 18489 |
| 501 | Ga0209282_1045570 | 3300027666 | Bacteria | 2564 |
| 502 | Ga0209813_10019500 | 3300027866 | Bacteria | 1886 |
| 503 | Ga0209974_10009270 | 3300027876 | Bacteria | 3342 |
| 504 | Ga0207428_10005251 | 3300027907 | Bacteria | 12103 |
| 505 | Ga0268266_10025929 | 3300028379 | Bacteria | 4987 |
| 506 | Ga0268266_10030607 | 3300028379 | Bacteria | 4572 |
| 507 | Ga0268266_10105632 | 3300028379 | Bacteria | 2488 |
| 508 | Ga0268266_10116941 | 3300028379 | Bacteria | 2369 |
| 509 | Ga0268266_10378352 | 3300028379 | Bacteria | 1335 |
| 510 | Ga0268265_10046509 | 3300028380 | Bacteria | 3244 |
| 511 | Ga0268265_10057290 | 3300028380 | Bacteria | 2969 |
| 512 | Ga0268265_10163799 | 3300028380 | Bacteria | 1892 |
| 513 | Ga0268264_10000476 | 3300028381 | Bacteria | 53780 |
| 514 | Ga0268264_10099835 | 3300028381 | Bacteria | 2520 |
| 515 | Ga0268264_10118483 | 3300028381 | Bacteria | 2330 |
| 516 | Ga0268264_10185483 | 3300028381 | Bacteria | 1892 |
| 517 | Ga0268264_10196688 | 3300028381 | Bacteria | 1841 |
| 518 | Ga0265337_1001230 | 3300028556 | Bacteria | 12964 |
| 519 | Ga0265337_1002560 | 3300028556 | Bacteria | 8271 |
| 520 | Ga0265337_1003365 | 3300028556 | Bacteria | 6955 |
| 521 | Ga0265319_1000298 | 3300028563 | Bacteria | 36808 |
| 522 | Ga0265319_1002101 | 3300028563 | Bacteria | 11157 |
| 523 | Ga0265319_1002859 | 3300028563 | Bacteria | 9227 |
| 524 | Ga0265319_1003884 | 3300028563 | Bacteria | 7624 |
| 525 | Ga0265319_1007656 | 3300028563 | Bacteria | 4822 |
| 526 | Ga0265319_1008667 | 3300028563 | Bacteria | 4426 |
| 527 | Ga0265319_1010597 | 3300028563 | Bacteria | 3835 |
| 528 | Ga0265319_1010831 | 3300028563 | Bacteria | 3778 |
| 529 | Ga0265319_1024830 | 3300028563 | Bacteria | 2152 |
| 530 | Ga0265334_10006566 | 3300028573 | Bacteria | 5007 |
| 531 | Ga0265334_10019358 | 3300028573 | Bacteria | 2801 |
| 532 | Ga0265334_10041329 | 3300028573 | Bacteria | 1803 |
| 533 | Ga0265318_10000007 | 3300028577 | Bacteria | 280699 |
| 534 | Ga0265318_10000206 | 3300028577 | Bacteria | 50931 |
| 535 | Ga0265318_10001154 | 3300028577 | Bacteria | 16401 |
| 536 | Ga0265318_10002287 | 3300028577 | Bacteria | 10299 |
| 537 | Ga0265318_10002712 | 3300028577 | Bacteria | 9292 |
| 538 | Ga0265318_10003821 | 3300028577 | Bacteria | 7464 |
| 539 | Ga0265318_10039618 | 3300028577 | Bacteria | 1797 |
| 540 | Ga0265323_10006142 | 3300028653 | Bacteria | 5065 |
| 541 | Ga0265323_10024474 | 3300028653 | Bacteria | 2294 |
| 542 | Ga0265323_10034080 | 3300028653 | Bacteria | 1882 |
| 543 | Ga0265322_10006788 | 3300028654 | Bacteria | 3360 |
| 544 | Ga0265322_10007141 | 3300028654 | Bacteria | 3271 |
| 545 | Ga0265336_10001485 | 3300028666 | Bacteria | 10650 |
| 546 | Ga0307515_10001559 | 3300028794 | Bacteria | 51153 |
| 547 | Ga0307515_10001978 | 3300028794 | Bacteria | 45366 |
| 548 | Ga0307515_10007368 | 3300028794 | Bacteria | 21770 |
| 549 | Ga0307515_10031969 | 3300028794 | Bacteria | 8742 |
| 550 | Ga0307515_10141817 | 3300028794 | Bacteria | 2572 |
| 551 | Ga0265338_10001695 | 3300028800 | Bacteria | 35004 |
| 552 | Ga0265338_10003574 | 3300028800 | Bacteria | 21714 |
| 553 | Ga0265338_10051361 | 3300028800 | Bacteria | 3712 |
| 554 | Ga0265324_10011450 | 3300029957 | Bacteria | 3378 |
| 555 | Ga0265324_10024904 | 3300029957 | Bacteria | 2124 |
| 556 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 557 | Ga0268256_1003591 | 3300030500 | Bacteria | 6913 |
| 558 | Ga0268256_1012308 | 3300030500 | Bacteria | 2652 |
| 559 | Ga0316181_1196002 | 3300030744 | Bacteria | 1668 |
| 560 | Ga0265330_10003483 | 3300031235 | Bacteria | 8204 |
| 561 | Ga0265330_10004065 | 3300031235 | Bacteria | 7503 |
| 562 | Ga0265332_10004106 | 3300031238 | Bacteria | 6910 |
| 563 | Ga0265328_10000435 | 3300031239 | Bacteria | 19580 |
| 564 | Ga0265328_10019863 | 3300031239 | Bacteria | 2577 |
| 565 | Ga0265320_10000791 | 3300031240 | Bacteria | 24071 |
| 566 | Ga0265320_10001929 | 3300031240 | Bacteria | 14642 |
| 567 | Ga0265320_10002191 | 3300031240 | Bacteria | 13736 |
| 568 | Ga0265320_10002983 | 3300031240 | Bacteria | 11569 |
| 569 | Ga0265320_10003355 | 3300031240 | Bacteria | 10800 |
| 570 | Ga0265320_10005312 | 3300031240 | Bacteria | 8288 |
| 571 | Ga0265320_10007308 | 3300031240 | Bacteria | 6865 |
| 572 | Ga0265320_10010969 | 3300031240 | Bacteria | 5358 |
| 573 | Ga0265320_10018235 | 3300031240 | Bacteria | 3871 |
| 574 | Ga0265320_10033988 | 3300031240 | Bacteria | 2599 |
| 575 | Ga0265325_10013776 | 3300031241 | Bacteria | 4592 |
| 576 | Ga0265325_10029351 | 3300031241 | Bacteria | 2957 |
| 577 | Ga0265329_10000781 | 3300031242 | Bacteria | 16177 |
| 578 | Ga0265340_10018449 | 3300031247 | Bacteria | 3598 |
| 579 | Ga0265331_10002350 | 3300031250 | Bacteria | 12860 |
| 580 | Ga0265331_10013946 | 3300031250 | Bacteria | 4298 |
| 581 | Ga0265331_10018214 | 3300031250 | Bacteria | 3647 |
| 582 | Ga0265327_10000091 | 3300031251 | Bacteria | 196369 |
| 583 | Ga0265327_10002906 | 3300031251 | Bacteria | 17180 |
| 584 | Ga0265327_10004492 | 3300031251 | Bacteria | 12323 |
| 585 | Ga0265327_10028872 | 3300031251 | Bacteria | 3163 |
| 586 | Ga0265316_10005524 | 3300031344 | Bacteria | 12265 |
| 587 | Ga0265316_10033074 | 3300031344 | Bacteria | 4215 |
| 588 | Ga0265316_10156506 | 3300031344 | Bacteria | 1705 |
| 589 | Ga0307513_10010539 | 3300031456 | Bacteria | 11570 |
| 590 | Ga0307513_10056407 | 3300031456 | Bacteria | 4194 |
| 591 | Ga0307513_10091206 | 3300031456 | Bacteria | 3106 |
| 592 | Ga0307408_100060897 | 3300031548 | Bacteria | 2753 |
| 593 | Ga0307408_100233217 | 3300031548 | Bacteria | 1509 |
| 594 | Ga0265313_10003023 | 3300031595 | Bacteria | 13985 |
| 595 | Ga0265313_10003044 | 3300031595 | Bacteria | 13917 |
| 596 | Ga0265313_10003588 | 3300031595 | Bacteria | 12478 |
| 597 | Ga0265313_10004342 | 3300031595 | Bacteria | 10967 |
| 598 | Ga0265313_10007241 | 3300031595 | Bacteria | 7629 |
| 599 | Ga0265313_10015661 | 3300031595 | Bacteria | 4402 |
| 600 | Ga0265313_10026134 | 3300031595 | Bacteria | 3081 |
| 601 | Ga0307508_10001088 | 3300031616 | Bacteria | 31450 |
| 602 | Ga0265314_10002313 | 3300031711 | Bacteria | 19685 |
| 603 | Ga0265314_10003676 | 3300031711 | Bacteria | 14722 |
| 604 | Ga0265314_10005244 | 3300031711 | Bacteria | 11743 |
| 605 | Ga0265314_10005332 | 3300031711 | Bacteria | 11633 |
| 606 | Ga0265314_10098056 | 3300031711 | Bacteria | 1891 |
| 607 | Ga0265314_10116656 | 3300031711 | Bacteria | 1688 |
| 608 | Ga0265342_10002774 | 3300031712 | Bacteria | 14839 |
| 609 | Ga0265342_10011659 | 3300031712 | Bacteria | 5998 |
| 610 | Ga0265342_10014643 | 3300031712 | Bacteria | 5199 |
| 611 | Ga0265342_10014665 | 3300031712 | Bacteria | 5194 |
| 612 | Ga0265342_10023075 | 3300031712 | Bacteria | 3944 |
| 613 | Ga0265342_10058582 | 3300031712 | Bacteria | 2277 |
| 614 | Ga0265342_10058665 | 3300031712 | Bacteria | 2275 |
| 615 | Ga0265342_10059285 | 3300031712 | Bacteria | 2261 |
| 616 | Ga0265342_10089160 | 3300031712 | Bacteria | 1770 |
| 617 | Ga0265342_10111690 | 3300031712 | Bacteria | 1546 |
| 618 | Ga0307405_10000857 | 3300031731 | Bacteria | 11991 |
| 619 | Ga0307410_10228399 | 3300031852 | Bacteria | 1436 |
| 620 | Ga0307406_10013439 | 3300031901 | Bacteria | 4689 |
| 621 | Ga0307412_10000493 | 3300031911 | Bacteria | 23544 |
| 622 | Ga0307412_10173865 | 3300031911 | Bacteria | 1613 |
| 623 | Ga0315914_1000012 | 3300031967 | Bacteria | 169896 |
| 624 | Ga0307416_100469386 | 3300032002 | Bacteria | 1316 |
| 625 | Ga0307414_10020814 | 3300032004 | Bacteria | 4097 |
| 626 | Ga0307414_10054215 | 3300032004 | Bacteria | 2800 |
| 627 | Ga0307414_10061116 | 3300032004 | Bacteria | 2667 |
| 628 | Ga0307414_10125605 | 3300032004 | Bacteria | 1981 |
| 629 | Ga0307414_10163823 | 3300032004 | Bacteria | 1769 |
| 630 | Ga0307414_10318020 | 3300032004 | Bacteria | 1324 |
| 631 | Ga0307415_100054506 | 3300032126 | Bacteria | 2730 |
| 632 | Ga0307510_10186046 | 3300033180 | Bacteria | 1632 |
| 633 | Ga0315913_1000006 | 3300033430 | Bacteria | 169893 |
| 634 | Ga0315915_1000010 | 3300033464 | Bacteria | 240214 |
| 635 | Ga0373931_0091831 | 3300035691 | Bacteria | 1693 |
| 636 | Ga0373927_0000350 | 3300035695 | Bacteria | 36173 |
| 637 | Ga0373925_0015189 | 3300037068 | Bacteria | 5567 |
| 638 | Ga0373925_0098230 | 3300037068 | Bacteria | 2247 |
| 639 | Ga0395899_0000117 | 3300037312 | Bacteria | 130159 |
| 640 | Ga0395899_0000125 | 3300037312 | Bacteria | 120964 |
| 641 | Ga0395899_0000721 | 3300037312 | Bacteria | 33125 |
| 642 | Ga0395899_0011241 | 3300037312 | Bacteria | 6858 |
| 643 | Ga0395899_0014995 | 3300037312 | Bacteria | 5912 |
| 644 | Ga0395900_0000020 | 3300037418 | Bacteria | 353500 |
| 645 | Ga0395900_0010176 | 3300037418 | Bacteria | 9621 |
| 646 | Ga0395900_0012623 | 3300037418 | Bacteria | 8641 |
| 647 | Ga0395900_0032997 | 3300037418 | Bacteria | 5328 |
| 648 | Ga0395900_0037038 | 3300037418 | Bacteria | 5030 |
| 649 | Ga0395900_0111033 | 3300037418 | Bacteria | 2816 |
| 650 | Ga0395898_0000259 | 3300037466 | Bacteria | 130131 |
| 651 | Ga0395898_0017388 | 3300037466 | Bacteria | 7346 |
| 652 | Ga0395905_0000019 | 3300037471 | Bacteria | 353500 |
| 653 | Ga0395905_0005044 | 3300037471 | Bacteria | 13597 |
| 654 | Ga0395905_0021769 | 3300037471 | Bacteria | 6063 |
| 655 | Ga0395905_0054858 | 3300037471 | Bacteria | 3729 |
| 656 | Ga0395905_0071756 | 3300037471 | Bacteria | 3246 |
| 657 | Ga0395905_0099657 | 3300037471 | Bacteria | 2728 |
| 658 | Ga0395905_0130601 | 3300037471 | Bacteria | 2362 |
| 659 | Ga0395901_0000016 | 3300038443 | Bacteria | 354008 |
| 660 | Ga0395901_0196598 | 3300038443 | Bacteria | 2114 |
| 661 | Ga0395901_0279372 | 3300038443 | Bacteria | 1735 |
| 662 | Ga0395901_0315195 | 3300038443 | Bacteria | 1619 |
| 663 | Ga0395901_0386153 | 3300038443 | Bacteria | 1440 |
| 664 | Ga0400483_084393 | 3300039062 | Bacteria | 4457 |
| 665 | Ga0400483_182297 | 3300039062 | Bacteria | 2436 |
| 666 | Ga0400483_251795 | 3300039062 | Bacteria | 1621 |
| 667 | Ga0436365_0266395 | 3300039437 | Bacteria | 2349 |
| 668 | Ga0436365_0842412 | 3300039437 | Bacteria | 5014 |
| 669 | Ga0436365_1369348 | 3300039437 | Bacteria | 12178 |
| 670 | Ga0436361_0688051 | 3300039447 | Bacteria | 2348 |
| 671 | Ga0436361_0974810 | 3300039447 | Bacteria | 1082 |
| 672 | Ga0436361_0998006 | 3300039447 | Bacteria | 6806 |
| 673 | Ga0436361_1208326 | 3300039447 | Bacteria | 1994 |
| 674 | Ga0439436_0005499 | 3300041404 | Bacteria | 3879 |
| 675 | Ga0439465_0002128 | 3300041413 | Bacteria | 6513 |
| 676 | Ga0451791_1547477 | 3300041451 | Bacteria | 3717 |
| 677 | Ga0451841_1414464 | 3300041498 | Bacteria | 1833 |
| 678 | Ga0451849_0897929 | 3300041505 | Bacteria | 1561 |
| 679 | Ga0451851_1171717 | 3300041507 | Bacteria | 5736 |
| 680 | Ga0451853_2936904 | 3300041512 | Bacteria | 1754 |
| 681 | Ga0439443_007170 | 3300042003 | Bacteria | 1546 |
| 682 | Ga0439458_0019877 | 3300042157 | Bacteria | 1548 |
| 683 | Ga0439459_0000950 | 3300042438 | Bacteria | 4094 |
| 684 | Ga0450918_008457 | 3300042531 | Bacteria | 1807 |
| 685 | Ga0451577_0000024 | 3300042876 | Bacteria | 411758 |
| 686 | Ga0451577_0000027 | 3300042876 | Bacteria | 397014 |
| 687 | Ga0451577_0000354 | 3300042876 | Bacteria | 85568 |
| 688 | Ga0451577_0002562 | 3300042876 | Bacteria | 21462 |
| 689 | Ga0451577_0043614 | 3300042876 | Bacteria | 4018 |
| 690 | Ga0451577_0059473 | 3300042876 | Bacteria | 3407 |
| 691 | Ga0451577_0111277 | 3300042876 | Bacteria | 2450 |
| 692 | Ga0451577_0389251 | 3300042876 | Bacteria | 1265 |
| 693 | Ga0453683_0000022 | 3300044673 | Bacteria | 269593 |
| 694 | Ga0453683_0000146 | 3300044673 | Bacteria | 103930 |
| 695 | Ga0453683_0006735 | 3300044673 | Bacteria | 7853 |
| 696 | Ga0453683_0020622 | 3300044673 | Bacteria | 4211 |
| 697 | Ga0453683_0090655 | 3300044673 | Bacteria | 1916 |
| 698 | Ga0453684_0000001 | 3300044712 | Bacteria | 2623166 |
| 699 | Ga0453684_0000154 | 3300044712 | Bacteria | 305062 |
| 700 | Ga0453684_0000213 | 3300044712 | Bacteria | 253663 |
| 701 | Ga0453684_0000846 | 3300044712 | Bacteria | 103225 |
| 702 | Ga0453684_0018498 | 3300044712 | Bacteria | 10689 |
| 703 | Ga0453684_0022207 | 3300044712 | Bacteria | 9431 |
| 704 | Ga0453684_0051650 | 3300044712 | Bacteria | 5386 |
| 705 | Ga0453684_0056828 | 3300044712 | Bacteria | 5072 |
| 706 | Ga0453684_0133152 | 3300044712 | Bacteria | 2980 |
| 707 | Ga0453684_0135017 | 3300044712 | Bacteria | 2956 |
| 708 | Ga0453684_0139638 | 3300044712 | Bacteria | 2896 |
| 709 | Ga0453684_0239025 | 3300044712 | Bacteria | 2092 |
| 710 | Ga0466968_0040355 | 3300044735 | Bacteria | 1968 |
| 711 | Ga0466970_0005945 | 3300044765 | Bacteria | 6083 |
| 712 | Ga0466957_0066171 | 3300044842 | Bacteria | 2227 |
| 713 | Ga0466960_0022200 | 3300044901 | Bacteria | 2835 |
| 714 | Ga0466960_0022279 | 3300044901 | Bacteria | 2831 |
| 715 | Ga0451576_0000032 | 3300045051 | Bacteria | 397014 |
| 716 | Ga0451576_0000175 | 3300045051 | Bacteria | 161976 |
| 717 | Ga0451576_0000443 | 3300045051 | Bacteria | 94447 |
| 718 | Ga0451576_0002775 | 3300045051 | Bacteria | 25283 |
| 719 | Ga0451576_0003405 | 3300045051 | Bacteria | 21917 |
| 720 | Ga0451576_0007566 | 3300045051 | Bacteria | 12948 |
| 721 | Ga0451576_0011426 | 3300045051 | Bacteria | 10088 |
| 722 | Ga0451576_0013758 | 3300045051 | Bacteria | 9039 |
| 723 | Ga0451576_0073549 | 3300045051 | Bacteria | 3557 |
| 724 | Ga0451576_0341613 | 3300045051 | Bacteria | 1567 |
| 725 | Ga0466967_0031036 | 3300045976 | Bacteria | 4494 |
| 726 | Ga0495627_000769 | 3300046453 | Bacteria | 23843 |
| 727 | Ga0495590_0001675 | 3300046457 | Bacteria | 9433 |
| 728 | Ga0495638_0001181 | 3300046460 | Bacteria | 25058 |
| 729 | Ga0495638_0005170 | 3300046460 | Bacteria | 9758 |
| 730 | Ga0495638_0006604 | 3300046460 | Bacteria | 8427 |
| 731 | Ga0495638_0008934 | 3300046460 | Bacteria | 7066 |
| 732 | Ga0495638_0025692 | 3300046460 | Bacteria | 3824 |
| 733 | Ga0495638_0030182 | 3300046460 | Bacteria | 3491 |
| 734 | Ga0495638_0065339 | 3300046460 | Bacteria | 2240 |
| 735 | Ga0495638_0084370 | 3300046460 | Bacteria | 1922 |
| 736 | Ga0495650_0000237 | 3300046471 | Bacteria | 110872 |
| 737 | Ga0495605_0001952 | 3300046474 | Bacteria | 13095 |
| 738 | Ga0495583_0000001 | 3300046506 | Bacteria | 811973 |
| 739 | Ga0495610_0000407 | 3300046512 | Bacteria | 44093 |
| 740 | Ga0495610_0001969 | 3300046512 | Bacteria | 17628 |
| 741 | Ga0495610_0003529 | 3300046512 | Bacteria | 12123 |
| 742 | Ga0495610_0003825 | 3300046512 | Bacteria | 11469 |
| 743 | Ga0495610_0028351 | 3300046512 | Bacteria | 2962 |
| 744 | Ga0495610_0097095 | 3300046512 | Bacteria | 1326 |
| 745 | Ga0495616_0000109 | 3300046513 | Bacteria | 71495 |
| 746 | Ga0495616_0072627 | 3300046513 | Bacteria | 1661 |
| 747 | Ga0495616_0086043 | 3300046513 | Bacteria | 1496 |
| 748 | Ga0495620_0028963 | 3300046515 | Bacteria | 2569 |
| 749 | Ga0495620_0034736 | 3300046515 | Bacteria | 2275 |
| 750 | Ga0495628_0065316 | 3300046516 | Bacteria | 2847 |
| 751 | Ga0495630_0011311 | 3300046517 | Bacteria | 6455 |
| 752 | Ga0495630_0058273 | 3300046517 | Bacteria | 2895 |
| 753 | Ga0495631_0001848 | 3300046518 | Bacteria | 12498 |
| 754 | Ga0495631_0003360 | 3300046518 | Bacteria | 8775 |
| 755 | Ga0495631_0034754 | 3300046518 | Bacteria | 2258 |
| 756 | Ga0495632_0003529 | 3300046519 | Bacteria | 11059 |
| 757 | Ga0495632_0005104 | 3300046519 | Bacteria | 8775 |
| 758 | Ga0495637_0003364 | 3300046520 | Bacteria | 8508 |
| 759 | Ga0495643_0002725 | 3300046522 | Bacteria | 13593 |
| 760 | Ga0495643_0002802 | 3300046522 | Bacteria | 13314 |
| 761 | Ga0495648_0000509 | 3300046524 | Bacteria | 41858 |
| 762 | Ga0495663_0019216 | 3300046525 | Bacteria | 1954 |
| 763 | Ga0495654_0000110 | 3300046530 | Bacteria | 93042 |
| 764 | Ga0495654_0000249 | 3300046530 | Bacteria | 49711 |
| 765 | Ga0495587_0055372 | 3300046536 | Bacteria | 2336 |
| 766 | Ga0495597_0018011 | 3300046542 | Bacteria | 3318 |
| 767 | Ga0495597_0048517 | 3300046542 | Bacteria | 1878 |
| 768 | Ga0495633_0002890 | 3300046558 | Bacteria | 11772 |
| 769 | Ga0495633_0009054 | 3300046558 | Bacteria | 5536 |
| 770 | Ga0495633_0112870 | 3300046558 | Bacteria | 1260 |
| 771 | Ga0495668_0000037 | 3300046616 | Bacteria | 233981 |
| 772 | Ga0495668_0003688 | 3300046616 | Bacteria | 11306 |
| 773 | Ga0495625_0000284 | 3300046660 | Bacteria | 78635 |
| 774 | Ga0495625_0001387 | 3300046660 | Bacteria | 29722 |
| 775 | Ga0495625_0002396 | 3300046660 | Bacteria | 20344 |
| 776 | Ga0495625_0009397 | 3300046660 | Bacteria | 8184 |
| 777 | Ga0495625_0016011 | 3300046660 | Bacteria | 5912 |
| 778 | Ga0495649_0000649 | 3300046694 | Bacteria | 28270 |
| 779 | Ga0495589_0008352 | 3300046794 | Bacteria | 5410 |
| 780 | Ga0495600_0161865 | 3300046809 | Bacteria | 1446 |
| 781 | Ga0495660_0072773 | 3300046810 | Bacteria | 1819 |
| 782 | Ga0495604_0039341 | 3300047317 | Bacteria | 3717 |
| 783 | Ga0495636_0107141 | 3300047318 | Bacteria | 1227 |
| 784 | Ga0495674_0008997 | 3300047319 | Bacteria | 9488 |
| 785 | Ga0495672_0003205 | 3300047320 | Bacteria | 14223 |
| 786 | Ga0495672_0009178 | 3300047320 | Bacteria | 7202 |
| 787 | Ga0495673_0000156 | 3300047469 | Bacteria | 118831 |
| 788 | Ga0495673_0001785 | 3300047469 | Bacteria | 16335 |
| 789 | Ga0495684_0010387 | 3300047471 | Bacteria | 7200 |
| 790 | Ga0495686_0000025 | 3300047472 | Bacteria | 388098 |
| 791 | Ga0495686_0002042 | 3300047472 | Bacteria | 19884 |
| 792 | Ga0495686_0002729 | 3300047472 | Bacteria | 16131 |
| 793 | Ga0495686_0039677 | 3300047472 | Bacteria | 3006 |
| 794 | Ga0495686_0071479 | 3300047472 | Bacteria | 2135 |
| 795 | Ga0495686_0074730 | 3300047472 | Bacteria | 2079 |
| 796 | Ga0496100_0024136 | 3300048903 | Bacteria | 3704 |
| 797 | Ga0496100_0043880 | 3300048903 | Bacteria | 2861 |
| 798 | Ga0496100_0053196 | 3300048903 | Bacteria | 2636 |
| 799 | Ga0496101_0006593 | 3300048904 | Bacteria | 7481 |
| 800 | Ga0496101_0007333 | 3300048904 | Bacteria | 7139 |
| 801 | Ga0496101_0227588 | 3300048904 | Bacteria | 1449 |
| 802 | Ga0496102_0011027 | 3300048905 | Bacteria | 7786 |
| 803 | Ga0496103_0049797 | 3300048906 | Bacteria | 2591 |
| 804 | Ga0496104_0028708 | 3300048907 | Bacteria | 5156 |
| 805 | Ga0496105_0003076 | 3300048908 | Bacteria | 12259 |
| 806 | Ga0496105_0048040 | 3300048908 | Bacteria | 3523 |
| 807 | Ga0496106_0000982 | 3300048909 | Bacteria | 20805 |
| 808 | Ga0496106_0006952 | 3300048909 | Bacteria | 8365 |
| 809 | Ga0496106_0168989 | 3300048909 | Bacteria | 1732 |
| 810 | Ga0496107_0000864 | 3300048910 | Bacteria | 17818 |
| 811 | Ga0496107_0000914 | 3300048910 | Bacteria | 17392 |
| 812 | Ga0496107_0019454 | 3300048910 | Bacteria | 4790 |
| 813 | Ga0496108_0000529 | 3300048911 | Bacteria | 29960 |
| 814 | Ga0496108_0098416 | 3300048911 | Bacteria | 2493 |
| 815 | Ga0496108_0221932 | 3300048911 | Bacteria | 1642 |
| 816 | Ga0496109_0100563 | 3300048912 | Bacteria | 2683 |
| 817 | Ga0496109_0193465 | 3300048912 | Bacteria | 1911 |
| 818 | Ga0496109_0243579 | 3300048912 | Bacteria | 1692 |
| 819 | Ga0496110_0158482 | 3300048913 | Bacteria | 2051 |
| 820 | Ga0496112_0182082 | 3300048915 | Bacteria | 2065 |
| 821 | Ga0496112_0222368 | 3300048915 | Bacteria | 1844 |
| 822 | Ga0496113_0256304 | 3300048916 | Bacteria | 1397 |
| 823 | Ga0496114_0000962 | 3300048917 | Bacteria | 21556 |
| 824 | Ga0496114_0023493 | 3300048917 | Bacteria | 5031 |
| 825 | Ga0496115_0003066 | 3300048918 | Bacteria | 11999 |
| 826 | Ga0496115_0013897 | 3300048918 | Bacteria | 6093 |
| 827 | Ga0496115_0037401 | 3300048918 | Bacteria | 3846 |
| 828 | Ga0496116_0000142 | 3300048919 | Bacteria | 150342 |
| 829 | Ga0496116_0009760 | 3300048919 | Bacteria | 8146 |
| 830 | Ga0496116_0011061 | 3300048919 | Bacteria | 7507 |
| 831 | Ga0496116_0029217 | 3300048919 | Bacteria | 3978 |
| 832 | Ga0496116_0051921 | 3300048919 | Bacteria | 2719 |
| 833 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 834 | Ga0496117_0001574 | 3300048920 | Bacteria | 32408 |
| 835 | Ga0496117_0004520 | 3300048920 | Bacteria | 15278 |
| 836 | Ga0496117_0012510 | 3300048920 | Bacteria | 7471 |
| 837 | Ga0496118_0000087 | 3300048921 | Bacteria | 176693 |
| 838 | Ga0496118_0003357 | 3300048921 | Bacteria | 20255 |
| 839 | Ga0496118_0126311 | 3300048921 | Bacteria | 1654 |
| 840 | Ga0496119_0005947 | 3300048922 | Bacteria | 11472 |
| 841 | Ga0496119_0011964 | 3300048922 | Bacteria | 7109 |
| 842 | Ga0496119_0022330 | 3300048922 | Bacteria | 4535 |
| 843 | Ga0496119_0033726 | 3300048922 | Bacteria | 3387 |
| 844 | Ga0496120_0000413 | 3300048923 | Bacteria | 68125 |
| 845 | Ga0496120_0001104 | 3300048923 | Bacteria | 35202 |
| 846 | Ga0496120_0017315 | 3300048923 | Bacteria | 4677 |
| 847 | Ga0496120_0020008 | 3300048923 | Bacteria | 4265 |
| 848 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 849 | Ga0496121_0001116 | 3300048924 | Bacteria | 47237 |
| 850 | Ga0496121_0002536 | 3300048924 | Bacteria | 27686 |
| 851 | Ga0496121_0004530 | 3300048924 | Bacteria | 18596 |
| 852 | Ga0496121_0084672 | 3300048924 | Bacteria | 2499 |
| 853 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 854 | Ga0496122_0000190 | 3300048925 | Bacteria | 140376 |
| 855 | Ga0496122_0000215 | 3300048925 | Bacteria | 128810 |
| 856 | Ga0496122_0008959 | 3300048925 | Bacteria | 10641 |
| 857 | Ga0496122_0010294 | 3300048925 | Bacteria | 9677 |
| 858 | Ga0496122_0033581 | 3300048925 | Bacteria | 4216 |
| 859 | Ga0496122_0040083 | 3300048925 | Bacteria | 3728 |
| 860 | Ga0496122_0040321 | 3300048925 | Bacteria | 3713 |
| 861 | Ga0496122_0047411 | 3300048925 | Bacteria | 3317 |
| 862 | Ga0496122_0067097 | 3300048925 | Bacteria | 2586 |
| 863 | Ga0496122_0132461 | 3300048925 | Bacteria | 1580 |
| 864 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 865 | Ga0496123_0000306 | 3300048926 | Bacteria | 95266 |
| 866 | Ga0496123_0000336 | 3300048926 | Bacteria | 89161 |
| 867 | Ga0496123_0013645 | 3300048926 | Bacteria | 6797 |
| 868 | Ga0496123_0016026 | 3300048926 | Bacteria | 6112 |
| 869 | Ga0496123_0027463 | 3300048926 | Bacteria | 4238 |
| 870 | Ga0496123_0059789 | 3300048926 | Bacteria | 2461 |
| 871 | Ga0496124_0001040 | 3300048927 | Bacteria | 43813 |
| 872 | Ga0496124_0006855 | 3300048927 | Bacteria | 12267 |
| 873 | Ga0496124_0008840 | 3300048927 | Bacteria | 10458 |
| 874 | Ga0496124_0011355 | 3300048927 | Bacteria | 8905 |
| 875 | Ga0496124_0015066 | 3300048927 | Bacteria | 7434 |
| 876 | Ga0496124_0017201 | 3300048927 | Bacteria | 6826 |
| 877 | Ga0496124_0017234 | 3300048927 | Bacteria | 6814 |
| 878 | Ga0496124_0031646 | 3300048927 | Bacteria | 4681 |
| 879 | Ga0496124_0100368 | 3300048927 | Bacteria | 2346 |
| 880 | Ga0496124_0149850 | 3300048927 | Bacteria | 1831 |
| 881 | Ga0496125_0000039 | 3300048928 | Bacteria | 318665 |
