metagRoot

F496337

General Info

Members	Datasets	Scaffolds	Average Seq Length
2063	802	4126	139

Family's Representative Sequence

Representative Sequence	3300046455\|Ga0495603_0011788\|Ga0495603_0011788_4595_4987
Length	130
Sequence	MFVNRRDVQIQWGDCDPANIVYYPRYFAKQDIIRKYGLVGIPMVDTRAKFYIASTHGDWITIESRIERFKRSSFEVAHKVFKGEALAIEAFETRVLVGRHPDDPARLKSAPFPEEIIERFTRADQARCIV

Samples

	Sample ID	Description	Type	Environment
1	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
2	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
3	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
4	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
5	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
6	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
7	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
8	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
9	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
10	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
11	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
12	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
13	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
14	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
15	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
16	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
17	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
18	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
19	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
20	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
21	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
22	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
23	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
24	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
25	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
26	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
27	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
28	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
29	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
30	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
31	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
32	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
33	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
34	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
35	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
36	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
37	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
38	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
39	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
40	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
41	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
42	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
43	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
44	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
45	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
46	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
47	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
48	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
49	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
50	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
51	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
52	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
53	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
54	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
55	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
56	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
57	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
58	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
59	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
60	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
61	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
62	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
63	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
64	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
65	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
66	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
67	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
68	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
69	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
70	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
71	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
72	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
73	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
74	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
75	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
76	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
77	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
78	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
79	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
80	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
81	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
82	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
83	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
84	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
85	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
86	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
87	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
88	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
89	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
90	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
91	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
92	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
93	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
94	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
95	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
96	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
97	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
98	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
99	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
100	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
101	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
102	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
103	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
104	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
105	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
106	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
107	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
108	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
109	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
110	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
111	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
112	3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Metagenome	Nodule
113	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
114	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
115	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
116	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
117	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
118	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
119	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
120	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
121	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
122	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
123	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
124	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
125	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
126	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
127	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
128	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
129	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
130	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
131	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
132	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
133	3300012483	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610	Metagenome	Rhizosphere
134	3300012490	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610	Metagenome	Rhizosphere
135	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
136	3300012508	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510	Metagenome	Rhizosphere
137	3300012515	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610	Metagenome	Rhizosphere
138	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
139	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
140	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
141	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
142	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
143	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
144	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
145	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
146	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
147	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
148	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
149	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
150	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
151	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
152	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
153	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
154	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
155	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
156	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
157	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
158	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
159	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
160	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
161	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
162	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
163	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
164	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
165	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
171	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
173	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
244	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
245	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
246	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
247	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
250	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
254	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
255	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
256	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
257	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
258	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
259	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
260	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
261	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
262	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
263	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
264	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
265	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
266	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
267	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
268	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
269	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
270	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
271	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
272	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
273	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
274	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
275	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
276	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
277	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
278	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
279	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
280	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
281	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
282	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
283	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
284	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
285	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
286	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
287	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
288	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
289	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
290	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
291	3300033544	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5	Metagenome	Unclassified
292	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
293	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
294	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
295	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
296	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
297	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
298	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
299	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
300	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
301	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
302	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
303	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
304	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
305	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
306	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
307	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
308	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
309	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
310	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
311	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
312	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
313	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
314	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
315	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
316	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
317	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
318	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
319	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
320	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
321	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
322	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
323	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
324	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
325	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
326	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
327	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
328	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
329	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
330	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
331	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
332	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
333	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
334	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
335	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
336	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
337	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
338	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
339	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
340	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
341	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
342	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
343	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
344	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
345	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
346	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
347	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
348	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
349	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
350	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
351	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
352	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
353	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
354	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
355	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
356	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
357	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
358	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
359	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
360	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
361	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
362	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
363	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
364	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
365	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
366	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
367	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
368	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
369	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
370	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
371	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
372	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
373	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
374	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
375	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
376	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
377	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
378	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
379	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
380	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
381	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
382	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
383	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
384	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
385	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
386	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
387	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
388	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
389	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
390	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
391	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
392	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
393	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
394	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
395	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
396	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
397	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
398	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
399	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
400	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
401	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
402	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
403	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
404	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
405	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
406	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
407	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
408	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
409	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
410	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
411	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
412	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
413	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
414	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
415	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
416	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
417	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
418	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
419	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
420	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
421	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
422	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
423	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
424	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
425	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
426	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
427	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
428	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
429	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
430	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
431	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
432	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
433	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
434	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
435	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
436	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
437	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
438	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
439	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
440	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
441	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
442	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
443	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
444	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
445	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
446	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
447	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
448	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
449	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
450	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
451	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
452	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
453	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
454	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
455	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
456	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
457	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
458	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
459	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
460	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
461	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
462	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
463	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
464	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
465	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
466	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
467	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
468	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
469	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
470	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
471	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
472	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
473	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
474	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
475	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
476	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
477	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
478	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
479	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
480	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
481	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
482	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
483	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
484	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
485	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
486	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
487	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
488	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
489	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
490	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
491	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
492	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
493	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
494	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
495	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
496	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
497	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
498	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
499	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
500	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
501	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
502	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
503	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
504	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
505	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
506	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
507	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
508	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
509	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
510	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
511	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
512	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
513	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
514	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
515	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
516	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
517	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
518	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
519	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
520	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
521	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