| 882 | Ga0496125_0000248 | 3300048928 | Bacteria | 110840 |
| 883 | Ga0496125_0006049 | 3300048928 | Bacteria | 13230 |
| 884 | Ga0496125_0092061 | 3300048928 | Bacteria | 2268 |
| 885 | Ga0496125_0213966 | 3300048928 | Bacteria | 1249 |
| 886 | Ga0496126_0000866 | 3300048929 | Bacteria | 53241 |
| 887 | Ga0496126_0001294 | 3300048929 | Bacteria | 39967 |
| 888 | Ga0496126_0003703 | 3300048929 | Bacteria | 19064 |
| 889 | Ga0496126_0014931 | 3300048929 | Bacteria | 7831 |
| 890 | Ga0496126_0061773 | 3300048929 | Bacteria | 3364 |
| 891 | Ga0496126_0226154 | 3300048929 | Bacteria | 1569 |
| 892 | Ga0495678_003521 | 3300049459 | Bacteria | 9623 |
| 893 | Ga0501031_0000036 | 3300049568 | Bacteria | 73760 |
| 894 | Ga0501031_0021717 | 3300049568 | Bacteria | 4184 |
| 895 | Ga0501031_0029115 | 3300049568 | Bacteria | 3602 |
| 896 | Ga0501032_0000075 | 3300049569 | Bacteria | 84153 |
| 897 | Ga0501032_0000100 | 3300049569 | Bacteria | 73505 |
| 898 | Ga0501032_0001723 | 3300049569 | Bacteria | 17307 |
| 899 | Ga0501032_0001737 | 3300049569 | Bacteria | 17232 |
| 900 | Ga0501032_0002103 | 3300049569 | Bacteria | 15705 |
| 901 | Ga0501032_0056351 | 3300049569 | Bacteria | 2642 |
| 902 | Ga0501032_0058728 | 3300049569 | Bacteria | 2582 |
| 903 | Ga0501032_0104903 | 3300049569 | Bacteria | 1873 |
| 904 | Ga0501033_0000088 | 3300049570 | Bacteria | 87638 |
| 905 | Ga0501033_0001181 | 3300049570 | Bacteria | 23577 |
| 906 | Ga0501033_0001862 | 3300049570 | Bacteria | 18338 |
| 907 | Ga0501033_0002110 | 3300049570 | Bacteria | 17214 |
| 908 | Ga0501033_0004600 | 3300049570 | Bacteria | 11057 |
| 909 | Ga0501033_0087085 | 3300049570 | Bacteria | 2286 |
| 910 | Ga0501034_0000397 | 3300049571 | Bacteria | 73511 |
| 911 | Ga0501034_0001558 | 3300049571 | Bacteria | 30010 |
| 912 | Ga0501034_0003857 | 3300049571 | Bacteria | 16894 |
| 913 | Ga0501034_0013251 | 3300049571 | Bacteria | 8494 |
| 914 | Ga0501034_0041258 | 3300049571 | Bacteria | 4669 |
| 915 | Ga0501034_0062289 | 3300049571 | Bacteria | 3746 |
| 916 | Ga0501034_0084135 | 3300049571 | Bacteria | 3183 |
| 917 | Ga0501034_0086446 | 3300049571 | Bacteria | 3136 |
| 918 | Ga0501034_0086879 | 3300049571 | Bacteria | 3127 |
| 919 | Ga0501034_0191331 | 3300049571 | Bacteria | 2008 |
| 920 | Ga0501034_0284546 | 3300049571 | Bacteria | 1592 |
| 921 | Ga0501036_0000056 | 3300049572 | Bacteria | 73511 |
| 922 | Ga0501036_0000398 | 3300049572 | Bacteria | 30616 |
| 923 | Ga0501036_0003168 | 3300049572 | Bacteria | 13129 |
| 924 | Ga0501036_0022832 | 3300049572 | Bacteria | 5267 |
| 925 | Ga0501036_0060537 | 3300049572 | Bacteria | 3208 |
| 926 | Ga0501036_0067948 | 3300049572 | Bacteria | 3015 |
| 927 | Ga0501036_0189269 | 3300049572 | Bacteria | 1732 |
| 928 | Ga0501036_0308564 | 3300049572 | Bacteria | 1323 |
| 929 | Ga0501037_0000021 | 3300049573 | Bacteria | 150037 |
| 930 | Ga0501037_0000119 | 3300049573 | Bacteria | 73510 |
| 931 | Ga0501037_0000181 | 3300049573 | Bacteria | 58438 |
| 932 | Ga0501037_0001490 | 3300049573 | Bacteria | 17106 |
| 933 | Ga0501037_0022441 | 3300049573 | Bacteria | 4669 |
| 934 | Ga0501038_0000032 | 3300049574 | Bacteria | 131432 |
| 935 | Ga0501038_0000098 | 3300049574 | Bacteria | 73471 |
| 936 | Ga0501038_0001105 | 3300049574 | Bacteria | 24439 |
| 937 | Ga0501038_0032793 | 3300049574 | Bacteria | 4578 |
| 938 | Ga0501038_0053162 | 3300049574 | Bacteria | 3488 |
| 939 | Ga0501039_0000013 | 3300049575 | Bacteria | 234418 |
| 940 | Ga0501039_0000025 | 3300049575 | Bacteria | 152236 |
| 941 | Ga0501039_0009216 | 3300049575 | Bacteria | 7521 |
| 942 | Ga0501039_0029009 | 3300049575 | Bacteria | 4260 |
| 943 | Ga0501039_0063883 | 3300049575 | Bacteria | 2852 |
| 944 | Ga0501039_0134403 | 3300049575 | Bacteria | 1942 |
| 945 | Ga0501040_0006707 | 3300049576 | Bacteria | 7467 |
| 946 | Ga0501040_0022820 | 3300049576 | Bacteria | 4193 |
| 947 | Ga0501040_0106566 | 3300049576 | Bacteria | 1958 |
| 948 | Ga0501040_0199928 | 3300049576 | Bacteria | 1419 |
| 949 | Ga0501042_0008324 | 3300049578 | Bacteria | 6837 |
| 950 | Ga0501042_0021347 | 3300049578 | Bacteria | 4511 |
| 951 | Ga0501042_0061785 | 3300049578 | Bacteria | 2676 |
| 952 | Ga0501042_0128070 | 3300049578 | Bacteria | 1829 |
| 953 | Ga0501042_0194362 | 3300049578 | Bacteria | 1463 |
| 954 | Ga0501043_0000008 | 3300049579 | Bacteria | 223654 |
| 955 | Ga0501043_0002291 | 3300049579 | Bacteria | 16234 |
| 956 | Ga0501043_0004109 | 3300049579 | Bacteria | 11886 |
| 957 | Ga0501043_0009292 | 3300049579 | Bacteria | 7725 |
| 958 | Ga0501043_0013809 | 3300049579 | Bacteria | 6319 |
| 959 | Ga0501043_0021406 | 3300049579 | Bacteria | 5069 |
| 960 | Ga0501043_0029609 | 3300049579 | Bacteria | 4302 |
| 961 | Ga0501043_0046072 | 3300049579 | Bacteria | 3428 |
| 962 | Ga0501043_0163416 | 3300049579 | Bacteria | 1739 |
| 963 | Ga0501046_0000796 | 3300049580 | Bacteria | 30570 |
| 964 | Ga0501046_0003329 | 3300049580 | Bacteria | 14773 |
| 965 | Ga0501046_0004770 | 3300049580 | Bacteria | 12232 |
| 966 | Ga0501046_0132190 | 3300049580 | Bacteria | 1892 |
| 967 | Ga0501046_0143187 | 3300049580 | Bacteria | 1807 |
| 968 | Ga0501047_0001349 | 3300049581 | Bacteria | 24106 |
| 969 | Ga0501047_0004591 | 3300049581 | Bacteria | 12985 |
| 970 | Ga0501047_0006856 | 3300049581 | Bacteria | 10703 |
| 971 | Ga0501047_0007284 | 3300049581 | Bacteria | 10401 |
| 972 | Ga0501047_0009767 | 3300049581 | Bacteria | 9069 |
| 973 | Ga0501047_0014505 | 3300049581 | Bacteria | 7494 |
| 974 | Ga0501047_0031934 | 3300049581 | Bacteria | 5081 |
| 975 | Ga0501047_0032382 | 3300049581 | Bacteria | 5046 |
| 976 | Ga0501047_0051975 | 3300049581 | Bacteria | 3960 |
| 977 | Ga0501047_0079750 | 3300049581 | Bacteria | 3147 |
| 978 | Ga0501047_0100203 | 3300049581 | Bacteria | 2776 |
| 979 | Ga0501047_0125892 | 3300049581 | Bacteria | 2442 |
| 980 | Ga0501047_0154168 | 3300049581 | Bacteria | 2171 |
| 981 | Ga0501047_0186682 | 3300049581 | Bacteria | 1938 |
| 982 | Ga0501048_0001499 | 3300049582 | Bacteria | 17673 |
| 983 | Ga0501048_0055597 | 3300049582 | Bacteria | 2809 |
| 984 | Ga0501048_0151484 | 3300049582 | Bacteria | 1640 |
| 985 | Ga0501048_0286447 | 3300049582 | Bacteria | 1171 |
| 986 | Ga0501067_0011338 | 3300049583 | Bacteria | 4937 |
| 987 | Ga0501067_0035321 | 3300049583 | Bacteria | 2775 |
| 988 | Ga0501068_0010703 | 3300049584 | Bacteria | 5157 |
| 989 | Ga0501068_0022112 | 3300049584 | Bacteria | 3716 |
| 990 | Ga0501068_0043794 | 3300049584 | Bacteria | 2693 |
| 991 | Ga0501068_0081653 | 3300049584 | Bacteria | 1985 |
| 992 | Ga0501068_0132289 | 3300049584 | Bacteria | 1560 |
| 993 | Ga0501068_0154471 | 3300049584 | Bacteria | 1444 |
| 994 | Ga0501069_0000028 | 3300049585 | Bacteria | 106038 |
| 995 | Ga0501069_0070269 | 3300049585 | Bacteria | 1961 |
| 996 | Ga0501069_0094575 | 3300049585 | Bacteria | 1691 |
| 997 | Ga0501070_0000208 | 3300049586 | Bacteria | 55386 |
| 998 | Ga0501070_0000264 | 3300049586 | Bacteria | 49510 |
| 999 | Ga0501070_0002017 | 3300049586 | Bacteria | 17837 |
| 1000 | Ga0501070_0011937 | 3300049586 | Bacteria | 7337 |
| 1001 | Ga0501070_0038239 | 3300049586 | Bacteria | 4004 |
| 1002 | Ga0501070_0064702 | 3300049586 | Bacteria | 3028 |
| 1003 | Ga0501070_0247854 | 3300049586 | Bacteria | 1457 |
| 1004 | Ga0501071_0015623 | 3300049587 | Bacteria | 5212 |
| 1005 | Ga0501071_0026908 | 3300049587 | Bacteria | 4042 |
| 1006 | Ga0501071_0129555 | 3300049587 | Bacteria | 1873 |
| 1007 | Ga0501071_0172254 | 3300049587 | Bacteria | 1620 |
| 1008 | Ga0501071_0305027 | 3300049587 | Bacteria | 1207 |
| 1009 | Ga0501072_0006570 | 3300049588 | Bacteria | 8854 |
| 1010 | Ga0501072_0110393 | 3300049588 | Bacteria | 2189 |
| 1011 | Ga0501072_0119994 | 3300049588 | Bacteria | 2095 |
| 1012 | Ga0501072_0156423 | 3300049588 | Bacteria | 1817 |
| 1013 | Ga0501073_0001991 | 3300049589 | Bacteria | 15236 |
| 1014 | Ga0501073_0017923 | 3300049589 | Bacteria | 5122 |
| 1015 | Ga0501074_0000016 | 3300049590 | Bacteria | 78666 |
| 1016 | Ga0501074_0006671 | 3300049590 | Bacteria | 8338 |
| 1017 | Ga0501074_0064103 | 3300049590 | Bacteria | 2646 |
| 1018 | Ga0501074_0182621 | 3300049590 | Bacteria | 1496 |
| 1019 | Ga0501074_0266137 | 3300049590 | Bacteria | 1218 |
| 1020 | Ga0501075_0005584 | 3300049591 | Bacteria | 8603 |
| 1021 | Ga0501075_0117059 | 3300049591 | Bacteria | 2026 |
| 1022 | Ga0501075_0125926 | 3300049591 | Bacteria | 1950 |
| 1023 | Ga0501076_0094212 | 3300049592 | Bacteria | 2411 |
| 1024 | Ga0501076_0147835 | 3300049592 | Bacteria | 1911 |
| 1025 | Ga0501076_0427094 | 3300049592 | Bacteria | 1090 |
| 1026 | Ga0501077_0018272 | 3300049593 | Bacteria | 4436 |
| 1027 | Ga0501077_0080859 | 3300049593 | Bacteria | 2058 |
| 1028 | Ga0501077_0083851 | 3300049593 | Bacteria | 2020 |
| 1029 | Ga0501238_002317 | 3300049671 | Bacteria | 2265 |
| 1030 | Ga0501079_0013164 | 3300049741 | Bacteria | 6305 |
| 1031 | Ga0501080_0000065 | 3300049742 | Bacteria | 69171 |
| 1032 | Ga0501080_0000515 | 3300049742 | Bacteria | 30480 |
| 1033 | Ga0501080_0002532 | 3300049742 | Bacteria | 15995 |
| 1034 | Ga0501080_0018343 | 3300049742 | Bacteria | 6477 |
| 1035 | Ga0501080_0044577 | 3300049742 | Bacteria | 4129 |
| 1036 | Ga0501080_0067657 | 3300049742 | Bacteria | 3322 |
| 1037 | Ga0501080_0131816 | 3300049742 | Bacteria | 2314 |
| 1038 | Ga0501081_0007123 | 3300049743 | Bacteria | 7267 |
| 1039 | Ga0501081_0038321 | 3300049743 | Bacteria | 3274 |
| 1040 | Ga0501083_0000482 | 3300049744 | Bacteria | 25555 |
| 1041 | Ga0501083_0001671 | 3300049744 | Bacteria | 15142 |
| 1042 | Ga0501083_0007197 | 3300049744 | Bacteria | 7902 |
| 1043 | Ga0501083_0030737 | 3300049744 | Bacteria | 3687 |
| 1044 | Ga0501083_0042867 | 3300049744 | Bacteria | 3067 |
| 1045 | Ga0501083_0047820 | 3300049744 | Bacteria | 2889 |
| 1046 | Ga0501083_0069870 | 3300049744 | Bacteria | 2336 |
| 1047 | Ga0501083_0220879 | 3300049744 | Bacteria | 1234 |
| 1048 | Ga0501035_0000011 | 3300049822 | Bacteria | 305794 |
| 1049 | Ga0501035_0000053 | 3300049822 | Bacteria | 142860 |
| 1050 | Ga0501035_0000085 | 3300049822 | Bacteria | 116189 |
| 1051 | Ga0501035_0000584 | 3300049822 | Bacteria | 40265 |
| 1052 | Ga0501035_0001564 | 3300049822 | Bacteria | 23277 |
| 1053 | Ga0501035_0001865 | 3300049822 | Bacteria | 21239 |
| 1054 | Ga0501035_0002030 | 3300049822 | Bacteria | 20177 |
| 1055 | Ga0501035_0002594 | 3300049822 | Bacteria | 17645 |
| 1056 | Ga0501035_0017631 | 3300049822 | Bacteria | 6587 |
| 1057 | Ga0501035_0026972 | 3300049822 | Bacteria | 5253 |
| 1058 | Ga0501035_0051433 | 3300049822 | Bacteria | 3689 |
| 1059 | Ga0501035_0121609 | 3300049822 | Bacteria | 2282 |
| 1060 | Ga0501035_0167383 | 3300049822 | Bacteria | 1900 |
| 1061 | Ga0501035_0178021 | 3300049822 | Bacteria | 1833 |
| 1062 | Ga0501035_0245654 | 3300049822 | Bacteria | 1521 |
| 1063 | Ga0501044_0000011 | 3300049823 | Bacteria | 257385 |
| 1064 | Ga0501044_0000206 | 3300049823 | Bacteria | 75006 |
| 1065 | Ga0501044_0000214 | 3300049823 | Bacteria | 73483 |
| 1066 | Ga0501044_0003350 | 3300049823 | Bacteria | 18063 |
| 1067 | Ga0501044_0014012 | 3300049823 | Bacteria | 8659 |
| 1068 | Ga0501044_0021514 | 3300049823 | Bacteria | 6879 |
| 1069 | Ga0501044_0029188 | 3300049823 | Bacteria | 5817 |
| 1070 | Ga0501044_0032189 | 3300049823 | Bacteria | 5513 |
| 1071 | Ga0501044_0041808 | 3300049823 | Bacteria | 4771 |
| 1072 | Ga0501044_0130899 | 3300049823 | Bacteria | 2503 |
| 1073 | Ga0501044_0259986 | 3300049823 | Bacteria | 1674 |
| 1074 | Ga0501044_0261060 | 3300049823 | Bacteria | 1670 |
| 1075 | Ga0501044_0261644 | 3300049823 | Bacteria | 1668 |
| 1076 | Ga0501045_0045184 | 3300049824 | Bacteria | 3207 |
| 1077 | Ga0501045_0098913 | 3300049824 | Bacteria | 2158 |
| 1078 | nmdc:mga03683_1625_c2 | 3300050489 | Bacteria | 1824 |
| 1079 | nmdc:mga03683_61655_c1 | 3300050489 | Bacteria | 1587 |
| 1080 | nmdc:mga03n38_11236_c1 | 3300050490 | Bacteria | 3328 |
| 1081 | nmdc:mga03n38_12796_c1 | 3300050490 | Bacteria | 3168 |
| 1082 | nmdc:mga03n38_49203_c1 | 3300050490 | Bacteria | 1873 |
| 1083 | nmdc:mga00v17_12_c1 | 3300050491 | Bacteria | 129050 |
| 1084 | nmdc:mga00v17_3914_c1 | 3300050491 | Bacteria | 7681 |
| 1085 | nmdc:mga00v17_639_c1 | 3300050491 | Bacteria | 19367 |
| 1086 | nmdc:mga00v17_74517_c1 | 3300050491 | Bacteria | 2109 |
| 1087 | nmdc:mga0yw44_291_c1 | 3300050492 | Bacteria | 17253 |
| 1088 | nmdc:mga0k408_143212_c1 | 3300050493 | Bacteria | 1422 |
| 1089 | nmdc:mga0k408_14483_c1 | 3300050493 | Bacteria | 3435 |
| 1090 | nmdc:mga0k408_48746_c1 | 3300050493 | Bacteria | 2451 |
| 1091 | nmdc:mga0k408_74905_c1 | 3300050493 | Bacteria | 1977 |
| 1092 | nmdc:mga06z11_32566_c1 | 3300050494 | Bacteria | 2543 |
| 1093 | nmdc:mga06z11_6219_c1 | 3300050494 | Bacteria | 4838 |
| 1094 | nmdc:mga06z11_91404_c1 | 3300050494 | Bacteria | 1653 |
| 1095 | nmdc:mga07m45_11234_c1 | 3300050496 | Bacteria | 4701 |
| 1096 | nmdc:mga07m45_85941_c1 | 3300050496 | Bacteria | 1799 |
| 1097 | nmdc:mga05p37_204559_c1 | 3300050507 | Bacteria | 2389 |
| 1098 | nmdc:mga05p37_695355_c1 | 3300050507 | Bacteria | 1131 |
| 1099 | nmdc:mga09592_142995_c1 | 3300050508 | Bacteria | 2062 |
| 1100 | nmdc:mga09592_264916_c1 | 3300050508 | Bacteria | 1491 |
| 1101 | nmdc:mga0qj67_87777_c1 | 3300050509 | Bacteria | 2497 |
| 1102 | nmdc:mga06r32_100635_c1 | 3300050510 | Bacteria | 2836 |
| 1103 | nmdc:mga0rr50_142263_c1 | 3300050513 | Bacteria | 1931 |
| 1104 | nmdc:mga08x19_261471_c1 | 3300050514 | Bacteria | 1196 |
| 1105 | nmdc:mga0a205_8555_c1 | 3300050515 | Bacteria | 9308 |
| 1106 | nmdc:mga0sz30_1084_c1 | 3300050516 | Bacteria | 9781 |
| 1107 | nmdc:mga0sz30_2810_c1 | 3300050516 | Bacteria | 6216 |
| 1108 | nmdc:mga0sz30_32753_c1 | 3300050516 | Bacteria | 2157 |
| 1109 | Ga0495601_0037547 | 3300053077 | Bacteria | 3029 |
| 1110 | Ga0500610_0007910 | 3300053079 | Bacteria | 4595 |
| 1111 | Ga0500578_0000134 | 3300053086 | Bacteria | 89131 |
| 1112 | Ga0500578_0041968 | 3300053086 | Bacteria | 2937 |
| 1113 | Ga0500643_000992 | 3300053087 | Bacteria | 17440 |
| 1114 | Ga0500643_042891 | 3300053087 | Bacteria | 1321 |
| 1115 | Ga0500644_0000618 | 3300053088 | Bacteria | 13280 |
| 1116 | Ga0500644_0004179 | 3300053088 | Bacteria | 3601 |
| 1117 | Ga0500651_0027106 | 3300053093 | Bacteria | 3602 |
| 1118 | Ga0500641_0001998 | 3300053096 | Bacteria | 7231 |
| 1119 | Ga0500554_043963 | 3300053102 | Bacteria | 1382 |
| 1120 | Ga0500556_0001416 | 3300053104 | Bacteria | 10332 |
| 1121 | Ga0500560_000083 | 3300053107 | Bacteria | 9237 |
| 1122 | Ga0500562_000545 | 3300053108 | Bacteria | 9127 |
| 1123 | Ga0500572_001610 | 3300053111 | Bacteria | 5961 |
| 1124 | Ga0500594_0000319 | 3300053118 | Bacteria | 10752 |
| 1125 | Ga0500594_0034655 | 3300053118 | Bacteria | 1350 |
| 1126 | Ga0500597_061909 | 3300053120 | Bacteria | 1609 |
| 1127 | Ga0500608_000259 | 3300053122 | Bacteria | 20696 |
| 1128 | Ga0500608_044527 | 3300053122 | Bacteria | 2131 |
| 1129 | Ga0500614_003099 | 3300053123 | Bacteria | 3614 |
| 1130 | Ga0500618_000314 | 3300053125 | Bacteria | 35813 |
| 1131 | Ga0500618_000677 | 3300053125 | Bacteria | 20060 |
| 1132 | Ga0500618_009330 | 3300053125 | Bacteria | 2682 |
| 1133 | Ga0500618_016011 | 3300053125 | Bacteria | 1884 |
| 1134 | Ga0500658_0000526 | 3300053134 | Bacteria | 16212 |
| 1135 | Ga0500559_0000307 | 3300053136 | Bacteria | 37126 |
| 1136 | Ga0500559_0002861 | 3300053136 | Bacteria | 8722 |
| 1137 | Ga0500559_0020295 | 3300053136 | Bacteria | 2809 |
| 1138 | Ga0500561_0000098 | 3300053137 | Bacteria | 16671 |
| 1139 | Ga0500564_000155 | 3300053138 | Bacteria | 17869 |
| 1140 | Ga0500568_0000093 | 3300053139 | Bacteria | 83403 |
| 1141 | Ga0500573_0019055 | 3300053140 | Bacteria | 3924 |
| 1142 | Ga0500577_0000256 | 3300053142 | Bacteria | 13913 |
| 1143 | Ga0500590_003631 | 3300053148 | Bacteria | 7157 |
| 1144 | Ga0500604_0056608 | 3300053151 | Bacteria | 1222 |
| 1145 | Ga0500616_0000277 | 3300053153 | Bacteria | 76399 |
| 1146 | Ga0500616_0001018 | 3300053153 | Bacteria | 29841 |
| 1147 | Ga0500616_0001109 | 3300053153 | Bacteria | 27847 |
| 1148 | Ga0500616_0012776 | 3300053153 | Bacteria | 4902 |
| 1149 | Ga0500616_0025011 | 3300053153 | Bacteria | 3313 |
| 1150 | Ga0500616_0044112 | 3300053153 | Bacteria | 2380 |
| 1151 | Ga0500616_0062010 | 3300053153 | Bacteria | 1933 |
| 1152 | Ga0500620_000576 | 3300053155 | Bacteria | 6304 |
| 1153 | Ga0500622_0000458 | 3300053156 | Bacteria | 38693 |
| 1154 | Ga0500622_0000627 | 3300053156 | Bacteria | 31781 |
| 1155 | Ga0500622_0004784 | 3300053156 | Bacteria | 8325 |
| 1156 | Ga0500622_0009618 | 3300053156 | Bacteria | 5342 |
| 1157 | Ga0500622_0019462 | 3300053156 | Bacteria | 3605 |
| 1158 | Ga0500622_0035314 | 3300053156 | Bacteria | 2616 |
| 1159 | Ga0500624_005531 | 3300053157 | Bacteria | 1682 |
| 1160 | Ga0500627_0072248 | 3300053158 | Bacteria | 1529 |
| 1161 | Ga0500627_0075524 | 3300053158 | Bacteria | 1497 |
| 1162 | Ga0500627_0093577 | 3300053158 | Bacteria | 1346 |
| 1163 | Ga0500634_0000041 | 3300053161 | Bacteria | 59177 |
| 1164 | Ga0500634_0000261 | 3300053161 | Bacteria | 16846 |
| 1165 | Ga0500636_0000180 | 3300053177 | Bacteria | 33813 |
| 1166 | Ga0500645_001032 | 3300053730 | Bacteria | 15600 |
| 1167 | Ga0500645_001323 | 3300053730 | Bacteria | 12840 |
| 1168 | Ga0501084_0004414 | 3300054114 | Bacteria | 11476 |
| 1169 | Ga0501084_0035642 | 3300054114 | Bacteria | 4159 |
| 1170 | Ga0501084_0159408 | 3300054114 | Bacteria | 1903 |
| 1171 | Ga0501084_0243561 | 3300054114 | Bacteria | 1518 |
| 1172 | Ga0587068_009854 | 3300059641 | Bacteria | 1414 |
| 1173 | Ga0501082_0019524 | 3300060353 | Bacteria | 5844 |
| 1174 | Ga0501082_0030438 | 3300060353 | Bacteria | 4651 |
| 1175 | Ga0501082_0045872 | 3300060353 | Bacteria | 3768 |
| 1176 | Ga0530510_0033362 | 3300061734 | Bacteria | 3707 |
| 1177 | Ga0530510_0089281 | 3300061734 | Bacteria | 2247 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0004591 | Ga0501047_0004591_15_938 | 282 |
| 2 | 3300009553 | Ga0105249_10092252 | Ga0105249_100922523 | 289 |
| 3 | iso_pu_bacteria | 8004395343 | 8004400655 | 299 |
| 4 | 3300009148 | Ga0105243_10166001 | Ga0105243_101660012 | 305 |
| 5 | 3300009148 | Ga0105243_10580402 | Ga0105243_105804021 | 305 |
| 6 | 3300009176 | Ga0105242_10028628 | Ga0105242_100286282 | 305 |
| 7 | 3300009176 | Ga0105242_10301588 | Ga0105242_103015882 | 305 |
| 8 | 3300009177 | Ga0105248_10263764 | Ga0105248_102637641 | 305 |
| 9 | 3300011119 | Ga0105246_10006723 | Ga0105246_100067235 | 305 |
| 10 | 3300013308 | Ga0157375_10296609 | Ga0157375_102966092 | 305 |
| 11 | 3300014745 | Ga0157377_10011153 | Ga0157377_100111533 | 305 |
| 12 | 3300048912 | Ga0496109_0193465 | Ga0496109_0193465_683_1669 | 305 |
| 13 | 3300048913 | Ga0496110_0158482 | Ga0496110_0158482_441_1427 | 305 |
| 14 | 3300049578 | Ga0501042_0128070 | Ga0501042_0128070_34_1017 | 305 |
| 15 | 3300050508 | nmdc:mga09592_142995_c1 | nmdc:mga09592_142995_c1_182_1165 | 305 |
| 16 | 3300053087 | Ga0500643_042891 | Ga0500643_042891_19_981 | 309 |
| 17 | 3300053125 | Ga0500618_016011 | Ga0500618_016011_896_1873 | 314 |
| 18 | 3300002077 | JGI24744J21845_10016419 | JGI24744J21845_100164192 | 316 |
| 19 | 3300005328 | Ga0070676_10038717 | Ga0070676_100387172 | 316 |
| 20 | 3300005331 | Ga0070670_100003032 | Ga0070670_10000303212 | 316 |
| 21 | 3300005334 | Ga0068869_100264930 | Ga0068869_1002649302 | 316 |
| 22 | 3300005338 | Ga0068868_100023793 | Ga0068868_1000237934 | 316 |
| 23 | 3300005340 | Ga0070689_100047479 | Ga0070689_1000474793 | 316 |
| 24 | 3300005347 | Ga0070668_100168933 | Ga0070668_1001689332 | 316 |
| 25 | 3300005354 | Ga0070675_100014504 | Ga0070675_1000145044 | 316 |
| 26 | 3300005356 | Ga0070674_100001105 | Ga0070674_1000011056 | 316 |
| 27 | 3300005356 | Ga0070674_100065860 | Ga0070674_1000658602 | 316 |
| 28 | 3300005365 | Ga0070688_100028395 | Ga0070688_1000283952 | 316 |
| 29 | 3300005456 | Ga0070678_100018307 | Ga0070678_1000183073 | 316 |
| 30 | 3300005456 | Ga0070678_100281065 | Ga0070678_1002810652 | 316 |
| 31 | 3300005466 | Ga0070685_10017126 | Ga0070685_100171262 | 316 |
| 32 | 3300005544 | Ga0070686_100002414 | Ga0070686_1000024142 | 316 |
| 33 | 3300005548 | Ga0070665_100098125 | Ga0070665_1000981253 | 316 |
| 34 | 3300005564 | Ga0070664_100018666 | Ga0070664_1000186663 | 316 |
| 35 | 3300005577 | Ga0068857_100029006 | Ga0068857_1000290063 | 316 |
| 36 | 3300005615 | Ga0070702_100040085 | Ga0070702_1000400852 | 316 |
| 37 | 3300005618 | Ga0068864_100002913 | Ga0068864_1000029132 | 316 |
| 38 | 3300005840 | Ga0068870_10016476 | Ga0068870_100164762 | 316 |
| 39 | 3300005937 | Ga0081455_10101948 | Ga0081455_101019482 | 316 |
| 40 | 3300006358 | Ga0068871_100254352 | Ga0068871_1002543522 | 316 |
| 41 | 3300006844 | Ga0075428_100043000 | Ga0075428_1000430002 | 316 |
| 42 | 3300006846 | Ga0075430_100013382 | Ga0075430_1000133823 | 316 |
| 43 | 3300006852 | Ga0075433_10114709 | Ga0075433_101147092 | 316 |
| 44 | 3300006880 | Ga0075429_100022586 | Ga0075429_1000225864 | 316 |
| 45 | 3300006880 | Ga0075429_100174417 | Ga0075429_1001744172 | 316 |
| 46 | 3300006881 | Ga0068865_100059929 | Ga0068865_1000599292 | 316 |
| 47 | 3300007076 | Ga0075435_100017580 | Ga0075435_1000175804 | 316 |
| 48 | 3300009094 | Ga0111539_10032300 | Ga0111539_100323003 | 316 |
| 49 | 3300009098 | Ga0105245_10004544 | Ga0105245_1000454412 | 316 |
| 50 | 3300025901 | Ga0207688_10015208 | Ga0207688_100152084 | 316 |
| 51 | 3300025907 | Ga0207645_10007970 | Ga0207645_100079706 | 316 |
| 52 | 3300025908 | Ga0207643_10060789 | Ga0207643_100607892 | 316 |
| 53 | 3300025918 | Ga0207662_10033707 | Ga0207662_100337073 | 316 |
| 54 | 3300025925 | Ga0207650_10011696 | Ga0207650_100116964 | 316 |
| 55 | 3300025925 | Ga0207650_10073554 | Ga0207650_100735542 | 316 |
| 56 | 3300025927 | Ga0207687_10127876 | Ga0207687_101278762 | 316 |
| 57 | 3300025933 | Ga0207706_10244122 | Ga0207706_102441222 | 316 |
| 58 | 3300025934 | Ga0207686_10087696 | Ga0207686_100876962 | 316 |
| 59 | 3300025935 | Ga0207709_10151631 | Ga0207709_101516312 | 316 |
| 60 | 3300025937 | Ga0207669_10007020 | Ga0207669_100070202 | 316 |
| 61 | 3300025940 | Ga0207691_10293629 | Ga0207691_102936292 | 316 |
| 62 | 3300025942 | Ga0207689_10079487 | Ga0207689_100794872 | 316 |
| 63 | 3300025944 | Ga0207661_10042650 | Ga0207661_100426502 | 316 |
| 64 | 3300026035 | Ga0207703_10224965 | Ga0207703_102249652 | 316 |
| 65 | 3300026088 | Ga0207641_10294916 | Ga0207641_102949162 | 316 |
| 66 | 3300026121 | Ga0207683_10049695 | Ga0207683_100496952 | 316 |
| 67 | 3300026121 | Ga0207683_10219024 | Ga0207683_102190242 | 316 |
| 68 | 3300027907 | Ga0207428_10005251 | Ga0207428_100052513 | 316 |
| 69 | 3300048911 | Ga0496108_0221932 | Ga0496108_0221932_571_1590 | 316 |