522	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
523	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
524	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
525	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
526	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
527	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
528	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
529	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
530	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
531	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
532	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
533	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
534	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
535	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
536	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
537	3300053106	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere	Metagenome	Endosphere
538	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
539	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
540	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
541	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
542	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
543	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
544	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
545	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
546	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
547	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
548	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
549	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
550	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
551	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
552	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
553	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
554	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
555	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
556	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
557	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
558	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
559	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
560	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
561	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
562	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
563	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
564	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
565	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
566	3300053722	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere	Metagenome	Endosphere
567	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
568	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
569	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
570	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
571	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
572	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
573	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
574	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
575	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
576	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
577	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
578	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
579	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
580	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
581	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
582	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
583	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
584	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
585	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
586	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
587	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
588	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
589	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
590	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
591	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
592	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
593	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
594	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
595	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
596	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
597	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
598	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
599	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
600	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
601	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
602	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
603	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
604	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
605	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
606	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
607	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
608	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
609	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
610	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
611	2791355199
612	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
613	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
614	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
615	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
616	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
617	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
618	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
619	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
620	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
621	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
622	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
623	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
624	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
625	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
626	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
627	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
628	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
629	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
630	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
631	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
632	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
633	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
634	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
635	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
636	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
637	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
638	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
639	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
640	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
641	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
642	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
643	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
644	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
645	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
646	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
647	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
648	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
649	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
650	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
651	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
652	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
653	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
654	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
655	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
656	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
657	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
658	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
659	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
660	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
661	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
662	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
663	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
664	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
665	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
666	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
667	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
668	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
669	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
670	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
671	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
672	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
673	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
674	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
675	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
676	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
677	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
678	2904699407
679	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
680	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
681	2906610324
682	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
683	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
684	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
685	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
686	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
687	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
688	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
689	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
690	2922368715
691	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
692	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
693	2922425934
694	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
695	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
696	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
697	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
698	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
699	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
700	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
701	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
702	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
703	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
704	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
705	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
706	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
707	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
708	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
709	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
710	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
711	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
712	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
713	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
714	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
715	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
716	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
717	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
718	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
719	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
720	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
721	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
722	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
723	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
724	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
725	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
726	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
727	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
728	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
729	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
730	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
731	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
732	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
733	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
734	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
735	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
736	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
737	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
738	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
739	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
740	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
741	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
742	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
743	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
744	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
745	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
746	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
747	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
748	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
749	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
750	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
751	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
752	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
753	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
754	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
755	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
756	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
757	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
758	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
759	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
760	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
761	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
762	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
763	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
764	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
765	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
766	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
767	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
768	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
769	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
770	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
771	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
772	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
773	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
774	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
775	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
776	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
777	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
778	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
779	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
780	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
781	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
782	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
783	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
784	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
785	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
786	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
787	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
788	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
789	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
790	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
791	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
792	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
793	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
794	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
795	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
796	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
797	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
798	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
799	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
800	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
801	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
802	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	89.26
Metatranscriptomes	0.05
Isolates	10.69

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.15
Nodule	8.77
Rhizoplane	5.77
Rhizosphere	65.34
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0495603_0011788	3300046455	Bacteria	5292
2	JGI24739J22299_10124799	3300001989	Bacteria	768
3	JGI24738J21930_10037237	3300002075	Bacteria	989
4	JGI24034J26672_10055359	3300002239	Bacteria	688
5	JGI25406J46586_10000233	3300003203	Bacteria	24719
6	JGI25165J46597_1008525	3300003214	Bacteria	1600
7	JGI25165J46597_1011314	3300003214	Bacteria	1277
8	JGI25153J46596_10003608	3300003215	Bacteria	8589
9	JGI25153J46596_10006371	3300003215	Bacteria	5987
10	JGI25153J46596_10013655	3300003215	Bacteria	3420
11	JGI25153J46596_10014278	3300003215	Bacteria	3310
12	JGI25153J46596_10047158	3300003215	Bacteria	1270
13	JGI25153J46596_10073495	3300003215	Bacteria	876
14	rootL2_10188137	3300003322	Bacteria	1261
15	JGI25160J50197_1002871	3300003354	Bacteria	7885
16	JGI25160J50197_1008049	3300003354	Bacteria	4052
17	JGI25160J50197_1035337	3300003354	Bacteria	1227
18	JGI25404J52841_10003860	3300003659	Bacteria	3000
19	JGI25404J52841_10007829	3300003659	Bacteria	2267
20	JGI25404J52841_10010100	3300003659	Bacteria	2027
21	JGI25404J52841_10024955	3300003659	Bacteria	1287
22	JGI25404J52841_10077074	3300003659	Bacteria	696
23	Ga0055539_1002270	3300003752	Bacteria	3021
24	Ga0055542_1012063	3300003762	Bacteria	1507
25	Ga0055529_1016643	3300003763	Bacteria	924
26	Ga0055526_1049892	3300003771	Bacteria	963
27	Ga0055531_10011226	3300003794	Bacteria	4350
28	JGI25405J52794_10025895	3300003911	Bacteria	1204
29	Ga0065165_1000917	3300005262	Bacteria	37935
30	Ga0065165_1001167	3300005262	Bacteria	30545
31	Ga0065165_1060570	3300005262	Bacteria	1038
32	Ga0065712_10350117	3300005290	Bacteria	788
33	Ga0065715_10307557	3300005293	Bacteria	1022
34	Ga0070658_10259657	3300005327	Bacteria	1475
35	Ga0070676_10216531	3300005328	Bacteria	1263
36	Ga0070683_100060073	3300005329	Bacteria	3532
37	Ga0070683_100062216	3300005329	Bacteria	3471
38	Ga0070683_100139445	3300005329	Bacteria	2297
39	Ga0070683_100347351	3300005329	Bacteria	1413
40	Ga0070677_10335551	3300005333	Bacteria	779
41	Ga0068869_100013881	3300005334	Bacteria	5371
42	Ga0068869_100044308	3300005334	Bacteria	3199
43	Ga0068869_100700177	3300005334	Bacteria	864
44	Ga0068869_101535378	3300005334	Bacteria	592
45	Ga0070666_10078034	3300005335	Bacteria	2260
46	Ga0070666_10332158	3300005335	Bacteria	1086
47	Ga0070680_100172603	3300005336	Bacteria	1820
48	Ga0070680_100319101	3300005336	Bacteria	1319
49	Ga0070682_100160839	3300005337	Bacteria	1551
50	Ga0070682_100237546	3300005337	Bacteria	1307
51	Ga0070682_100523821	3300005337	Bacteria	923
52	Ga0070682_100557643	3300005337	Bacteria	898
53	Ga0070682_100915457	3300005337	Bacteria	722
54	Ga0068868_100005952	3300005338	Bacteria	8601
55	Ga0068868_100009208	3300005338	Bacteria	7095
56	Ga0068868_100498836	3300005338	Bacteria	1066
57	Ga0070660_100061594	3300005339	Bacteria	2913
58	Ga0070660_100183335	3300005339	Bacteria	1695
59	Ga0070660_100258818	3300005339	Bacteria	1420
60	Ga0070660_100261744	3300005339	Bacteria	1412
61	Ga0070660_100545721	3300005339	Bacteria	967
62	Ga0070660_100739034	3300005339	Bacteria	826
63	Ga0070660_100796375	3300005339	Bacteria	795
64	Ga0070660_101112661	3300005339	Bacteria	669
65	Ga0070689_100469288	3300005340	Bacteria	1074
66	Ga0070687_100413356	3300005343	Bacteria	888
67	Ga0070661_100222751	3300005344	Bacteria	1447
68	Ga0070661_100424252	3300005344	Bacteria	1055
69	Ga0070661_100645758	3300005344	Bacteria	859
70	Ga0070668_100041755	3300005347	Bacteria	3514
71	Ga0070668_100325671	3300005347	Bacteria	1295
72	Ga0070668_100822166	3300005347	Bacteria	826
73	Ga0070668_101022168	3300005347	Bacteria	743
74	Ga0070668_101044508	3300005347	Bacteria	736
75	Ga0070668_101533663	3300005347	Bacteria	609
76	Ga0070669_100093363	3300005353	Bacteria	2259
77	Ga0070675_100826298	3300005354	Bacteria	847
78	Ga0070675_101305984	3300005354	Bacteria	668
79	Ga0070675_102084279	3300005354	Bacteria	523
80	Ga0070671_100138591	3300005355	Bacteria	2052
81	Ga0070671_100239690	3300005355	Bacteria	1539
82	Ga0070671_100314323	3300005355	Bacteria	1334
83	Ga0070671_100391892	3300005355	Bacteria	1188
84	Ga0070671_101529435	3300005355	Bacteria	591
85	Ga0070674_100246057	3300005356	Bacteria	1402
86	Ga0070674_101191985	3300005356	Bacteria	676
87	Ga0070674_101402435	3300005356	Bacteria	626
88	Ga0070673_100284803	3300005364	Bacteria	1450
89	Ga0070673_100720607	3300005364	Bacteria	917
90	Ga0070673_101271596	3300005364	Bacteria	691
91	Ga0070688_100067284	3300005365	Bacteria	2282
92	Ga0070688_100465419	3300005365	Bacteria	948
93	Ga0070688_100825585	3300005365	Bacteria	726
94	Ga0070659_100149609	3300005366	Bacteria	1904
95	Ga0070659_100172391	3300005366	Bacteria	1773
96	Ga0070659_100180187	3300005366	Bacteria	1734
97	Ga0070659_100453186	3300005366	Bacteria	1088
98	Ga0070659_100860696	3300005366	Bacteria	791
99	Ga0070659_100965790	3300005366	Bacteria	747
100	Ga0070667_100099699	3300005367	Bacteria	2508
101	Ga0070667_100701357	3300005367	Bacteria	937
102	Ga0070667_101768297	3300005367	Bacteria	582
103	Ga0070709_10001520	3300005434	Bacteria	12532
104	Ga0070709_10011423	3300005434	Bacteria	4949
105	Ga0070709_10025696	3300005434	Bacteria	3482
106	Ga0070709_10271732	3300005434	Bacteria	1228
107	Ga0070709_10639391	3300005434	Bacteria	823
108	Ga0070709_11111162	3300005434	Bacteria	633
109	Ga0070714_100086974	3300005435	Bacteria	2732
110	Ga0070714_100488678	3300005435	Bacteria	1173
111	Ga0070713_100003802	3300005436	Bacteria	9991
112	Ga0070713_100004746	3300005436	Bacteria	9191
113	Ga0070713_100032524	3300005436	Bacteria	4167
114	Ga0070713_100036537	3300005436	Bacteria	3965
115	Ga0070713_100081587	3300005436	Bacteria	2760
116	Ga0070713_100128293	3300005436	Bacteria	2234
117	Ga0070713_100135629	3300005436	Bacteria	2174
118	Ga0070710_10000656	3300005437	Bacteria	16428
119	Ga0070710_10002985	3300005437	Bacteria	8039
120	Ga0070710_10945793	3300005437	Bacteria	625
121	Ga0070701_10464715	3300005438	Bacteria	815
122	Ga0070711_100004436	3300005439	Bacteria	8279
123	Ga0070711_100005326	3300005439	Bacteria	7689
124	Ga0070711_100052438	3300005439	Bacteria	2807
125	Ga0070711_100065075	3300005439	Bacteria	2548
126	Ga0070711_100479027	3300005439	Bacteria	1023
127	Ga0070711_100900739	3300005439	Bacteria	755
128	Ga0070711_100960167	3300005439	Bacteria	732
129	Ga0070711_101229329	3300005439	Bacteria	648
130	Ga0070711_102034014	3300005439	Bacteria	505
131	Ga0070700_100373212	3300005441	Bacteria	1064
132	Ga0070700_100480586	3300005441	Bacteria	951
133	Ga0070694_100042928	3300005444	Bacteria	3021
134	Ga0070663_100034939	3300005455	Bacteria	3484
135	Ga0070663_100051373	3300005455	Bacteria	2936
136	Ga0070663_100086232	3300005455	Bacteria	2318
137	Ga0070663_100165497	3300005455	Bacteria	1705
138	Ga0070663_100868032	3300005455	Bacteria	778
139	Ga0070678_100030437	3300005456	Bacteria	3710
140	Ga0070678_100031850	3300005456	Bacteria	3642
141	Ga0070678_100047100	3300005456	Bacteria	3096
142	Ga0070678_100130216	3300005456	Bacteria	1998
143	Ga0070678_100403812	3300005456	Bacteria	1188
144	Ga0070678_101138721	3300005456	Bacteria	722
145	Ga0070662_100070508	3300005457	Bacteria	2575
146	Ga0070662_100399730	3300005457	Bacteria	1134
147	Ga0070662_100415085	3300005457	Bacteria	1113
148	Ga0070662_100461492	3300005457	Bacteria	1056
149	Ga0070662_101625903	3300005457	Bacteria	558
150	Ga0070681_10034725	3300005458	Bacteria	5064
151	Ga0070681_10179213	3300005458	Bacteria	2040
152	Ga0070681_10263644	3300005458	Bacteria	1635
153	Ga0070681_10802403	3300005458	Bacteria	858
154	Ga0070681_11110414	3300005458	Bacteria	712
155	Ga0068867_101168368	3300005459	Bacteria	705
156	Ga0070706_100494868	3300005467	Bacteria	1138
157	Ga0070706_100660236	3300005467	Bacteria	970
158	Ga0070706_100761862	3300005467	Bacteria	897
159	Ga0070707_100597574	3300005468	Bacteria	1066
160	Ga0070707_100769149	3300005468	Bacteria	926
161	Ga0070707_101273465	3300005468	Bacteria	701
162	Ga0070698_100658171	3300005471	Bacteria	989
163	Ga0070699_100889176	3300005518	Bacteria	816
164	Ga0070679_100017100	3300005530	Bacteria	7011
165	Ga0070679_100031850	3300005530	Bacteria	5213
166	Ga0070679_100164777	3300005530	Bacteria	2190
167	Ga0070679_100482531	3300005530	Bacteria	1184
168	Ga0070679_100845287	3300005530	Bacteria	858
169	Ga0070684_100027140	3300005535	Bacteria	4831
170	Ga0070684_100041359	3300005535	Bacteria	3973
171	Ga0070684_100057856	3300005535	Bacteria	3386
172	Ga0070684_100672431	3300005535	Bacteria	964
173	Ga0070684_100886275	3300005535	Bacteria	836
174	Ga0070697_100084079	3300005536	Bacteria	2624
175	Ga0070697_100468506	3300005536	Bacteria	1099
176	Ga0070697_100648376	3300005536	Bacteria	930
177	Ga0068853_100050201	3300005539	Bacteria	3588
178	Ga0068853_100067623	3300005539	Bacteria	3104
179	Ga0068853_100100953	3300005539	Bacteria	2551
180	Ga0068853_100436177	3300005539	Bacteria	1230
181	Ga0068853_100892211	3300005539	Bacteria	854
182	Ga0070672_100148895	3300005543	Bacteria	1935
183	Ga0070672_100194595	3300005543	Bacteria	1694
184	Ga0070686_100474910	3300005544	Bacteria	966
185	Ga0070696_100776194	3300005546	Bacteria	787
186	Ga0070693_100106549	3300005547	Bacteria	1717
187	Ga0070693_100114883	3300005547	Bacteria	1662
188	Ga0070693_100428212	3300005547	Bacteria	924
189	Ga0070693_100462570	3300005547	Bacteria	893
190	Ga0070693_100706343	3300005547	Bacteria	739
191	Ga0070693_101311867	3300005547	Bacteria	560
192	Ga0070665_100004629	3300005548	Bacteria	14379
193	Ga0070665_100015575	3300005548	Bacteria	7638
194	Ga0070665_100151226	3300005548	Bacteria	2324
195	Ga0070665_100259675	3300005548	Bacteria	1738
196	Ga0070665_100278469	3300005548	Bacteria	1674
197	Ga0070665_100520843	3300005548	Bacteria	1201
198	Ga0070665_100535932	3300005548	Bacteria	1182
199	Ga0070665_100626497	3300005548	Bacteria	1089
200	Ga0070665_100917352	3300005548	Bacteria	888