| 70 | 3300049568 | Ga0501031_0021717 | Ga0501031_0021717_2063_3079 | 316 |
| 71 | 3300049568 | Ga0501031_0029115 | Ga0501031_0029115_1539_2555 | 316 |
| 72 | 3300049572 | Ga0501036_0003168 | Ga0501036_0003168_9797_10813 | 316 |
| 73 | 3300049572 | Ga0501036_0067948 | Ga0501036_0067948_789_1805 | 316 |
| 74 | 3300049574 | Ga0501038_0032793 | Ga0501038_0032793_2384_3400 | 316 |
| 75 | 3300049575 | Ga0501039_0029009 | Ga0501039_0029009_2647_3663 | 316 |
| 76 | 3300049575 | Ga0501039_0063883 | Ga0501039_0063883_793_1809 | 316 |
| 77 | 3300049575 | Ga0501039_0134403 | Ga0501039_0134403_667_1686 | 316 |
| 78 | 3300049576 | Ga0501040_0006707 | Ga0501040_0006707_5774_6790 | 316 |
| 79 | 3300049576 | Ga0501040_0022820 | Ga0501040_0022820_976_1992 | 316 |
| 80 | 3300049578 | Ga0501042_0021347 | Ga0501042_0021347_812_1828 | 316 |
| 81 | 3300049578 | Ga0501042_0194362 | Ga0501042_0194362_432_1448 | 316 |
| 82 | 3300049579 | Ga0501043_0021406 | Ga0501043_0021406_425_1441 | 316 |
| 83 | 3300049580 | Ga0501046_0003329 | Ga0501046_0003329_622_1638 | 316 |
| 84 | 3300049582 | Ga0501048_0286447 | Ga0501048_0286447_70_1086 | 316 |
| 85 | 3300049583 | Ga0501067_0035321 | Ga0501067_0035321_920_1936 | 316 |
| 86 | 3300049584 | Ga0501068_0010703 | Ga0501068_0010703_2553_3569 | 316 |
| 87 | 3300049584 | Ga0501068_0022112 | Ga0501068_0022112_521_1537 | 316 |
| 88 | 3300049584 | Ga0501068_0132289 | Ga0501068_0132289_131_1147 | 316 |
| 89 | 3300049585 | Ga0501069_0070269 | Ga0501069_0070269_430_1446 | 316 |
| 90 | 3300049587 | Ga0501071_0015623 | Ga0501071_0015623_3001_4017 | 316 |
| 91 | 3300049587 | Ga0501071_0172254 | Ga0501071_0172254_31_1047 | 316 |
| 92 | 3300049588 | Ga0501072_0006570 | Ga0501072_0006570_5134_6150 | 316 |
| 93 | 3300049588 | Ga0501072_0110393 | Ga0501072_0110393_467_1480 | 316 |
| 94 | 3300049588 | Ga0501072_0156423 | Ga0501072_0156423_245_1261 | 316 |
| 95 | 3300049590 | Ga0501074_0006671 | Ga0501074_0006671_1507_2523 | 316 |
| 96 | 3300049590 | Ga0501074_0182621 | Ga0501074_0182621_459_1475 | 316 |
| 97 | 3300049591 | Ga0501075_0005584 | Ga0501075_0005584_5746_6762 | 316 |
| 98 | 3300049591 | Ga0501075_0117059 | Ga0501075_0117059_544_1563 | 316 |
| 99 | 3300049591 | Ga0501075_0125926 | Ga0501075_0125926_43_1059 | 316 |
| 100 | 3300049592 | Ga0501076_0094212 | Ga0501076_0094212_1123_2142 | 316 |
| 101 | 3300049592 | Ga0501076_0147835 | Ga0501076_0147835_420_1427 | 316 |
| 102 | 3300049592 | Ga0501076_0427094 | Ga0501076_0427094_31_1047 | 316 |
| 103 | 3300049593 | Ga0501077_0018272 | Ga0501077_0018272_2498_3514 | 316 |
| 104 | 3300049593 | Ga0501077_0080859 | Ga0501077_0080859_1012_2028 | 316 |
| 105 | 3300049741 | Ga0501079_0013164 | Ga0501079_0013164_4094_5110 | 316 |
| 106 | 3300049742 | Ga0501080_0067657 | Ga0501080_0067657_1260_2276 | 316 |
| 107 | 3300049743 | Ga0501081_0007123 | Ga0501081_0007123_2387_3403 | 316 |
| 108 | 3300049743 | Ga0501081_0038321 | Ga0501081_0038321_1044_2060 | 316 |
| 109 | 3300049822 | Ga0501035_0017631 | Ga0501035_0017631_4212_5228 | 316 |
| 110 | 3300049824 | Ga0501045_0045184 | Ga0501045_0045184_1539_2555 | 316 |
| 111 | 3300050507 | nmdc:mga05p37_204559_c1 | nmdc:mga05p37_204559_c1_1361_2377 | 316 |
| 112 | 3300050507 | nmdc:mga05p37_695355_c1 | nmdc:mga05p37_695355_c1_60_1076 | 316 |
| 113 | 3300050508 | nmdc:mga09592_264916_c1 | nmdc:mga09592_264916_c1_378_1391 | 316 |
| 114 | 3300050509 | nmdc:mga0qj67_87777_c1 | nmdc:mga0qj67_87777_c1_192_1205 | 316 |
| 115 | 3300050510 | nmdc:mga06r32_100635_c1 | nmdc:mga06r32_100635_c1_535_1548 | 316 |
| 116 | 3300050513 | nmdc:mga0rr50_142263_c1 | nmdc:mga0rr50_142263_c1_762_1778 | 316 |
| 117 | 3300050514 | nmdc:mga08x19_261471_c1 | nmdc:mga08x19_261471_c1_16_1032 | 316 |
| 118 | 3300050515 | nmdc:mga0a205_8555_c1 | nmdc:mga0a205_8555_c1_402_1418 | 316 |
| 119 | 3300054114 | Ga0501084_0004414 | Ga0501084_0004414_2504_3520 | 316 |
| 120 | 3300054114 | Ga0501084_0035642 | Ga0501084_0035642_1786_2802 | 316 |
| 121 | 3300054114 | Ga0501084_0243561 | Ga0501084_0243561_456_1469 | 316 |
| 122 | 3300060353 | Ga0501082_0019524 | Ga0501082_0019524_3073_4089 | 316 |
| 123 | 3300060353 | Ga0501082_0045872 | Ga0501082_0045872_500_1516 | 316 |
| 124 | 3300061734 | Ga0530510_0033362 | Ga0530510_0033362_1758_2774 | 316 |
| 125 | iso_pu_bacteria | 2869234852 | 2869240035 | 320 |
| 126 | iso_pu_bacteria | 2977971508 | 2977976288 | 320 |
| 127 | 3300005354 | Ga0070675_100054361 | Ga0070675_1000543611 | 327 |
| 128 | 3300048915 | Ga0496112_0182082 | Ga0496112_0182082_986_2041 | 327 |
| 129 | 3300028577 | Ga0265318_10039618 | Ga0265318_100396182 | 331 |
| 130 | 3300039447 | Ga0436361_0974810 | Ga0436361_0974810_35_1063 | 331 |
| 131 | 3300048903 | Ga0496100_0043880 | Ga0496100_0043880_578_1708 | 334 |
| 132 | 3300048904 | Ga0496101_0007333 | Ga0496101_0007333_160_1290 | 334 |
| 133 | 3300048917 | Ga0496114_0000962 | Ga0496114_0000962_12771_13901 | 334 |
| 134 | 3300048918 | Ga0496115_0037401 | Ga0496115_0037401_562_1692 | 334 |
| 135 | 3300044712 | Ga0453684_0239025 | Ga0453684_0239025_877_2073 | 335 |
| 136 | 3300005617 | Ga0068859_100256800 | Ga0068859_1002568002 | 337 |
| 137 | 3300006931 | Ga0097620_100256807 | Ga0097620_1002568072 | 337 |
| 138 | 3300025940 | Ga0207691_10030454 | Ga0207691_100304545 | 337 |
| 139 | 3300005331 | Ga0070670_100028366 | Ga0070670_1000283662 | 338 |
| 140 | 3300028800 | Ga0265338_10001695 | Ga0265338_1000169526 | 339 |
| 141 | 3300001979 | JGI24740J21852_10000015 | JGI24740J21852_1000001539 | 340 |
| 142 | 3300002737 | JGI25162J39368_1000368 | JGI25162J39368_100036824 | 340 |
| 143 | 3300003214 | JGI25165J46597_1000516 | JGI25165J46597_100051610 | 340 |
| 144 | 3300003322 | rootL2_10006964 | rootL2_100069645 | 340 |
| 145 | 3300005614 | Ga0068856_100013130 | Ga0068856_1000131304 | 340 |
| 146 | 3300006931 | Ga0097620_100468647 | Ga0097620_1004686472 | 340 |
| 147 | 3300025233 | Ga0209437_100098 | Ga0209437_100098171 | 340 |
| 148 | 3300025261 | Ga0209233_1000095 | Ga0209233_1000095288 | 340 |
| 149 | 3300025272 | Ga0209455_1014510 | Ga0209455_10145102 | 340 |
| 150 | 3300048925 | Ga0496122_0010294 | Ga0496122_0010294_2186_3307 | 340 |
| 151 | 3300003322 | rootL2_10022274 | rootL2_100222744 | 341 |
| 152 | 3300006177 | Ga0075362_10013866 | Ga0075362_100138663 | 341 |
| 153 | 3300028563 | Ga0265319_1007656 | Ga0265319_10076563 | 341 |
| 154 | 3300028577 | Ga0265318_10000206 | Ga0265318_1000020611 | 341 |
| 155 | 3300031235 | Ga0265330_10003483 | Ga0265330_100034834 | 341 |
| 156 | 3300031238 | Ga0265332_10004106 | Ga0265332_100041065 | 341 |
| 157 | 3300031239 | Ga0265328_10000435 | Ga0265328_100004355 | 341 |
| 158 | 3300031240 | Ga0265320_10002191 | Ga0265320_1000219110 | 341 |
| 159 | 3300031242 | Ga0265329_10000781 | Ga0265329_1000078112 | 341 |
| 160 | 3300031344 | Ga0265316_10005524 | Ga0265316_100055247 | 341 |
| 161 | 3300031595 | Ga0265313_10015661 | Ga0265313_100156614 | 341 |
| 162 | 3300031711 | Ga0265314_10005244 | Ga0265314_100052443 | 341 |
| 163 | 3300031712 | Ga0265342_10002774 | Ga0265342_100027744 | 341 |
| 164 | 3300048927 | Ga0496124_0100368 | Ga0496124_0100368_1247_2305 | 341 |
| 165 | 3300050489 | nmdc:mga03683_1625_c2 | nmdc:mga03683_1625_c2_566_1744 | 341 |
| 166 | iso_pu_bacteria | 646564506 | 646814839 | 341 |
| 167 | 3300002737 | JGI25162J39368_1000366 | JGI25162J39368_100036626 | 342 |
| 168 | 3300003214 | JGI25165J46597_1001042 | JGI25165J46597_100104211 | 342 |
| 169 | 3300003791 | Ga0055530_10003980 | Ga0055530_100039806 | 342 |
| 170 | 3300025233 | Ga0209437_100051 | Ga0209437_100051331 | 342 |
| 171 | 3300025261 | Ga0209233_1000113 | Ga0209233_100011312 | 342 |
| 172 | 3300025298 | Ga0209050_1000908 | Ga0209050_100090811 | 342 |
| 173 | 3300032004 | Ga0307414_10163823 | Ga0307414_101638232 | 342 |
| 174 | 3300039437 | Ga0436365_0842412 | Ga0436365_0842412_1027_2127 | 342 |
| 175 | 3300046558 | Ga0495633_0002890 | Ga0495633_0002890_2711_3820 | 342 |
| 176 | 3300053153 | Ga0500616_0001109 | Ga0500616_0001109_11014_12147 | 342 |
| 177 | 3300002704 | JGI25155J39150_1000001 | JGI25155J39150_1000001289 | 343 |
| 178 | 3300002705 | JGI25156J39149_1000001 | JGI25156J39149_100000144 | 343 |
| 179 | 3300002738 | JGI25154J39366_1000122 | JGI25154J39366_100012213 | 343 |
| 180 | 3300002741 | JGI25157J39369_1000044 | JGI25157J39369_100004443 | 343 |
| 181 | 3300003214 | JGI25165J46597_1009070 | JGI25165J46597_10090702 | 343 |
| 182 | 3300005548 | Ga0070665_100042535 | Ga0070665_1000425353 | 343 |
| 183 | 3300005616 | Ga0068852_100248618 | Ga0068852_1002486182 | 343 |
| 184 | 3300006353 | Ga0075370_10017996 | Ga0075370_100179963 | 343 |
| 185 | 3300009093 | Ga0105240_10000076 | Ga0105240_10000076158 | 343 |
| 186 | 3300009148 | Ga0105243_10176018 | Ga0105243_101760182 | 343 |
| 187 | 3300009545 | Ga0105237_10000226 | Ga0105237_1000022637 | 343 |
| 188 | 3300010375 | Ga0105239_10000641 | Ga0105239_100006419 | 343 |
| 189 | 3300013104 | Ga0157370_10000455 | Ga0157370_1000045539 | 343 |
| 190 | 3300013105 | Ga0157369_10377473 | Ga0157369_103774731 | 343 |
| 191 | 3300015262 | Ga0182007_10001815 | Ga0182007_1000181510 | 343 |
| 192 | 3300015265 | Ga0182005_1004710 | Ga0182005_10047102 | 343 |
| 193 | 3300025206 | Ga0209435_100012 | Ga0209435_100012340 | 343 |
| 194 | 3300025246 | Ga0209646_1000026 | Ga0209646_1000026340 | 343 |
| 195 | 3300025250 | Ga0209026_1000014 | Ga0209026_1000014340 | 343 |
| 196 | 3300025253 | Ga0209677_101925 | Ga0209677_1019254 | 343 |
| 197 | 3300025256 | Ga0209759_1000012 | Ga0209759_1000012340 | 343 |
| 198 | 3300025261 | Ga0209233_1000427 | Ga0209233_10004277 | 343 |
| 199 | 3300025913 | Ga0207695_10000011 | Ga0207695_1000001143 | 343 |
| 200 | 3300025914 | Ga0207671_10000093 | Ga0207671_1000009389 | 343 |
| 201 | 3300025981 | Ga0207640_10072226 | Ga0207640_100722262 | 343 |
| 202 | 3300026142 | Ga0207698_10262390 | Ga0207698_102623902 | 343 |
| 203 | 3300028379 | Ga0268266_10030607 | Ga0268266_100306072 | 343 |
| 204 | 3300028563 | Ga0265319_1002859 | Ga0265319_10028594 | 343 |
| 205 | 3300031250 | Ga0265331_10002350 | Ga0265331_1000235010 | 343 |
| 206 | 3300031344 | Ga0265316_10156506 | Ga0265316_101565062 | 343 |
| 207 | 3300031712 | Ga0265342_10059285 | Ga0265342_100592853 | 343 |
| 208 | 3300039062 | Ga0400483_084393 | Ga0400483_084393_695_1780 | 343 |
| 209 | 3300044765 | Ga0466970_0005945 | Ga0466970_0005945_3866_4987 | 343 |
| 210 | 3300044842 | Ga0466957_0066171 | Ga0466957_0066171_1033_2154 | 343 |
| 211 | 3300045976 | Ga0466967_0031036 | Ga0466967_0031036_2074_3195 | 343 |
| 212 | 3300048919 | Ga0496116_0009760 | Ga0496116_0009760_1487_2608 | 343 |
| 213 | 3300048920 | Ga0496117_0001574 | Ga0496117_0001574_12741_13862 | 343 |
| 214 | 3300048921 | Ga0496118_0003357 | Ga0496118_0003357_1354_2475 | 343 |
| 215 | 3300048922 | Ga0496119_0022330 | Ga0496119_0022330_1446_2567 | 343 |
| 216 | 3300048923 | Ga0496120_0020008 | Ga0496120_0020008_686_1807 | 343 |
| 217 | 3300048924 | Ga0496121_0002536 | Ga0496121_0002536_24656_25777 | 343 |
| 218 | 3300048925 | Ga0496122_0047411 | Ga0496122_0047411_2037_3158 | 343 |
| 219 | 3300048927 | Ga0496124_0149850 | Ga0496124_0149850_449_1570 | 343 |
| 220 | 3300048929 | Ga0496126_0061773 | Ga0496126_0061773_2034_3155 | 343 |
| 221 | 3300053153 | Ga0500616_0062010 | Ga0500616_0062010_411_1517 | 343 |
| 222 | 3300005344 | Ga0070661_100008418 | Ga0070661_1000084186 | 344 |
| 223 | 3300005539 | Ga0068853_100001593 | Ga0068853_1000015939 | 344 |
| 224 | 3300005616 | Ga0068852_100093576 | Ga0068852_1000935761 | 344 |
| 225 | 3300005834 | Ga0068851_10001703 | Ga0068851_100017033 | 344 |
| 226 | 3300009545 | Ga0105237_10089906 | Ga0105237_100899062 | 344 |
| 227 | 3300009551 | Ga0105238_10017174 | Ga0105238_100171743 | 344 |
| 228 | 3300010375 | Ga0105239_10074698 | Ga0105239_100746983 | 344 |
| 229 | 3300025321 | Ga0207656_10000915 | Ga0207656_100009157 | 344 |
| 230 | 3300025914 | Ga0207671_10066354 | Ga0207671_100663542 | 344 |
| 231 | 3300025920 | Ga0207649_10003204 | Ga0207649_100032043 | 344 |
| 232 | 3300025924 | Ga0207694_10137643 | Ga0207694_101376432 | 344 |
| 233 | 3300025981 | Ga0207640_10058755 | Ga0207640_100587552 | 344 |
| 234 | 3300026041 | Ga0207639_10001696 | Ga0207639_100016969 | 344 |
| 235 | 3300026142 | Ga0207698_10020535 | Ga0207698_100205353 | 344 |
| 236 | 3300050493 | nmdc:mga0k408_74905_c1 | nmdc:mga0k408_74905_c1_832_1965 | 344 |
| 237 | 3300053102 | Ga0500554_043963 | Ga0500554_043963_17_1084 | 344 |
| 238 | 3300028379 | Ga0268266_10378352 | Ga0268266_103783521 | 345 |
| 239 | 3300031712 | Ga0265342_10014643 | Ga0265342_100146432 | 345 |
| 240 | 3300026095 | Ga0207676_10367245 | Ga0207676_103672451 | 346 |
| 241 | 3300039447 | Ga0436361_0998006 | Ga0436361_0998006_511_1623 | 346 |
| 242 | 3300044712 | Ga0453684_0139638 | Ga0453684_0139638_1100_2350 | 346 |
| 243 | 3300049583 | Ga0501067_0011338 | Ga0501067_0011338_1979_3064 | 347 |
| 244 | 3300005843 | Ga0068860_100000183 | Ga0068860_10000018398 | 348 |
| 245 | 3300028381 | Ga0268264_10000476 | Ga0268264_1000047645 | 348 |
| 246 | 3300028563 | Ga0265319_1010597 | Ga0265319_10105972 | 348 |
| 247 | 3300031240 | Ga0265320_10010969 | Ga0265320_100109692 | 348 |
| 248 | 3300053122 | Ga0500608_000259 | Ga0500608_000259_6956_8068 | 348 |
| 249 | 3300005544 | Ga0070686_100079093 | Ga0070686_1000790931 | 350 |
| 250 | 3300005616 | Ga0068852_100184323 | Ga0068852_1001843232 | 350 |
| 251 | 3300005617 | Ga0068859_100002560 | Ga0068859_10000256010 | 350 |
| 252 | 3300005719 | Ga0068861_100018208 | Ga0068861_1000182082 | 350 |
| 253 | 3300006931 | Ga0097620_100002560 | Ga0097620_10000256010 | 350 |
| 254 | 3300009551 | Ga0105238_10003533 | Ga0105238_1000353311 | 350 |
| 255 | 3300025949 | Ga0207667_10057794 | Ga0207667_100577943 | 350 |
| 256 | 3300026023 | Ga0207677_10201146 | Ga0207677_102011462 | 350 |
| 257 | 3300026041 | Ga0207639_10082103 | Ga0207639_100821031 | 350 |
| 258 | 3300026118 | Ga0207675_100049032 | Ga0207675_1000490324 | 350 |
| 259 | 3300031712 | Ga0265342_10058665 | Ga0265342_100586652 | 350 |
| 260 | iso_pu_bacteria | 2643221574 | 2643884313 | 350 |
| 261 | iso_pu_bacteria | 2643221663 | 2644352792 | 350 |
| 262 | iso_pu_bacteria | 2643221699 | 2644548737 | 350 |
| 263 | iso_pu_bacteria | 2928972540 | 2928972901 | 350 |
| 264 | iso_pu_bacteria | 2941485952 | 2941486787 | 350 |
| 265 | iso_pu_bacteria | 2977240413 | 2977242681 | 350 |
| 266 | 3300005328 | Ga0070676_10023523 | Ga0070676_100235232 | 351 |
| 267 | 3300005329 | Ga0070683_100005576 | Ga0070683_1000055762 | 351 |
| 268 | 3300005330 | Ga0070690_100100785 | Ga0070690_1001007852 | 351 |
| 269 | 3300005338 | Ga0068868_100055855 | Ga0068868_1000558552 | 351 |
| 270 | 3300005343 | Ga0070687_100005675 | Ga0070687_1000056752 | 351 |
| 271 | 3300005347 | Ga0070668_100002911 | Ga0070668_10000291111 | 351 |
| 272 | 3300005354 | Ga0070675_100068867 | Ga0070675_1000688672 | 351 |
| 273 | 3300005364 | Ga0070673_100002651 | Ga0070673_1000026514 | 351 |
| 274 | 3300005367 | Ga0070667_100267968 | Ga0070667_1002679682 | 351 |
| 275 | 3300005444 | Ga0070694_100142608 | Ga0070694_1001426082 | 351 |
| 276 | 3300005459 | Ga0068867_100010186 | Ga0068867_1000101864 | 351 |
| 277 | 3300005535 | Ga0070684_100073099 | Ga0070684_1000730992 | 351 |
| 278 | 3300005616 | Ga0068852_100010318 | Ga0068852_1000103185 | 351 |
| 279 | 3300005719 | Ga0068861_100040524 | Ga0068861_1000405241 | 351 |
| 280 | 3300005841 | Ga0068863_100016803 | Ga0068863_1000168032 | 351 |
| 281 | 3300005842 | Ga0068858_100088823 | Ga0068858_1000888231 | 351 |
| 282 | 3300006881 | Ga0068865_100007748 | Ga0068865_1000077485 | 351 |
| 283 | 3300009094 | Ga0111539_10074239 | Ga0111539_100742393 | 351 |
| 284 | 3300009148 | Ga0105243_10186964 | Ga0105243_101869642 | 351 |
| 285 | 3300013297 | Ga0157378_10047506 | Ga0157378_100475062 | 351 |
| 286 | 3300013308 | Ga0157375_10180529 | Ga0157375_101805292 | 351 |
| 287 | 3300025315 | Ga0207697_10031978 | Ga0207697_100319782 | 351 |
| 288 | 3300025321 | Ga0207656_10079580 | Ga0207656_100795802 | 351 |
| 289 | 3300025885 | Ga0207653_10037193 | Ga0207653_100371932 | 351 |
| 290 | 3300025901 | Ga0207688_10047884 | Ga0207688_100478842 | 351 |
| 291 | 3300025907 | Ga0207645_10001505 | Ga0207645_1000150514 | 351 |
| 292 | 3300025918 | Ga0207662_10009356 | Ga0207662_100093564 | 351 |
| 293 | 3300025923 | Ga0207681_10006107 | Ga0207681_100061073 | 351 |
| 294 | 3300025926 | Ga0207659_10059779 | Ga0207659_100597792 | 351 |
| 295 | 3300025936 | Ga0207670_10034359 | Ga0207670_100343592 | 351 |
| 296 | 3300025936 | Ga0207670_10054411 | Ga0207670_100544112 | 351 |
| 297 | 3300025937 | Ga0207669_10046066 | Ga0207669_100460662 | 351 |
| 298 | 3300025938 | Ga0207704_10004070 | Ga0207704_100040702 | 351 |
| 299 | 3300025940 | Ga0207691_10009401 | Ga0207691_100094015 | 351 |
| 300 | 3300025940 | Ga0207691_10018799 | Ga0207691_100187992 | 351 |
| 301 | 3300025944 | Ga0207661_10013261 | Ga0207661_100132614 | 351 |
| 302 | 3300025960 | Ga0207651_10002477 | Ga0207651_100024772 | 351 |
| 303 | 3300025972 | Ga0207668_10018441 | Ga0207668_100184413 | 351 |
| 304 | 3300026075 | Ga0207708_10008534 | Ga0207708_100085342 | 351 |
| 305 | 3300026088 | Ga0207641_10040754 | Ga0207641_100407542 | 351 |
| 306 | 3300026089 | Ga0207648_10009328 | Ga0207648_100093286 | 351 |
| 307 | 3300026118 | Ga0207675_100065731 | Ga0207675_1000657313 | 351 |
| 308 | 3300026142 | Ga0207698_10080084 | Ga0207698_100800842 | 351 |
| 309 | 3300028381 | Ga0268264_10185483 | Ga0268264_101854832 | 351 |
| 310 | 3300037068 | Ga0373925_0098230 | Ga0373925_0098230_521_1651 | 351 |
| 311 | 3300042876 | Ga0451577_0000027 | Ga0451577_0000027_120488_121738 | 351 |
| 312 | 3300042876 | Ga0451577_0002562 | Ga0451577_0002562_19945_21195 | 351 |
| 313 | 3300042876 | Ga0451577_0059473 | Ga0451577_0059473_725_1975 | 351 |
| 314 | 3300044673 | Ga0453683_0000022 | Ga0453683_0000022_252852_254102 | 351 |
| 315 | 3300044673 | Ga0453683_0000146 | Ga0453683_0000146_96849_98099 | 351 |
| 316 | 3300044673 | Ga0453683_0020622 | Ga0453683_0020622_2024_3274 | 351 |
| 317 | 3300044673 | Ga0453683_0090655 | Ga0453683_0090655_135_1385 | 351 |
| 318 | 3300044712 | Ga0453684_0000154 | Ga0453684_0000154_28536_29786 | 351 |
| 319 | 3300044712 | Ga0453684_0000213 | Ga0453684_0000213_209119_210369 | 351 |
| 320 | 3300044712 | Ga0453684_0000846 | Ga0453684_0000846_69725_70975 | 351 |
| 321 | 3300044712 | Ga0453684_0133152 | Ga0453684_0133152_199_1449 | 351 |
| 322 | 3300044712 | Ga0453684_0135017 | Ga0453684_0135017_852_2102 | 351 |
| 323 | 3300045051 | Ga0451576_0000032 | Ga0451576_0000032_275277_276527 | 351 |
| 324 | 3300045051 | Ga0451576_0000175 | Ga0451576_0000175_128476_129726 | 351 |
| 325 | 3300045051 | Ga0451576_0011426 | Ga0451576_0011426_6209_7459 | 351 |
| 326 | 3300045051 | Ga0451576_0013758 | Ga0451576_0013758_1880_3130 | 351 |
| 327 | 3300045051 | Ga0451576_0341613 | Ga0451576_0341613_287_1417 | 351 |
| 328 | 3300046517 | Ga0495630_0011311 | Ga0495630_0011311_2462_3592 | 351 |
| 329 | 3300047319 | Ga0495674_0008997 | Ga0495674_0008997_902_2032 | 351 |
| 330 | 3300047472 | Ga0495686_0000025 | Ga0495686_0000025_206589_207728 | 351 |
| 331 | 3300048904 | Ga0496101_0227588 | Ga0496101_0227588_301_1431 | 351 |
| 332 | 3300048911 | Ga0496108_0098416 | Ga0496108_0098416_177_1307 | 351 |
| 333 | 3300048912 | Ga0496109_0100563 | Ga0496109_0100563_1448_2578 | 351 |
| 334 | 3300053077 | Ga0495601_0037547 | Ga0495601_0037547_1416_2546 | 351 |
| 335 | iso_pu_bacteria | 2503198000 | 2503201572 | 351 |
| 336 | iso_pu_bacteria | 2508501122 | 2509108400 | 351 |
| 337 | iso_pu_bacteria | 2508501123 | 2509113171 | 351 |
| 338 | iso_pu_bacteria | 2508501127 | 2509143270 | 351 |
| 339 | iso_pu_bacteria | 2509276018 | 2509367789 | 351 |
| 340 | iso_pu_bacteria | 2509276019 | 2509376467 | 351 |
| 341 | iso_pu_bacteria | 2509276021 | 2509392060 | 351 |
| 342 | iso_pu_bacteria | 2509276022 | 2509396344 | 351 |
| 343 | iso_pu_bacteria | 2509276033 | 2509445651 | 351 |
| 344 | iso_pu_bacteria | 2509276033 | 2509447048 | 351 |
| 345 | iso_pu_bacteria | 2510065019 | 2510133950 | 351 |
| 346 | iso_pu_bacteria | 2510065057 | 2510306451 | 351 |
| 347 | iso_pu_bacteria | 2510065059 | 2510315465 | 351 |
| 348 | iso_pu_bacteria | 2510461069 | 2510841899 | 351 |
| 349 | iso_pu_bacteria | 2510461076 | 2510895368 | 351 |
| 350 | iso_pu_bacteria | 2510917020 | 2511125297 | 351 |
| 351 | iso_pu_bacteria | 2510917022 | 2511135397 | 351 |
| 352 | iso_pu_bacteria | 2510917026 | 2511170666 | 351 |
| 353 | iso_pu_bacteria | 2510917028 | 2511187050 | 351 |
| 354 | iso_pu_bacteria | 2510917030 | 2511199024 | 351 |
| 355 | iso_pu_bacteria | 2511231027 | 2511389852 | 351 |
| 356 | iso_pu_bacteria | 2511231052 | 2511502241 | 351 |
| 357 | iso_pu_bacteria | 2512047086 | 2512533614 | 351 |
| 358 | iso_pu_bacteria | 2512875016 | 2512931458 | 351 |
| 359 | iso_pu_bacteria | 2512875024 | 2512959292 | 351 |
| 360 | iso_pu_bacteria | 2512875026 | 2512970697 | 351 |
| 361 | iso_pu_bacteria | 2513237084 | 2513567977 | 351 |
| 362 | iso_pu_bacteria | 2513237085 | 2513576937 | 351 |
| 363 | iso_pu_bacteria | 2513237086 | 2513584387 | 351 |
| 364 | iso_pu_bacteria | 2513237088 | 2513596470 | 351 |
| 365 | iso_pu_bacteria | 2513237089 | 2513604259 | 351 |
| 366 | iso_pu_bacteria | 2513237090 | 2513612757 | 351 |
| 367 | iso_pu_bacteria | 2513237091 | 2513618801 | 351 |
| 368 | iso_pu_bacteria | 2513237093 | 2513633391 | 351 |
| 369 | iso_pu_bacteria | 2513237103 | 2513708053 | 351 |
| 370 | iso_pu_bacteria | 2513237138 | 2513865595 | 351 |
| 371 | iso_pu_bacteria | 2513237140 | 2513884408 | 351 |
| 372 | iso_pu_bacteria | 2513237143 | 2513905006 | 351 |
| 373 | iso_pu_bacteria | 2513237144 | 2513909006 | 351 |
| 374 | iso_pu_bacteria | 2513237146 | 2513925388 | 351 |
| 375 | iso_pu_bacteria | 2513237156 | 2513986828 | 351 |
| 376 | iso_pu_bacteria | 2513237159 | 2514001507 | 351 |
| 377 | iso_pu_bacteria | 2513237160 | 2514006392 | 351 |
| 378 | iso_pu_bacteria | 2513237162 | 2514020012 | 351 |
| 379 | iso_pu_bacteria | 2513237164 | 2514033662 | 351 |
| 380 | iso_pu_bacteria | 2513237305 | 2514421513 | 351 |
| 381 | iso_pu_bacteria | 2513237351 | 2514589234 | 351 |
| 382 | iso_pu_bacteria | 2515075009 | 2515112999 | 351 |
| 383 | iso_pu_bacteria | 2515154107 | 2515609017 | 351 |
| 384 | iso_pu_bacteria | 2515154113 | 2515638509 | 351 |
| 385 | iso_pu_bacteria | 2515154114 | 2515640958 | 351 |
| 386 | iso_pu_bacteria | 2515154116 | 2515655360 | 351 |
| 387 | iso_pu_bacteria | 2515154134 | 2515739477 | 351 |
| 388 | iso_pu_bacteria | 2516143018 | 2516204141 | 351 |
| 389 | iso_pu_bacteria | 2516653046 | 2516893620 | 351 |
| 390 | iso_pu_bacteria | 2516653077 | 2517036699 | 351 |