201	Ga0070665_101154974	3300005548	Bacteria	785
202	Ga0070704_100582200	3300005549	Bacteria	981
203	Ga0070704_100852080	3300005549	Bacteria	817
204	Ga0068855_100115681	3300005563	Bacteria	3074
205	Ga0068855_100142688	3300005563	Bacteria	2728
206	Ga0068855_100181157	3300005563	Bacteria	2382
207	Ga0068855_100273742	3300005563	Bacteria	1877
208	Ga0068855_100335002	3300005563	Bacteria	1670
209	Ga0068855_100354230	3300005563	Bacteria	1616
210	Ga0068855_100442905	3300005563	Bacteria	1418
211	Ga0068855_100988709	3300005563	Bacteria	884
212	Ga0068855_101536765	3300005563	Bacteria	682
213	Ga0070664_100283740	3300005564	Bacteria	1493
214	Ga0070664_100524591	3300005564	Bacteria	1093
215	Ga0070664_100645259	3300005564	Bacteria	984
216	Ga0070664_100722888	3300005564	Bacteria	928
217	Ga0070664_101029975	3300005564	Bacteria	774
218	Ga0068857_100084143	3300005577	Bacteria	2842
219	Ga0068857_100095998	3300005577	Bacteria	2656
220	Ga0068857_100631988	3300005577	Bacteria	1013
221	Ga0068857_100657412	3300005577	Bacteria	993
222	Ga0068857_101963032	3300005577	Bacteria	574
223	Ga0068854_100035331	3300005578	Bacteria	3497
224	Ga0068854_100144716	3300005578	Bacteria	1827
225	Ga0068854_100176550	3300005578	Bacteria	1666
226	Ga0068854_100270200	3300005578	Bacteria	1365
227	Ga0068854_100297991	3300005578	Bacteria	1303
228	Ga0068854_100831851	3300005578	Bacteria	807
229	Ga0068854_100868279	3300005578	Bacteria	791
230	Ga0068856_100000137	3300005614	Bacteria	73762
231	Ga0068856_100081950	3300005614	Bacteria	3201
232	Ga0068856_100150572	3300005614	Bacteria	2336
233	Ga0068856_100151171	3300005614	Bacteria	2331
234	Ga0068856_100851816	3300005614	Bacteria	931
235	Ga0068856_100915603	3300005614	Bacteria	896
236	Ga0068856_101375148	3300005614	Bacteria	721
237	Ga0070702_100037542	3300005615	Bacteria	2691
238	Ga0070702_100456722	3300005615	Bacteria	928
239	Ga0068852_100041075	3300005616	Bacteria	3906
240	Ga0068852_100351507	3300005616	Bacteria	1439
241	Ga0068852_100486940	3300005616	Bacteria	1226
242	Ga0068852_100532169	3300005616	Bacteria	1174
243	Ga0068852_100793539	3300005616	Bacteria	961
244	Ga0068852_101101163	3300005616	Bacteria	814
245	Ga0068859_100119183	3300005617	Bacteria	2705
246	Ga0068859_100190632	3300005617	Bacteria	2134
247	Ga0068859_100439644	3300005617	Bacteria	1400
248	Ga0068859_100757868	3300005617	Bacteria	1059
249	Ga0068859_101222379	3300005617	Bacteria	828
250	Ga0068864_100050250	3300005618	Bacteria	3588
251	Ga0068866_10085758	3300005718	Bacteria	1702
252	Ga0068866_10175721	3300005718	Bacteria	1261
253	Ga0068861_100034317	3300005719	Bacteria	3751
254	Ga0068861_101070439	3300005719	Bacteria	773
255	Ga0068861_102700276	3300005719	Bacteria	501
256	Ga0068851_10210401	3300005834	Bacteria	1089
257	Ga0068851_10554852	3300005834	Bacteria	695
258	Ga0068870_10193910	3300005840	Bacteria	1228
259	Ga0068870_10274818	3300005840	Bacteria	1054
260	Ga0068863_100186135	3300005841	Bacteria	1994
261	Ga0068863_100420950	3300005841	Bacteria	1308
262	Ga0068863_100582881	3300005841	Bacteria	1106
263	Ga0068863_100596810	3300005841	Bacteria	1093
264	Ga0068858_100045860	3300005842	Bacteria	4052
265	Ga0068858_100097155	3300005842	Bacteria	2746
266	Ga0068858_100127363	3300005842	Bacteria	2385
267	Ga0068858_100153712	3300005842	Bacteria	2164
268	Ga0068858_100528007	3300005842	Bacteria	1141
269	Ga0068858_100994344	3300005842	Bacteria	822
270	Ga0068860_100000313	3300005843	Bacteria	66545
271	Ga0068860_100305798	3300005843	Bacteria	1558
272	Ga0068860_100350641	3300005843	Bacteria	1452
273	Ga0068860_100549852	3300005843	Bacteria	1156
274	Ga0068860_100739212	3300005843	Bacteria	995
275	Ga0068860_100996661	3300005843	Bacteria	856
276	Ga0068860_101052254	3300005843	Bacteria	832
277	Ga0068860_102069769	3300005843	Bacteria	591
278	Ga0068862_100060270	3300005844	Bacteria	3259
279	Ga0068862_100146849	3300005844	Bacteria	2096
280	Ga0068862_101777401	3300005844	Bacteria	625
281	Ga0081455_10023465	3300005937	Bacteria	5739
282	Ga0081455_10197216	3300005937	Bacteria	1511
283	Ga0081455_10205210	3300005937	Bacteria	1473
284	Ga0081455_10217359	3300005937	Bacteria	1419
285	Ga0081455_10251587	3300005937	Bacteria	1292
286	Ga0081455_10935094	3300005937	Bacteria	538
287	Ga0081538_10047308	3300005981	Bacteria	2640
288	Ga0081540_1003389	3300005983	Bacteria	12636
289	Ga0081540_1005656	3300005983	Bacteria	9295
290	Ga0081540_1005657	3300005983	Bacteria	9294
291	Ga0081540_1012479	3300005983	Bacteria	5588
292	Ga0081540_1013267	3300005983	Bacteria	5368
293	Ga0081540_1019710	3300005983	Bacteria	4086
294	Ga0081540_1030350	3300005983	Bacteria	2995
295	Ga0081540_1032245	3300005983	Bacteria	2865
296	Ga0081540_1060906	3300005983	Bacteria	1802
297	Ga0081540_1176736	3300005983	Bacteria	805
298	Ga0081540_1233896	3300005983	Bacteria	647
299	Ga0081539_10000157	3300005985	Bacteria	158278
300	Ga0081539_10002599	3300005985	Bacteria	24763
301	Ga0081539_10017515	3300005985	Bacteria	5025
302	Ga0081539_10022796	3300005985	Bacteria	4126
303	Ga0081539_10051720	3300005985	Bacteria	2313
304	Ga0081539_10057358	3300005985	Bacteria	2155
305	Ga0081539_10488174	3300005985	Bacteria	510
306	Ga0070717_10001671	3300006028	Bacteria	15424
307	Ga0070717_10017257	3300006028	Bacteria	5613
308	Ga0070717_10743691	3300006028	Bacteria	891
309	Ga0075365_10042277	3300006038	Bacteria	2979
310	Ga0075365_10080973	3300006038	Bacteria	2199
311	Ga0075365_10100347	3300006038	Bacteria	1981
312	Ga0075365_10138586	3300006038	Bacteria	1688
313	Ga0075365_10177196	3300006038	Bacteria	1490
314	Ga0075368_10047928	3300006042	Bacteria	1692
315	Ga0075368_10098548	3300006042	Bacteria	1199
316	Ga0075368_10111463	3300006042	Bacteria	1128
317	Ga0075363_100002704	3300006048	Bacteria	7338
318	Ga0075363_100041425	3300006048	Bacteria	2429
319	Ga0075363_100055098	3300006048	Bacteria	2129
320	Ga0075363_100269458	3300006048	Bacteria	983
321	Ga0075363_100353481	3300006048	Bacteria	858
322	Ga0075364_10219482	3300006051	Bacteria	1290
323	Ga0075364_10543149	3300006051	Bacteria	794
324	Ga0070715_10000590	3300006163	Bacteria	9547
325	Ga0070715_10906601	3300006163	Bacteria	543
326	Ga0070716_100015909	3300006173	Bacteria	3875
327	Ga0070716_100017234	3300006173	Bacteria	3741
328	Ga0070716_100086034	3300006173	Bacteria	1890
329	Ga0070716_100247411	3300006173	Bacteria	1212
330	Ga0070716_100874762	3300006173	Bacteria	701
331	Ga0070712_100002371	3300006175	Bacteria	11602
332	Ga0070712_100021384	3300006175	Bacteria	4250
333	Ga0070712_100200762	3300006175	Bacteria	1566
334	Ga0070712_100306110	3300006175	Bacteria	1288
335	Ga0070712_100444424	3300006175	Bacteria	1078
336	Ga0070712_100975851	3300006175	Bacteria	733
337	Ga0070712_101710623	3300006175	Bacteria	551
338	Ga0075362_10051603	3300006177	Bacteria	1841
339	Ga0075362_10172173	3300006177	Bacteria	1046
340	Ga0075362_10244591	3300006177	Bacteria	881
341	Ga0075362_10373290	3300006177	Bacteria	717
342	Ga0075367_10012975	3300006178	Bacteria	4464
343	Ga0075367_10102176	3300006178	Bacteria	1753
344	Ga0075367_10264291	3300006178	Bacteria	1080
345	Ga0075367_10311218	3300006178	Bacteria	992
346	Ga0075367_10645809	3300006178	Bacteria	673
347	Ga0075367_10962545	3300006178	Bacteria	545
348	Ga0075369_10039962	3300006186	Bacteria	2004
349	Ga0075369_10163724	3300006186	Bacteria	1020
350	Ga0075369_10266674	3300006186	Bacteria	796
351	Ga0075369_10441589	3300006186	Bacteria	616
352	Ga0075366_10131341	3300006195	Bacteria	1511
353	Ga0075366_10287378	3300006195	Bacteria	1005
354	Ga0075366_10789630	3300006195	Bacteria	590
355	Ga0097621_100014735	3300006237	Bacteria	5860
356	Ga0097621_100688012	3300006237	Bacteria	941
357	Ga0097621_101504491	3300006237	Bacteria	639
358	Ga0075370_10001262	3300006353	Bacteria	10776
359	Ga0075370_10189481	3300006353	Bacteria	1211
360	Ga0075370_10191797	3300006353	Bacteria	1204
361	Ga0075370_10589033	3300006353	Bacteria	673
362	Ga0075370_10841497	3300006353	Bacteria	560
363	Ga0068871_100289957	3300006358	Bacteria	1434
364	Ga0068871_100390426	3300006358	Bacteria	1238
365	Ga0068871_101450764	3300006358	Bacteria	648
366	Ga0075428_100367202	3300006844	Bacteria	1544
367	Ga0075428_100424739	3300006844	Bacteria	1424
368	Ga0075430_100788751	3300006846	Bacteria	783
369	Ga0075430_101131487	3300006846	Bacteria	645
370	Ga0075434_100412054	3300006871	Bacteria	1372
371	Ga0075434_100486760	3300006871	Bacteria	1255
372	Ga0075429_100282742	3300006880	Bacteria	1453
373	Ga0068865_100066305	3300006881	Bacteria	2546
374	Ga0068865_101009708	3300006881	Bacteria	729
375	Ga0068865_101339002	3300006881	Bacteria	638
376	Ga0075436_100135585	3300006914	Bacteria	1728
377	Ga0075436_100831655	3300006914	Bacteria	689
378	Ga0097620_100119191	3300006931	Bacteria	2705
379	Ga0097620_100190621	3300006931	Bacteria	2134
380	Ga0097620_100439625	3300006931	Bacteria	1400
381	Ga0097620_100757865	3300006931	Bacteria	1059
382	Ga0097620_101222319	3300006931	Bacteria	828
383	Ga0099825_1041834	3300006941	Bacteria	1295
384	Ga0099824_1008303	3300006942	Bacteria	13338
385	Ga0099824_1010623	3300006942	Bacteria	10757
386	Ga0099822_1000541	3300006943	Bacteria	35996
387	Ga0075435_100036950	3300007076	Bacteria	3886
388	Ga0075435_100188979	3300007076	Bacteria	1743
389	Ga0099795_10012521	3300007788	Bacteria	2576
390	Ga0099795_10089424	3300007788	Bacteria	1191
391	Ga0099795_10113640	3300007788	Bacteria	1076
392	Ga0099795_10177007	3300007788	Bacteria	889
393	Ga0099795_10246643	3300007788	Bacteria	769
394	Ga0105251_10210152	3300009011	Bacteria	876
395	Ga0105240_10013303	3300009093	Bacteria	11310
396	Ga0105240_10033967	3300009093	Bacteria	6585
397	Ga0105240_10094752	3300009093	Bacteria	3641
398	Ga0105240_10136853	3300009093	Bacteria	2933
399	Ga0105240_10174427	3300009093	Bacteria	2543
400	Ga0105240_10596271	3300009093	Bacteria	1217
401	Ga0105240_10919059	3300009093	Bacteria	940
402	Ga0105240_12782948	3300009093	Bacteria	503
403	Ga0111539_10264383	3300009094	Bacteria	2003
404	Ga0111539_10464737	3300009094	Bacteria	1473
405	Ga0105245_10274375	3300009098	Bacteria	1646
406	Ga0105245_10344617	3300009098	Bacteria	1474
407	Ga0105245_10478086	3300009098	Bacteria	1259
408	Ga0105245_10507544	3300009098	Bacteria	1223
409	Ga0105247_10016513	3300009101	Bacteria	4425
410	Ga0105247_10044475	3300009101	Bacteria	2723
411	Ga0105247_10073098	3300009101	Bacteria	2148
412	Ga0105247_10341307	3300009101	Bacteria	1051
413	Ga0105247_10363220	3300009101	Bacteria	1022
414	Ga0105247_11273866	3300009101	Bacteria	589
415	Ga0114129_10285040	3300009147	Bacteria	2206
416	Ga0114129_11660062	3300009147	Bacteria	781
417	Ga0105243_10079455	3300009148	Bacteria	2673
418	Ga0105243_10158432	3300009148	Bacteria	1949
419	Ga0105243_10361895	3300009148	Bacteria	1335
420	Ga0105243_10800944	3300009148	Bacteria	929
421	Ga0105243_11675559	3300009148	Bacteria	664
422	Ga0105243_12055230	3300009148	Bacteria	606
423	Ga0105241_10004267	3300009174	Bacteria	10572
424	Ga0105241_10081363	3300009174	Bacteria	2537
425	Ga0105241_10083949	3300009174	Bacteria	2500
426	Ga0105241_10172549	3300009174	Bacteria	1787
427	Ga0105241_10175798	3300009174	Bacteria	1772
428	Ga0105241_10364396	3300009174	Bacteria	1258
429	Ga0105241_10702151	3300009174	Bacteria	923
430	Ga0105241_11811373	3300009174	Bacteria	596
431	Ga0105242_10626556	3300009176	Bacteria	1043
432	Ga0105242_10735085	3300009176	Bacteria	970
433	Ga0105242_12887996	3300009176	Bacteria	531
434	Ga0105248_10306033	3300009177	Bacteria	1790
435	Ga0105248_11052858	3300009177	Bacteria	919
436	Ga0105248_11742282	3300009177	Bacteria	706
437	Ga0105237_10017841	3300009545	Bacteria	7357
438	Ga0105237_10020621	3300009545	Bacteria	6791
439	Ga0105237_10082692	3300009545	Bacteria	3201
440	Ga0105237_10111420	3300009545	Bacteria	2729
441	Ga0105237_10132493	3300009545	Bacteria	2487
442	Ga0105237_10145400	3300009545	Bacteria	2366
443	Ga0105237_10312710	3300009545	Bacteria	1574
444	Ga0105237_10459852	3300009545	Bacteria	1279
445	Ga0105237_10533313	3300009545	Bacteria	1180
446	Ga0105237_10646743	3300009545	Bacteria	1064
447	Ga0105238_10153984	3300009551	Bacteria	2274
448	Ga0105238_10179888	3300009551	Bacteria	2092
449	Ga0105238_10220820	3300009551	Bacteria	1871
450	Ga0105238_10778791	3300009551	Bacteria	971
451	Ga0105238_11199051	3300009551	Bacteria	783
452	Ga0105238_11606169	3300009551	Bacteria	680
453	Ga0105249_10097572	3300009553	Bacteria	2759
454	Ga0105249_10223880	3300009553	Bacteria	1852
455	Ga0105249_11920669	3300009553	Bacteria	665
456	Ga0099796_10027886	3300010159	Bacteria	1808
457	Ga0099796_10049785	3300010159	Bacteria	1450
458	Ga0099796_10244885	3300010159	Bacteria	743
459	Ga0099796_10418346	3300010159	Bacteria	591
460	Ga0105239_10023011	3300010375	Bacteria	6870
461	Ga0105239_10031553	3300010375	Bacteria	5826
462	Ga0105239_10066232	3300010375	Bacteria	3968
463	Ga0105239_10099249	3300010375	Bacteria	3219
464	Ga0105239_10135023	3300010375	Bacteria	2747
465	Ga0105239_10180495	3300010375	Bacteria	2362
466	Ga0105239_10500715	3300010375	Bacteria	1381
467	Ga0105239_10832606	3300010375	Bacteria	1058
468	Ga0105239_10988961	3300010375	Bacteria	967
469	Ga0105239_12726441	3300010375	Bacteria	577
470	Ga0105246_10031978	3300011119	Bacteria	3486
471	Ga0105246_10052370	3300011119	Bacteria	2806