| 391 | iso_pu_bacteria | 2516653085 | 2517077058 | 351 |
| 392 | iso_pu_bacteria | 2517093000 | 2517095826 | 351 |
| 393 | iso_pu_bacteria | 2517287029 | 2517407398 | 351 |
| 394 | iso_pu_bacteria | 2517487022 | 2517570332 | 351 |
| 395 | iso_pu_bacteria | 2519899620 | 2520380516 | 351 |
| 396 | iso_pu_bacteria | 2523231067 | 2523470734 | 351 |
| 397 | iso_pu_bacteria | 2524023207 | 2524448559 | 351 |
| 398 | iso_pu_bacteria | 2524023209 | 2524459584 | 351 |
| 399 | iso_pu_bacteria | 2529292951 | 2530645958 | 351 |
| 400 | iso_pu_bacteria | 2534681786 | 2535485134 | 351 |
| 401 | iso_pu_bacteria | 2534681796 | 2535516861 | 351 |
| 402 | iso_pu_bacteria | 2537561587 | 2537875438 | 351 |
| 403 | iso_pu_bacteria | 2551306084 | 2551674547 | 351 |
| 404 | iso_pu_bacteria | 2551306084 | 2551677928 | 351 |
| 405 | iso_pu_bacteria | 2551306085 | 2551687741 | 351 |
| 406 | iso_pu_bacteria | 2551306086 | 2551691430 | 351 |
| 407 | iso_pu_bacteria | 2551306087 | 2551700538 | 351 |
| 408 | iso_pu_bacteria | 2551306089 | 2551715573 | 351 |
| 409 | iso_pu_bacteria | 2551306090 | 2551715884 | 351 |
| 410 | iso_pu_bacteria | 2551306091 | 2551725515 | 351 |
| 411 | iso_pu_bacteria | 2551306092 | 2551732308 | 351 |
| 412 | iso_pu_bacteria | 2551306093 | 2551741369 | 351 |
| 413 | iso_pu_bacteria | 2554235003 | 2554248228 | 351 |
| 414 | iso_pu_bacteria | 2558860100 | 2558864466 | 351 |
| 415 | iso_pu_bacteria | 2558860242 | 2559295344 | 351 |
| 416 | iso_pu_bacteria | 2558860983 | 2561468375 | 351 |
| 417 | iso_pu_bacteria | 2582581279 | 2585150026 | 351 |
| 418 | iso_pu_bacteria | 2582581280 | 2585154817 | 351 |
| 419 | iso_pu_bacteria | 2582581283 | 2585166344 | 351 |
| 420 | iso_pu_bacteria | 2582581293 | 2585198588 | 351 |
| 421 | iso_pu_bacteria | 2582581294 | 2585202275 | 351 |
| 422 | iso_pu_bacteria | 2582581298 | 2585222827 | 351 |
| 423 | iso_pu_bacteria | 2582581299 | 2585231738 | 351 |
| 424 | iso_pu_bacteria | 2582581304 | 2585255079 | 351 |
| 425 | iso_pu_bacteria | 2582581306 | 2585267428 | 351 |
| 426 | iso_pu_bacteria | 2582581307 | 2585271134 | 351 |
| 427 | iso_pu_bacteria | 2582581308 | 2585277478 | 351 |
| 428 | iso_pu_bacteria | 2582581315 | 2585323338 | 351 |
| 429 | iso_pu_bacteria | 2582581316 | 2585331480 | 351 |
| 430 | iso_pu_bacteria | 2582581865 | 2585386496 | 351 |
| 431 | iso_pu_bacteria | 2582581866 | 2585393252 | 351 |
| 432 | iso_pu_bacteria | 2582581867 | 2585402402 | 351 |
| 433 | iso_pu_bacteria | 2585427526 | 2585527438 | 351 |
| 434 | iso_pu_bacteria | 2585427527 | 2585535105 | 351 |
| 435 | iso_pu_bacteria | 2585427528 | 2585538179 | 351 |
| 436 | iso_pu_bacteria | 2585427529 | 2585545410 | 351 |
| 437 | iso_pu_bacteria | 2585427530 | 2585555955 | 351 |
| 438 | iso_pu_bacteria | 2585427531 | 2585558858 | 351 |
| 439 | iso_pu_bacteria | 2585427590 | 2585822911 | 351 |
| 440 | iso_pu_bacteria | 2585427593 | 2585836128 | 351 |
| 441 | iso_pu_bacteria | 2585427594 | 2585843222 | 351 |
| 442 | iso_pu_bacteria | 2585427608 | 2585898240 | 351 |
| 443 | iso_pu_bacteria | 2585427609 | 2585904172 | 351 |
| 444 | iso_pu_bacteria | 2585427633 | 2585996199 | 351 |
| 445 | iso_pu_bacteria | 2585427634 | 2586000809 | 351 |
| 446 | iso_pu_bacteria | 2585428106 | 2587919248 | 351 |
| 447 | iso_pu_bacteria | 2585428125 | 2587980711 | 351 |
| 448 | iso_pu_bacteria | 2588253730 | 2588517296 | 351 |
| 449 | iso_pu_bacteria | 2597489875 | 2597813196 | 351 |
| 450 | iso_pu_bacteria | 2599185156 | 2599331747 | 351 |
| 451 | iso_pu_bacteria | 2599185170 | 2599417304 | 351 |
| 452 | iso_pu_bacteria | 2599185210 | 2599601656 | 351 |
| 453 | iso_pu_bacteria | 2599185236 | 2599721916 | 351 |
| 454 | iso_pu_bacteria | 2599185301 | 2599936717 | 351 |
| 455 | iso_pu_bacteria | 2599185352 | 2600194389 | 351 |
| 456 | iso_pu_bacteria | 2600254933 | 2600374363 | 351 |
| 457 | iso_pu_bacteria | 2600255279 | 2601610084 | 351 |
| 458 | iso_pu_bacteria | 2600255308 | 2601746859 | 351 |
| 459 | iso_pu_bacteria | 2615840624 | 2616293369 | 351 |
| 460 | iso_pu_bacteria | 2615840626 | 2616308953 | 351 |
| 461 | iso_pu_bacteria | 2615840698 | 2616554224 | 351 |
| 462 | iso_pu_bacteria | 2617270742 | 2617384722 | 351 |
| 463 | iso_pu_bacteria | 2643221545 | 2643748030 | 351 |
| 464 | iso_pu_bacteria | 2643221550 | 2643771085 | 351 |
| 465 | iso_pu_bacteria | 2643221551 | 2643776089 | 351 |
| 466 | iso_pu_bacteria | 2643221552 | 2643781629 | 351 |
| 467 | iso_pu_bacteria | 2643221555 | 2643794536 | 351 |
| 468 | iso_pu_bacteria | 2643221557 | 2643803092 | 351 |
| 469 | iso_pu_bacteria | 2643221558 | 2643811536 | 351 |
| 470 | iso_pu_bacteria | 2643221564 | 2643840044 | 351 |
| 471 | iso_pu_bacteria | 2643221568 | 2643856775 | 351 |
| 472 | iso_pu_bacteria | 2643221582 | 2643920348 | 351 |
| 473 | iso_pu_bacteria | 2643221583 | 2643923688 | 351 |
| 474 | iso_pu_bacteria | 2643221584 | 2643928304 | 351 |
| 475 | iso_pu_bacteria | 2643221595 | 2643984435 | 351 |
| 476 | iso_pu_bacteria | 2643221599 | 2644003162 | 351 |
| 477 | iso_pu_bacteria | 2643221607 | 2644050523 | 351 |
| 478 | iso_pu_bacteria | 2643221618 | 2644107283 | 351 |
| 479 | iso_pu_bacteria | 2643221623 | 2644129350 | 351 |
| 480 | iso_pu_bacteria | 2643221626 | 2644150849 | 351 |
| 481 | iso_pu_bacteria | 2643221627 | 2644153292 | 351 |
| 482 | iso_pu_bacteria | 2643221629 | 2644166900 | 351 |
| 483 | iso_pu_bacteria | 2643221634 | 2644193504 | 351 |
| 484 | iso_pu_bacteria | 2643221636 | 2644205751 | 351 |
| 485 | iso_pu_bacteria | 2643221637 | 2644209033 | 351 |
| 486 | iso_pu_bacteria | 2643221640 | 2644225077 | 351 |
| 487 | iso_pu_bacteria | 2643221642 | 2644232385 | 351 |
| 488 | iso_pu_bacteria | 2643221643 | 2644238684 | 351 |
| 489 | iso_pu_bacteria | 2643221653 | 2644298666 | 351 |
| 490 | iso_pu_bacteria | 2643221655 | 2644308678 | 351 |
| 491 | iso_pu_bacteria | 2643221659 | 2644335496 | 351 |
| 492 | iso_pu_bacteria | 2643221662 | 2644349414 | 351 |
| 493 | iso_pu_bacteria | 2643221674 | 2644411240 | 351 |
| 494 | iso_pu_bacteria | 2643221686 | 2644483441 | 351 |
| 495 | iso_pu_bacteria | 2643221688 | 2644492026 | 351 |
| 496 | iso_pu_bacteria | 2643221689 | 2644499652 | 351 |
| 497 | iso_pu_bacteria | 2643221691 | 2644508073 | 351 |
| 498 | iso_pu_bacteria | 2643221693 | 2644521962 | 351 |
| 499 | iso_pu_bacteria | 2643221698 | 2644539901 | 351 |
| 500 | iso_pu_bacteria | 2643221712 | 2644614619 | 351 |
| 501 | iso_pu_bacteria | 2643221718 | 2644652563 | 351 |
| 502 | iso_pu_bacteria | 2643221719 | 2644656895 | 351 |
| 503 | iso_pu_bacteria | 2643221723 | 2644676083 | 351 |
| 504 | iso_pu_bacteria | 2657244999 | 2657681557 | 351 |
| 505 | iso_pu_bacteria | 2667528174 | 2671111434 | 351 |
| 506 | iso_pu_bacteria | 2687453392 | 2688598478 | 351 |
| 507 | iso_pu_bacteria | 2690316117 | 2692315545 | 351 |
| 508 | iso_pu_bacteria | 2693429783 | 2694632941 | 351 |
| 509 | iso_pu_bacteria | 2693429784 | 2694636024 | 351 |
| 510 | iso_pu_bacteria | 2718217882 | 2719181801 | 351 |
| 511 | iso_pu_bacteria | 2718217927 | 2719386404 | 351 |
| 512 | iso_pu_bacteria | 2718217997 | 2719666152 | 351 |
| 513 | iso_pu_bacteria | 2718218009 | 2719732465 | 351 |
| 514 | iso_pu_bacteria | 2718218199 | 2720492572 | 351 |
| 515 | iso_pu_bacteria | 2718218232 | 2720614007 | 351 |
| 516 | iso_pu_bacteria | 2718218233 | 2720620812 | 351 |
| 517 | iso_pu_bacteria | 2718218235 | 2720632137 | 351 |
| 518 | iso_pu_bacteria | 2718218269 | 2720775865 | 351 |
| 519 | iso_pu_bacteria | 2718218363 | 2721147892 | 351 |
| 520 | iso_pu_bacteria | 2718218365 | 2721159343 | 351 |
| 521 | iso_pu_bacteria | 2718218366 | 2721164728 | 351 |
| 522 | iso_pu_bacteria | 2718218423 | 2721400108 | 351 |
| 523 | iso_pu_bacteria | 2721755514 | 2722840898 | 351 |
| 524 | iso_pu_bacteria | 2721755556 | 2723027469 | 351 |
| 525 | iso_pu_bacteria | 2721755684 | 2723561088 | 351 |
| 526 | iso_pu_bacteria | 2721755685 | 2723567684 | 351 |
| 527 | iso_pu_bacteria | 2721755686 | 2723575413 | 351 |
| 528 | iso_pu_bacteria | 2721755809 | 2724038921 | 351 |
| 529 | iso_pu_bacteria | 2721755810 | 2724045221 | 351 |
| 530 | iso_pu_bacteria | 2721755819 | 2724090472 | 351 |
| 531 | iso_pu_bacteria | 2721755822 | 2724104949 | 351 |
| 532 | iso_pu_bacteria | 2721755823 | 2724110808 | 351 |
| 533 | iso_pu_bacteria | 2724679232 | 2725952566 | 351 |
| 534 | iso_pu_bacteria | 2728369352 | 2730108405 | 351 |
| 535 | iso_pu_bacteria | 2728369365 | 2730165036 | 351 |
| 536 | iso_pu_bacteria | 2728369397 | 2730298975 | 351 |
| 537 | iso_pu_bacteria | 2738541293 | 2738800080 | 351 |
| 538 | iso_pu_bacteria | 2738541317 | 2738947339 | 351 |
| 539 | iso_pu_bacteria | 2738541333 | 2739032836 | 351 |
| 540 | iso_pu_bacteria | 2738543024 | 2739307196 | 351 |
| 541 | iso_pu_bacteria | 2738543031 | 2739349055 | 351 |
| 542 | iso_pu_bacteria | 2751185800 | 2753359761 | 351 |
| 543 | iso_pu_bacteria | 2751185821 | 2753462024 | 351 |
| 544 | iso_pu_bacteria | 2756170246 | 2756675433 | 351 |
| 545 | iso_pu_bacteria | 2757320392 | 2757569730 | 351 |
| 546 | iso_pu_bacteria | 2758568016 | 2758642022 | 351 |
| 547 | iso_pu_bacteria | 2765235802 | 2765464618 | 351 |
| 548 | iso_pu_bacteria | 2765235942 | 2766065864 | 351 |
| 549 | iso_pu_bacteria | 2767802442 | 2770195438 | 351 |
| 550 | iso_pu_bacteria | 2775506902 | 2776270625 | 351 |
| 551 | iso_pu_bacteria | 2775506904 | 2776280552 | 351 |
| 552 | iso_pu_bacteria | 2775507049 | 2776913920 | 351 |
| 553 | iso_pu_bacteria | 2775507266 | 2778175411 | 351 |
| 554 | iso_pu_bacteria | 2791355048 | 2792460022 | 351 |
| 555 | iso_pu_bacteria | 2791355082 | 2792585131 | 351 |
| 556 | iso_pu_bacteria | 2791355091 | 2792620775 | 351 |
| 557 | iso_pu_bacteria | 2791355092 | 2792626134 | 351 |
| 558 | iso_pu_bacteria | 2791355094 | 2792639070 | 351 |
| 559 | iso_pu_bacteria | 2791355123 | 2792749274 | 351 |
| 560 | iso_pu_bacteria | 2791355253 | 2793280308 | 351 |
| 561 | iso_pu_bacteria | 2791355256 | 2793294442 | 351 |
| 562 | iso_pu_bacteria | 2791355259 | 2793314548 | 351 |
| 563 | iso_pu_bacteria | 2791355260 | 2793320376 | 351 |
| 564 | iso_pu_bacteria | 2791355261 | 2793329545 | 351 |
| 565 | iso_pu_bacteria | 2791355262 | 2793334485 | 351 |
| 566 | iso_pu_bacteria | 2791355263 | 2793339202 | 351 |
| 567 | iso_pu_bacteria | 2791355264 | 2793348875 | 351 |
| 568 | iso_pu_bacteria | 2791355265 | 2793351837 | 351 |
| 569 | iso_pu_bacteria | 2791355266 | 2793362589 | 351 |
| 570 | iso_pu_bacteria | 2791355267 | 2793368879 | 351 |
| 571 | iso_pu_bacteria | 2802428858 | 2802720027 | 351 |
| 572 | iso_pu_bacteria | 2802428859 | 2802727040 | 351 |
| 573 | iso_pu_bacteria | 2802428860 | 2802731957 | 351 |
| 574 | iso_pu_bacteria | 2802428861 | 2802739288 | 351 |
| 575 | iso_pu_bacteria | 2802428862 | 2802745731 | 351 |
| 576 | iso_pu_bacteria | 2802428863 | 2802752332 | 351 |
| 577 | iso_pu_bacteria | 2802429268 | 2804752748 | 351 |
| 578 | iso_pu_bacteria | 2802429605 | 2805928806 | 351 |
| 579 | iso_pu_bacteria | 2802429606 | 2805935088 | 351 |
| 580 | iso_pu_bacteria | 2802429633 | 2806043816 | 351 |
| 581 | iso_pu_bacteria | 2802429634 | 2806050253 | 351 |
| 582 | iso_pu_bacteria | 2802429635 | 2806057069 | 351 |
| 583 | iso_pu_bacteria | 2802429636 | 2806064451 | 351 |
| 584 | iso_pu_bacteria | 2802429637 | 2806071718 | 351 |
| 585 | iso_pu_bacteria | 2808606387 | 2808987922 | 351 |
| 586 | iso_pu_bacteria | 2818991272 | 2819241408 | 351 |
| 587 | iso_pu_bacteria | 2818991435 | 2819539371 | 351 |
| 588 | iso_pu_bacteria | 2818991439 | 2819559057 | 351 |
| 589 | iso_pu_bacteria | 2818991448 | 2819609144 | 351 |
| 590 | iso_pu_bacteria | 2818991453 | 2819637628 | 351 |
| 591 | iso_pu_bacteria | 2818991454 | 2819647755 | 351 |
| 592 | iso_pu_bacteria | 2818991461 | 2819684907 | 351 |
| 593 | iso_pu_bacteria | 2821123053 | 2821127494 | 351 |
| 594 | iso_pu_bacteria | 2837678835 | 2837683132 | 351 |
| 595 | iso_pu_bacteria | 2838016132 | 2838017658 | 351 |
| 596 | iso_pu_bacteria | 2838022645 | 2838027541 | 351 |
| 597 | iso_pu_bacteria | 2838029111 | 2838029810 | 351 |
| 598 | iso_pu_bacteria | 2838035591 | 2838038496 | 351 |
| 599 | iso_pu_bacteria | 2838042994 | 2838043963 | 351 |
| 600 | iso_pu_bacteria | 2838048938 | 2838054391 | 351 |
| 601 | iso_pu_bacteria | 2838061910 | 2838068020 | 351 |
| 602 | iso_pu_bacteria | 2838068647 | 2838070148 | 351 |
| 603 | iso_pu_bacteria | 2838074704 | 2838076863 | 351 |
| 604 | iso_pu_bacteria | 2838661181 | 2838661593 | 351 |
| 605 | iso_pu_bacteria | 2838668709 | 2838670355 | 351 |
| 606 | iso_pu_bacteria | 2838675328 | 2838675781 | 351 |
| 607 | iso_pu_bacteria | 2838680041 | 2838683473 | 351 |
| 608 | iso_pu_bacteria | 2838686498 | 2838687060 | 351 |
| 609 | iso_pu_bacteria | 2838694306 | 2838697584 | 351 |
| 610 | iso_pu_bacteria | 2838701080 | 2838702726 | 351 |
| 611 | iso_pu_bacteria | 2838707686 | 2838710700 | 351 |
| 612 | iso_pu_bacteria | 2838714209 | 2838714663 | 351 |
| 613 | iso_pu_bacteria | 2838719591 | 2838721536 | 351 |
| 614 | iso_pu_bacteria | 2838724970 | 2838725423 | 351 |
| 615 | iso_pu_bacteria | 2838729681 | 2838729967 | 351 |
| 616 | iso_pu_bacteria | 2838736955 | 2838738018 | 351 |
| 617 | iso_pu_bacteria | 2838742623 | 2838743018 | 351 |
| 618 | iso_pu_bacteria | 2839993093 | 2839997030 | 351 |
| 619 | iso_pu_bacteria | 2840764183 | 2840767418 | 351 |
| 620 | iso_pu_bacteria | 2840878972 | 2840882920 | 351 |
| 621 | iso_pu_bacteria | 2841734538 | 2841739234 | 351 |
| 622 | iso_pu_bacteria | 2841840854 | 2841841613 | 351 |
| 623 | iso_pu_bacteria | 2841846520 | 2841848488 | 351 |
| 624 | iso_pu_bacteria | 2841851746 | 2841852504 | 351 |
| 625 | iso_pu_bacteria | 2841859092 | 2841862119 | 351 |
| 626 | iso_pu_bacteria | 2841864319 | 2841870777 | 351 |
| 627 | iso_pu_bacteria | 2842077413 | 2842078873 | 351 |
| 628 | iso_pu_bacteria | 2842110456 | 2842113275 | 351 |
| 629 | iso_pu_bacteria | 2842118031 | 2842118617 | 351 |
| 630 | iso_pu_bacteria | 2842124991 | 2842125481 | 351 |
| 631 | iso_pu_bacteria | 2842130223 | 2842130676 | 351 |
| 632 | iso_pu_bacteria | 2842140634 | 2842141391 | 351 |
| 633 | iso_pu_bacteria | 2842146304 | 2842148016 | 351 |
| 634 | iso_pu_bacteria | 2842152218 | 2842154154 | 351 |
| 635 | iso_pu_bacteria | 2842156927 | 2842158036 | 351 |
| 636 | iso_pu_bacteria | 2842163707 | 2842168800 | 351 |
| 637 | iso_pu_bacteria | 2842170452 | 2842170907 | 351 |
| 638 | iso_pu_bacteria | 2842175837 | 2842177774 | 351 |
| 639 | iso_pu_bacteria | 2842180545 | 2842181655 | 351 |
| 640 | iso_pu_bacteria | 2842187318 | 2842187772 | 351 |
| 641 | iso_pu_bacteria | 2842192696 | 2842197352 | 351 |
| 642 | iso_pu_bacteria | 2842198810 | 2842203551 | 351 |
| 643 | iso_pu_bacteria | 2842205361 | 2842205485 | 351 |
| 644 | iso_pu_bacteria | 2842211629 | 2842212083 | 351 |
| 645 | iso_pu_bacteria | 2842217011 | 2842217931 | 351 |
| 646 | iso_pu_bacteria | 2842224351 | 2842226298 | 351 |
| 647 | iso_pu_bacteria | 2842229732 | 2842230294 | 351 |
| 648 | iso_pu_bacteria | 2842237096 | 2842240529 | 351 |
| 649 | iso_pu_bacteria | 2842243621 | 2842244196 | 351 |
| 650 | iso_pu_bacteria | 2842250916 | 2842253082 | 351 |
| 651 | iso_pu_bacteria | 2842257432 | 2842257718 | 351 |
| 652 | iso_pu_bacteria | 2842264693 | 2842266261 | 351 |
| 653 | iso_pu_bacteria | 2842271015 | 2842271402 | 351 |
| 654 | iso_pu_bacteria | 2842278818 | 2842278942 | 351 |
| 655 | iso_pu_bacteria | 2842285085 | 2842285606 | 351 |
| 656 | iso_pu_bacteria | 2842291075 | 2842292535 | 351 |
| 657 | iso_pu_bacteria | 2842298080 | 2842301365 | 351 |
| 658 | iso_pu_bacteria | 2842304105 | 2842305030 | 351 |
| 659 | iso_pu_bacteria | 2842311132 | 2842314918 | 351 |
| 660 | iso_pu_bacteria | 2842317721 | 2842320704 | 351 |
| 661 | iso_pu_bacteria | 2842341865 | 2842346453 | 351 |
| 662 | iso_pu_bacteria | 2842357229 | 2842357902 | 351 |
| 663 | iso_pu_bacteria | 2842363717 | 2842368968 | 351 |
| 664 | iso_pu_bacteria | 2842370503 | 2842374104 | 351 |
| 665 | iso_pu_bacteria | 2842377471 | 2842378933 | 351 |
| 666 | iso_pu_bacteria | 2842384541 | 2842385128 | 351 |
| 667 | iso_pu_bacteria | 2842395702 | 2842399889 | 351 |
| 668 | iso_pu_bacteria | 2842402390 | 2842402966 | 351 |
| 669 | iso_pu_bacteria | 2842409023 | 2842409662 | 351 |
| 670 | iso_pu_bacteria | 2842415677 | 2842416313 | 351 |
| 671 | iso_pu_bacteria | 2842422224 | 2842423762 | 351 |
| 672 | iso_pu_bacteria | 2842428310 | 2842430724 | 351 |
| 673 | iso_pu_bacteria | 2842434925 | 2842437289 | 351 |
| 674 | iso_pu_bacteria | 2842441272 | 2842443659 | 351 |
| 675 | iso_pu_bacteria | 2842447887 | 2842454046 | 351 |
| 676 | iso_pu_bacteria | 2842462802 | 2842464867 | 351 |
| 677 | iso_pu_bacteria | 2842469257 | 2842471907 | 351 |
| 678 | iso_pu_bacteria | 2842475841 | 2842476905 | 351 |
| 679 | iso_pu_bacteria | 2842482326 | 2842484565 | 351 |
| 680 | iso_pu_bacteria | 2842489311 | 2842491972 | 351 |
| 681 | iso_pu_bacteria | 2842495871 | 2842496832 | 351 |
| 682 | iso_pu_bacteria | 2842502639 | 2842503338 | 351 |
| 683 | iso_pu_bacteria | 2842509118 | 2842511134 | 351 |
| 684 | iso_pu_bacteria | 2842515876 | 2842518903 | 351 |
| 685 | iso_pu_bacteria | 2842521101 | 2842521810 | 351 |
| 686 | iso_pu_bacteria | 2842871566 | 2842871953 | 351 |
| 687 | iso_pu_bacteria | 2842922631 | 2842924152 | 351 |
| 688 | iso_pu_bacteria | 2843744320 | 2843744386 | 351 |
| 689 | iso_pu_bacteria | 2844002411 | 2844007389 | 351 |
| 690 | iso_pu_bacteria | 2844009547 | 2844013740 | 351 |
| 691 | iso_pu_bacteria | 2844454524 | 2844458427 | 351 |
| 692 | iso_pu_bacteria | 2847417321 | 2847419393 | 351 |
| 693 | iso_pu_bacteria | 2847670302 | 2847675645 | 351 |
| 694 | iso_pu_bacteria | 2847686936 | 2847692287 | 351 |
| 695 | iso_pu_bacteria | 2848992105 | 2848994420 | 351 |
| 696 | iso_pu_bacteria | 2849560528 | 2849564970 | 351 |
| 697 | iso_pu_bacteria | 2849573788 | 2849575094 | 351 |
| 698 | iso_pu_bacteria | 2850079185 | 2850081463 | 351 |
| 699 | iso_pu_bacteria | 2851153111 | 2851155861 | 351 |
| 700 | iso_pu_bacteria | 2852387548 | 2852390220 | 351 |
| 701 | iso_pu_bacteria | 2854896431 | 2854899584 | 351 |
| 702 | iso_pu_bacteria | 2854911287 | 2854912413 | 351 |
| 703 | iso_pu_bacteria | 2854916844 | 2854918409 | 351 |
| 704 | iso_pu_bacteria | 2855020534 | 2855020588 | 351 |
| 705 | iso_pu_bacteria | 2855825444 | 2855826340 | 351 |
| 706 | iso_pu_bacteria | 2855839649 | 2855841730 | 351 |
| 707 | iso_pu_bacteria | 2855872281 | 2855872525 | 351 |
| 708 | iso_pu_bacteria | 2856314179 | 2856319531 | 351 |
| 709 | iso_pu_bacteria | 2856320880 | 2856323881 | 351 |
| 710 | iso_pu_bacteria | 2856328259 | 2856331131 | 351 |
| 711 | iso_pu_bacteria | 2856334872 | 2856340755 | 351 |
| 712 | iso_pu_bacteria | 2856342000 | 2856342650 | 351 |
| 713 | iso_pu_bacteria | 2856349417 | 2856354045 | 351 |
| 714 | iso_pu_bacteria | 2856364286 | 2856369494 | 351 |
| 715 | iso_pu_bacteria | 2857349434 | 2857351117 | 351 |
| 716 | iso_pu_bacteria | 2857504554 | 2857507522 | 351 |
| 717 | iso_pu_bacteria | 2857516855 | 2857517439 | 351 |
| 718 | iso_pu_bacteria | 2857531043 | 2857536493 | 351 |
| 719 | iso_pu_bacteria | 2858800743 | 2858802515 | 351 |
| 720 | iso_pu_bacteria | 2869162929 | 2869166907 | 351 |
| 721 | iso_pu_bacteria | 2869169390 | 2869174539 | 351 |
| 722 | iso_pu_bacteria | 2869256925 | 2869260259 | 351 |
| 723 | iso_pu_bacteria | 2869264136 | 2869269370 | 351 |
| 724 | iso_pu_bacteria | 2869271264 | 2869271486 | 351 |
| 725 | iso_pu_bacteria | 2869278585 | 2869284967 | 351 |
| 726 | iso_pu_bacteria | 2869285874 | 2869286152 | 351 |
| 727 | iso_pu_bacteria | 2871429161 | 2871434585 | 351 |
| 728 | iso_pu_bacteria | 2871451962 | 2871453250 | 351 |
| 729 | iso_pu_bacteria | 2871459585 | 2871460638 | 351 |
| 730 | iso_pu_bacteria | 2871466892 | 2871470740 | 351 |
| 731 | iso_pu_bacteria | 2871474448 | 2871480407 | 351 |
| 732 | iso_pu_bacteria | 2871481445 | 2871483511 | 351 |
| 733 | iso_pu_bacteria | 2871488783 | 2871494511 | 351 |
| 734 | iso_pu_bacteria | 2871495908 | 2871501364 | 351 |
| 735 | iso_pu_bacteria | 2874102143 | 2874106811 | 351 |
| 736 | iso_pu_bacteria | 2874109183 | 2874114180 | 351 |
| 737 | iso_pu_bacteria | 2874116593 | 2874122274 | 351 |
| 738 | iso_pu_bacteria | 2874123672 | 2874130635 | 351 |
| 739 | iso_pu_bacteria | 2874131515 | 2874136679 | 351 |
| 740 | iso_pu_bacteria | 2874139085 | 2874145909 | 351 |
| 741 | iso_pu_bacteria | 2874146452 | 2874149790 | 351 |
| 742 | iso_pu_bacteria | 2874155637 | 2874158049 | 351 |
| 743 | iso_pu_bacteria | 2874162495 | 2874167498 | 351 |
| 744 | iso_pu_bacteria | 2874168670 | 2874169896 | 351 |
| 745 | iso_pu_bacteria | 2876363079 | 2876368437 | 351 |
| 746 | iso_pu_bacteria | 2876369609 | 2876370175 | 351 |
| 747 | iso_pu_bacteria | 2876377896 | 2876379100 | 351 |
| 748 | iso_pu_bacteria | 2876386047 | 2876389924 | 351 |
| 749 | iso_pu_bacteria | 2876392853 | 2876398476 | 351 |
| 750 | iso_pu_bacteria | 2876399893 | 2876406348 | 351 |
| 751 | iso_pu_bacteria | 2876406927 | 2876413086 | 351 |
| 752 | iso_pu_bacteria | 2876413966 | 2876416253 | 351 |
| 753 | iso_pu_bacteria | 2876420981 | 2876425732 | 351 |
| 754 | iso_pu_bacteria | 2878035449 | 2878040766 | 351 |
| 755 | iso_pu_bacteria | 2878730984 | 2878732486 | 351 |
| 756 | iso_pu_bacteria | 2878738818 | 2878745252 | 351 |
| 757 | iso_pu_bacteria | 2878745973 | 2878751718 | 351 |
| 758 | iso_pu_bacteria | 2878753008 | 2878758907 | 351 |
| 759 | iso_pu_bacteria | 2878760144 | 2878765344 | 351 |
| 760 | iso_pu_bacteria | 2878767105 | 2878773051 | 351 |
| 761 | iso_pu_bacteria | 2878774303 | 2878778577 | 351 |
| 762 | iso_pu_bacteria | 2878781027 | 2878788151 | 351 |
| 763 | iso_pu_bacteria | 2878788777 | 2878794326 | 351 |
| 764 | iso_pu_bacteria | 2881147464 | 2881151552 | 351 |
| 765 | iso_pu_bacteria | 2881155292 | 2881155339 | 351 |
| 766 | iso_pu_bacteria | 2881161766 | 2881167567 | 351 |
| 767 | iso_pu_bacteria | 2881845957 | 2881847108 | 351 |
| 768 | iso_pu_bacteria | 2881853255 | 2881856829 | 351 |
| 769 | iso_pu_bacteria | 2881861095 | 2881868528 | 351 |
| 770 | iso_pu_bacteria | 2882632389 | 2882636306 | 351 |
| 771 | iso_pu_bacteria | 2884960567 | 2884960839 | 351 |
| 772 | iso_pu_bacteria | 2885305155 | 2885309468 | 351 |
| 773 | iso_pu_bacteria | 2885312484 | 2885317953 | 351 |
| 774 | iso_pu_bacteria | 2885318864 | 2885321636 | 351 |
| 775 | iso_pu_bacteria | 2885326080 | 2885331652 | 351 |
| 776 | iso_pu_bacteria | 2885334103 | 2885338390 | 351 |
| 777 | iso_pu_bacteria | 2888337043 | 2888339462 | 351 |
| 778 | iso_pu_bacteria | 2888343758 | 2888346857 | 351 |
| 779 | iso_pu_bacteria | 2888350351 | 2888355792 | 351 |
| 780 | iso_pu_bacteria | 2889010040 | 2889010733 | 351 |
| 781 | iso_pu_bacteria | 2889016732 | 2889017572 | 351 |
| 782 | iso_pu_bacteria | 2889790730 | 2889795441 | 351 |
| 783 | iso_pu_bacteria | 2889914905 | 2889919456 | 351 |
| 784 | iso_pu_bacteria | 2891048133 | 2891050861 | 351 |
| 785 | iso_pu_bacteria | 2891373044 | 2891373343 | 351 |
| 786 | iso_pu_bacteria | 2894652903 | 2894655995 | 351 |
| 787 | iso_pu_bacteria | 2894817345 | 2894820354 | 351 |
| 788 | iso_pu_bacteria | 2896384573 | 2896389030 | 351 |
| 789 | iso_pu_bacteria | 2898329390 | 2898332412 | 351 |
| 790 | iso_pu_bacteria | 2899275550 | 2899276210 | 351 |
| 791 | iso_pu_bacteria | 2899792073 | 2899796057 | 351 |
| 792 | iso_pu_bacteria | 2899803654 | 2899807273 | 351 |
| 793 | iso_pu_bacteria | 2899845264 | 2899850635 | 351 |
| 794 | iso_pu_bacteria | 2903448605 | 2903451358 | 351 |
| 795 | iso_pu_bacteria | 2903492973 | 2903503854 | 351 |
| 796 | iso_pu_bacteria | 2903492973 | 2903504663 | 351 |
| 797 | iso_pu_bacteria | 2903521522 | 2903527436 | 351 |
| 798 | iso_pu_bacteria | 2903528002 | 2903533890 | 351 |
| 799 | iso_pu_bacteria | 2903540706 | 2903546175 | 351 |
| 800 | iso_pu_bacteria | 2904578770 | 2904580621 | 351 |
| 801 | iso_pu_bacteria | 2904659560 | 2904665031 | 351 |
| 802 | iso_pu_bacteria | 2906308376 | 2906314116 | 351 |
| 803 | iso_pu_bacteria | 2906321335 | 2906327282 | 351 |
| 804 | iso_pu_bacteria | 2906328253 | 2906329975 | 351 |
| 805 | iso_pu_bacteria | 2906354277 | 2906359653 | 351 |
| 806 | iso_pu_bacteria | 2906363423 | 2906364059 | 351 |
| 807 | iso_pu_bacteria | 2906378014 | 2906378136 | 351 |
| 808 | iso_pu_bacteria | 2906393657 | 2906399236 | 351 |
| 809 | iso_pu_bacteria | 2906401398 | 2906403577 | 351 |
| 810 | iso_pu_bacteria | 2906408224 | 2906414030 | 351 |
| 811 | iso_pu_bacteria | 2906414383 | 2906420251 | 351 |
| 812 | iso_pu_bacteria | 2913295892 | 2913299315 | 351 |
| 813 | iso_pu_bacteria | 2913308742 | 2913312563 | 351 |
| 814 | iso_pu_bacteria | 2915650412 | 2915653152 | 351 |
| 815 | iso_pu_bacteria | 2915980308 | 2915981439 | 351 |
| 816 | iso_pu_bacteria | 2915986958 | 2915991443 | 351 |
| 817 | iso_pu_bacteria | 2915993759 | 2915998700 | 351 |
| 818 | iso_pu_bacteria | 2916007675 | 2916011657 | 351 |
| 819 | iso_pu_bacteria | 2916014648 | 2916020777 | 351 |
| 820 | iso_pu_bacteria | 2916021584 | 2916024958 | 351 |
| 821 | iso_pu_bacteria | 2916028427 | 2916033771 | 351 |
| 822 | iso_pu_bacteria | 2916035215 | 2916037866 | 351 |
| 823 | iso_pu_bacteria | 2916041962 | 2916045334 | 351 |
| 824 | iso_pu_bacteria | 2916048683 | 2916049042 | 351 |
| 825 | iso_pu_bacteria | 2916055098 | 2916055720 | 351 |
| 826 | iso_pu_bacteria | 2916061851 | 2916064904 | 351 |
| 827 | iso_pu_bacteria | 2916068649 | 2916073995 | 351 |
| 828 | iso_pu_bacteria | 2916076590 | 2916082598 | 351 |
| 829 | iso_pu_bacteria | 2919100787 | 2919107662 | 351 |
| 830 | iso_pu_bacteria | 2919114240 | 2919114701 | 351 |
| 831 | iso_pu_bacteria | 2919119836 | 2919121662 | 351 |
| 832 | iso_pu_bacteria | 2919166419 | 2919169238 | 351 |
| 833 | iso_pu_bacteria | 2919171160 | 2919174715 | 351 |
| 834 | iso_pu_bacteria | 2919408235 | 2919409975 | 351 |
| 835 | iso_pu_bacteria | 2920760137 | 2920761524 | 351 |
| 836 | iso_pu_bacteria | 2920822456 | 2920825210 | 351 |
| 837 | iso_pu_bacteria | 2921201388 | 2921203052 | 351 |
| 838 | iso_pu_bacteria | 2921208531 | 2921211112 | 351 |
| 839 | iso_pu_bacteria | 2921237296 | 2921240930 | 351 |
| 840 | iso_pu_bacteria | 2921244191 | 2921246774 | 351 |
| 841 | iso_pu_bacteria | 2921250672 | 2921252086 | 351 |
| 842 | iso_pu_bacteria | 2921257292 | 2921261407 | 351 |
| 843 | iso_pu_bacteria | 2921263974 | 2921266209 | 351 |
| 844 | iso_pu_bacteria | 2921282425 | 2921287975 | 351 |
| 845 | iso_pu_bacteria | 2921289301 | 2921290956 | 351 |
| 846 | iso_pu_bacteria | 2921296804 | 2921301760 | 351 |
| 847 | iso_pu_bacteria | 2922130491 | 2922132552 | 351 |
| 848 | iso_pu_bacteria | 2922158528 | 2922162868 | 351 |
| 849 | iso_pu_bacteria | 2922172374 | 2922174252 | 351 |
| 850 | iso_pu_bacteria | 2922185730 | 2922188142 | 351 |
| 851 | iso_pu_bacteria | 2923556063 | 2923558568 | 351 |
| 852 | iso_pu_bacteria | 2924144063 | 2924146754 | 351 |
| 853 | iso_pu_bacteria | 2924150972 | 2924157992 | 351 |
| 854 | iso_pu_bacteria | 2924158325 | 2924159274 | 351 |
| 855 | iso_pu_bacteria | 2924165586 | 2924169160 | 351 |
| 856 | iso_pu_bacteria | 2924172951 | 2924174569 | 351 |
| 857 | iso_pu_bacteria | 2924179722 | 2924183000 | 351 |
| 858 | iso_pu_bacteria | 2924186466 | 2924192711 | 351 |
| 859 | iso_pu_bacteria | 2924193448 | 2924195384 | 351 |
| 860 | iso_pu_bacteria | 2924200457 | 2924203325 | 351 |
| 861 | iso_pu_bacteria | 2924207177 | 2924210744 | 351 |
| 862 | iso_pu_bacteria | 2924221636 | 2924223294 | 351 |
| 863 | iso_pu_bacteria | 2924228884 | 2924230520 | 351 |
| 864 | iso_pu_bacteria | 2924710171 | 2924711103 | 351 |
| 865 | iso_pu_bacteria | 2924718760 | 2924719241 | 351 |
| 866 | iso_pu_bacteria | 2924726620 | 2924728545 | 351 |
| 867 | iso_pu_bacteria | 2924733363 | 2924736404 | 351 |
| 868 | iso_pu_bacteria | 2924741084 | 2924745874 | 351 |
| 869 | iso_pu_bacteria | 2924754689 | 2924757252 | 351 |
| 870 | iso_pu_bacteria | 2924762789 | 2924764213 | 351 |
| 871 | iso_pu_bacteria | 2924776078 | 2924783389 | 351 |
| 872 | iso_pu_bacteria | 2924784321 | 2924789111 | 351 |
| 873 | iso_pu_bacteria | 2926754445 | 2926755717 | 351 |
| 874 | iso_pu_bacteria | 2926760298 | 2926762832 | 351 |
| 875 | iso_pu_bacteria | 2928521798 | 2928523877 | 351 |
| 876 | iso_pu_bacteria | 2928531327 | 2928534176 | 351 |
| 877 | iso_pu_bacteria | 2929138655 | 2929140866 | 351 |
| 878 | iso_pu_bacteria | 2932401849 | 2932402717 | 351 |
| 879 | iso_pu_bacteria | 2933006813 | 2933008799 | 351 |
| 880 | iso_pu_bacteria | 2933011516 | 2933014923 | 351 |
| 881 | iso_pu_bacteria | 2933016740 | 2933022326 | 351 |
| 882 | iso_pu_bacteria | 2933570622 | 2933570838 | 351 |
| 883 | iso_pu_bacteria | 2933586486 | 2933588669 | 351 |
| 884 | iso_pu_bacteria | 2933594066 | 2933596600 | 351 |
| 885 | iso_pu_bacteria | 2933599457 | 2933600954 | 351 |
| 886 | iso_pu_bacteria | 2935894831 | 2935897031 | 351 |
| 887 | iso_pu_bacteria | 2935901341 | 2935901964 | 351 |
| 888 | iso_pu_bacteria | 2936367885 | 2936372043 | 351 |
| 889 | iso_pu_bacteria | 2936375103 | 2936379906 | 351 |
| 890 | iso_pu_bacteria | 2936381700 | 2936382810 | 351 |
| 891 | iso_pu_bacteria | 2936996657 | 2937000704 | 351 |
| 892 | iso_pu_bacteria | 2937002841 | 2937004560 | 351 |
| 893 | iso_pu_bacteria | 2937009748 | 2937011196 | 351 |
| 894 | iso_pu_bacteria | 2937016420 | 2937019825 | 351 |
| 895 | iso_pu_bacteria | 2937023124 | 2937024582 | 351 |
| 896 | iso_pu_bacteria | 2937029754 | 2937030285 | 351 |
| 897 | iso_pu_bacteria | 2937036028 | 2937042667 | 351 |
| 898 | iso_pu_bacteria | 2937042894 | 2937045538 | 351 |
| 899 | iso_pu_bacteria | 2937056579 | 2937063572 | 351 |
| 900 | iso_pu_bacteria | 2937063883 | 2937067772 | 351 |
| 901 | iso_pu_bacteria | 2937071275 | 2937074389 | 351 |
| 902 | iso_pu_bacteria | 2937078374 | 2937080277 | 351 |
| 903 | iso_pu_bacteria | 2937084907 | 2937086024 | 351 |
| 904 | iso_pu_bacteria | 2937091812 | 2937097219 | 351 |
| 905 | iso_pu_bacteria | 2937098957 | 2937103037 | 351 |
| 906 | iso_pu_bacteria | 2937106411 | 2937113299 | 351 |
| 907 | iso_pu_bacteria | 2937113482 | 2937116146 | 351 |
| 908 | iso_pu_bacteria | 2937119839 | 2937121983 | 351 |
| 909 | iso_pu_bacteria | 2937126314 | 2937128824 | 351 |
| 910 | iso_pu_bacteria | 2937813078 | 2937815774 | 351 |
| 911 | iso_pu_bacteria | 2937822353 | 2937824500 | 351 |
| 912 | iso_pu_bacteria | 2937836603 | 2937838186 | 351 |
| 913 | iso_pu_bacteria | 2937843397 | 2937848002 | 351 |
| 914 | iso_pu_bacteria | 2937848649 | 2937853146 | 351 |
| 915 | iso_pu_bacteria | 2937861824 | 2937861988 | 351 |
| 916 | iso_pu_bacteria | 2937868953 | 2937873176 | 351 |
| 917 | iso_pu_bacteria | 2937877337 | 2937882088 | 351 |
| 918 | iso_pu_bacteria | 2937891427 | 2937896103 | 351 |
| 919 | iso_pu_bacteria | 2937972304 | 2937978549 | 351 |
| 920 | iso_pu_bacteria | 2937994558 | 2938000033 | 351 |
| 921 | iso_pu_bacteria | 2941499720 | 2941502141 | 351 |
| 922 | iso_pu_bacteria | 2954011201 | 2954012821 | 351 |
| 923 | iso_pu_bacteria | 2957375807 | 2957376386 | 351 |
| 924 | iso_pu_bacteria | 2957382221 | 2957384279 | 351 |
| 925 | iso_pu_bacteria | 2957388812 | 2957390742 | 351 |
| 926 | iso_pu_bacteria | 2957395598 | 2957395898 | 351 |
| 927 | iso_pu_bacteria | 2957402308 | 2957404504 | 351 |
| 928 | iso_pu_bacteria | 2957408893 | 2957412091 | 351 |
| 929 | iso_pu_bacteria | 2957415311 | 2957421207 | 351 |
| 930 | iso_pu_bacteria | 2957422303 | 2957425697 | 351 |
| 931 | iso_pu_bacteria | 2957430029 | 2957431714 | 351 |
| 932 | iso_pu_bacteria | 2957437181 | 2957438172 | 351 |
| 933 | iso_pu_bacteria | 2957443900 | 2957446910 | 351 |
| 934 | iso_pu_bacteria | 2957450854 | 2957453752 | 351 |
| 935 | iso_pu_bacteria | 2957457609 | 2957461623 | 351 |
| 936 | iso_pu_bacteria | 2957464669 | 2957467046 | 351 |
| 937 | iso_pu_bacteria | 2957471148 | 2957476390 | 351 |
| 938 | iso_pu_bacteria | 2957478035 | 2957479606 | 351 |
| 939 | iso_pu_bacteria | 2957484790 | 2957490464 | 351 |
| 940 | iso_pu_bacteria | 2957491536 | 2957494105 | 351 |
| 941 | iso_pu_bacteria | 2957498199 | 2957503308 | 351 |
| 942 | iso_pu_bacteria | 2957505466 | 2957510612 | 351 |
| 943 | iso_pu_bacteria | 2958034702 | 2958040669 | 351 |
| 944 | iso_pu_bacteria | 2958041894 | 2958051248 | 351 |
| 945 | iso_pu_bacteria | 2958041894 | 2958056751 | 351 |
| 946 | iso_pu_bacteria | 2958064165 | 2958064272 | 351 |
| 947 | iso_pu_bacteria | 2958071322 | 2958078163 | 351 |
| 948 | iso_pu_bacteria | 2958084443 | 2958089210 | 351 |
| 949 | iso_pu_bacteria | 2958100919 | 2958104767 | 351 |
| 950 | iso_pu_bacteria | 2958108152 | 2958114548 | 351 |
| 951 | iso_pu_bacteria | 2958115193 | 2958118491 | 351 |
| 952 | iso_pu_bacteria | 2958122699 | 2958125318 | 351 |
| 953 | iso_pu_bacteria | 2958130278 | 2958130551 | 351 |
| 954 | iso_pu_bacteria | 2958144490 | 2958147255 | 351 |
| 955 | iso_pu_bacteria | 2958158011 | 2958163201 | 351 |
| 956 | iso_pu_bacteria | 2958165035 | 2958170497 | 351 |
| 957 | iso_pu_bacteria | 2958172287 | 2958175705 | 351 |
| 958 | iso_pu_bacteria | 2958179912 | 2958184756 | 351 |
| 959 | iso_pu_bacteria | 2960584000 | 2960585416 | 351 |
| 960 | iso_pu_bacteria | 2960591022 | 2960592085 | 351 |
| 961 | iso_pu_bacteria | 2960597568 | 2960599995 | 351 |
| 962 | iso_pu_bacteria | 2960603979 | 2960610587 | 351 |
| 963 | iso_pu_bacteria | 2960610863 | 2960612318 | 351 |
| 964 | iso_pu_bacteria | 2960617483 | 2960620462 | 351 |
| 965 | iso_pu_bacteria | 2960624210 | 2960624483 | 351 |
| 966 | iso_pu_bacteria | 2960631154 | 2960632045 | 351 |
| 967 | iso_pu_bacteria | 2960637947 | 2960644126 | 351 |
| 968 | iso_pu_bacteria | 2960645483 | 2960648417 | 351 |
| 969 | iso_pu_bacteria | 2960652885 | 2960656528 | 351 |
| 970 | iso_pu_bacteria | 2960660292 | 2960665569 | 351 |
| 971 | iso_pu_bacteria | 2960667422 | 2960669656 | 351 |
| 972 | iso_pu_bacteria | 2960674078 | 2960675162 | 351 |
| 973 | iso_pu_bacteria | 2960680706 | 2960681620 | 351 |
| 974 | iso_pu_bacteria | 2960687367 | 2960691470 | 351 |
| 975 | iso_pu_bacteria | 2960693952 | 2960694804 | 351 |
| 976 | iso_pu_bacteria | 2961077736 | 2961082923 | 351 |
| 977 | iso_pu_bacteria | 2961114664 | 2961120032 | 351 |
| 978 | iso_pu_bacteria | 2961127735 | 2961133893 | 351 |
| 979 | iso_pu_bacteria | 2961136820 | 2961141066 | 351 |
| 980 | iso_pu_bacteria | 2961163497 | 2961168952 | 351 |
| 981 | iso_pu_bacteria | 2961170736 | 2961176014 | 351 |
| 982 | iso_pu_bacteria | 2963644680 | 2963647755 | 351 |
| 983 | iso_pu_bacteria | 2964607997 | 2964609782 | 351 |
| 984 | iso_pu_bacteria | 2964615318 | 2964617750 | 351 |
| 985 | iso_pu_bacteria | 2964621998 | 2964623635 | 351 |
| 986 | iso_pu_bacteria | 2964628898 | 2964632584 | 351 |
| 987 | iso_pu_bacteria | 2964636051 | 2964640821 | 351 |
| 988 | iso_pu_bacteria | 2964643177 | 2964645688 | 351 |
| 989 | iso_pu_bacteria | 2964649959 | 2964651553 | 351 |
| 990 | iso_pu_bacteria | 2964656573 | 2964660523 | 351 |
| 991 | iso_pu_bacteria | 2964663802 | 2964666925 | 351 |
| 992 | iso_pu_bacteria | 2964670856 | 2964674439 | 351 |
| 993 | iso_pu_bacteria | 2964678106 | 2964682872 | 351 |
| 994 | iso_pu_bacteria | 2964685014 | 2964688480 | 351 |
| 995 | iso_pu_bacteria | 2964691889 | 2964692477 | 351 |
| 996 | iso_pu_bacteria | 2964698721 | 2964701645 | 351 |
| 997 | iso_pu_bacteria | 2964705432 | 2964711095 | 351 |
| 998 | iso_pu_bacteria | 2964712639 | 2964715162 | 351 |
| 999 | iso_pu_bacteria | 2964719344 | 2964720676 | 351 |
| 1000 | iso_pu_bacteria | 2965018300 | 2965024239 | 351 |
| 1001 | iso_pu_bacteria | 2965025482 | 2965031520 | 351 |
| 1002 | iso_pu_bacteria | 2965040258 | 2965044323 | 351 |
| 1003 | iso_pu_bacteria | 2965062239 | 2965065029 | 351 |
| 1004 | iso_pu_bacteria | 2965089291 | 2965089869 | 351 |
| 1005 | iso_pu_bacteria | 2965102966 | 2965109472 | 351 |
| 1006 | iso_pu_bacteria | 2967664464 | 2967666383 | 351 |
| 1007 | iso_pu_bacteria | 2967671571 | 2967678416 | 351 |
| 1008 | iso_pu_bacteria | 2967678726 | 2967684428 | 351 |
| 1009 | iso_pu_bacteria | 2967686174 | 2967689718 | 351 |
| 1010 | iso_pu_bacteria | 2967693043 | 2967694641 | 351 |
| 1011 | iso_pu_bacteria | 2967699805 | 2967705098 | 351 |
| 1012 | iso_pu_bacteria | 2967706974 | 2967708619 | 351 |
| 1013 | iso_pu_bacteria | 2967714385 | 2967714872 | 351 |
| 1014 | iso_pu_bacteria | 2967721400 | 2967726126 | 351 |
| 1015 | iso_pu_bacteria | 2967728569 | 2967728996 | 351 |
| 1016 | iso_pu_bacteria | 2967735183 | 2967737145 | 351 |
| 1017 | iso_pu_bacteria | 2967742019 | 2967742552 | 351 |
| 1018 | iso_pu_bacteria | 2967748971 | 2967751605 | 351 |
| 1019 | iso_pu_bacteria | 2967755722 | 2967760015 | 351 |
| 1020 | iso_pu_bacteria | 2967762386 | 2967767512 | 351 |
| 1021 | iso_pu_bacteria | 2967769361 | 2967772123 | 351 |
| 1022 | iso_pu_bacteria | 2967775926 | 2967782237 | 351 |
| 1023 | iso_pu_bacteria | 2967996073 | 2968001902 | 351 |
| 1024 | iso_pu_bacteria | 2968003550 | 2968009074 | 351 |
| 1025 | iso_pu_bacteria | 2968016561 | 2968018409 | 351 |
| 1026 | iso_pu_bacteria | 2968083720 | 2968090388 | 351 |
| 1027 | iso_pu_bacteria | 2968091066 | 2968096396 | 351 |
| 1028 | iso_pu_bacteria | 2968097103 | 2968098897 | 351 |
| 1029 | iso_pu_bacteria | 2968110612 | 2968116389 | 351 |
| 1030 | iso_pu_bacteria | 2968117919 | 2968120664 | 351 |
| 1031 | iso_pu_bacteria | 2968128360 | 2968129216 | 351 |
| 1032 | iso_pu_bacteria | 2968138860 | 2968144246 | 351 |
| 1033 | iso_pu_bacteria | 2968171901 | 2968177346 | 351 |
| 1034 | iso_pu_bacteria | 2970019648 | 2970021064 | 351 |
| 1035 | iso_pu_bacteria | 2970026789 | 2970028346 | 351 |
| 1036 | iso_pu_bacteria | 2970033650 | 2970040287 | 351 |
| 1037 | iso_pu_bacteria | 2970040964 | 2970042637 | 351 |
| 1038 | iso_pu_bacteria | 2970047711 | 2970050968 | 351 |
| 1039 | iso_pu_bacteria | 2970054988 | 2970056698 | 351 |
| 1040 | iso_pu_bacteria | 2970061556 | 2970067140 | 351 |
| 1041 | iso_pu_bacteria | 2970068827 | 2970071584 | 351 |
| 1042 | iso_pu_bacteria | 2970076120 | 2970078260 | 351 |
| 1043 | iso_pu_bacteria | 2970082768 | 2970085242 | 351 |
| 1044 | iso_pu_bacteria | 2970088815 | 2970092544 | 351 |
| 1045 | iso_pu_bacteria | 2970095765 | 2970102158 | 351 |
| 1046 | iso_pu_bacteria | 2970102677 | 2970108001 | 351 |
| 1047 | iso_pu_bacteria | 2970109326 | 2970110706 | 351 |
| 1048 | iso_pu_bacteria | 2970116247 | 2970117352 | 351 |
| 1049 | iso_pu_bacteria | 2970122695 | 2970125825 | 351 |
| 1050 | iso_pu_bacteria | 2970129317 | 2970131168 | 351 |
| 1051 | iso_pu_bacteria | 2970136068 | 2970136290 | 351 |
| 1052 | iso_pu_bacteria | 2970143518 | 2970146731 | 351 |
| 1053 | iso_pu_bacteria | 2970149975 | 2970151618 | 351 |
| 1054 | iso_pu_bacteria | 2970156795 | 2970159565 | 351 |
| 1055 | iso_pu_bacteria | 2970164137 | 2970166980 | 351 |
| 1056 | iso_pu_bacteria | 2970170962 | 2970174240 | 351 |
| 1057 | iso_pu_bacteria | 2970177841 | 2970180822 | 351 |
| 1058 | iso_pu_bacteria | 2970184632 | 2970189167 | 351 |
| 1059 | iso_pu_bacteria | 2970191845 | 2970193597 | 351 |
| 1060 | iso_pu_bacteria | 2970469710 | 2970471417 | 351 |
| 1061 | iso_pu_bacteria | 2970489779 | 2970491081 | 351 |
| 1062 | iso_pu_bacteria | 2970503327 | 2970508680 | 351 |
| 1063 | iso_pu_bacteria | 2970510686 | 2970514661 | 351 |
| 1064 | iso_pu_bacteria | 2970524798 | 2970528627 | 351 |
| 1065 | iso_pu_bacteria | 2970540015 | 2970544737 | 351 |
| 1066 | iso_pu_bacteria | 2970547951 | 2970552481 | 351 |
| 1067 | iso_pu_bacteria | 2970554993 | 2970560192 | 351 |
| 1068 | iso_pu_bacteria | 2970593180 | 2970599582 | 351 |
| 1069 | iso_pu_bacteria | 2970619444 | 2970626921 | 351 |
| 1070 | iso_pu_bacteria | 2977516862 | 2977519113 | 351 |
| 1071 | iso_pu_bacteria | 2977523885 | 2977526326 | 351 |
| 1072 | iso_pu_bacteria | 2977530762 | 2977534058 | 351 |
| 1073 | iso_pu_bacteria | 2977537788 | 2977539623 | 351 |
| 1074 | iso_pu_bacteria | 2977544691 | 2977546357 | 351 |
| 1075 | iso_pu_bacteria | 2977551784 | 2977558429 | 351 |
| 1076 | iso_pu_bacteria | 2977558990 | 2977564450 | 351 |
| 1077 | iso_pu_bacteria | 2977565890 | 2977567662 | 351 |
| 1078 | iso_pu_bacteria | 2977572785 | 2977575749 | 351 |
| 1079 | iso_pu_bacteria | 2977579622 | 2977582000 | 351 |
| 1080 | iso_pu_bacteria | 2977821940 | 2977827447 | 351 |
| 1081 | iso_pu_bacteria | 2977843712 | 2977846009 | 351 |
| 1082 | iso_pu_bacteria | 2977851361 | 2977856227 | 351 |
| 1083 | iso_pu_bacteria | 2977858184 | 2977863739 | 351 |
| 1084 | iso_pu_bacteria | 2977864932 | 2977867050 | 351 |
| 1085 | iso_pu_bacteria | 2977872689 | 2977876246 | 351 |
| 1086 | iso_pu_bacteria | 2977907340 | 2977909454 | 351 |
| 1087 | iso_pu_bacteria | 2977915119 | 2977919450 | 351 |
| 1088 | iso_pu_bacteria | 2977922695 | 2977924262 | 351 |
| 1089 | iso_pu_bacteria | 2977935797 | 2977939894 | 351 |
| 1090 | iso_pu_bacteria | 2977942078 | 2977942784 | 351 |
| 1091 | iso_pu_bacteria | 2977950692 | 2977956252 | 351 |
| 1092 | iso_pu_bacteria | 2977957713 | 2977962017 | 351 |
| 1093 | iso_pu_bacteria | 2978969890 | 2978974614 | 351 |
| 1094 | iso_pu_bacteria | 2979089926 | 2979094675 | 351 |
| 1095 | iso_pu_bacteria | 2979095461 | 2979100760 | 351 |
| 1096 | iso_pu_bacteria | 2979100975 | 2979103910 | 351 |
| 1097 | iso_pu_bacteria | 2979710463 | 2979711960 | 351 |
| 1098 | iso_pu_bacteria | 2979779861 | 2979785522 | 351 |
| 1099 | iso_pu_bacteria | 2979793036 | 2979795003 | 351 |
| 1100 | iso_pu_bacteria | 2979808191 | 2979811672 | 351 |
| 1101 | iso_pu_bacteria | 2984509177 | 2984511523 | 351 |
| 1102 | iso_pu_bacteria | 2984518228 | 2984522116 | 351 |
| 1103 | iso_pu_bacteria | 2984537506 | 2984541415 | 351 |
| 1104 | iso_pu_bacteria | 2984587000 | 2984589935 | 351 |
| 1105 | iso_pu_bacteria | 2984601300 | 2984603692 | 351 |
| 1106 | iso_pu_bacteria | 2987636660 | 2987638302 | 351 |
| 1107 | iso_pu_bacteria | 2987652177 | 2987654540 | 351 |
| 1108 | iso_pu_bacteria | 2987659509 | 2987664983 | 351 |
| 1109 | iso_pu_bacteria | 2987666974 | 2987669208 | 351 |
| 1110 | iso_pu_bacteria | 2987673487 | 2987677056 | 351 |
| 1111 | iso_pu_bacteria | 2989349275 | 2989349667 | 351 |
| 1112 | iso_pu_bacteria | 2989771324 | 2989774282 | 351 |
| 1113 | iso_pu_bacteria | 2989776772 | 2989779201 | 351 |
| 1114 | iso_pu_bacteria | 2995392953 | 2995393038 | 351 |
| 1115 | iso_pu_bacteria | 2996310559 | 2996314041 | 351 |
| 1116 | iso_pu_bacteria | 2996336353 | 2996339129 | 351 |
| 1117 | iso_pu_bacteria | 2996341866 | 2996347296 | 351 |
| 1118 | iso_pu_bacteria | 2996348954 | 2996350206 | 351 |
| 1119 | iso_pu_bacteria | 2996386984 | 2996388062 | 351 |
| 1120 | iso_pu_bacteria | 2996887358 | 2996889043 | 351 |
| 1121 | iso_pu_bacteria | 2996893221 | 2996894336 | 351 |
| 1122 | iso_pu_bacteria | 3000017691 | 3000017841 | 351 |
| 1123 | iso_pu_bacteria | 3000135777 | 3000140624 | 351 |
| 1124 | iso_pu_bacteria | 3002141150 | 3002144752 | 351 |
| 1125 | iso_pu_bacteria | 3003930520 | 3003934061 | 351 |
| 1126 | iso_pu_bacteria | 3004167301 | 3004168942 | 351 |
| 1127 | iso_pu_bacteria | 3004188549 | 3004194040 | 351 |
| 1128 | iso_pu_bacteria | 3004203850 | 3004205454 | 351 |
| 1129 | iso_pu_bacteria | 3004211236 | 3004215997 | 351 |
| 1130 | iso_pu_bacteria | 3004218560 | 3004223747 | 351 |
| 1131 | iso_pu_bacteria | 3004232784 | 3004234590 | 351 |
| 1132 | iso_pu_bacteria | 3004239961 | 3004246936 | 351 |
| 1133 | iso_pu_bacteria | 3004248173 | 3004248454 | 351 |
| 1134 | iso_pu_bacteria | 3004268573 | 3004274981 | 351 |
| 1135 | iso_pu_bacteria | 3004275668 | 3004276904 | 351 |
| 1136 | iso_pu_bacteria | 3004334049 | 3004334313 | 351 |
| 1137 | iso_pu_bacteria | 3005409236 | 3005414605 | 351 |
| 1138 | iso_pu_bacteria | 3005416602 | 3005419475 | 351 |
| 1139 | iso_pu_bacteria | 3005445848 | 3005448441 | 351 |
| 1140 | iso_pu_bacteria | 3005452660 | 3005454631 | 351 |
| 1141 | iso_pu_bacteria | 637000159 | 637074562 | 351 |
| 1142 | iso_pu_bacteria | 639633055 | 639649183 | 351 |
| 1143 | iso_pu_bacteria | 643692032 | 643826309 | 351 |
| 1144 | iso_pu_bacteria | 648276728 | 648739209 | 351 |
| 1145 | iso_pu_bacteria | 649633066 | 649873004 | 351 |
| 1146 | iso_pu_bacteria | 650716007 | 650740554 | 351 |
| 1147 | iso_pu_bacteria | 8002285264 | 8002289009 | 351 |
| 1148 | iso_pu_bacteria | 8003570095 | 8003571619 | 351 |
| 1149 | iso_pu_bacteria | 8003992118 | 8003994163 | 351 |
| 1150 | iso_pu_bacteria | 8003999396 | 8004001795 | 351 |
| 1151 | iso_pu_bacteria | 8004300914 | 8004301568 | 351 |
| 1152 | iso_pu_bacteria | 8004374579 | 8004380428 | 351 |
| 1153 | iso_pu_bacteria | 8004387939 | 8004393606 | 351 |
| 1154 | iso_pu_bacteria | 8004445564 | 8004452029 | 351 |
| 1155 | iso_pu_bacteria | 8004633249 | 8004636154 | 351 |
| 1156 | iso_pu_bacteria | 8004640170 | 8004640782 | 351 |
| 1157 | iso_pu_bacteria | 8004695233 | 8004700453 | 351 |
| 1158 | iso_pu_bacteria | 8004703790 | 8004709393 | 351 |
| 1159 | iso_pu_bacteria | 8004714634 | 8004720374 | 351 |
| 1160 | iso_pu_bacteria | 8004727605 | 8004734807 | 351 |
| 1161 | iso_pu_bacteria | 8005246636 | 8005248763 | 351 |
| 1162 | iso_pu_bacteria | 8005258706 | 8005260300 | 351 |
| 1163 | iso_pu_bacteria | 8005275841 | 8005281201 | 351 |
| 1164 | iso_pu_bacteria | 8005282627 | 8005283263 | 351 |
| 1165 | iso_pu_bacteria | 8005289223 | 8005293631 | 351 |
| 1166 | iso_pu_bacteria | 8005301065 | 8005303116 | 351 |
| 1167 | iso_pu_bacteria | 8005307578 | 8005312825 | 351 |
| 1168 | iso_pu_bacteria | 8005314921 | 8005316766 | 351 |
| 1169 | iso_pu_bacteria | 8005321885 | 8005323570 | 351 |
| 1170 | iso_pu_bacteria | 8005376324 | 8005380919 | 351 |
| 1171 | iso_pu_bacteria | 8005382845 | 8005389131 | 351 |