472	Ga0105246_10198188	3300011119	Bacteria	1559
473	Ga0105246_10444436	3300011119	Bacteria	1088
474	Ga0105246_11087899	3300011119	Bacteria	729
475	Ga0105246_11245971	3300011119	Bacteria	687
476	Ga0157337_1014589	3300012483	Bacteria	660
477	Ga0157322_1005591	3300012490	Bacteria	869
478	Ga0157347_1037691	3300012502	Bacteria	629
479	Ga0157315_1010385	3300012508	Bacteria	819
480	Ga0157338_1022752	3300012515	Bacteria	743
481	Ga0157373_10181973	3300013100	Bacteria	1480
482	Ga0157371_10425358	3300013102	Bacteria	974
483	Ga0157370_10093493	3300013104	Bacteria	2822
484	Ga0157370_10184513	3300013104	Bacteria	1937
485	Ga0157370_10209538	3300013104	Bacteria	1807
486	Ga0157370_10822186	3300013104	Bacteria	845
487	Ga0157369_10006548	3300013105	Bacteria	13480
488	Ga0157369_10112437	3300013105	Bacteria	2893
489	Ga0157369_10134403	3300013105	Bacteria	2619
490	Ga0157369_10341636	3300013105	Bacteria	1555
491	Ga0157369_11396543	3300013105	Bacteria	713
492	Ga0157369_11450812	3300013105	Bacteria	698
493	Ga0157374_10179664	3300013296	Bacteria	2066
494	Ga0157374_10403436	3300013296	Bacteria	1364
495	Ga0157374_11019747	3300013296	Bacteria	847
496	Ga0157374_11349626	3300013296	Bacteria	735
497	Ga0157374_11356245	3300013296	Bacteria	734
498	Ga0157378_10001192	3300013297	Bacteria	23599
499	Ga0157378_10031729	3300013297	Bacteria	4666
500	Ga0157378_10410477	3300013297	Bacteria	1336
501	Ga0157378_10810695	3300013297	Bacteria	962
502	Ga0157378_11075757	3300013297	Bacteria	841
503	Ga0157378_11782155	3300013297	Bacteria	663
504	Ga0157378_12324002	3300013297	Bacteria	588
505	Ga0163162_10081273	3300013306	Bacteria	3311
506	Ga0163162_10105428	3300013306	Bacteria	2913
507	Ga0163162_10164090	3300013306	Bacteria	2345
508	Ga0163162_10234128	3300013306	Bacteria	1967
509	Ga0163162_10299853	3300013306	Bacteria	1739
510	Ga0163162_10377851	3300013306	Bacteria	1550
511	Ga0163162_10628014	3300013306	Bacteria	1199
512	Ga0163162_10807234	3300013306	Bacteria	1055
513	Ga0163162_10994774	3300013306	Bacteria	948
514	Ga0157372_10139256	3300013307	Bacteria	2795
515	Ga0157372_10172733	3300013307	Bacteria	2501
516	Ga0157372_10299932	3300013307	Bacteria	1869
517	Ga0157372_10500575	3300013307	Bacteria	1417
518	Ga0157372_10718321	3300013307	Bacteria	1162
519	Ga0157372_10901442	3300013307	Bacteria	1026
520	Ga0157372_12195483	3300013307	Bacteria	634
521	Ga0157375_10006444	3300013308	Bacteria	10223
522	Ga0157375_10070094	3300013308	Bacteria	3514
523	Ga0157375_10195176	3300013308	Bacteria	2179
524	Ga0157375_11056116	3300013308	Bacteria	950
525	Ga0157375_11475793	3300013308	Bacteria	802
526	Ga0157375_12095425	3300013308	Bacteria	673
527	Ga0157375_13263587	3300013308	Bacteria	541
528	Ga0163163_10010769	3300014325	Bacteria	8250
529	Ga0163163_10270858	3300014325	Bacteria	1749
530	Ga0163163_10326252	3300014325	Bacteria	1589
531	Ga0163163_10574974	3300014325	Bacteria	1190
532	Ga0163163_11331624	3300014325	Bacteria	780
533	Ga0163163_11429976	3300014325	Bacteria	753
534	Ga0157380_10136861	3300014326	Bacteria	2098
535	Ga0157380_10574738	3300014326	Bacteria	1110
536	Ga0157380_10869541	3300014326	Bacteria	925
537	Ga0157380_10974683	3300014326	Bacteria	879
538	Ga0157380_11485087	3300014326	Bacteria	730
539	Ga0157380_12589352	3300014326	Bacteria	573
540	Ga0157377_10166713	3300014745	Bacteria	1374
541	Ga0157377_10743533	3300014745	Bacteria	717
542	Ga0157379_10394413	3300014968	Bacteria	1271
543	Ga0157379_11883202	3300014968	Bacteria	589
544	Ga0157379_11935995	3300014968	Bacteria	581
545	Ga0157376_10106890	3300014969	Bacteria	2456
546	Ga0157376_10121557	3300014969	Bacteria	2315
547	Ga0157376_10179717	3300014969	Bacteria	1933
548	Ga0157376_11243925	3300014969	Bacteria	773
549	Ga0157376_12358623	3300014969	Bacteria	571
550	Ga0182006_1137118	3300015261	Bacteria	838
551	Ga0182007_10062995	3300015262	Bacteria	1215
552	Ga0163161_10234329	3300017792	Bacteria	1425
553	Ga0163161_10555463	3300017792	Bacteria	942
554	Ga0214544_1000003	3300021320	Bacteria	643752
555	Ga0214542_1000022	3300021321	Bacteria	193578
556	Ga0214545_1000010	3300021324	Bacteria	193578
557	Ga0214543_1000035	3300021327	Bacteria	183100
558	Ga0213873_10001016	3300021358	Bacteria	4551
559	Ga0213872_10300810	3300021361	Bacteria	666
560	Ga0213874_10079548	3300021377	Bacteria	1060
561	Ga0213874_10089417	3300021377	Bacteria	1009
562	Ga0213876_10017171	3300021384	Bacteria	3821
563	Ga0213876_10031721	3300021384	Bacteria	2787
564	Ga0213875_10087604	3300021388	Bacteria	1452
565	Ga0213871_10068397	3300021441	Bacteria	1000
566	Ga0213871_10222011	3300021441	Bacteria	594
567	Ga0209677_100492	3300025253	Bacteria	22270
568	Ga0209677_103568	3300025253	Bacteria	4952
569	Ga0209148_1000267	3300025254	Bacteria	81839
570	Ga0209148_1018192	3300025254	Bacteria	1183
571	Ga0209233_1001537	3300025261	Bacteria	9046
572	Ga0209233_1004347	3300025261	Bacteria	4836
573	Ga0209233_1013744	3300025261	Bacteria	2304
574	Ga0209233_1035962	3300025261	Bacteria	1113
575	Ga0209455_1004219	3300025272	Bacteria	4792
576	Ga0209455_1004254	3300025272	Bacteria	4760
577	Ga0209455_1008390	3300025272	Bacteria	2811
578	Ga0209455_1015806	3300025272	Bacteria	1643
579	Ga0209130_1039522	3300025284	Bacteria	918
580	Ga0209564_1011905	3300025295	Bacteria	3847
581	Ga0209564_1022023	3300025295	Bacteria	2267
582	Ga0209758_1000015	3300025297	Bacteria	851943
583	Ga0209758_1000711	3300025297	Bacteria	49164
584	Ga0209758_1000764	3300025297	Bacteria	46385
585	Ga0209758_1001094	3300025297	Bacteria	35071
586	Ga0209758_1001468	3300025297	Bacteria	27665
587	Ga0209758_1004096	3300025297	Bacteria	12498
588	Ga0209758_1025205	3300025297	Bacteria	2617
589	Ga0209758_1102925	3300025297	Bacteria	807
590	Ga0209256_1002592	3300025299	Bacteria	14393
591	Ga0209256_1069845	3300025299	Bacteria	793
592	Ga0207426_1000368	3300025302	Bacteria	79715
593	Ga0207426_1005258	3300025302	Bacteria	5970
594	Ga0207426_1013131	3300025302	Bacteria	3083
595	Ga0209051_1086739	3300025303	Bacteria	884
596	Ga0209257_1070321	3300025304	Bacteria	924
597	Ga0207697_10329959	3300025315	Bacteria	677
598	Ga0207656_10102737	3300025321	Bacteria	1312
599	Ga0207656_10137583	3300025321	Bacteria	1149
600	Ga0207656_10433794	3300025321	Bacteria	663
601	Ga0207682_10495817	3300025893	Bacteria	578
602	Ga0207692_10004867	3300025898	Bacteria	5346
603	Ga0207692_10063797	3300025898	Bacteria	1916
604	Ga0207642_10364001	3300025899	Bacteria	856
605	Ga0207642_10472105	3300025899	Bacteria	763
606	Ga0207642_10702272	3300025899	Bacteria	637
607	Ga0207710_10140399	3300025900	Bacteria	1166
608	Ga0207710_10214453	3300025900	Bacteria	954
609	Ga0207710_10265166	3300025900	Bacteria	862
610	Ga0207710_10375886	3300025900	Bacteria	727
611	Ga0207710_10509391	3300025900	Bacteria	625
612	Ga0207688_10016777	3300025901	Bacteria	3976
613	Ga0207688_10063558	3300025901	Bacteria	2082
614	Ga0207688_10117643	3300025901	Bacteria	1548
615	Ga0207688_10212700	3300025901	Bacteria	1162
616	Ga0207680_10338513	3300025903	Bacteria	1055
617	Ga0207647_10211956	3300025904	Bacteria	1118
618	Ga0207685_10114155	3300025905	Bacteria	1176
619	Ga0207685_10260687	3300025905	Bacteria	842
620	Ga0207685_10527314	3300025905	Bacteria	625
621	Ga0207699_10001435	3300025906	Bacteria	11313
622	Ga0207699_10003885	3300025906	Bacteria	7136
623	Ga0207699_10006921	3300025906	Bacteria	5519
624	Ga0207699_10074346	3300025906	Bacteria	2087
625	Ga0207645_10191598	3300025907	Bacteria	1344
626	Ga0207645_10238665	3300025907	Bacteria	1201
627	Ga0207643_10076315	3300025908	Bacteria	1936
628	Ga0207643_10450257	3300025908	Bacteria	819
629	Ga0207705_10029183	3300025909	Bacteria	3932
630	Ga0207705_10108063	3300025909	Bacteria	2053
631	Ga0207705_10156485	3300025909	Bacteria	1710
632	Ga0207684_10142789	3300025910	Bacteria	2059
633	Ga0207684_10167560	3300025910	Bacteria	1893
634	Ga0207684_10460353	3300025910	Bacteria	1092
635	Ga0207654_10103234	3300025911	Bacteria	1760
636	Ga0207654_10156794	3300025911	Bacteria	1467
637	Ga0207654_10195836	3300025911	Bacteria	1327
638	Ga0207654_10283071	3300025911	Bacteria	1122
639	Ga0207654_10343098	3300025911	Bacteria	1026
640	Ga0207654_10743045	3300025911	Bacteria	706
641	Ga0207707_10000143	3300025912	Bacteria	74226
642	Ga0207707_10000613	3300025912	Bacteria	35676
643	Ga0207707_10022062	3300025912	Bacteria	5565
644	Ga0207707_10030362	3300025912	Bacteria	4728
645	Ga0207707_10049787	3300025912	Bacteria	3650
646	Ga0207695_10000059	3300025913	Bacteria	363920
647	Ga0207695_10020632	3300025913	Bacteria	7543
648	Ga0207695_10111764	3300025913	Bacteria	2711
649	Ga0207695_10148861	3300025913	Bacteria	2282
650	Ga0207695_10213948	3300025913	Bacteria	1837
651	Ga0207695_10364142	3300025913	Bacteria	1332
652	Ga0207695_10912842	3300025913	Bacteria	758
653	Ga0207671_10106177	3300025914	Bacteria	2132
654	Ga0207671_10170809	3300025914	Bacteria	1688
655	Ga0207671_10665477	3300025914	Bacteria	829
656	Ga0207671_10676812	3300025914	Bacteria	821
657	Ga0207693_10005195	3300025915	Bacteria	10899
658	Ga0207693_10032442	3300025915	Bacteria	4123
659	Ga0207693_10088211	3300025915	Bacteria	2431
660	Ga0207693_10159692	3300025915	Bacteria	1773
661	Ga0207693_10203937	3300025915	Bacteria	1555
662	Ga0207693_10403137	3300025915	Bacteria	1069
663	Ga0207663_10001411	3300025916	Bacteria	11145
664	Ga0207663_10048671	3300025916	Bacteria	2625
665	Ga0207663_10100981	3300025916	Bacteria	1937
666	Ga0207663_10546993	3300025916	Bacteria	905
667	Ga0207663_10623640	3300025916	Bacteria	849
668	Ga0207663_11049581	3300025916	Bacteria	654
669	Ga0207663_11259923	3300025916	Bacteria	596
670	Ga0207660_10038751	3300025917	Bacteria	3328
671	Ga0207660_10429474	3300025917	Bacteria	1066
672	Ga0207662_10202787	3300025918	Bacteria	1285
673	Ga0207657_10006552	3300025919	Bacteria	12056
674	Ga0207657_10151681	3300025919	Bacteria	1887
675	Ga0207657_10214450	3300025919	Bacteria	1544
676	Ga0207657_10241019	3300025919	Bacteria	1444
677	Ga0207657_10296410	3300025919	Bacteria	1281
678	Ga0207657_10362729	3300025919	Bacteria	1142
679	Ga0207657_10547940	3300025919	Bacteria	904
680	Ga0207657_11496304	3300025919	Bacteria	505
681	Ga0207649_10210448	3300025920	Bacteria	1379
682	Ga0207649_10667251	3300025920	Bacteria	804
683	Ga0207652_10023738	3300025921	Bacteria	5083
684	Ga0207652_10135112	3300025921	Bacteria	2202
685	Ga0207652_10160675	3300025921	Bacteria	2014
686	Ga0207652_10553615	3300025921	Bacteria	1033
687	Ga0207652_10571516	3300025921	Bacteria	1015
688	Ga0207646_10075271	3300025922	Bacteria	3017
689	Ga0207646_10224791	3300025922	Bacteria	1696
690	Ga0207681_10113273	3300025923	Bacteria	1977
691	Ga0207681_11017706	3300025923	Bacteria	695
692	Ga0207694_10017116	3300025924	Bacteria	5476
693	Ga0207694_10152670	3300025924	Bacteria	1861
694	Ga0207694_10448788	3300025924	Bacteria	1076
695	Ga0207694_10747453	3300025924	Bacteria	825
696	Ga0207694_11110992	3300025924	Bacteria	669
697	Ga0207694_11144531	3300025924	Bacteria	658
698	Ga0207694_11779952	3300025924	Bacteria	518
699	Ga0207650_10540788	3300025925	Bacteria	976
700	Ga0207659_10197665	3300025926	Bacteria	1604
701	Ga0207687_10089139	3300025927	Bacteria	2245
702	Ga0207687_10166677	3300025927	Bacteria	1695
703	Ga0207687_10187193	3300025927	Bacteria	1608
704	Ga0207687_10205885	3300025927	Bacteria	1541
705	Ga0207687_10209382	3300025927	Bacteria	1529
706	Ga0207700_10007542	3300025928	Bacteria	6659
707	Ga0207700_10064374	3300025928	Bacteria	2793
708	Ga0207700_10074059	3300025928	Bacteria	2632
709	Ga0207700_10181339	3300025928	Bacteria	1763
710	Ga0207700_10203522	3300025928	Bacteria	1669
711	Ga0207700_10449883	3300025928	Bacteria	1135
712	Ga0207700_10922297	3300025928	Bacteria	782
713	Ga0207664_10064293	3300025929	Bacteria	2934
714	Ga0207664_10094469	3300025929	Bacteria	2458
715	Ga0207664_11072456	3300025929	Bacteria	721
716	Ga0207644_10037392	3300025931	Bacteria	3415
717	Ga0207644_10636309	3300025931	Bacteria	887
718	Ga0207690_10330702	3300025932	Bacteria	1200
719	Ga0207690_10849801	3300025932	Bacteria	756
720	Ga0207690_10904412	3300025932	Bacteria	732
721	Ga0207706_10025737	3300025933	Bacteria	5271
722	Ga0207706_10054738	3300025933	Bacteria	3520
723	Ga0207706_10110925	3300025933	Bacteria	2413
724	Ga0207706_10126798	3300025933	Bacteria	2245
725	Ga0207706_11049528	3300025933	Bacteria	683
726	Ga0207686_10030104	3300025934	Bacteria	3210
727	Ga0207686_10423330	3300025934	Bacteria	1019
728	Ga0207686_10748534	3300025934	Bacteria	780
729	Ga0207709_10028400	3300025935	Bacteria	3234
730	Ga0207709_10368445	3300025935	Bacteria	1090
731	Ga0207670_10531537	3300025936	Bacteria	958
732	Ga0207669_10757337	3300025937	Bacteria	802
733	Ga0207704_10311577	3300025938	Bacteria	1210
734	Ga0207704_10409386	3300025938	Bacteria	1072
735	Ga0207704_11451316	3300025938	Bacteria	588
736	Ga0207665_10006088	3300025939	Bacteria	8010
737	Ga0207665_10021690	3300025939	Bacteria	4225
738	Ga0207665_10031878	3300025939	Bacteria	3489
739	Ga0207665_10143808	3300025939	Bacteria	1703
740	Ga0207665_10580077	3300025939	Bacteria	874
741	Ga0207665_10785304	3300025939	Bacteria	752
742	Ga0207691_10133481	3300025940	Bacteria	2191
743	Ga0207691_10135680	3300025940	Bacteria	2170
744	Ga0207691_10153971	3300025940	Bacteria	2020