| 1172 | iso_pu_bacteria | 8005395548 | 8005396111 | 351 |
| 1173 | iso_pu_bacteria | 8005430974 | 8005435148 | 351 |
| 1174 | iso_pu_bacteria | 8005460587 | 8005463678 | 351 |
| 1175 | iso_pu_bacteria | 8005484373 | 8005489192 | 351 |
| 1176 | iso_pu_bacteria | 8005497431 | 8005500890 | 351 |
| 1177 | iso_pu_bacteria | 8005542996 | 8005545613 | 351 |
| 1178 | iso_pu_bacteria | 8005556819 | 8005557024 | 351 |
| 1179 | iso_pu_bacteria | 8005563573 | 8005567984 | 351 |
| 1180 | iso_pu_bacteria | 8005570704 | 8005573471 | 351 |
| 1181 | iso_pu_bacteria | 8005619151 | 8005622263 | 351 |
| 1182 | iso_pu_bacteria | 8005626139 | 8005632257 | 351 |
| 1183 | iso_pu_bacteria | 8005645114 | 8005648132 | 351 |
| 1184 | iso_pu_bacteria | 8005658619 | 8005659034 | 351 |
| 1185 | iso_pu_bacteria | 8005668836 | 8005672307 | 351 |
| 1186 | iso_pu_bacteria | 8005682033 | 8005682894 | 351 |
| 1187 | iso_pu_bacteria | 8005688590 | 8005692116 | 351 |
| 1188 | iso_pu_bacteria | 8005695170 | 8005697391 | 351 |
| 1189 | iso_pu_bacteria | 8018127388 | 8018134085 | 351 |
| 1190 | iso_pu_bacteria | 8018150411 | 8018153223 | 351 |
| 1191 | iso_pu_bacteria | 8018163183 | 8018164635 | 351 |
| 1192 | iso_pu_bacteria | 8018176218 | 8018181334 | 351 |
| 1193 | iso_pu_bacteria | 8023680758 | 8023683177 | 351 |
| 1194 | iso_pu_bacteria | 8024479707 | 8024482872 | 351 |
| 1195 | iso_pu_bacteria | 8024486573 | 8024488022 | 351 |
| 1196 | iso_pu_bacteria | 8024501048 | 8024504414 | 351 |
| 1197 | iso_pu_bacteria | 8045864390 | 8045864586 | 351 |
| 1198 | iso_pu_bacteria | 8046767195 | 8046771928 | 351 |
| 1199 | iso_pu_bacteria | 8049293176 | 8049295317 | 351 |
| 1200 | iso_pu_bacteria | 8054460903 | 8054462970 | 351 |
| 1201 | iso_pu_bacteria | 8054558443 | 8054562932 | 351 |
| 1202 | iso_pu_bacteria | 8055431914 | 8055432765 | 351 |
| 1203 | iso_pu_bacteria | 8055617313 | 8055620816 | 351 |
| 1204 | iso_pu_bacteria | 8056375014 | 8056375925 | 351 |
| 1205 | iso_pu_bacteria | 8056382006 | 8056386716 | 351 |
| 1206 | iso_pu_bacteria | 8056875544 | 8056877302 | 351 |
| 1207 | iso_pu_bacteria | 8057132660 | 8057134959 | 351 |
| 1208 | iso_pu_bacteria | 8057575449 | 8057575742 | 351 |
| 1209 | iso_pu_bacteria | 8057874678 | 8057877683 | 351 |
| 1210 | 3300013296 | Ga0157374_10000093 | Ga0157374_1000009355 | 352 |
| 1211 | 3300014969 | Ga0157376_10000397 | Ga0157376_100003972 | 352 |
| 1212 | 3300053730 | Ga0500645_001032 | Ga0500645_001032_7069_8175 | 352 |
| 1213 | 3300005841 | Ga0068863_100049068 | Ga0068863_1000490682 | 353 |
| 1214 | 3300009093 | Ga0105240_10000041 | Ga0105240_1000004111 | 353 |
| 1215 | 3300010375 | Ga0105239_10088268 | Ga0105239_100882682 | 353 |
| 1216 | 3300021384 | Ga0213876_10012004 | Ga0213876_100120043 | 353 |
| 1217 | 3300026088 | Ga0207641_10121994 | Ga0207641_101219942 | 353 |
| 1218 | 3300037312 | Ga0395899_0011241 | Ga0395899_0011241_2026_3111 | 353 |
| 1219 | 3300039437 | Ga0436365_0266395 | Ga0436365_0266395_1031_2131 | 353 |
| 1220 | 3300039437 | Ga0436365_1369348 | Ga0436365_1369348_3038_4150 | 353 |
| 1221 | 3300046516 | Ga0495628_0065316 | Ga0495628_0065316_269_1369 | 353 |
| 1222 | 3300046517 | Ga0495630_0058273 | Ga0495630_0058273_568_1668 | 353 |
| 1223 | 3300047471 | Ga0495684_0010387 | Ga0495684_0010387_5674_6774 | 353 |
| 1224 | 3300049571 | Ga0501034_0013251 | Ga0501034_0013251_2278_3423 | 353 |
| 1225 | 3300049571 | Ga0501034_0084135 | Ga0501034_0084135_258_1334 | 353 |
| 1226 | 3300049573 | Ga0501037_0022441 | Ga0501037_0022441_80_1225 | 353 |
| 1227 | 3300049574 | Ga0501038_0053162 | Ga0501038_0053162_999_2144 | 353 |
| 1228 | 3300049579 | Ga0501043_0009292 | Ga0501043_0009292_3054_4199 | 353 |
| 1229 | 3300049581 | Ga0501047_0032382 | Ga0501047_0032382_62_1207 | 353 |
| 1230 | 3300049582 | Ga0501048_0055597 | Ga0501048_0055597_201_1298 | 353 |
| 1231 | 3300049589 | Ga0501073_0001991 | Ga0501073_0001991_11821_12966 | 353 |
| 1232 | 3300049590 | Ga0501074_0266137 | Ga0501074_0266137_19_1164 | 353 |
| 1233 | 3300049742 | Ga0501080_0002532 | Ga0501080_0002532_4556_5701 | 353 |
| 1234 | 3300049744 | Ga0501083_0220879 | Ga0501083_0220879_19_1164 | 353 |
| 1235 | 3300049822 | Ga0501035_0026972 | Ga0501035_0026972_3505_4650 | 353 |
| 1236 | 3300049823 | Ga0501044_0261060 | Ga0501044_0261060_126_1271 | 353 |
| 1237 | 3300060353 | Ga0501082_0030438 | Ga0501082_0030438_652_1797 | 353 |
| 1238 | iso_pu_bacteria | 2965110997 | 2965117692 | 353 |
| 1239 | 3300003322 | rootL2_10193157 | rootL2_101931572 | 354 |
| 1240 | 3300003578 | Ga0006562J51391_1043939 | Ga0006562J51391_10439397 | 354 |
| 1241 | 3300003781 | Ga0055536_1001275 | Ga0055536_10012752 | 354 |
| 1242 | 3300003794 | Ga0055531_10023750 | Ga0055531_100237502 | 354 |
| 1243 | 3300005436 | Ga0070713_100001844 | Ga0070713_10000184414 | 354 |
| 1244 | 3300005530 | Ga0070679_100270265 | Ga0070679_1002702651 | 354 |
| 1245 | 3300005563 | Ga0068855_100494933 | Ga0068855_1004949331 | 354 |
| 1246 | 3300005614 | Ga0068856_100314614 | Ga0068856_1003146141 | 354 |
| 1247 | 3300006051 | Ga0075364_10039752 | Ga0075364_100397522 | 354 |
| 1248 | 3300009545 | Ga0105237_10217388 | Ga0105237_102173882 | 354 |
| 1249 | 3300013102 | Ga0157371_10043374 | Ga0157371_100433742 | 354 |
| 1250 | 3300013104 | Ga0157370_10015013 | Ga0157370_100150134 | 354 |
| 1251 | 3300013105 | Ga0157369_10011166 | Ga0157369_100111665 | 354 |
| 1252 | 3300014968 | Ga0157379_10238537 | Ga0157379_102385372 | 354 |
| 1253 | 3300025292 | Ga0209676_1000038 | Ga0209676_1000038440 | 354 |
| 1254 | 3300025292 | Ga0209676_1000644 | Ga0209676_100064427 | 354 |
| 1255 | 3300025298 | Ga0209050_1009729 | Ga0209050_10097292 | 354 |
| 1256 | 3300025304 | Ga0209257_1000060 | Ga0209257_1000060160 | 354 |
| 1257 | 3300025913 | Ga0207695_10000125 | Ga0207695_1000012557 | 354 |
| 1258 | 3300025928 | Ga0207700_10011303 | Ga0207700_100113034 | 354 |
| 1259 | 3300025944 | Ga0207661_10045424 | Ga0207661_100454243 | 354 |
| 1260 | 3300025949 | Ga0207667_10417392 | Ga0207667_104173921 | 354 |
| 1261 | 3300028556 | Ga0265337_1001230 | Ga0265337_10012304 | 354 |
| 1262 | 3300028556 | Ga0265337_1002560 | Ga0265337_10025602 | 354 |
| 1263 | 3300028556 | Ga0265337_1003365 | Ga0265337_10033651 | 354 |
| 1264 | 3300028563 | Ga0265319_1000298 | Ga0265319_100029827 | 354 |
| 1265 | 3300028563 | Ga0265319_1002101 | Ga0265319_10021016 | 354 |
| 1266 | 3300028563 | Ga0265319_1003884 | Ga0265319_10038844 | 354 |
| 1267 | 3300028563 | Ga0265319_1008667 | Ga0265319_10086672 | 354 |
| 1268 | 3300028563 | Ga0265319_1010831 | Ga0265319_10108312 | 354 |
| 1269 | 3300028563 | Ga0265319_1024830 | Ga0265319_10248302 | 354 |
| 1270 | 3300028573 | Ga0265334_10006566 | Ga0265334_100065664 | 354 |
| 1271 | 3300028573 | Ga0265334_10019358 | Ga0265334_100193582 | 354 |
| 1272 | 3300028573 | Ga0265334_10041329 | Ga0265334_100413292 | 354 |
| 1273 | 3300028577 | Ga0265318_10000007 | Ga0265318_1000000724 | 354 |
| 1274 | 3300028577 | Ga0265318_10001154 | Ga0265318_1000115413 | 354 |
| 1275 | 3300028577 | Ga0265318_10002287 | Ga0265318_100022879 | 354 |
| 1276 | 3300028577 | Ga0265318_10002712 | Ga0265318_100027126 | 354 |
| 1277 | 3300028577 | Ga0265318_10003821 | Ga0265318_100038212 | 354 |
| 1278 | 3300028653 | Ga0265323_10006142 | Ga0265323_100061423 | 354 |
| 1279 | 3300028653 | Ga0265323_10024474 | Ga0265323_100244742 | 354 |
| 1280 | 3300028653 | Ga0265323_10034080 | Ga0265323_100340802 | 354 |
| 1281 | 3300028654 | Ga0265322_10006788 | Ga0265322_100067882 | 354 |
| 1282 | 3300028654 | Ga0265322_10007141 | Ga0265322_100071412 | 354 |
| 1283 | 3300028666 | Ga0265336_10001485 | Ga0265336_100014857 | 354 |
| 1284 | 3300028794 | Ga0307515_10141817 | Ga0307515_101418172 | 354 |
| 1285 | 3300028800 | Ga0265338_10003574 | Ga0265338_100035745 | 354 |
| 1286 | 3300028800 | Ga0265338_10051361 | Ga0265338_100513613 | 354 |
| 1287 | 3300029957 | Ga0265324_10011450 | Ga0265324_100114502 | 354 |
| 1288 | 3300029957 | Ga0265324_10024904 | Ga0265324_100249042 | 354 |
| 1289 | 3300031235 | Ga0265330_10004065 | Ga0265330_100040653 | 354 |
| 1290 | 3300031239 | Ga0265328_10019863 | Ga0265328_100198633 | 354 |
| 1291 | 3300031240 | Ga0265320_10000791 | Ga0265320_100007916 | 354 |
| 1292 | 3300031240 | Ga0265320_10001929 | Ga0265320_100019297 | 354 |
| 1293 | 3300031240 | Ga0265320_10002983 | Ga0265320_100029833 | 354 |
| 1294 | 3300031240 | Ga0265320_10003355 | Ga0265320_100033556 | 354 |
| 1295 | 3300031240 | Ga0265320_10005312 | Ga0265320_100053125 | 354 |
| 1296 | 3300031240 | Ga0265320_10007308 | Ga0265320_100073083 | 354 |
| 1297 | 3300031240 | Ga0265320_10018235 | Ga0265320_100182353 | 354 |
| 1298 | 3300031240 | Ga0265320_10033988 | Ga0265320_100339882 | 354 |
| 1299 | 3300031241 | Ga0265325_10013776 | Ga0265325_100137764 | 354 |
| 1300 | 3300031250 | Ga0265331_10013946 | Ga0265331_100139464 | 354 |
| 1301 | 3300031250 | Ga0265331_10018214 | Ga0265331_100182144 | 354 |
| 1302 | 3300031251 | Ga0265327_10000091 | Ga0265327_1000009116 | 354 |
| 1303 | 3300031251 | Ga0265327_10002906 | Ga0265327_1000290613 | 354 |
| 1304 | 3300031251 | Ga0265327_10004492 | Ga0265327_100044924 | 354 |
| 1305 | 3300031251 | Ga0265327_10028872 | Ga0265327_100288722 | 354 |
| 1306 | 3300031344 | Ga0265316_10033074 | Ga0265316_100330742 | 354 |
| 1307 | 3300031595 | Ga0265313_10003023 | Ga0265313_100030235 | 354 |
| 1308 | 3300031595 | Ga0265313_10003044 | Ga0265313_100030442 | 354 |
| 1309 | 3300031595 | Ga0265313_10004342 | Ga0265313_100043427 | 354 |
| 1310 | 3300031595 | Ga0265313_10007241 | Ga0265313_100072412 | 354 |
| 1311 | 3300031595 | Ga0265313_10026134 | Ga0265313_100261343 | 354 |
| 1312 | 3300031616 | Ga0307508_10001088 | Ga0307508_100010889 | 354 |
| 1313 | 3300031711 | Ga0265314_10002313 | Ga0265314_100023136 | 354 |
| 1314 | 3300031711 | Ga0265314_10003676 | Ga0265314_1000367610 | 354 |
| 1315 | 3300031711 | Ga0265314_10005332 | Ga0265314_100053324 | 354 |
| 1316 | 3300031711 | Ga0265314_10098056 | Ga0265314_100980562 | 354 |
| 1317 | 3300031712 | Ga0265342_10011659 | Ga0265342_100116593 | 354 |
| 1318 | 3300031712 | Ga0265342_10023075 | Ga0265342_100230752 | 354 |
| 1319 | 3300031712 | Ga0265342_10058582 | Ga0265342_100585822 | 354 |
| 1320 | 3300031712 | Ga0265342_10089160 | Ga0265342_100891601 | 354 |
| 1321 | 3300031712 | Ga0265342_10111690 | Ga0265342_101116902 | 354 |
| 1322 | 3300031901 | Ga0307406_10013439 | Ga0307406_100134392 | 354 |
| 1323 | 3300032004 | Ga0307414_10020814 | Ga0307414_100208142 | 354 |
| 1324 | 3300032004 | Ga0307414_10054215 | Ga0307414_100542152 | 354 |
| 1325 | 3300032004 | Ga0307414_10061116 | Ga0307414_100611162 | 354 |
| 1326 | 3300032004 | Ga0307414_10125605 | Ga0307414_101256052 | 354 |
| 1327 | 3300033180 | Ga0307510_10186046 | Ga0307510_101860462 | 354 |
| 1328 | 3300035691 | Ga0373931_0091831 | Ga0373931_0091831_167_1282 | 354 |
| 1329 | 3300037312 | Ga0395899_0000125 | Ga0395899_0000125_93349_94458 | 354 |
| 1330 | 3300039447 | Ga0436361_0688051 | Ga0436361_0688051_1175_2287 | 354 |
| 1331 | 3300039447 | Ga0436361_1208326 | Ga0436361_1208326_172_1284 | 354 |
| 1332 | 3300042876 | Ga0451577_0000024 | Ga0451577_0000024_214439_215554 | 354 |
| 1333 | 3300042876 | Ga0451577_0000354 | Ga0451577_0000354_7510_8625 | 354 |
| 1334 | 3300042876 | Ga0451577_0043614 | Ga0451577_0043614_1425_2507 | 354 |
| 1335 | 3300042876 | Ga0451577_0111277 | Ga0451577_0111277_11_1126 | 354 |
| 1336 | 3300042876 | Ga0451577_0389251 | Ga0451577_0389251_136_1251 | 354 |
| 1337 | 3300044673 | Ga0453683_0006735 | Ga0453683_0006735_5229_6344 | 354 |
| 1338 | 3300044712 | Ga0453684_0000001 | Ga0453684_0000001_831085_832209 | 354 |
| 1339 | 3300044712 | Ga0453684_0018498 | Ga0453684_0018498_6139_7254 | 354 |
| 1340 | 3300044712 | Ga0453684_0022207 | Ga0453684_0022207_1192_2274 | 354 |
| 1341 | 3300044712 | Ga0453684_0051650 | Ga0453684_0051650_2065_3180 | 354 |
| 1342 | 3300044712 | Ga0453684_0056828 | Ga0453684_0056828_1772_2887 | 354 |
| 1343 | 3300045051 | Ga0451576_0000443 | Ga0451576_0000443_93254_94369 | 354 |
| 1344 | 3300045051 | Ga0451576_0002775 | Ga0451576_0002775_10801_11916 | 354 |
| 1345 | 3300045051 | Ga0451576_0003405 | Ga0451576_0003405_12934_14046 | 354 |
| 1346 | 3300045051 | Ga0451576_0007566 | Ga0451576_0007566_9432_10547 | 354 |
| 1347 | 3300045051 | Ga0451576_0073549 | Ga0451576_0073549_650_1765 | 354 |
| 1348 | 3300046694 | Ga0495649_0000649 | Ga0495649_0000649_11214_12323 | 354 |
| 1349 | 3300048925 | Ga0496122_0040321 | Ga0496122_0040321_218_1327 | 354 |
| 1350 | 3300048926 | Ga0496123_0013645 | Ga0496123_0013645_5655_6764 | 354 |
| 1351 | 3300048928 | Ga0496125_0092061 | Ga0496125_0092061_961_2070 | 354 |
| 1352 | 3300049569 | Ga0501032_0001723 | Ga0501032_0001723_587_1702 | 354 |
| 1353 | 3300049569 | Ga0501032_0002103 | Ga0501032_0002103_3004_4119 | 354 |
| 1354 | 3300049570 | Ga0501033_0001181 | Ga0501033_0001181_17363_18484 | 354 |
| 1355 | 3300049570 | Ga0501033_0004600 | Ga0501033_0004600_8739_9854 | 354 |
| 1356 | 3300049572 | Ga0501036_0022832 | Ga0501036_0022832_1051_2166 | 354 |
| 1357 | 3300049572 | Ga0501036_0189269 | Ga0501036_0189269_21_1136 | 354 |
| 1358 | 3300049573 | Ga0501037_0001490 | Ga0501037_0001490_8633_9748 | 354 |
| 1359 | 3300049574 | Ga0501038_0001105 | Ga0501038_0001105_9073_10188 | 354 |
| 1360 | 3300049575 | Ga0501039_0009216 | Ga0501039_0009216_2911_4026 | 354 |
| 1361 | 3300049578 | Ga0501042_0008324 | Ga0501042_0008324_2937_4052 | 354 |
| 1362 | 3300049579 | Ga0501043_0029609 | Ga0501043_0029609_1143_2258 | 354 |
| 1363 | 3300049579 | Ga0501043_0163416 | Ga0501043_0163416_102_1223 | 354 |
| 1364 | 3300049580 | Ga0501046_0000796 | Ga0501046_0000796_10501_11622 | 354 |
| 1365 | 3300049580 | Ga0501046_0004770 | Ga0501046_0004770_8248_9363 | 354 |
| 1366 | 3300049580 | Ga0501046_0132190 | Ga0501046_0132190_462_1577 | 354 |
| 1367 | 3300049580 | Ga0501046_0143187 | Ga0501046_0143187_406_1521 | 354 |
| 1368 | 3300049581 | Ga0501047_0006856 | Ga0501047_0006856_5629_6744 | 354 |
| 1369 | 3300049581 | Ga0501047_0007284 | Ga0501047_0007284_1042_2157 | 354 |
| 1370 | 3300049581 | Ga0501047_0031934 | Ga0501047_0031934_714_1835 | 354 |
| 1371 | 3300049581 | Ga0501047_0125892 | Ga0501047_0125892_769_1884 | 354 |
| 1372 | 3300049581 | Ga0501047_0186682 | Ga0501047_0186682_151_1272 | 354 |
| 1373 | 3300049582 | Ga0501048_0001499 | Ga0501048_0001499_6115_7230 | 354 |
| 1374 | 3300049744 | Ga0501083_0001671 | Ga0501083_0001671_630_1784 | 354 |
| 1375 | 3300049744 | Ga0501083_0047820 | Ga0501083_0047820_38_1153 | 354 |
| 1376 | 3300049822 | Ga0501035_0002594 | Ga0501035_0002594_5629_6744 | 354 |
| 1377 | 3300049822 | Ga0501035_0121609 | Ga0501035_0121609_307_1428 | 354 |
| 1378 | 3300049822 | Ga0501035_0245654 | Ga0501035_0245654_75_1190 | 354 |
| 1379 | 3300049823 | Ga0501044_0000206 | Ga0501044_0000206_33131_34246 | 354 |
| 1380 | 3300049823 | Ga0501044_0003350 | Ga0501044_0003350_5629_6744 | 354 |
| 1381 | 3300049823 | Ga0501044_0032189 | Ga0501044_0032189_1780_2895 | 354 |
| 1382 | 3300049823 | Ga0501044_0041808 | Ga0501044_0041808_713_1834 | 354 |
| 1383 | 3300050491 | nmdc:mga00v17_74517_c1 | nmdc:mga00v17_74517_c1_543_1622 | 354 |
| 1384 | 3300053088 | Ga0500644_0004179 | Ga0500644_0004179_1692_2801 | 354 |
| 1385 | 3300053093 | Ga0500651_0027106 | Ga0500651_0027106_360_1469 | 354 |
| 1386 | 3300053096 | Ga0500641_0001998 | Ga0500641_0001998_1502_2614 | 354 |
| 1387 | 3300053140 | Ga0500573_0019055 | Ga0500573_0019055_891_2000 | 354 |
| 1388 | 3300053156 | Ga0500622_0019462 | Ga0500622_0019462_1488_2597 | 354 |
| 1389 | 2162886007 | SwRhRL2b_contig_1038538 | SwRhRL2b_0044.00006730 | 355 |
| 1390 | 3300001915 | JGI24741J21665_1004868 | JGI24741J21665_10048682 | 355 |
| 1391 | 3300002739 | JGI25158J39367_1000038 | JGI25158J39367_100003812 | 355 |
| 1392 | 3300002739 | JGI25158J39367_1005327 | JGI25158J39367_10053272 | 355 |
| 1393 | 3300002741 | JGI25157J39369_1000787 | JGI25157J39369_100078711 | 355 |
| 1394 | 3300002773 | JGI25152J39213_1000636 | JGI25152J39213_10006368 | 355 |
| 1395 | 3300002773 | JGI25152J39213_1002957 | JGI25152J39213_10029574 | 355 |
| 1396 | 3300002773 | JGI25152J39213_1003042 | JGI25152J39213_10030423 | 355 |
| 1397 | 3300002773 | JGI25152J39213_1005715 | JGI25152J39213_10057152 | 355 |
| 1398 | 3300002774 | JGI25150J39212_1000107 | JGI25150J39212_100010710 | 355 |
| 1399 | 3300002774 | JGI25150J39212_1003012 | JGI25150J39212_10030122 | 355 |
| 1400 | 3300002987 | JGI25159J45721_1000014 | JGI25159J45721_100001453 | 355 |
| 1401 | 3300002987 | JGI25159J45721_1000154 | JGI25159J45721_10001542 | 355 |
| 1402 | 3300002987 | JGI25159J45721_1001072 | JGI25159J45721_10010724 | 355 |
| 1403 | 3300003187 | JGI25151J46595_10000374 | JGI25151J46595_1000037436 | 355 |
| 1404 | 3300003187 | JGI25151J46595_10000839 | JGI25151J46595_100008398 | 355 |
| 1405 | 3300003187 | JGI25151J46595_10006464 | JGI25151J46595_100064643 | 355 |
| 1406 | 3300003187 | JGI25151J46595_10015704 | JGI25151J46595_100157042 | 355 |
| 1407 | 3300003203 | JGI25406J46586_10014863 | JGI25406J46586_100148632 | 355 |
| 1408 | 3300003214 | JGI25165J46597_1000015 | JGI25165J46597_1000015151 | 355 |
| 1409 | 3300003215 | JGI25153J46596_10000696 | JGI25153J46596_100006966 | 355 |
| 1410 | 3300003215 | JGI25153J46596_10023168 | JGI25153J46596_100231682 | 355 |
| 1411 | 3300003215 | JGI25153J46596_10023978 | JGI25153J46596_100239782 | 355 |
| 1412 | 3300003215 | JGI25153J46596_10047584 | JGI25153J46596_100475841 | 355 |
| 1413 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001657 | 355 |
| 1414 | 3300003354 | JGI25160J50197_1000020 | JGI25160J50197_100002053 | 355 |
| 1415 | 3300003354 | JGI25160J50197_1002863 | JGI25160J50197_10028632 | 355 |
| 1416 | 3300003354 | JGI25160J50197_1030303 | JGI25160J50197_10303032 | 355 |
| 1417 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_100000196 | 355 |
| 1418 | 3300003374 | JGI25161J50226_1000174 | JGI25161J50226_100017434 | 355 |
| 1419 | 3300003374 | JGI25161J50226_1001510 | JGI25161J50226_10015105 | 355 |
| 1420 | 3300003374 | JGI25161J50226_1002239 | JGI25161J50226_10022393 | 355 |
| 1421 | 3300003578 | Ga0006562J51391_1023353 | Ga0006562J51391_10233534 | 355 |
| 1422 | 3300003762 | Ga0055542_1001274 | Ga0055542_10012742 | 355 |
| 1423 | 3300003771 | Ga0055526_1000597 | Ga0055526_100059721 | 355 |
| 1424 | 3300003771 | Ga0055526_1001490 | Ga0055526_10014907 | 355 |
| 1425 | 3300003771 | Ga0055526_1003506 | Ga0055526_10035062 | 355 |
| 1426 | 3300003771 | Ga0055526_1003741 | Ga0055526_10037417 | 355 |
| 1427 | 3300003773 | Ga0055537_1001473 | Ga0055537_10014735 | 355 |
| 1428 | 3300003775 | Ga0055524_1003871 | Ga0055524_10038714 | 355 |
| 1429 | 3300003775 | Ga0055524_1004279 | Ga0055524_10042796 | 355 |
| 1430 | 3300003775 | Ga0055524_1005006 | Ga0055524_10050062 | 355 |
| 1431 | 3300003775 | Ga0055524_1007099 | Ga0055524_10070993 | 355 |
| 1432 | 3300003775 | Ga0055524_1014345 | Ga0055524_10143452 | 355 |
| 1433 | 3300003781 | Ga0055536_1001187 | Ga0055536_100118712 | 355 |
| 1434 | 3300003781 | Ga0055536_1005415 | Ga0055536_10054155 | 355 |
| 1435 | 3300003781 | Ga0055536_1012576 | Ga0055536_10125762 | 355 |
| 1436 | 3300003790 | Ga0055528_1001199 | Ga0055528_10011998 | 355 |
| 1437 | 3300003790 | Ga0055528_1001734 | Ga0055528_100173410 | 355 |
| 1438 | 3300003790 | Ga0055528_1002830 | Ga0055528_10028309 | 355 |
| 1439 | 3300003790 | Ga0055528_1005558 | Ga0055528_10055585 | 355 |
| 1440 | 3300003790 | Ga0055528_1005775 | Ga0055528_10057755 | 355 |
| 1441 | 3300003790 | Ga0055528_1018688 | Ga0055528_10186882 | 355 |
| 1442 | 3300003791 | Ga0055530_10009807 | Ga0055530_100098073 | 355 |
| 1443 | 3300003792 | Ga0055540_1000929 | Ga0055540_100092911 | 355 |
| 1444 | 3300003792 | Ga0055540_1016839 | Ga0055540_10168391 | 355 |
| 1445 | 3300003794 | Ga0055531_10002881 | Ga0055531_100028813 | 355 |
| 1446 | 3300003794 | Ga0055531_10008539 | Ga0055531_100085392 | 355 |
| 1447 | 3300003794 | Ga0055531_10010959 | Ga0055531_100109594 | 355 |
| 1448 | 3300003794 | Ga0055531_10036493 | Ga0055531_100364932 | 355 |
| 1449 | 3300004625 | Ga0055543_1000003 | Ga0055543_1000003112 | 355 |
| 1450 | 3300004625 | Ga0055543_1000047 | Ga0055543_100004745 | 355 |
| 1451 | 3300004625 | Ga0055543_1000500 | Ga0055543_10005008 | 355 |
| 1452 | 3300004625 | Ga0055543_1001281 | Ga0055543_10012817 | 355 |
| 1453 | 3300005262 | Ga0065165_1000013 | Ga0065165_1000013167 | 355 |
| 1454 | 3300005262 | Ga0065165_1000068 | Ga0065165_100006857 | 355 |
| 1455 | 3300005262 | Ga0065165_1003894 | Ga0065165_10038943 | 355 |
| 1456 | 3300005289 | Ga0065704_10008543 | Ga0065704_100085432 | 355 |
| 1457 | 3300005327 | Ga0070658_10049567 | Ga0070658_100495673 | 355 |
| 1458 | 3300005331 | Ga0070670_100002993 | Ga0070670_10000299311 | 355 |
| 1459 | 3300005339 | Ga0070660_100095702 | Ga0070660_1000957022 | 355 |
| 1460 | 3300005339 | Ga0070660_100163494 | Ga0070660_1001634942 | 355 |
| 1461 | 3300005347 | Ga0070668_100010616 | Ga0070668_1000106165 | 355 |
| 1462 | 3300005347 | Ga0070668_100012891 | Ga0070668_1000128914 | 355 |
| 1463 | 3300005347 | Ga0070668_100078199 | Ga0070668_1000781992 | 355 |
| 1464 | 3300005355 | Ga0070671_100033702 | Ga0070671_1000337023 | 355 |
| 1465 | 3300005356 | Ga0070674_100016809 | Ga0070674_1000168094 | 355 |
| 1466 | 3300005367 | Ga0070667_100303778 | Ga0070667_1003037782 | 355 |
| 1467 | 3300005440 | Ga0070705_100098636 | Ga0070705_1000986362 | 355 |
| 1468 | 3300005455 | Ga0070663_100024934 | Ga0070663_1000249342 | 355 |
| 1469 | 3300005455 | Ga0070663_100118538 | Ga0070663_1001185382 | 355 |
| 1470 | 3300005456 | Ga0070678_100248634 | Ga0070678_1002486342 | 355 |
| 1471 | 3300005457 | Ga0070662_100300083 | Ga0070662_1003000831 | 355 |
| 1472 | 3300005459 | Ga0068867_100171488 | Ga0068867_1001714882 | 355 |
| 1473 | 3300005535 | Ga0070684_100134470 | Ga0070684_1001344702 | 355 |
| 1474 | 3300005539 | Ga0068853_100242359 | Ga0068853_1002423592 | 355 |
| 1475 | 3300005546 | Ga0070696_100137933 | Ga0070696_1001379332 | 355 |
| 1476 | 3300005548 | Ga0070665_100035316 | Ga0070665_1000353163 | 355 |
| 1477 | 3300005548 | Ga0070665_100075267 | Ga0070665_1000752673 | 355 |
| 1478 | 3300005548 | Ga0070665_100142921 | Ga0070665_1001429212 | 355 |
| 1479 | 3300005548 | Ga0070665_100152121 | Ga0070665_1001521212 | 355 |
| 1480 | 3300005563 | Ga0068855_100069226 | Ga0068855_1000692263 | 355 |
| 1481 | 3300005564 | Ga0070664_100117821 | Ga0070664_1001178212 | 355 |
| 1482 | 3300005718 | Ga0068866_10095286 | Ga0068866_100952862 | 355 |
| 1483 | 3300005841 | Ga0068863_100038880 | Ga0068863_1000388802 | 355 |
| 1484 | 3300005842 | Ga0068858_100125185 | Ga0068858_1001251852 | 355 |
| 1485 | 3300005843 | Ga0068860_100150648 | Ga0068860_1001506482 | 355 |
| 1486 | 3300005844 | Ga0068862_100032639 | Ga0068862_1000326393 | 355 |
| 1487 | 3300005844 | Ga0068862_100072962 | Ga0068862_1000729622 | 355 |
| 1488 | 3300005983 | Ga0081540_1045519 | Ga0081540_10455192 | 355 |
| 1489 | 3300005985 | Ga0081539_10001091 | Ga0081539_1000109139 | 355 |
| 1490 | 3300005985 | Ga0081539_10020691 | Ga0081539_100206912 | 355 |
| 1491 | 3300006038 | Ga0075365_10004585 | Ga0075365_100045852 | 355 |
| 1492 | 3300006038 | Ga0075365_10005814 | Ga0075365_100058142 | 355 |
| 1493 | 3300006038 | Ga0075365_10098168 | Ga0075365_100981682 | 355 |
| 1494 | 3300006038 | Ga0075365_10163928 | Ga0075365_101639282 | 355 |
| 1495 | 3300006042 | Ga0075368_10008483 | Ga0075368_100084832 | 355 |
| 1496 | 3300006048 | Ga0075363_100005871 | Ga0075363_1000058714 | 355 |
| 1497 | 3300006048 | Ga0075363_100025123 | Ga0075363_1000251232 | 355 |
| 1498 | 3300006051 | Ga0075364_10086268 | Ga0075364_100862681 | 355 |
| 1499 | 3300006177 | Ga0075362_10010664 | Ga0075362_100106642 | 355 |
| 1500 | 3300006177 | Ga0075362_10063214 | Ga0075362_100632142 | 355 |
| 1501 | 3300006178 | Ga0075367_10006519 | Ga0075367_100065194 | 355 |
| 1502 | 3300006178 | Ga0075367_10009312 | Ga0075367_100093121 | 355 |
| 1503 | 3300006186 | Ga0075369_10005462 | Ga0075369_100054622 | 355 |
| 1504 | 3300006186 | Ga0075369_10009967 | Ga0075369_100099673 | 355 |
| 1505 | 3300006186 | Ga0075369_10015627 | Ga0075369_100156272 | 355 |
| 1506 | 3300006186 | Ga0075369_10035613 | Ga0075369_100356132 | 355 |
| 1507 | 3300006195 | Ga0075366_10008655 | Ga0075366_100086553 | 355 |
| 1508 | 3300006353 | Ga0075370_10012603 | Ga0075370_100126033 | 355 |
| 1509 | 3300006353 | Ga0075370_10081836 | Ga0075370_100818362 | 355 |
| 1510 | 3300006353 | Ga0075370_10087140 | Ga0075370_100871402 | 355 |
| 1511 | 3300006353 | Ga0075370_10107335 | Ga0075370_101073352 | 355 |
| 1512 | 3300006353 | Ga0075370_10123037 | Ga0075370_101230372 | 355 |
| 1513 | 3300006358 | Ga0068871_100176497 | Ga0068871_1001764972 | 355 |
| 1514 | 3300006881 | Ga0068865_100069159 | Ga0068865_1000691592 | 355 |
| 1515 | 3300006881 | Ga0068865_100114373 | Ga0068865_1001143732 | 355 |
| 1516 | 3300006946 | Ga0079104_1000193 | Ga0079104_100019365 | 355 |
| 1517 | 3300006946 | Ga0079104_1001253 | Ga0079104_10012539 | 355 |
| 1518 | 3300006946 | Ga0079104_1003360 | Ga0079104_10033604 | 355 |
| 1519 | 3300006948 | Ga0099826_10001254 | Ga0099826_1000125410 | 355 |
| 1520 | 3300006948 | Ga0099826_10064039 | Ga0099826_100640392 | 355 |
| 1521 | 3300009092 | Ga0105250_10015698 | Ga0105250_100156981 | 355 |
| 1522 | 3300009148 | Ga0105243_10007500 | Ga0105243_100075004 | 355 |
| 1523 | 3300009176 | Ga0105242_10161244 | Ga0105242_101612442 | 355 |
| 1524 | 3300009177 | Ga0105248_10040139 | Ga0105248_100401393 | 355 |
| 1525 | 3300009177 | Ga0105248_10571246 | Ga0105248_105712461 | 355 |
| 1526 | 3300009545 | Ga0105237_10014016 | Ga0105237_100140166 | 355 |
| 1527 | 3300009551 | Ga0105238_10001971 | Ga0105238_1000197111 | 355 |
| 1528 | 3300009553 | Ga0105249_10017238 | Ga0105249_100172384 | 355 |
| 1529 | 3300009765 | Ga0123341_1000007 | Ga0123341_100000787 | 355 |
| 1530 | 3300009765 | Ga0123341_1046896 | Ga0123341_10468962 | 355 |
| 1531 | 3300009766 | Ga0123342_1004784 | Ga0123342_100478413 | 355 |
| 1532 | 3300009766 | Ga0123342_1013992 | Ga0123342_10139922 | 355 |
| 1533 | 3300013102 | Ga0157371_10000017 | Ga0157371_1000001753 | 355 |
| 1534 | 3300013104 | Ga0157370_10000461 | Ga0157370_1000046127 | 355 |
| 1535 | 3300013104 | Ga0157370_10090223 | Ga0157370_100902232 | 355 |
| 1536 | 3300013105 | Ga0157369_10159016 | Ga0157369_101590162 | 355 |
| 1537 | 3300013105 | Ga0157369_10187316 | Ga0157369_101873162 | 355 |
| 1538 | 3300013249 | Ga0171463_1003 | Ga0171463_1003168 | 355 |
| 1539 | 3300013308 | Ga0157375_10004209 | Ga0157375_1000420910 | 355 |
| 1540 | 3300013308 | Ga0157375_10070230 | Ga0157375_100702303 | 355 |
| 1541 | 3300014326 | Ga0157380_10116875 | Ga0157380_101168752 | 355 |
| 1542 | 3300014968 | Ga0157379_10007600 | Ga0157379_100076005 | 355 |
| 1543 | 3300014968 | Ga0157379_10359759 | Ga0157379_103597591 | 355 |
| 1544 | 3300015690 | Ga0183363_1344 | Ga0183363_13443 | 355 |
| 1545 | 3300017792 | Ga0163161_10006062 | Ga0163161_100060627 | 355 |
| 1546 | 3300017792 | Ga0163161_10164127 | Ga0163161_101641272 | 355 |
| 1547 | 3300021320 | Ga0214544_1001800 | Ga0214544_100180019 | 355 |
| 1548 | 3300021321 | Ga0214542_1000012 | Ga0214542_100001291 | 355 |
| 1549 | 3300021327 | Ga0214543_1000024 | Ga0214543_100002492 | 355 |
| 1550 | 3300021327 | Ga0214543_1000038 | Ga0214543_100003870 | 355 |
| 1551 | 3300022739 | Ga0228711_1000008 | Ga0228711_100000841 | 355 |
| 1552 | 3300022740 | Ga0228710_1000009 | Ga0228710_100000940 | 355 |
| 1553 | 3300025208 | Ga0209436_100150 | Ga0209436_10015024 | 355 |
| 1554 | 3300025208 | Ga0209436_101065 | Ga0209436_1010656 | 355 |
| 1555 | 3300025208 | Ga0209436_104522 | Ga0209436_1045222 | 355 |
| 1556 | 3300025245 | Ga0207425_1000075 | Ga0207425_100007562 | 355 |
| 1557 | 3300025245 | Ga0207425_1002079 | Ga0207425_10020793 | 355 |
| 1558 | 3300025245 | Ga0207425_1019409 | Ga0207425_10194092 | 355 |
| 1559 | 3300025250 | Ga0209026_1000025 | Ga0209026_1000025166 | 355 |
| 1560 | 3300025254 | Ga0209148_1000128 | Ga0209148_100012823 | 355 |
| 1561 | 3300025256 | Ga0209759_1000121 | Ga0209759_100012166 | 355 |
| 1562 | 3300025258 | Ga0209129_1000156 | Ga0209129_100015636 | 355 |
| 1563 | 3300025258 | Ga0209129_1000218 | Ga0209129_10002182 | 355 |
| 1564 | 3300025258 | Ga0209129_1001767 | Ga0209129_10017674 | 355 |
| 1565 | 3300025258 | Ga0209129_1001868 | Ga0209129_10018682 | 355 |
| 1566 | 3300025258 | Ga0209129_1002344 | Ga0209129_10023447 | 355 |
| 1567 | 3300025258 | Ga0209129_1003478 | Ga0209129_10034784 | 355 |
| 1568 | 3300025258 | Ga0209129_1007240 | Ga0209129_10072402 | 355 |
| 1569 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010249 | 355 |
| 1570 | 3300025263 | Ga0209565_1000118 | Ga0209565_100011831 | 355 |
| 1571 | 3300025263 | Ga0209565_1019270 | Ga0209565_10192702 | 355 |
| 1572 | 3300025272 | Ga0209455_1000127 | Ga0209455_1000127137 | 355 |
| 1573 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010210 | 355 |
| 1574 | 3300025273 | Ga0209673_1000117 | Ga0209673_100011784 | 355 |
| 1575 | 3300025273 | Ga0209673_1000151 | Ga0209673_100015167 | 355 |
| 1576 | 3300025273 | Ga0209673_1000863 | Ga0209673_100086326 | 355 |
| 1577 | 3300025273 | Ga0209673_1001685 | Ga0209673_10016857 | 355 |
| 1578 | 3300025273 | Ga0209673_1002134 | Ga0209673_10021347 | 355 |
| 1579 | 3300025273 | Ga0209673_1008788 | Ga0209673_10087883 | 355 |
| 1580 | 3300025273 | Ga0209673_1013220 | Ga0209673_10132202 | 355 |
| 1581 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003120 | 355 |
| 1582 | 3300025284 | Ga0209130_1000020 | Ga0209130_1000020256 | 355 |
| 1583 | 3300025284 | Ga0209130_1000034 | Ga0209130_1000034162 | 355 |
| 1584 | 3300025284 | Ga0209130_1017817 | Ga0209130_10178172 | 355 |
| 1585 | 3300025291 | Ga0209675_1006073 | Ga0209675_10060732 | 355 |
| 1586 | 3300025292 | Ga0209676_1000128 | Ga0209676_100012847 | 355 |
| 1587 | 3300025292 | Ga0209676_1000151 | Ga0209676_100015161 | 355 |
| 1588 | 3300025292 | Ga0209676_1000482 | Ga0209676_100048241 | 355 |
| 1589 | 3300025292 | Ga0209676_1018885 | Ga0209676_10188852 | 355 |
| 1590 | 3300025294 | Ga0209025_1000070 | Ga0209025_1000070241 | 355 |
| 1591 | 3300025294 | Ga0209025_1000140 | Ga0209025_100014074 | 355 |
| 1592 | 3300025294 | Ga0209025_1000314 | Ga0209025_100031424 | 355 |
| 1593 | 3300025294 | Ga0209025_1000506 | Ga0209025_10005067 | 355 |
| 1594 | 3300025294 | Ga0209025_1001869 | Ga0209025_100186917 | 355 |
| 1595 | 3300025294 | Ga0209025_1003183 | Ga0209025_100318312 | 355 |
| 1596 | 3300025294 | Ga0209025_1005193 | Ga0209025_10051934 | 355 |
| 1597 | 3300025294 | Ga0209025_1014241 | Ga0209025_10142415 | 355 |
| 1598 | 3300025294 | Ga0209025_1014979 | Ga0209025_10149792 | 355 |
| 1599 | 3300025294 | Ga0209025_1031047 | Ga0209025_10310471 | 355 |
| 1600 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013161 | 355 |
| 1601 | 3300025295 | Ga0209564_1000647 | Ga0209564_100064716 | 355 |
| 1602 | 3300025295 | Ga0209564_1001780 | Ga0209564_100178011 | 355 |
| 1603 | 3300025295 | Ga0209564_1001993 | Ga0209564_100199312 | 355 |
| 1604 | 3300025295 | Ga0209564_1013012 | Ga0209564_10130122 | 355 |
| 1605 | 3300025297 | Ga0209758_1000413 | Ga0209758_100041336 | 355 |
| 1606 | 3300025297 | Ga0209758_1000655 | Ga0209758_10006557 | 355 |
| 1607 | 3300025297 | Ga0209758_1000758 | Ga0209758_10007587 | 355 |
| 1608 | 3300025297 | Ga0209758_1001882 | Ga0209758_100188213 | 355 |
| 1609 | 3300025297 | Ga0209758_1002154 | Ga0209758_10021547 | 355 |
| 1610 | 3300025297 | Ga0209758_1004734 | Ga0209758_10047344 | 355 |
| 1611 | 3300025297 | Ga0209758_1011908 | Ga0209758_10119082 | 355 |
| 1612 | 3300025297 | Ga0209758_1013333 | Ga0209758_10133333 | 355 |
| 1613 | 3300025297 | Ga0209758_1021031 | Ga0209758_10210313 | 355 |
| 1614 | 3300025297 | Ga0209758_1027881 | Ga0209758_10278812 | 355 |
| 1615 | 3300025298 | Ga0209050_1000646 | Ga0209050_100064628 | 355 |
| 1616 | 3300025298 | Ga0209050_1002863 | Ga0209050_10028636 | 355 |
| 1617 | 3300025298 | Ga0209050_1003757 | Ga0209050_10037577 | 355 |
| 1618 | 3300025298 | Ga0209050_1004392 | Ga0209050_10043922 | 355 |
| 1619 | 3300025298 | Ga0209050_1007987 | Ga0209050_10079874 | 355 |
| 1620 | 3300025299 | Ga0209256_1001653 | Ga0209256_100165313 | 355 |
| 1621 | 3300025299 | Ga0209256_1001736 | Ga0209256_100173613 | 355 |
| 1622 | 3300025299 | Ga0209256_1002069 | Ga0209256_100206910 | 355 |
| 1623 | 3300025299 | Ga0209256_1002712 | Ga0209256_10027129 | 355 |
| 1624 | 3300025299 | Ga0209256_1004803 | Ga0209256_10048035 | 355 |
| 1625 | 3300025299 | Ga0209256_1005804 | Ga0209256_10058042 | 355 |
| 1626 | 3300025299 | Ga0209256_1006089 | Ga0209256_10060892 | 355 |
| 1627 | 3300025299 | Ga0209256_1009099 | Ga0209256_10090994 | 355 |
| 1628 | 3300025299 | Ga0209256_1010510 | Ga0209256_10105103 | 355 |
| 1629 | 3300025299 | Ga0209256_1010871 | Ga0209256_10108712 | 355 |
| 1630 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006535 | 355 |
| 1631 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008324 | 355 |
| 1632 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011659 | 355 |
| 1633 | 3300025302 | Ga0207426_1000221 | Ga0207426_1000221123 | 355 |
| 1634 | 3300025302 | Ga0207426_1000869 | Ga0207426_10008698 | 355 |
| 1635 | 3300025303 | Ga0209051_1000097 | Ga0209051_100009758 | 355 |
| 1636 | 3300025303 | Ga0209051_1000314 | Ga0209051_100031426 | 355 |
| 1637 | 3300025303 | Ga0209051_1001673 | Ga0209051_100167314 | 355 |
| 1638 | 3300025303 | Ga0209051_1006481 | Ga0209051_10064815 | 355 |
| 1639 | 3300025303 | Ga0209051_1009478 | Ga0209051_10094783 | 355 |
| 1640 | 3300025303 | Ga0209051_1023834 | Ga0209051_10238342 | 355 |
| 1641 | 3300025304 | Ga0209257_1000200 | Ga0209257_100020025 | 355 |
| 1642 | 3300025304 | Ga0209257_1000413 | Ga0209257_100041313 | 355 |
| 1643 | 3300025304 | Ga0209257_1001142 | Ga0209257_100114222 | 355 |
| 1644 | 3300025304 | Ga0209257_1002070 | Ga0209257_10020708 | 355 |
| 1645 | 3300025304 | Ga0209257_1003315 | Ga0209257_10033152 | 355 |
| 1646 | 3300025904 | Ga0207647_10004029 | Ga0207647_100040293 | 355 |
| 1647 | 3300025911 | Ga0207654_10076184 | Ga0207654_100761842 | 355 |
| 1648 | 3300025912 | Ga0207707_10246383 | Ga0207707_102463831 | 355 |
| 1649 | 3300025914 | Ga0207671_10029964 | Ga0207671_100299643 | 355 |
| 1650 | 3300025919 | Ga0207657_10040197 | Ga0207657_100401973 | 355 |
| 1651 | 3300025923 | Ga0207681_10075520 | Ga0207681_100755202 | 355 |
| 1652 | 3300025924 | Ga0207694_10043337 | Ga0207694_100433373 | 355 |
| 1653 | 3300025925 | Ga0207650_10000837 | Ga0207650_100008374 | 355 |
| 1654 | 3300025932 | Ga0207690_10165585 | Ga0207690_101655851 | 355 |
| 1655 | 3300025934 | Ga0207686_10118387 | Ga0207686_101183872 | 355 |
| 1656 | 3300025937 | Ga0207669_10130961 | Ga0207669_101309612 | 355 |
| 1657 | 3300025938 | Ga0207704_10098033 | Ga0207704_100980332 | 355 |
| 1658 | 3300025940 | Ga0207691_10131070 | Ga0207691_101310702 | 355 |
| 1659 | 3300025941 | Ga0207711_10013870 | Ga0207711_100138702 | 355 |
| 1660 | 3300025941 | Ga0207711_10039419 | Ga0207711_100394193 | 355 |
| 1661 | 3300025945 | Ga0207679_10049622 | Ga0207679_100496222 | 355 |
| 1662 | 3300025949 | Ga0207667_10123954 | Ga0207667_101239542 | 355 |
| 1663 | 3300025961 | Ga0207712_10050862 | Ga0207712_100508623 | 355 |
| 1664 | 3300025972 | Ga0207668_10005083 | Ga0207668_100050833 | 355 |
| 1665 | 3300025972 | Ga0207668_10005717 | Ga0207668_100057174 | 355 |
| 1666 | 3300025972 | Ga0207668_10237982 | Ga0207668_102379822 | 355 |
| 1667 | 3300025986 | Ga0207658_10068385 | Ga0207658_100683852 | 355 |
| 1668 | 3300025986 | Ga0207658_10132204 | Ga0207658_101322042 | 355 |
| 1669 | 3300025986 | Ga0207658_10238936 | Ga0207658_102389362 | 355 |
| 1670 | 3300025986 | Ga0207658_10302719 | Ga0207658_103027191 | 355 |
| 1671 | 3300026067 | Ga0207678_10112095 | Ga0207678_101120952 | 355 |
| 1672 | 3300026067 | Ga0207678_10118442 | Ga0207678_101184422 | 355 |
| 1673 | 3300026088 | Ga0207641_10030350 | Ga0207641_100303503 | 355 |
| 1674 | 3300026121 | Ga0207683_10057103 | Ga0207683_100571034 | 355 |
| 1675 | 3300026121 | Ga0207683_10167090 | Ga0207683_101670902 | 355 |
| 1676 | 3300027111 | Ga0209281_1000034 | Ga0209281_100003465 | 355 |
| 1677 | 3300027111 | Ga0209281_1000106 | Ga0209281_1000106191 | 355 |
| 1678 | 3300027111 | Ga0209281_1000318 | Ga0209281_100031828 | 355 |
| 1679 | 3300027312 | Ga0209371_1000022 | Ga0209371_100002281 | 355 |
| 1680 | 3300027312 | Ga0209371_1003359 | Ga0209371_10033593 | 355 |
| 1681 | 3300027312 | Ga0209371_1012916 | Ga0209371_10129161 | 355 |
| 1682 | 3300027666 | Ga0209282_1000024 | Ga0209282_1000024122 | 355 |
| 1683 | 3300027666 | Ga0209282_1000531 | Ga0209282_10005311 | 355 |
| 1684 | 3300027666 | Ga0209282_1045570 | Ga0209282_10455702 | 355 |
| 1685 | 3300027866 | Ga0209813_10019500 | Ga0209813_100195002 | 355 |
| 1686 | 3300027876 | Ga0209974_10009270 | Ga0209974_100092702 | 355 |
| 1687 | 3300028379 | Ga0268266_10025929 | Ga0268266_100259292 | 355 |
| 1688 | 3300028379 | Ga0268266_10105632 | Ga0268266_101056322 | 355 |
| 1689 | 3300028379 | Ga0268266_10116941 | Ga0268266_101169412 | 355 |
| 1690 | 3300028380 | Ga0268265_10046509 | Ga0268265_100465092 | 355 |
| 1691 | 3300028380 | Ga0268265_10057290 | Ga0268265_100572902 | 355 |
| 1692 | 3300028380 | Ga0268265_10163799 | Ga0268265_101637992 | 355 |
| 1693 | 3300028381 | Ga0268264_10099835 | Ga0268264_100998352 | 355 |
| 1694 | 3300028381 | Ga0268264_10118483 | Ga0268264_101184832 | 355 |
| 1695 | 3300028381 | Ga0268264_10196688 | Ga0268264_101966882 | 355 |
| 1696 | 3300028794 | Ga0307515_10001559 | Ga0307515_1000155930 | 355 |
| 1697 | 3300028794 | Ga0307515_10001978 | Ga0307515_1000197817 | 355 |
| 1698 | 3300028794 | Ga0307515_10007368 | Ga0307515_1000736813 | 355 |
| 1699 | 3300028794 | Ga0307515_10031969 | Ga0307515_100319697 | 355 |
| 1700 | 3300030500 | Ga0268256_1000019 | Ga0268256_1000019439 | 355 |
| 1701 | 3300030500 | Ga0268256_1003591 | Ga0268256_10035913 | 355 |
| 1702 | 3300030500 | Ga0268256_1012308 | Ga0268256_10123082 | 355 |
| 1703 | 3300030744 | Ga0316181_1196002 | Ga0316181_11960022 | 355 |
| 1704 | 3300031241 | Ga0265325_10029351 | Ga0265325_100293513 | 355 |
| 1705 | 3300031247 | Ga0265340_10018449 | Ga0265340_100184493 | 355 |
| 1706 | 3300031456 | Ga0307513_10010539 | Ga0307513_100105393 | 355 |
| 1707 | 3300031456 | Ga0307513_10056407 | Ga0307513_100564073 | 355 |
| 1708 | 3300031456 | Ga0307513_10091206 | Ga0307513_100912062 | 355 |
| 1709 | 3300031548 | Ga0307408_100060897 | Ga0307408_1000608972 | 355 |
| 1710 | 3300031548 | Ga0307408_100233217 | Ga0307408_1002332172 | 355 |
| 1711 | 3300031595 | Ga0265313_10003588 | Ga0265313_100035888 | 355 |
| 1712 | 3300031711 | Ga0265314_10116656 | Ga0265314_101166562 | 355 |
| 1713 | 3300031712 | Ga0265342_10014665 | Ga0265342_100146655 | 355 |
| 1714 | 3300031731 | Ga0307405_10000857 | Ga0307405_100008579 | 355 |
| 1715 | 3300031852 | Ga0307410_10228399 | Ga0307410_102283992 | 355 |
| 1716 | 3300031911 | Ga0307412_10000493 | Ga0307412_100004932 | 355 |
| 1717 | 3300031911 | Ga0307412_10173865 | Ga0307412_101738652 | 355 |
| 1718 | 3300031967 | Ga0315914_1000012 | Ga0315914_100001241 | 355 |
| 1719 | 3300032002 | Ga0307416_100469386 | Ga0307416_1004693861 | 355 |
| 1720 | 3300032004 | Ga0307414_10318020 | Ga0307414_103180201 | 355 |
| 1721 | 3300032126 | Ga0307415_100054506 | Ga0307415_1000545063 | 355 |
| 1722 | 3300033430 | Ga0315913_1000006 | Ga0315913_100000641 | 355 |
| 1723 | 3300033464 | Ga0315915_1000010 | Ga0315915_1000010224 | 355 |
| 1724 | 3300035695 | Ga0373927_0000350 | Ga0373927_0000350_26888_27988 | 355 |
| 1725 | 3300037068 | Ga0373925_0015189 | Ga0373925_0015189_2818_3918 | 355 |
| 1726 | 3300037312 | Ga0395899_0000117 | Ga0395899_0000117_34726_35808 | 355 |
| 1727 | 3300037312 | Ga0395899_0000721 | Ga0395899_0000721_4427_5515 | 355 |
| 1728 | 3300037312 | Ga0395899_0014995 | Ga0395899_0014995_2347_3417 | 355 |
| 1729 | 3300037418 | Ga0395900_0000020 | Ga0395900_0000020_34726_35808 | 355 |
| 1730 | 3300037418 | Ga0395900_0010176 | Ga0395900_0010176_247_1347 | 355 |
| 1731 | 3300037418 | Ga0395900_0012623 | Ga0395900_0012623_6843_7913 | 355 |
| 1732 | 3300037418 | Ga0395900_0032997 | Ga0395900_0032997_1490_2572 | 355 |
| 1733 | 3300037418 | Ga0395900_0037038 | Ga0395900_0037038_3665_4753 | 355 |
| 1734 | 3300037418 | Ga0395900_0111033 | Ga0395900_0111033_1699_2769 | 355 |
| 1735 | 3300037466 | Ga0395898_0000259 | Ga0395898_0000259_34726_35808 | 355 |
| 1736 | 3300037466 | Ga0395898_0017388 | Ga0395898_0017388_859_1947 | 355 |
| 1737 | 3300037471 | Ga0395905_0000019 | Ga0395905_0000019_317693_318775 | 355 |
| 1738 | 3300037471 | Ga0395905_0005044 | Ga0395905_0005044_9917_11017 | 355 |
| 1739 | 3300037471 | Ga0395905_0021769 | Ga0395905_0021769_4219_5301 | 355 |
| 1740 | 3300037471 | Ga0395905_0054858 | Ga0395905_0054858_1931_3001 | 355 |
| 1741 | 3300037471 | Ga0395905_0071756 | Ga0395905_0071756_148_1230 | 355 |
| 1742 | 3300037471 | Ga0395905_0099657 | Ga0395905_0099657_271_1371 | 355 |
| 1743 | 3300037471 | Ga0395905_0130601 | Ga0395905_0130601_47_1117 | 355 |
| 1744 | 3300038443 | Ga0395901_0000016 | Ga0395901_0000016_35234_36316 | 355 |
| 1745 | 3300038443 | Ga0395901_0196598 | Ga0395901_0196598_729_1799 | 355 |
| 1746 | 3300038443 | Ga0395901_0279372 | Ga0395901_0279372_404_1486 | 355 |
| 1747 | 3300038443 | Ga0395901_0315195 | Ga0395901_0315195_370_1458 | 355 |
| 1748 | 3300038443 | Ga0395901_0386153 | Ga0395901_0386153_22_1104 | 355 |
| 1749 | 3300039062 | Ga0400483_182297 | Ga0400483_182297_294_1415 | 355 |
| 1750 | 3300039062 | Ga0400483_251795 | Ga0400483_251795_499_1581 | 355 |
| 1751 | 3300041404 | Ga0439436_0005499 | Ga0439436_0005499_2726_3826 | 355 |
| 1752 | 3300041413 | Ga0439465_0002128 | Ga0439465_0002128_5171_6271 | 355 |
| 1753 | 3300041451 | Ga0451791_1547477 | Ga0451791_1547477_1292_2392 | 355 |
| 1754 | 3300041498 | Ga0451841_1414464 | Ga0451841_1414464_668_1768 | 355 |
| 1755 | 3300041505 | Ga0451849_0897929 | Ga0451849_0897929_95_1195 | 355 |
| 1756 | 3300041507 | Ga0451851_1171717 | Ga0451851_1171717_3972_5072 | 355 |
| 1757 | 3300041512 | Ga0451853_2936904 | Ga0451853_2936904_199_1314 | 355 |
| 1758 | 3300042003 | Ga0439443_007170 | Ga0439443_007170_235_1350 | 355 |
| 1759 | 3300042157 | Ga0439458_0019877 | Ga0439458_0019877_344_1426 | 355 |
| 1760 | 3300042438 | Ga0439459_0000950 | Ga0439459_0000950_2640_3755 | 355 |
| 1761 | 3300042531 | Ga0450918_008457 | Ga0450918_008457_324_1424 | 355 |
| 1762 | 3300044735 | Ga0466968_0040355 | Ga0466968_0040355_270_1373 | 355 |
| 1763 | 3300044901 | Ga0466960_0022200 | Ga0466960_0022200_1075_2145 | 355 |
| 1764 | 3300044901 | Ga0466960_0022279 | Ga0466960_0022279_495_1577 | 355 |
| 1765 | 3300046453 | Ga0495627_000769 | Ga0495627_000769_22313_23428 | 355 |
| 1766 | 3300046457 | Ga0495590_0001675 | Ga0495590_0001675_5804_6919 | 355 |
| 1767 | 3300046460 | Ga0495638_0001181 | Ga0495638_0001181_22492_23592 | 355 |
| 1768 | 3300046460 | Ga0495638_0005170 | Ga0495638_0005170_2046_3161 | 355 |
| 1769 | 3300046460 | Ga0495638_0006604 | Ga0495638_0006604_2127_3239 | 355 |
| 1770 | 3300046460 | Ga0495638_0008934 | Ga0495638_0008934_2027_3127 | 355 |
| 1771 | 3300046460 | Ga0495638_0025692 | Ga0495638_0025692_2151_3266 | 355 |
| 1772 | 3300046460 | Ga0495638_0030182 | Ga0495638_0030182_457_1539 | 355 |
| 1773 | 3300046460 | Ga0495638_0065339 | Ga0495638_0065339_642_1757 | 355 |
| 1774 | 3300046460 | Ga0495638_0084370 | Ga0495638_0084370_392_1492 | 355 |
| 1775 | 3300046471 | Ga0495650_0000237 | Ga0495650_0000237_40088_41203 | 355 |
| 1776 | 3300046474 | Ga0495605_0001952 | Ga0495605_0001952_6563_7663 | 355 |
| 1777 | 3300046506 | Ga0495583_0000001 | Ga0495583_0000001_744732_745847 | 355 |
| 1778 | 3300046512 | Ga0495610_0000407 | Ga0495610_0000407_2283_3398 | 355 |
| 1779 | 3300046512 | Ga0495610_0001969 | Ga0495610_0001969_5016_6116 | 355 |
| 1780 | 3300046512 | Ga0495610_0003529 | Ga0495610_0003529_2893_4008 | 355 |
| 1781 | 3300046512 | Ga0495610_0003825 | Ga0495610_0003825_7870_8970 | 355 |
| 1782 | 3300046512 | Ga0495610_0028351 | Ga0495610_0028351_1251_2351 | 355 |
| 1783 | 3300046512 | Ga0495610_0097095 | Ga0495610_0097095_92_1174 | 355 |
| 1784 | 3300046513 | Ga0495616_0000109 | Ga0495616_0000109_24663_25778 | 355 |
| 1785 | 3300046513 | Ga0495616_0072627 | Ga0495616_0072627_122_1237 | 355 |
| 1786 | 3300046513 | Ga0495616_0086043 | Ga0495616_0086043_80_1180 | 355 |
| 1787 | 3300046515 | Ga0495620_0028963 | Ga0495620_0028963_406_1521 | 355 |
| 1788 | 3300046515 | Ga0495620_0034736 | Ga0495620_0034736_426_1526 | 355 |
| 1789 | 3300046518 | Ga0495631_0001848 | Ga0495631_0001848_1556_2671 | 355 |
| 1790 | 3300046518 | Ga0495631_0003360 | Ga0495631_0003360_1429_2529 | 355 |
| 1791 | 3300046518 | Ga0495631_0034754 | Ga0495631_0034754_254_1354 | 355 |
| 1792 | 3300046519 | Ga0495632_0003529 | Ga0495632_0003529_9590_10705 | 355 |
| 1793 | 3300046519 | Ga0495632_0005104 | Ga0495632_0005104_1411_2511 | 355 |
| 1794 | 3300046520 | Ga0495637_0003364 | Ga0495637_0003364_1398_2513 | 355 |
| 1795 | 3300046522 | Ga0495643_0002725 | Ga0495643_0002725_11324_12424 | 355 |
| 1796 | 3300046522 | Ga0495643_0002802 | Ga0495643_0002802_12078_13178 | 355 |
| 1797 | 3300046524 | Ga0495648_0000509 | Ga0495648_0000509_34939_36051 | 355 |
| 1798 | 3300046525 | Ga0495663_0019216 | Ga0495663_0019216_388_1503 | 355 |
| 1799 | 3300046530 | Ga0495654_0000110 | Ga0495654_0000110_60331_61431 | 355 |
| 1800 | 3300046530 | Ga0495654_0000249 | Ga0495654_0000249_7061_8176 | 355 |