745	Ga0207691_10284223	3300025940	Bacteria	1423
746	Ga0207711_10052528	3300025941	Bacteria	3493
747	Ga0207711_10055306	3300025941	Bacteria	3407
748	Ga0207711_10169648	3300025941	Bacteria	1979
749	Ga0207711_10608277	3300025941	Bacteria	1020
750	Ga0207689_10085839	3300025942	Bacteria	2587
751	Ga0207689_10094502	3300025942	Bacteria	2455
752	Ga0207689_10600556	3300025942	Bacteria	926
753	Ga0207689_11219657	3300025942	Bacteria	633
754	Ga0207661_10045171	3300025944	Bacteria	3485
755	Ga0207661_10065867	3300025944	Bacteria	2941
756	Ga0207661_10144436	3300025944	Bacteria	2051
757	Ga0207661_10624757	3300025944	Bacteria	989
758	Ga0207679_10148500	3300025945	Bacteria	1904
759	Ga0207679_10405909	3300025945	Bacteria	1199
760	Ga0207679_10615910	3300025945	Bacteria	979
761	Ga0207679_10759882	3300025945	Bacteria	882
762	Ga0207667_10064954	3300025949	Bacteria	3807
763	Ga0207667_10114066	3300025949	Bacteria	2786
764	Ga0207667_10114571	3300025949	Bacteria	2779
765	Ga0207667_10142047	3300025949	Bacteria	2472
766	Ga0207667_10151057	3300025949	Bacteria	2391
767	Ga0207667_10165662	3300025949	Bacteria	2272
768	Ga0207667_10224237	3300025949	Bacteria	1925
769	Ga0207667_10554184	3300025949	Bacteria	1162
770	Ga0207651_11740429	3300025960	Bacteria	561
771	Ga0207712_10045213	3300025961	Bacteria	3048
772	Ga0207712_10226740	3300025961	Bacteria	1497
773	Ga0207712_11771064	3300025961	Bacteria	553
774	Ga0207668_10218356	3300025972	Bacteria	1529
775	Ga0207668_10310158	3300025972	Bacteria	1305
776	Ga0207668_10786317	3300025972	Bacteria	841
777	Ga0207640_10008004	3300025981	Bacteria	5840
778	Ga0207640_10104012	3300025981	Bacteria	1998
779	Ga0207640_10953136	3300025981	Bacteria	752
780	Ga0207658_11086894	3300025986	Bacteria	730
781	Ga0207677_10019118	3300026023	Bacteria	4129
782	Ga0207677_10060703	3300026023	Bacteria	2615
783	Ga0207703_10107143	3300026035	Bacteria	2379
784	Ga0207703_10135926	3300026035	Bacteria	2128
785	Ga0207703_10530434	3300026035	Bacteria	1108
786	Ga0207703_10660613	3300026035	Bacteria	992
787	Ga0207703_11413610	3300026035	Bacteria	669
788	Ga0207639_10066056	3300026041	Bacteria	2810
789	Ga0207639_10112546	3300026041	Bacteria	2221
790	Ga0207639_10181927	3300026041	Bacteria	1789
791	Ga0207639_10207018	3300026041	Bacteria	1686
792	Ga0207639_10720806	3300026041	Bacteria	926
793	Ga0207639_10994489	3300026041	Bacteria	785
794	Ga0207678_10017766	3300026067	Bacteria	6245
795	Ga0207678_10019513	3300026067	Bacteria	5956
796	Ga0207678_10033040	3300026067	Bacteria	4508
797	Ga0207678_10059483	3300026067	Bacteria	3287
798	Ga0207678_10060315	3300026067	Bacteria	3263
799	Ga0207678_10079668	3300026067	Bacteria	2804
800	Ga0207678_10090054	3300026067	Bacteria	2622
801	Ga0207678_10095764	3300026067	Bacteria	2537
802	Ga0207708_10119838	3300026075	Bacteria	2050
803	Ga0207702_10000063	3300026078	Bacteria	123034
804	Ga0207702_10042949	3300026078	Bacteria	3793
805	Ga0207702_10173249	3300026078	Bacteria	1981
806	Ga0207702_10198642	3300026078	Bacteria	1857
807	Ga0207702_10338836	3300026078	Bacteria	1436
808	Ga0207641_10037994	3300026088	Bacteria	4024
809	Ga0207641_10079791	3300026088	Bacteria	2838
810	Ga0207641_10507102	3300026088	Bacteria	1172
811	Ga0207641_10632470	3300026088	Bacteria	1050
812	Ga0207648_10023956	3300026089	Bacteria	5457
813	Ga0207648_10811332	3300026089	Bacteria	871
814	Ga0207676_10071505	3300026095	Bacteria	2786
815	Ga0207676_10328881	3300026095	Bacteria	1406
816	Ga0207676_10581514	3300026095	Bacteria	1073
817	Ga0207676_10703494	3300026095	Bacteria	979
818	Ga0207676_11951772	3300026095	Bacteria	586
819	Ga0207674_10027211	3300026116	Bacteria	6054
820	Ga0207674_10061985	3300026116	Bacteria	3777
821	Ga0207674_10289724	3300026116	Bacteria	1586
822	Ga0207674_10330258	3300026116	Bacteria	1475
823	Ga0207674_10617189	3300026116	Bacteria	1047
824	Ga0207674_11710656	3300026116	Bacteria	597
825	Ga0207675_100037599	3300026118	Bacteria	4514
826	Ga0207675_100336806	3300026118	Bacteria	1476
827	Ga0207675_101200862	3300026118	Bacteria	779
828	Ga0207675_102689779	3300026118	Bacteria	506
829	Ga0207683_10038422	3300026121	Bacteria	4172
830	Ga0207683_10040055	3300026121	Bacteria	4087
831	Ga0207683_10093362	3300026121	Bacteria	2682
832	Ga0207683_10161017	3300026121	Bacteria	2029
833	Ga0207683_10445613	3300026121	Bacteria	1193
834	Ga0207683_10629477	3300026121	Bacteria	994
835	Ga0207683_10762169	3300026121	Bacteria	898
836	Ga0207683_10829173	3300026121	Bacteria	858
837	Ga0207683_11723529	3300026121	Bacteria	576
838	Ga0207698_10047325	3300026142	Bacteria	3257
839	Ga0207698_10087420	3300026142	Bacteria	2539
840	Ga0207698_10287855	3300026142	Bacteria	1523
841	Ga0207698_10442465	3300026142	Bacteria	1252
842	Ga0209389_1000012	3300027296	Bacteria	213243
843	Ga0209389_1000069	3300027296	Bacteria	98063
844	Ga0209589_1000015	3300027357	Bacteria	225913
845	Ga0209589_1000077	3300027357	Bacteria	98063
846	Ga0209489_100015	3300027361	Bacteria	225913
847	Ga0209489_100019	3300027361	Bacteria	213243
848	Ga0209489_100020	3300027361	Bacteria	207541
849	Ga0209700_100018	3300027363	Bacteria	238200
850	Ga0209700_100025	3300027363	Bacteria	225913
851	Ga0209179_1004877	3300027512	Bacteria	2059
852	Ga0209179_1065467	3300027512	Bacteria	792
853	Ga0209588_1087090	3300027671	Bacteria	1007
854	Ga0207428_10148947	3300027907	Bacteria	1782
855	Ga0207428_10671352	3300027907	Bacteria	743
856	Ga0268266_10003840	3300028379	Bacteria	14672
857	Ga0268266_10008431	3300028379	Bacteria	9163
858	Ga0268266_10034518	3300028379	Bacteria	4302
859	Ga0268266_10287401	3300028379	Bacteria	1530
860	Ga0268266_10289849	3300028379	Bacteria	1524
861	Ga0268266_10682454	3300028379	Bacteria	989
862	Ga0268266_10869747	3300028379	Bacteria	871
863	Ga0268266_11040395	3300028379	Bacteria	792
864	Ga0268265_10110693	3300028380	Bacteria	2241
865	Ga0268265_10159172	3300028380	Bacteria	1915
866	Ga0268265_10385589	3300028380	Bacteria	1290
867	Ga0268265_11917130	3300028380	Bacteria	599
868	Ga0268264_10000356	3300028381	Bacteria	68810
869	Ga0268264_10170323	3300028381	Bacteria	1969
870	Ga0268264_10296210	3300028381	Bacteria	1521
871	Ga0268264_10435357	3300028381	Bacteria	1267
872	Ga0268264_10545097	3300028381	Bacteria	1137
873	Ga0268264_10884772	3300028381	Bacteria	896
874	Ga0265337_1028183	3300028556	Bacteria	1687
875	Ga0265326_10093053	3300028558	Bacteria	854
876	Ga0265319_1094407	3300028563	Bacteria	942
877	Ga0265334_10167391	3300028573	Bacteria	770
878	Ga0265323_10007414	3300028653	Bacteria	4559
879	Ga0265336_10000346	3300028666	Bacteria	30553
880	Ga0307517_10001423	3300028786	Bacteria	40213
881	Ga0307517_10103123	3300028786	Bacteria	2231
882	Ga0307515_10032146	3300028794	Bacteria	8708
883	Ga0307515_10491678	3300028794	Bacteria	838
884	Ga0265338_10000417	3300028800	Bacteria	76249
885	Ga0265324_10053383	3300029957	Bacteria	1387
886	Ga0307511_10087863	3300030521	Bacteria	2130
887	Ga0265330_10014662	3300031235	Bacteria	3635
888	Ga0265330_10265438	3300031235	Bacteria	723
889	Ga0265332_10019479	3300031238	Bacteria	2995
890	Ga0265325_10340841	3300031241	Bacteria	663
891	Ga0265340_10002373	3300031247	Bacteria	10714
892	Ga0265339_10003359	3300031249	Bacteria	11199
893	Ga0265339_10008317	3300031249	Bacteria	6608
894	Ga0265339_10067138	3300031249	Bacteria	1919
895	Ga0265339_10148864	3300031249	Bacteria	1186
896	Ga0265331_10110493	3300031250	Bacteria	1261
897	Ga0265331_10342095	3300031250	Bacteria	670
898	Ga0265316_10479568	3300031344	Bacteria	890
899	Ga0307513_10160211	3300031456	Bacteria	2144
900	Ga0307509_10103122	3300031507	Bacteria	2881
901	Ga0307509_10170540	3300031507	Bacteria	2056
902	Ga0307509_10365858	3300031507	Bacteria	1160
903	Ga0307408_100508290	3300031548	Bacteria	1056
904	Ga0307408_100916392	3300031548	Bacteria	803
905	Ga0307508_10000012	3300031616	Bacteria	243167
906	Ga0307508_10013966	3300031616	Bacteria	7327
907	Ga0307508_10095708	3300031616	Bacteria	2560
908	Ga0307508_10148584	3300031616	Bacteria	1948
909	Ga0307508_10238343	3300031616	Bacteria	1417
910	Ga0307508_10259862	3300031616	Bacteria	1331
911	Ga0307508_10333307	3300031616	Bacteria	1109
912	Ga0307508_10507706	3300031616	Bacteria	801
913	Ga0307508_10693837	3300031616	Bacteria	627
914	Ga0265314_10032879	3300031711	Bacteria	3810
915	Ga0265314_10043122	3300031711	Bacteria	3210
916	Ga0265314_10094223	3300031711	Bacteria	1942
917	Ga0265314_10403949	3300031711	Bacteria	738
918	Ga0265342_10003269	3300031712	Bacteria	13437
919	Ga0265342_10100726	3300031712	Bacteria	1646
920	Ga0265342_10376715	3300031712	Bacteria	736
921	Ga0307516_10074049	3300031730	Bacteria	3262
922	Ga0307516_10118097	3300031730	Bacteria	2446
923	Ga0307516_10283648	3300031730	Bacteria	1337
924	Ga0307516_10840748	3300031730	Bacteria	581
925	Ga0307405_10099808	3300031731	Bacteria	1944
926	Ga0307405_10438169	3300031731	Bacteria	1033
927	Ga0307405_10517343	3300031731	Bacteria	960
928	Ga0307413_10209419	3300031824	Bacteria	1415
929	Ga0307413_10401276	3300031824	Bacteria	1074
930	Ga0307413_10789558	3300031824	Bacteria	797
931	Ga0307518_10383323	3300031838	Bacteria	796
932	Ga0307410_10359920	3300031852	Bacteria	1165
933	Ga0307410_10961269	3300031852	Bacteria	735
934	Ga0307406_10345595	3300031901	Bacteria	1160
935	Ga0307406_11579529	3300031901	Bacteria	579
936	Ga0307412_10581560	3300031911	Bacteria	945
937	Ga0307412_11066495	3300031911	Bacteria	717
938	Ga0307412_11308191	3300031911	Bacteria	653
939	Ga0307409_100615857	3300031995	Bacteria	1075
940	Ga0307409_100742023	3300031995	Bacteria	985
941	Ga0307409_100946245	3300031995	Bacteria	877
942	Ga0307416_100165078	3300032002	Bacteria	2053
943	Ga0307416_100170057	3300032002	Bacteria	2027
944	Ga0307416_100562523	3300032002	Bacteria	1215
945	Ga0307416_100572816	3300032002	Bacteria	1205
946	Ga0307416_100686280	3300032002	Bacteria	1112
947	Ga0307411_10359393	3300032005	Bacteria	1190
948	Ga0307411_10776908	3300032005	Bacteria	841
949	Ga0307411_10842386	3300032005	Bacteria	811
950	Ga0307415_100041039	3300032126	Bacteria	3070
951	Ga0307415_100074599	3300032126	Bacteria	2398
952	Ga0307415_100205605	3300032126	Bacteria	1566
953	Ga0307507_10386634	3300033179	Bacteria	803
954	Ga0307507_10465288	3300033179	Bacteria	693
955	Ga0307507_10510608	3300033179	Bacteria	645
956	Ga0307510_10015377	3300033180	Bacteria	9047
957	Ga0307510_10023362	3300033180	Bacteria	7168
958	Ga0307510_10047751	3300033180	Bacteria	4580
959	Ga0307510_10068023	3300033180	Bacteria	3579
960	Ga0307510_10100483	3300033180	Bacteria	2686
961	Ga0315911_1000037	3300033442	Bacteria	62198
962	Ga0316215_1002468	3300033544	Bacteria	1748
963	Ga0316215_1005057	3300033544	Bacteria	1267
964	Ga0373938_0030358	3300034957	Bacteria	1153
965	Ga0373929_0050158	3300035085	Bacteria	952
966	Ga0373934_0002532	3300035086	Bacteria	6723
967	Ga0373934_0131191	3300035086	Bacteria	1022
968	Ga0373934_0368895	3300035086	Bacteria	598
969	Ga0373934_0402812	3300035086	Bacteria	572
970	Ga0373940_0149301	3300035088	Bacteria	744
971	Ga0373944_0013773	3300035089	Bacteria	2249
972	Ga0373951_0058726	3300035091	Bacteria	960
973	Ga0373952_0049196	3300035092	Bacteria	1000
974	Ga0373923_0003267	3300035111	Bacteria	5166
975	Ga0373923_0107440	3300035111	Bacteria	1236
976	Ga0373932_0076704	3300035112	Bacteria	1048
977	Ga0373932_0078908	3300035112	Bacteria	1036
978	Ga0373936_0001098	3300035113	Bacteria	9698
979	Ga0373936_0010885	3300035113	Bacteria	3437
980	Ga0373939_0309195	3300035114	Bacteria	632
981	Ga0373945_0001922	3300035116	Bacteria	6445
982	Ga0373953_0001769	3300035117	Bacteria	6378
983	Ga0373953_0009391	3300035117	Bacteria	3364
984	Ga0373953_0136825	3300035117	Bacteria	1047
985	Ga0373953_0302542	3300035117	Bacteria	698
986	Ga0373954_0006705	3300035118	Bacteria	5021
987	Ga0373954_0021038	3300035118	Bacteria	2953
988	Ga0373954_0109116	3300035118	Bacteria	1338
989	Ga0373954_0248741	3300035118	Bacteria	875
990	Ga0373956_0000376	3300035119	Bacteria	18268
991	Ga0373957_0005684	3300035120	Bacteria	3881
992	Ga0373957_0126643	3300035120	Bacteria	1037
993	Ga0373957_0165487	3300035120	Bacteria	912
994	Ga0373960_0039504	3300035121	Bacteria	1358
995	Ga0373943_0013877	3300035170	Bacteria	3643
996	Ga0373943_0021992	3300035170	Bacteria	2949
997	Ga0373943_0071667	3300035170	Bacteria	1756
998	Ga0373943_0991274	3300035170	Bacteria	504
999	Ga0373946_0003124	3300035171	Bacteria	5867
1000	Ga0373946_0114177	3300035171	Bacteria	1226
1001	Ga0373946_0263791	3300035171	Bacteria	843
1002	Ga0373955_0000325	3300035172	Bacteria	19823
1003	Ga0373955_0067917	3300035172	Bacteria	1985
1004	Ga0373955_0086410	3300035172	Bacteria	1781
1005	Ga0373955_0493345	3300035172	Bacteria	748
1006	Ga0373955_0552862	3300035172	Bacteria	704
1007	Ga0373961_0096129	3300035241	Bacteria	953
1008	Ga0373924_0007619	3300035410	Bacteria	3912
1009	Ga0373931_0009747	3300035691	Bacteria	4598
1010	Ga0373931_0109888	3300035691	Bacteria	1563
1011	Ga0373931_1204276	3300035691	Bacteria	519
1012	Ga0373935_0050257	3300035692	Bacteria	2646
1013	Ga0373935_1405015	3300035692	Bacteria	522
1014	Ga0373927_0000137	3300035695	Bacteria	56546
1015	Ga0373927_0023546	3300035695	Bacteria	4032
1016	Ga0373927_0036587	3300035695	Bacteria	3192
1017	Ga0373927_0056610	3300035695	Bacteria	2535
1018	Ga0373927_0068754	3300035695	Bacteria	2292
1019	Ga0373927_0073602	3300035695	Bacteria	2212
1020	Ga0373933_0000108	3300035724	Bacteria	53024
1021	Ga0373933_0005894	3300035724	Bacteria	6664
1022	Ga0373933_0074164	3300035724	Bacteria	2074
1023	Ga0373933_0154167	3300035724	Bacteria	1456
1024	Ga0373947_0000902	3300035725	Bacteria	17985
1025	Ga0373947_0012959	3300035725	Bacteria	4780
1026	Ga0373947_0103699	3300035725	Bacteria	1790
1027	Ga0373937_0007855	3300036401	Bacteria	9247
1028	Ga0373937_0024716	3300036401	Bacteria	5421
1029	Ga0373937_0041640	3300036401	Bacteria	4189
1030	Ga0373937_0085096	3300036401	Bacteria	2926
1031	Ga0373937_0206959	3300036401	Bacteria	1845
1032	Ga0373937_0353280	3300036401	Bacteria	1392
1033	Ga0373925_0002159	3300037068	Bacteria	16068
1034	Ga0373925_0010829	3300037068	Bacteria	6612
1035	Ga0373925_0027502	3300037068	Bacteria	4162
1036	Ga0373925_0036147	3300037068	Bacteria	3646
1037	Ga0373925_0166377	3300037068	Bacteria	1739
1038	Ga0373925_0314821	3300037068	Bacteria	1266
1039	Ga0373925_0393001	3300037068	Bacteria	1130
1040	Ga0395899_0069956	3300037312	Bacteria	2569
1041	Ga0395899_0741913	3300037312	Bacteria	612
1042	Ga0395900_0001756	3300037418	Bacteria	24872
1043	Ga0395900_0010446	3300037418	Bacteria	9497
1044	Ga0395900_0310507	3300037418	Bacteria	1560
1045	Ga0395900_1133459	3300037418	Bacteria	699
1046	Ga0395898_0014127	3300037466	Bacteria	8208
1047	Ga0395898_0058280	3300037466	Bacteria	3760
1048	Ga0395898_0070167	3300037466	Bacteria	3388
1049	Ga0395898_0114507	3300037466	Bacteria	2584
1050	Ga0395898_0125707	3300037466	Bacteria	2457
1051	Ga0395905_0033826	3300037471	Bacteria	4801
1052	Ga0395905_0098242	3300037471	Bacteria	2749
1053	Ga0395905_0367275	3300037471	Bacteria	1332
1054	Ga0395905_0788484	3300037471	Bacteria	853
1055	Ga0395905_1370841	3300037471	Bacteria	611
1056	Ga0436364_0461113	3300037853	Bacteria	2216
1057	Ga0436364_0567719	3300037853	Bacteria	1643
1058	Ga0436364_0755715	3300037853	Bacteria	1368
1059	Ga0436364_1480697	3300037853	Bacteria	1511
1060	Ga0395901_0028786	3300038443	Bacteria	5715
1061	Ga0395901_0033726	3300038443	Bacteria	5286
1062	Ga0395901_0382530	3300038443	Bacteria	1448
1063	Ga0395901_1401679	3300038443	Bacteria	657
1064	Ga0436365_0457714	3300039437	Bacteria	7003
1065	Ga0436365_0465888	3300039437	Bacteria	976
1066	Ga0436365_0470267	3300039437	Bacteria	1089
1067	Ga0436365_0535532	3300039437	Bacteria	530
1068	Ga0436365_0567755	3300039437	Bacteria	914
1069	Ga0436365_0592130	3300039437	Bacteria	8188
1070	Ga0436365_1055631	3300039437	Bacteria	686
1071	Ga0436365_1318311	3300039437	Bacteria	1736
1072	Ga0436365_1766966	3300039437	Bacteria	2155
1073	Ga0436365_1822955	3300039437	Bacteria	1660
1074	Ga0436360_0271275	3300039438	Bacteria	1880
1075	Ga0436360_0728475	3300039438	Bacteria	922
1076	Ga0436361_0162931	3300039447	Bacteria	803
1077	Ga0436361_0176045	3300039447	Bacteria	1024
1078	Ga0436361_1053264	3300039447	Bacteria	1130
1079	Ga0436363_0131451	3300039450	Bacteria	1874
1080	Ga0436363_0277737	3300039450	Bacteria	930
1081	Ga0436363_0667058	3300039450	Bacteria	2167
1082	Ga0436363_0811316	3300039450	Bacteria	721
1083	Ga0436363_1163541	3300039450	Bacteria	968
1084	Ga0436363_1295760	3300039450	Bacteria	1348
1085	Ga0436362_0664428	3300039453	Bacteria	5651
1086	Ga0436362_0666664	3300039453	Bacteria	780
1087	Ga0439465_0051910	3300041413	Bacteria	1345
1088	Ga0439465_0131803	3300041413	Bacteria	883
1089	Ga0439465_0233931	3300041413	Bacteria	676
1090	Ga0451787_779488	3300041441	Bacteria	674
1091	Ga0451789_1128803	3300041443	Bacteria	1388
1092	Ga0451795_0601895	3300041456	Bacteria	1789
1093	Ga0451795_1712836	3300041456	Bacteria	529
1094	Ga0451798_0080004	3300041458	Bacteria	599
1095	Ga0451800_1177411	3300041459	Bacteria	1018
1096	Ga0451802_0212299	3300041460	Bacteria	571
1097	Ga0451804_0051753	3300041463	Bacteria	1033
1098	Ga0451833_0611562	3300041491	Bacteria	828
1099	Ga0451835_0949682	3300041492	Bacteria	501
1100	Ga0451837_0744389	3300041494	Bacteria	811
1101	Ga0451841_0624660	3300041498	Bacteria	616
1102	Ga0451845_0566838	3300041501	Bacteria	1004
1103	Ga0451847_0531524	3300041503	Bacteria	1082
1104	Ga0451849_1377632	3300041505	Bacteria	719
1105	Ga0439445_0232531	3300042004	Bacteria	548
1106	Ga0439452_085843	3300042010	Bacteria	683
1107	Ga0466969_0128244	3300044656	Bacteria	1177
1108	Ga0466969_0299876	3300044656	Bacteria	727
1109	Ga0466972_0000100	3300044658	Bacteria	76018
1110	Ga0466972_0014629	3300044658	Bacteria	3927
1111	Ga0466965_0011221	3300044683	Bacteria	4195
1112	Ga0466966_0001463	3300044684	Bacteria	15199
1113	Ga0466961_0000601	3300044693	Bacteria	22652
1114	Ga0466963_0058249	3300044694	Bacteria	2575
1115	Ga0466963_0139843	3300044694	Bacteria	1677
1116	Ga0466963_0143314	3300044694	Bacteria	1656
1117	Ga0466964_0020493	3300044706	Bacteria	2547
1118	Ga0466964_0629609	3300044706	Bacteria	591
1119	Ga0466971_0305191	3300044719	Bacteria	765
1120	Ga0466968_0008001	3300044735	Bacteria	4039
1121	Ga0466968_0027271	3300044735	Bacteria	2350
1122	Ga0466968_0513968	3300044735	Bacteria	598
1123	Ga0466970_0306927	3300044765	Bacteria	896
1124	Ga0466957_0298086	3300044842	Bacteria	1083
1125	Ga0466957_0775164	3300044842	Bacteria	680
1126	Ga0466957_1169032	3300044842	Bacteria	556
1127	Ga0466960_0200413	3300044901	Bacteria	1090
1128	Ga0466960_0386850	3300044901	Bacteria	804
1129	Ga0466959_0000634	3300045049	Bacteria	20407
1130	Ga0466959_0054194	3300045049	Bacteria	2931
1131	Ga0466959_0059778	3300045049	Bacteria	2774
1132	Ga0466959_0179892	3300045049	Bacteria	1480
1133	Ga0466958_0012458	3300045836	Bacteria	4821
1134	Ga0466967_0161245	3300045976	Bacteria	2105
1135	Ga0466967_0227567	3300045976	Bacteria	1774
1136	Ga0466967_0294185	3300045976	Bacteria	1561
1137	Ga0466967_0820019	3300045976	Bacteria	924
1138	Ga0466967_1402699	3300045976	Bacteria	696
1139	Ga0495617_189794	3300046452	Bacteria	645
1140	Ga0495627_194441	3300046453	Bacteria	560
1141	Ga0495592_0000339	3300046454	Bacteria	38389
1142	Ga0495592_0008958	3300046454	Bacteria	7516
1143	Ga0495592_0033013	3300046454	Bacteria	3905
1144	Ga0495592_0034020	3300046454	Bacteria	3843
1145	Ga0495592_0058113	3300046454	Bacteria	2853
1146	Ga0495592_0103564	3300046454	Bacteria	2024
1147	Ga0495592_0406878	3300046454	Bacteria	861
1148	Ga0495603_0000277	3300046455	Bacteria	27280
1149	Ga0495603_0030355	3300046455	Bacteria	3256
1150	Ga0495603_0030573	3300046455	Bacteria	3243
1151	Ga0495603_0058565	3300046455	Bacteria	2277
1152	Ga0495603_0064886	3300046455	Bacteria	2152
1153	Ga0495603_0599734	3300046455	Bacteria	630
1154	Ga0495590_0074315	3300046457	Bacteria	1195
1155	Ga0495590_0170149	3300046457	Bacteria	794
1156	Ga0495590_0356297	3300046457	Bacteria	556
1157	Ga0495629_0000029	3300046459	Bacteria	127000
1158	Ga0495629_0001483	3300046459	Bacteria	18494
1159	Ga0495629_0038459	3300046459	Bacteria	3370
1160	Ga0495629_0043490	3300046459	Bacteria	3153
1161	Ga0495629_0056255	3300046459	Bacteria	2751
1162	Ga0495629_0087111	3300046459	Bacteria	2179
1163	Ga0495629_0438206	3300046459	Bacteria	886
1164	Ga0495638_0014467	3300046460	Bacteria	5330
1165	Ga0495638_0017657	3300046460	Bacteria	4751
1166	Ga0495638_0069511	3300046460	Bacteria	2158
1167	Ga0495638_0376448	3300046460	Bacteria	743
1168	Ga0495638_0431987	3300046460	Bacteria	676
1169	Ga0495641_0003605	3300046461	Bacteria	11465
1170	Ga0495641_0033063	3300046461	Bacteria	2458
1171	Ga0495641_0119785	3300046461	Bacteria	1174
1172	Ga0495651_0031486	3300046462	Bacteria	4136
1173	Ga0495651_0034091	3300046462	Bacteria	3969
1174	Ga0495651_0042153	3300046462	Bacteria	3545
1175	Ga0495651_0053385	3300046462	Bacteria	3111
1176	Ga0495651_0165251	3300046462	Bacteria	1581
1177	Ga0495651_0635518	3300046462	Bacteria	670
1178	Ga0495653_0001063	3300046463	Bacteria	21155
1179	Ga0495653_0141058	3300046463	Bacteria	1695
1180	Ga0495653_0164002	3300046463	Bacteria	1540
1181	Ga0495580_0002567	3300046472	Bacteria	15791
1182	Ga0495580_0094251	3300046472	Bacteria	2083
1183	Ga0495580_0135806	3300046472	Bacteria	1705
1184	Ga0495582_0000024	3300046473	Bacteria	82444
1185	Ga0495582_0076346	3300046473	Bacteria	1857
1186	Ga0495582_0313738	3300046473	Bacteria	902
1187	Ga0495582_0582550	3300046473	Bacteria	647
1188	Ga0495605_0045762	3300046474	Bacteria	2155
1189	Ga0495605_0218294	3300046474	Bacteria	825
1190	Ga0495605_0258450	3300046474	Bacteria	744
1191	Ga0495639_0000006	3300046475	Bacteria	100361
1192	Ga0495639_0027634	3300046475	Bacteria	2512
1193	Ga0495639_0029660	3300046475	Bacteria	2428
1194	Ga0495639_0188269	3300046475	Bacteria	1007
1195	Ga0495639_0194114	3300046475	Bacteria	992
1196	Ga0495639_0329034	3300046475	Bacteria	765
1197	Ga0495639_0413937	3300046475	Bacteria	682
1198	Ga0495662_0000348	3300046476	Bacteria	20253
1199	Ga0495662_0143009	3300046476	Bacteria	1178
1200	Ga0495662_0273781	3300046476	Bacteria	831
1201	Ga0495662_0417645	3300046476	Bacteria	659
1202	Ga0495662_0541660	3300046476	Bacteria	570
1203	Ga0495664_0007034	3300046477	Bacteria	6232
1204	Ga0495664_0013716	3300046477	Bacteria	4596
1205	Ga0495664_0041673	3300046477	Bacteria	2717
1206	Ga0495664_0042709	3300046477	Bacteria	2686
1207	Ga0495664_0183695	3300046477	Bacteria	1267
1208	Ga0495664_0394411	3300046477	Bacteria	831
1209	Ga0495664_0413932	3300046477	Bacteria	809
1210	Ga0495584_0172906	3300046491	Bacteria	1098
1211	Ga0495584_0187522	3300046491	Bacteria	1051
1212	Ga0495584_0228178	3300046491	Bacteria	946
1213	Ga0495584_0321919	3300046491	Bacteria	785
1214	Ga0495585_0105730	3300046492	Bacteria	1501
1215	Ga0495585_0112852	3300046492	Bacteria	1444
1216	Ga0495585_0315756	3300046492	Bacteria	765
1217	Ga0495594_0000170	3300046499	Bacteria	31295
1218	Ga0495596_0231163	3300046500	Bacteria	718
1219	Ga0495596_0259217	3300046500	Bacteria	675
1220	Ga0495596_0378352	3300046500	Bacteria	552
1221	Ga0495606_0011270	3300046507	Bacteria	7313
1222	Ga0495606_0013516	3300046507	Bacteria	6440
1223	Ga0495606_0124831	3300046507	Bacteria	1536
1224	Ga0495606_0194509	3300046507	Bacteria	1160
1225	Ga0495606_0285811	3300046507	Bacteria	900
1226	Ga0495608_0002749	3300046511	Bacteria	12636
1227	Ga0495608_0071053	3300046511	Bacteria	2271
1228	Ga0495608_0075302	3300046511	Bacteria	2199
1229	Ga0495608_0340730	3300046511	Bacteria	924
1230	Ga0495610_0044538	3300046512	Bacteria	2202
1231	Ga0495610_0263438	3300046512	Bacteria	678
1232	Ga0495616_0158585	3300046513	Bacteria	1019
1233	Ga0495616_0285692	3300046513	Bacteria	700
1234	Ga0495618_0018824	3300046514	Bacteria	4242
1235	Ga0495618_0097183	3300046514	Bacteria	1884
1236	Ga0495620_0069579	3300046515	Bacteria	1443
1237	Ga0495628_0010789	3300046516	Bacteria	7737
1238	Ga0495628_0014226	3300046516	Bacteria	6678
1239	Ga0495628_0040319	3300046516	Bacteria	3731
1240	Ga0495628_0074634	3300046516	Bacteria	2641
1241	Ga0495628_0074994	3300046516	Bacteria	2634
1242	Ga0495628_0079529	3300046516	Bacteria	2549
1243	Ga0495630_0003257	3300046517	Bacteria	11317
1244	Ga0495630_0543444	3300046517	Bacteria	891
1245	Ga0495630_0902054	3300046517	Bacteria	673
1246	Ga0495631_0132036	3300046518	Bacteria	1073
1247	Ga0495631_0242852	3300046518	Bacteria	768
1248	Ga0495631_0362040	3300046518	Bacteria	617
1249	Ga0495632_0383115	3300046519	Bacteria	616
1250	Ga0495643_0157573	3300046522	Bacteria	1119
1251	Ga0495643_0250024	3300046522	Bacteria	828
1252	Ga0495648_0019778	3300046524	Bacteria	4718
1253	Ga0495648_0470391	3300046524	Bacteria	545
1254	Ga0495663_0058748	3300046525	Bacteria	1206
1255	Ga0495666_0011725	3300046526	Bacteria	4370
1256	Ga0495666_0031438	3300046526	Bacteria	2601
1257	Ga0495666_0115215	3300046526	Bacteria	1261
1258	Ga0495652_0021359	3300046529	Bacteria	5757
1259	Ga0495652_0040442	3300046529	Bacteria	4030
1260	Ga0495652_0047155	3300046529	Bacteria	3696
1261	Ga0495652_0061633	3300046529	Bacteria	3165
1262	Ga0495652_0101400	3300046529	Bacteria	2333
1263	Ga0495652_0105377	3300046529	Bacteria	2278
1264	Ga0495652_0179399	3300046529	Bacteria	1627
1265	Ga0495652_0182406	3300046529	Bacteria	1609
1266	Ga0495665_0000178	3300046531	Bacteria	32333
1267	Ga0495665_0044353	3300046531	Bacteria	2363
1268	Ga0495665_0528883	3300046531	Bacteria	593
1269	Ga0495640_0003797	3300046533	Bacteria	12127
1270	Ga0495640_0004410	3300046533	Bacteria	11233
1271	Ga0495640_0008433	3300046533	Bacteria	8084
1272	Ga0495640_0022850	3300046533	Bacteria	4566
1273	Ga0495640_0060314	3300046533	Bacteria	2580
1274	Ga0495640_0101453	3300046533	Bacteria	1888
1275	Ga0495640_0286250	3300046533	Bacteria	1026
1276	Ga0495586_0116006	3300046535	Bacteria	1493
1277	Ga0495587_0010898	3300046536	Bacteria	5768
1278	Ga0495587_0087441	3300046536	Bacteria	1803
1279	Ga0495587_0246208	3300046536	Bacteria	1005
1280	Ga0495587_0253739	3300046536	Bacteria	989
1281	Ga0495587_0285249	3300046536	Bacteria	925
1282	Ga0495598_0054147	3300046537	Bacteria	1217
1283	Ga0495609_0058832	3300046538	Bacteria	1700
1284	Ga0495645_0004746	3300046543	Bacteria	9290
1285	Ga0495645_0033925	3300046543	Bacteria	3723
1286	Ga0495645_0052192	3300046543	Bacteria	2976
1287	Ga0495645_0068585	3300046543	Bacteria	2560
1288	Ga0495645_0100650	3300046543	Bacteria	2055
1289	Ga0495645_0279368	3300046543	Bacteria	1099