| 1801 | 3300046536 | Ga0495587_0055372 | Ga0495587_0055372_1006_2106 | 355 |
| 1802 | 3300046542 | Ga0495597_0018011 | Ga0495597_0018011_426_1526 | 355 |
| 1803 | 3300046542 | Ga0495597_0048517 | Ga0495597_0048517_439_1551 | 355 |
| 1804 | 3300046558 | Ga0495633_0009054 | Ga0495633_0009054_2414_3514 | 355 |
| 1805 | 3300046558 | Ga0495633_0112870 | Ga0495633_0112870_68_1168 | 355 |
| 1806 | 3300046616 | Ga0495668_0000037 | Ga0495668_0000037_167184_168296 | 355 |
| 1807 | 3300046616 | Ga0495668_0003688 | Ga0495668_0003688_1870_2985 | 355 |
| 1808 | 3300046660 | Ga0495625_0000284 | Ga0495625_0000284_11419_12534 | 355 |
| 1809 | 3300046660 | Ga0495625_0001387 | Ga0495625_0001387_24698_25798 | 355 |
| 1810 | 3300046660 | Ga0495625_0002396 | Ga0495625_0002396_16011_17126 | 355 |
| 1811 | 3300046660 | Ga0495625_0009397 | Ga0495625_0009397_6918_8033 | 355 |
| 1812 | 3300046660 | Ga0495625_0016011 | Ga0495625_0016011_4008_5108 | 355 |
| 1813 | 3300046794 | Ga0495589_0008352 | Ga0495589_0008352_2891_4006 | 355 |
| 1814 | 3300046809 | Ga0495600_0161865 | Ga0495600_0161865_126_1226 | 355 |
| 1815 | 3300046810 | Ga0495660_0072773 | Ga0495660_0072773_123_1223 | 355 |
| 1816 | 3300047317 | Ga0495604_0039341 | Ga0495604_0039341_1977_3077 | 355 |
| 1817 | 3300047318 | Ga0495636_0107141 | Ga0495636_0107141_75_1175 | 355 |
| 1818 | 3300047320 | Ga0495672_0003205 | Ga0495672_0003205_2544_3689 | 355 |
| 1819 | 3300047320 | Ga0495672_0009178 | Ga0495672_0009178_3049_4164 | 355 |
| 1820 | 3300047469 | Ga0495673_0000156 | Ga0495673_0000156_45020_46135 | 355 |
| 1821 | 3300047469 | Ga0495673_0001785 | Ga0495673_0001785_14402_15514 | 355 |
| 1822 | 3300047472 | Ga0495686_0002042 | Ga0495686_0002042_16551_17666 | 355 |
| 1823 | 3300047472 | Ga0495686_0002729 | Ga0495686_0002729_12246_13346 | 355 |
| 1824 | 3300047472 | Ga0495686_0039677 | Ga0495686_0039677_1509_2609 | 355 |
| 1825 | 3300047472 | Ga0495686_0071479 | Ga0495686_0071479_587_1687 | 355 |
| 1826 | 3300047472 | Ga0495686_0074730 | Ga0495686_0074730_626_1726 | 355 |
| 1827 | 3300048903 | Ga0496100_0024136 | Ga0496100_0024136_1907_2992 | 355 |
| 1828 | 3300048903 | Ga0496100_0053196 | Ga0496100_0053196_1377_2462 | 355 |
| 1829 | 3300048904 | Ga0496101_0006593 | Ga0496101_0006593_4377_5462 | 355 |
| 1830 | 3300048905 | Ga0496102_0011027 | Ga0496102_0011027_382_1467 | 355 |
| 1831 | 3300048906 | Ga0496103_0049797 | Ga0496103_0049797_1086_2171 | 355 |
| 1832 | 3300048907 | Ga0496104_0028708 | Ga0496104_0028708_429_1514 | 355 |
| 1833 | 3300048908 | Ga0496105_0003076 | Ga0496105_0003076_550_1635 | 355 |
| 1834 | 3300048908 | Ga0496105_0048040 | Ga0496105_0048040_1663_2748 | 355 |
| 1835 | 3300048909 | Ga0496106_0000982 | Ga0496106_0000982_13340_14440 | 355 |
| 1836 | 3300048909 | Ga0496106_0006952 | Ga0496106_0006952_4406_5521 | 355 |
| 1837 | 3300048909 | Ga0496106_0168989 | Ga0496106_0168989_484_1569 | 355 |
| 1838 | 3300048910 | Ga0496107_0000864 | Ga0496107_0000864_5392_6477 | 355 |
| 1839 | 3300048910 | Ga0496107_0000914 | Ga0496107_0000914_1901_3016 | 355 |
| 1840 | 3300048910 | Ga0496107_0019454 | Ga0496107_0019454_1533_2618 | 355 |
| 1841 | 3300048911 | Ga0496108_0000529 | Ga0496108_0000529_17796_18866 | 355 |
| 1842 | 3300048912 | Ga0496109_0243579 | Ga0496109_0243579_224_1309 | 355 |
| 1843 | 3300048915 | Ga0496112_0222368 | Ga0496112_0222368_313_1395 | 355 |
| 1844 | 3300048916 | Ga0496113_0256304 | Ga0496113_0256304_91_1176 | 355 |
| 1845 | 3300048917 | Ga0496114_0023493 | Ga0496114_0023493_3775_4860 | 355 |
| 1846 | 3300048918 | Ga0496115_0003066 | Ga0496115_0003066_3874_4989 | 355 |
| 1847 | 3300048918 | Ga0496115_0013897 | Ga0496115_0013897_446_1531 | 355 |
| 1848 | 3300048919 | Ga0496116_0000142 | Ga0496116_0000142_97666_98766 | 355 |
| 1849 | 3300048919 | Ga0496116_0011061 | Ga0496116_0011061_3793_4893 | 355 |
| 1850 | 3300048919 | Ga0496116_0029217 | Ga0496116_0029217_1481_2581 | 355 |
| 1851 | 3300048919 | Ga0496116_0051921 | Ga0496116_0051921_59_1159 | 355 |
| 1852 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_474967_476067 | 355 |
| 1853 | 3300048920 | Ga0496117_0004520 | Ga0496117_0004520_1999_3099 | 355 |
| 1854 | 3300048920 | Ga0496117_0012510 | Ga0496117_0012510_1078_2178 | 355 |
| 1855 | 3300048921 | Ga0496118_0000087 | Ga0496118_0000087_86526_87626 | 355 |
| 1856 | 3300048921 | Ga0496118_0126311 | Ga0496118_0126311_487_1587 | 355 |
| 1857 | 3300048922 | Ga0496119_0005947 | Ga0496119_0005947_3214_4314 | 355 |
| 1858 | 3300048922 | Ga0496119_0011964 | Ga0496119_0011964_4747_5829 | 355 |
| 1859 | 3300048922 | Ga0496119_0033726 | Ga0496119_0033726_1558_2658 | 355 |
| 1860 | 3300048923 | Ga0496120_0000413 | Ga0496120_0000413_9894_10994 | 355 |
| 1861 | 3300048923 | Ga0496120_0001104 | Ga0496120_0001104_9472_10554 | 355 |
| 1862 | 3300048923 | Ga0496120_0017315 | Ga0496120_0017315_2911_4011 | 355 |
| 1863 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_386453_387553 | 355 |
| 1864 | 3300048924 | Ga0496121_0001116 | Ga0496121_0001116_33908_35008 | 355 |
| 1865 | 3300048924 | Ga0496121_0004530 | Ga0496121_0004530_2796_3911 | 355 |
| 1866 | 3300048924 | Ga0496121_0084672 | Ga0496121_0084672_546_1628 | 355 |
| 1867 | 3300048925 | Ga0496122_0000004 | Ga0496122_0000004_113791_114891 | 355 |
| 1868 | 3300048925 | Ga0496122_0000190 | Ga0496122_0000190_128435_129535 | 355 |
| 1869 | 3300048925 | Ga0496122_0000215 | Ga0496122_0000215_45511_46614 | 355 |
| 1870 | 3300048925 | Ga0496122_0008959 | Ga0496122_0008959_7416_8516 | 355 |
| 1871 | 3300048925 | Ga0496122_0033581 | Ga0496122_0033581_1123_2223 | 355 |
| 1872 | 3300048925 | Ga0496122_0040083 | Ga0496122_0040083_1158_2258 | 355 |
| 1873 | 3300048925 | Ga0496122_0067097 | Ga0496122_0067097_573_1655 | 355 |
| 1874 | 3300048925 | Ga0496122_0132461 | Ga0496122_0132461_228_1328 | 355 |
| 1875 | 3300048926 | Ga0496123_0000007 | Ga0496123_0000007_113791_114891 | 355 |
| 1876 | 3300048926 | Ga0496123_0000306 | Ga0496123_0000306_82197_83300 | 355 |
| 1877 | 3300048926 | Ga0496123_0000336 | Ga0496123_0000336_12431_13531 | 355 |
| 1878 | 3300048926 | Ga0496123_0016026 | Ga0496123_0016026_3815_4915 | 355 |
| 1879 | 3300048926 | Ga0496123_0027463 | Ga0496123_0027463_89_1189 | 355 |
| 1880 | 3300048926 | Ga0496123_0059789 | Ga0496123_0059789_188_1288 | 355 |
| 1881 | 3300048927 | Ga0496124_0001040 | Ga0496124_0001040_11811_12911 | 355 |
| 1882 | 3300048927 | Ga0496124_0006855 | Ga0496124_0006855_3308_4408 | 355 |
| 1883 | 3300048927 | Ga0496124_0008840 | Ga0496124_0008840_4851_5951 | 355 |
| 1884 | 3300048927 | Ga0496124_0011355 | Ga0496124_0011355_3733_4833 | 355 |
| 1885 | 3300048927 | Ga0496124_0015066 | Ga0496124_0015066_1648_2748 | 355 |
| 1886 | 3300048927 | Ga0496124_0017201 | Ga0496124_0017201_303_1415 | 355 |
| 1887 | 3300048927 | Ga0496124_0017234 | Ga0496124_0017234_1842_2942 | 355 |
| 1888 | 3300048927 | Ga0496124_0031646 | Ga0496124_0031646_760_1863 | 355 |
| 1889 | 3300048928 | Ga0496125_0000039 | Ga0496125_0000039_165091_166191 | 355 |
| 1890 | 3300048928 | Ga0496125_0000248 | Ga0496125_0000248_97156_98256 | 355 |
| 1891 | 3300048928 | Ga0496125_0006049 | Ga0496125_0006049_2937_4037 | 355 |
| 1892 | 3300048928 | Ga0496125_0213966 | Ga0496125_0213966_157_1239 | 355 |
| 1893 | 3300048929 | Ga0496126_0000866 | Ga0496126_0000866_12464_13564 | 355 |
| 1894 | 3300048929 | Ga0496126_0001294 | Ga0496126_0001294_11948_13048 | 355 |
| 1895 | 3300048929 | Ga0496126_0003703 | Ga0496126_0003703_16695_17807 | 355 |
| 1896 | 3300048929 | Ga0496126_0014931 | Ga0496126_0014931_1551_2651 | 355 |
| 1897 | 3300048929 | Ga0496126_0226154 | Ga0496126_0226154_218_1303 | 355 |
| 1898 | 3300049459 | Ga0495678_003521 | Ga0495678_003521_6129_7244 | 355 |
| 1899 | 3300049568 | Ga0501031_0000036 | Ga0501031_0000036_62572_63654 | 355 |
| 1900 | 3300049569 | Ga0501032_0000075 | Ga0501032_0000075_67878_68960 | 355 |
| 1901 | 3300049569 | Ga0501032_0000100 | Ga0501032_0000100_10151_11233 | 355 |
| 1902 | 3300049569 | Ga0501032_0001737 | Ga0501032_0001737_104_1186 | 355 |
| 1903 | 3300049569 | Ga0501032_0056351 | Ga0501032_0056351_1040_2140 | 355 |
| 1904 | 3300049569 | Ga0501032_0058728 | Ga0501032_0058728_981_2081 | 355 |
| 1905 | 3300049569 | Ga0501032_0104903 | Ga0501032_0104903_681_1763 | 355 |
| 1906 | 3300049570 | Ga0501033_0000088 | Ga0501033_0000088_62273_63355 | 355 |
| 1907 | 3300049570 | Ga0501033_0001862 | Ga0501033_0001862_11622_12722 | 355 |
| 1908 | 3300049570 | Ga0501033_0002110 | Ga0501033_0002110_5877_6959 | 355 |
| 1909 | 3300049570 | Ga0501033_0087085 | Ga0501033_0087085_594_1676 | 355 |
| 1910 | 3300049571 | Ga0501034_0000397 | Ga0501034_0000397_10157_11239 | 355 |
| 1911 | 3300049571 | Ga0501034_0001558 | Ga0501034_0001558_2045_3127 | 355 |
| 1912 | 3300049571 | Ga0501034_0003857 | Ga0501034_0003857_5586_6668 | 355 |
| 1913 | 3300049571 | Ga0501034_0041258 | Ga0501034_0041258_1205_2290 | 355 |
| 1914 | 3300049571 | Ga0501034_0062289 | Ga0501034_0062289_715_1815 | 355 |
| 1915 | 3300049571 | Ga0501034_0086446 | Ga0501034_0086446_1903_2988 | 355 |
| 1916 | 3300049571 | Ga0501034_0086879 | Ga0501034_0086879_1813_2898 | 355 |
| 1917 | 3300049571 | Ga0501034_0191331 | Ga0501034_0191331_71_1156 | 355 |
| 1918 | 3300049571 | Ga0501034_0284546 | Ga0501034_0284546_282_1382 | 355 |
| 1919 | 3300049572 | Ga0501036_0000056 | Ga0501036_0000056_10157_11239 | 355 |
| 1920 | 3300049572 | Ga0501036_0000398 | Ga0501036_0000398_19533_20615 | 355 |
| 1921 | 3300049572 | Ga0501036_0060537 | Ga0501036_0060537_837_1919 | 355 |
| 1922 | 3300049572 | Ga0501036_0308564 | Ga0501036_0308564_136_1236 | 355 |
| 1923 | 3300049573 | Ga0501037_0000021 | Ga0501037_0000021_80752_81834 | 355 |
| 1924 | 3300049573 | Ga0501037_0000119 | Ga0501037_0000119_10156_11238 | 355 |
| 1925 | 3300049573 | Ga0501037_0000181 | Ga0501037_0000181_24456_25538 | 355 |
| 1926 | 3300049574 | Ga0501038_0000032 | Ga0501038_0000032_62473_63555 | 355 |
| 1927 | 3300049574 | Ga0501038_0000098 | Ga0501038_0000098_10130_11212 | 355 |
| 1928 | 3300049575 | Ga0501039_0000013 | Ga0501039_0000013_62273_63355 | 355 |
| 1929 | 3300049575 | Ga0501039_0000025 | Ga0501039_0000025_76742_77824 | 355 |
| 1930 | 3300049576 | Ga0501040_0106566 | Ga0501040_0106566_598_1680 | 355 |
| 1931 | 3300049576 | Ga0501040_0199928 | Ga0501040_0199928_229_1314 | 355 |
| 1932 | 3300049578 | Ga0501042_0061785 | Ga0501042_0061785_690_1775 | 355 |
| 1933 | 3300049579 | Ga0501043_0000008 | Ga0501043_0000008_52173_53255 | 355 |
| 1934 | 3300049579 | Ga0501043_0002291 | Ga0501043_0002291_10133_11215 | 355 |
| 1935 | 3300049579 | Ga0501043_0004109 | Ga0501043_0004109_808_1890 | 355 |
| 1936 | 3300049579 | Ga0501043_0013809 | Ga0501043_0013809_773_1873 | 355 |
| 1937 | 3300049579 | Ga0501043_0046072 | Ga0501043_0046072_1294_2376 | 355 |
| 1938 | 3300049581 | Ga0501047_0001349 | Ga0501047_0001349_9813_10895 | 355 |
| 1939 | 3300049581 | Ga0501047_0009767 | Ga0501047_0009767_4260_5342 | 355 |
| 1940 | 3300049581 | Ga0501047_0014505 | Ga0501047_0014505_4967_6049 | 355 |
| 1941 | 3300049581 | Ga0501047_0051975 | Ga0501047_0051975_2290_3375 | 355 |
| 1942 | 3300049581 | Ga0501047_0079750 | Ga0501047_0079750_539_1621 | 355 |
| 1943 | 3300049581 | Ga0501047_0100203 | Ga0501047_0100203_333_1433 | 355 |
| 1944 | 3300049581 | Ga0501047_0154168 | Ga0501047_0154168_497_1579 | 355 |
| 1945 | 3300049582 | Ga0501048_0151484 | Ga0501048_0151484_497_1579 | 355 |
| 1946 | 3300049584 | Ga0501068_0043794 | Ga0501068_0043794_1553_2635 | 355 |
| 1947 | 3300049584 | Ga0501068_0081653 | Ga0501068_0081653_93_1175 | 355 |
| 1948 | 3300049584 | Ga0501068_0154471 | Ga0501068_0154471_57_1157 | 355 |
| 1949 | 3300049585 | Ga0501069_0000028 | Ga0501069_0000028_78732_79814 | 355 |
| 1950 | 3300049585 | Ga0501069_0094575 | Ga0501069_0094575_326_1408 | 355 |
| 1951 | 3300049586 | Ga0501070_0000208 | Ga0501070_0000208_6316_7398 | 355 |
| 1952 | 3300049586 | Ga0501070_0000264 | Ga0501070_0000264_7693_8775 | 355 |
| 1953 | 3300049586 | Ga0501070_0002017 | Ga0501070_0002017_16131_17213 | 355 |
| 1954 | 3300049586 | Ga0501070_0011937 | Ga0501070_0011937_2567_3649 | 355 |
| 1955 | 3300049586 | Ga0501070_0038239 | Ga0501070_0038239_2175_3290 | 355 |
| 1956 | 3300049586 | Ga0501070_0064702 | Ga0501070_0064702_704_1786 | 355 |
| 1957 | 3300049586 | Ga0501070_0247854 | Ga0501070_0247854_106_1188 | 355 |
| 1958 | 3300049587 | Ga0501071_0026908 | Ga0501071_0026908_1824_2906 | 355 |
| 1959 | 3300049587 | Ga0501071_0129555 | Ga0501071_0129555_243_1325 | 355 |
| 1960 | 3300049587 | Ga0501071_0305027 | Ga0501071_0305027_62_1144 | 355 |
| 1961 | 3300049588 | Ga0501072_0119994 | Ga0501072_0119994_77_1222 | 355 |
| 1962 | 3300049589 | Ga0501073_0017923 | Ga0501073_0017923_2670_3752 | 355 |
| 1963 | 3300049590 | Ga0501074_0000016 | Ga0501074_0000016_61471_62553 | 355 |
| 1964 | 3300049590 | Ga0501074_0064103 | Ga0501074_0064103_517_1599 | 355 |
| 1965 | 3300049593 | Ga0501077_0083851 | Ga0501077_0083851_742_1827 | 355 |
| 1966 | 3300049671 | Ga0501238_002317 | Ga0501238_002317_491_1606 | 355 |
| 1967 | 3300049742 | Ga0501080_0000065 | Ga0501080_0000065_20294_21376 | 355 |
| 1968 | 3300049742 | Ga0501080_0000515 | Ga0501080_0000515_18838_19920 | 355 |
| 1969 | 3300049742 | Ga0501080_0018343 | Ga0501080_0018343_3730_4830 | 355 |
| 1970 | 3300049742 | Ga0501080_0044577 | Ga0501080_0044577_2679_3761 | 355 |
| 1971 | 3300049742 | Ga0501080_0131816 | Ga0501080_0131816_458_1528 | 355 |
| 1972 | 3300049744 | Ga0501083_0000482 | Ga0501083_0000482_24370_25452 | 355 |
| 1973 | 3300049744 | Ga0501083_0007197 | Ga0501083_0007197_6016_7101 | 355 |
| 1974 | 3300049744 | Ga0501083_0030737 | Ga0501083_0030737_574_1719 | 355 |
| 1975 | 3300049744 | Ga0501083_0042867 | Ga0501083_0042867_1211_2356 | 355 |
| 1976 | 3300049744 | Ga0501083_0069870 | Ga0501083_0069870_1127_2227 | 355 |
| 1977 | 3300049822 | Ga0501035_0000011 | Ga0501035_0000011_16147_17229 | 355 |
| 1978 | 3300049822 | Ga0501035_0000053 | Ga0501035_0000053_79506_80588 | 355 |
| 1979 | 3300049822 | Ga0501035_0000085 | Ga0501035_0000085_42784_43866 | 355 |
| 1980 | 3300049822 | Ga0501035_0000584 | Ga0501035_0000584_6226_7326 | 355 |
| 1981 | 3300049822 | Ga0501035_0001564 | Ga0501035_0001564_8477_9559 | 355 |
| 1982 | 3300049822 | Ga0501035_0001865 | Ga0501035_0001865_7412_8494 | 355 |
| 1983 | 3300049822 | Ga0501035_0002030 | Ga0501035_0002030_10172_11254 | 355 |
| 1984 | 3300049822 | Ga0501035_0051433 | Ga0501035_0051433_1397_2479 | 355 |
| 1985 | 3300049822 | Ga0501035_0167383 | Ga0501035_0167383_155_1237 | 355 |
| 1986 | 3300049822 | Ga0501035_0178021 | Ga0501035_0178021_378_1478 | 355 |
| 1987 | 3300049823 | Ga0501044_0000011 | Ga0501044_0000011_37461_38543 | 355 |
| 1988 | 3300049823 | Ga0501044_0000214 | Ga0501044_0000214_62273_63355 | 355 |
| 1989 | 3300049823 | Ga0501044_0014012 | Ga0501044_0014012_926_2008 | 355 |
| 1990 | 3300049823 | Ga0501044_0021514 | Ga0501044_0021514_5337_6419 | 355 |
| 1991 | 3300049823 | Ga0501044_0029188 | Ga0501044_0029188_3639_4721 | 355 |
| 1992 | 3300049823 | Ga0501044_0130899 | Ga0501044_0130899_1081_2166 | 355 |
| 1993 | 3300049823 | Ga0501044_0259986 | Ga0501044_0259986_269_1369 | 355 |
| 1994 | 3300049823 | Ga0501044_0261644 | Ga0501044_0261644_266_1366 | 355 |
| 1995 | 3300049824 | Ga0501045_0098913 | Ga0501045_0098913_117_1199 | 355 |
| 1996 | 3300050489 | nmdc:mga03683_61655_c1 | nmdc:mga03683_61655_c1_443_1543 | 355 |
| 1997 | 3300050490 | nmdc:mga03n38_11236_c1 | nmdc:mga03n38_11236_c1_269_1369 | 355 |
| 1998 | 3300050490 | nmdc:mga03n38_12796_c1 | nmdc:mga03n38_12796_c1_1617_2699 | 355 |
| 1999 | 3300050490 | nmdc:mga03n38_49203_c1 | nmdc:mga03n38_49203_c1_754_1839 | 355 |
| 2000 | 3300050491 | nmdc:mga00v17_12_c1 | nmdc:mga00v17_12_c1_22818_23918 | 355 |
| 2001 | 3300050491 | nmdc:mga00v17_3914_c1 | nmdc:mga00v17_3914_c1_2914_4014 | 355 |
| 2002 | 3300050491 | nmdc:mga00v17_639_c1 | nmdc:mga00v17_639_c1_12438_13538 | 355 |
| 2003 | 3300050492 | nmdc:mga0yw44_291_c1 | nmdc:mga0yw44_291_c1_9698_10798 | 355 |
| 2004 | 3300050493 | nmdc:mga0k408_143212_c1 | nmdc:mga0k408_143212_c1_79_1179 | 355 |
| 2005 | 3300050493 | nmdc:mga0k408_14483_c1 | nmdc:mga0k408_14483_c1_458_1558 | 355 |
| 2006 | 3300050493 | nmdc:mga0k408_48746_c1 | nmdc:mga0k408_48746_c1_608_1720 | 355 |
| 2007 | 3300050494 | nmdc:mga06z11_32566_c1 | nmdc:mga06z11_32566_c1_375_1475 | 355 |
| 2008 | 3300050494 | nmdc:mga06z11_6219_c1 | nmdc:mga06z11_6219_c1_1874_2974 | 355 |
| 2009 | 3300050494 | nmdc:mga06z11_91404_c1 | nmdc:mga06z11_91404_c1_127_1209 | 355 |
| 2010 | 3300050496 | nmdc:mga07m45_11234_c1 | nmdc:mga07m45_11234_c1_2197_3279 | 355 |
| 2011 | 3300050496 | nmdc:mga07m45_85941_c1 | nmdc:mga07m45_85941_c1_103_1188 | 355 |
| 2012 | 3300050516 | nmdc:mga0sz30_1084_c1 | nmdc:mga0sz30_1084_c1_1242_2342 | 355 |
| 2013 | 3300050516 | nmdc:mga0sz30_2810_c1 | nmdc:mga0sz30_2810_c1_4755_5867 | 355 |
| 2014 | 3300050516 | nmdc:mga0sz30_32753_c1 | nmdc:mga0sz30_32753_c1_454_1536 | 355 |
| 2015 | 3300053079 | Ga0500610_0007910 | Ga0500610_0007910_2087_3187 | 355 |
| 2016 | 3300053086 | Ga0500578_0000134 | Ga0500578_0000134_12877_13992 | 355 |
| 2017 | 3300053086 | Ga0500578_0041968 | Ga0500578_0041968_1765_2865 | 355 |
| 2018 | 3300053087 | Ga0500643_000992 | Ga0500643_000992_2751_3863 | 355 |
| 2019 | 3300053088 | Ga0500644_0000618 | Ga0500644_0000618_5099_6211 | 355 |
| 2020 | 3300053104 | Ga0500556_0001416 | Ga0500556_0001416_8212_9327 | 355 |
| 2021 | 3300053107 | Ga0500560_000083 | Ga0500560_000083_4581_5681 | 355 |
| 2022 | 3300053108 | Ga0500562_000545 | Ga0500562_000545_4319_5434 | 355 |
| 2023 | 3300053111 | Ga0500572_001610 | Ga0500572_001610_3509_4609 | 355 |
| 2024 | 3300053118 | Ga0500594_0000319 | Ga0500594_0000319_7219_8334 | 355 |
| 2025 | 3300053118 | Ga0500594_0034655 | Ga0500594_0034655_232_1332 | 355 |
| 2026 | 3300053120 | Ga0500597_061909 | Ga0500597_061909_47_1174 | 355 |
| 2027 | 3300053122 | Ga0500608_044527 | Ga0500608_044527_474_1574 | 355 |
| 2028 | 3300053123 | Ga0500614_003099 | Ga0500614_003099_927_2042 | 355 |
| 2029 | 3300053125 | Ga0500618_000314 | Ga0500618_000314_10661_11761 | 355 |
| 2030 | 3300053125 | Ga0500618_000677 | Ga0500618_000677_7022_8122 | 355 |
| 2031 | 3300053125 | Ga0500618_009330 | Ga0500618_009330_1386_2489 | 355 |
| 2032 | 3300053134 | Ga0500658_0000526 | Ga0500658_0000526_10122_11222 | 355 |
| 2033 | 3300053136 | Ga0500559_0000307 | Ga0500559_0000307_28992_30107 | 355 |
| 2034 | 3300053136 | Ga0500559_0002861 | Ga0500559_0002861_3432_4532 | 355 |
| 2035 | 3300053136 | Ga0500559_0020295 | Ga0500559_0020295_186_1301 | 355 |
| 2036 | 3300053137 | Ga0500561_0000098 | Ga0500561_0000098_9960_11060 | 355 |
| 2037 | 3300053138 | Ga0500564_000155 | Ga0500564_000155_5031_6143 | 355 |
| 2038 | 3300053139 | Ga0500568_0000093 | Ga0500568_0000093_38156_39238 | 355 |
| 2039 | 3300053142 | Ga0500577_0000256 | Ga0500577_0000256_10047_11162 | 355 |
| 2040 | 3300053148 | Ga0500590_003631 | Ga0500590_003631_5583_6683 | 355 |
| 2041 | 3300053151 | Ga0500604_0056608 | Ga0500604_0056608_31_1113 | 355 |
| 2042 | 3300053153 | Ga0500616_0000277 | Ga0500616_0000277_27267_28370 | 355 |
| 2043 | 3300053153 | Ga0500616_0001018 | Ga0500616_0001018_27311_28411 | 355 |
| 2044 | 3300053153 | Ga0500616_0012776 | Ga0500616_0012776_1331_2416 | 355 |
| 2045 | 3300053153 | Ga0500616_0025011 | Ga0500616_0025011_1775_2875 | 355 |
| 2046 | 3300053153 | Ga0500616_0044112 | Ga0500616_0044112_1041_2156 | 355 |
| 2047 | 3300053155 | Ga0500620_000576 | Ga0500620_000576_1395_2477 | 355 |
| 2048 | 3300053156 | Ga0500622_0000458 | Ga0500622_0000458_24381_25481 | 355 |
| 2049 | 3300053156 | Ga0500622_0000627 | Ga0500622_0000627_4370_5470 | 355 |
| 2050 | 3300053156 | Ga0500622_0004784 | Ga0500622_0004784_6083_7198 | 355 |
| 2051 | 3300053156 | Ga0500622_0009618 | Ga0500622_0009618_3855_4967 | 355 |
| 2052 | 3300053156 | Ga0500622_0035314 | Ga0500622_0035314_712_1827 | 355 |
| 2053 | 3300053157 | Ga0500624_005531 | Ga0500624_005531_524_1624 | 355 |
| 2054 | 3300053158 | Ga0500627_0072248 | Ga0500627_0072248_42_1157 | 355 |
| 2055 | 3300053158 | Ga0500627_0075524 | Ga0500627_0075524_99_1181 | 355 |
| 2056 | 3300053158 | Ga0500627_0093577 | Ga0500627_0093577_170_1270 | 355 |
| 2057 | 3300053161 | Ga0500634_0000041 | Ga0500634_0000041_46494_47579 | 355 |
| 2058 | 3300053161 | Ga0500634_0000261 | Ga0500634_0000261_3401_4501 | 355 |
| 2059 | 3300053177 | Ga0500636_0000180 | Ga0500636_0000180_16346_17446 | 355 |
| 2060 | 3300053730 | Ga0500645_001323 | Ga0500645_001323_10181_11296 | 355 |
| 2061 | 3300054114 | Ga0501084_0159408 | Ga0501084_0159408_564_1649 | 355 |
| 2062 | 3300059641 | Ga0587068_009854 | Ga0587068_009854_105_1205 | 355 |
| 2063 | 3300061734 | Ga0530510_0089281 | Ga0530510_0089281_442_1527 | 355 |
| 2064 | iso_pu_bacteria | 2643221610 | 2644063454 | 355 |
| 2065 | iso_pu_bacteria | 2643221668 | 2644374737 | 355 |
| 2066 | iso_pu_bacteria | 2643221675 | 2644414217 | 355 |
| 2067 | iso_pu_bacteria | 2643221680 | 2644447745 | 355 |
| 2068 | iso_pu_bacteria | 2643221726 | 2644690218 | 355 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cxr-assembly4.cif.gz_D | crystal structure of mray bound to a sphaerimicin analogue | 0.9632 | 23 | 351 |
| 6oyz-assembly4.cif.gz_D | crystal structure of mray bound to capuramycin | 0.9563 | 20 | 351 |
| 6oyz-assembly2.cif.gz_C | crystal structure of mray bound to capuramycin | 0.9557 | 24 | 351 |
| 6oz6-assembly4.cif.gz_D | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9539 | 24 | 351 |
| 6oyz-assembly1.cif.gz_A | crystal structure of mray bound to capuramycin | 0.9538 | 20 | 351 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0CC63_1_145_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.3877 | 96 | 245 | 1.10.287.3510 |
| af_P0ADJ8_1_145_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3589 | 166 | 277 | 1.20.1250.20 |
| 4p18E00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.3579 | 184 | 250 | 1.20.1260.10 |
| af_P0CC63_1_145_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.3168 | 96 | 245 | 1.10.287.3510 |
| af_A4QN56_306_560_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3018 | 100 | 350 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6UUB9-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9948 | 198 | 353 |
GO:0005886
GO:0008963 GO:0009252 GO:0046872 GO:0071555 |
| AF-A0A3S1VV32-F1-model_v4 | deleted | 0.9933 | 184 | 336 |
|
| AF-A0A2X3HJK8-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9931 | 197 | 353 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0051992 GO:0071555 |
| AF-A0A431JKN2-F1-model_v4 | deleted | 0.9911 | 1 | 322 |
|
| AF-A0A6N6S6W3-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9906 | 173 | 348 |
GO:0005886
GO:0008963 GO:0009252 GO:0046872 GO:0051992 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar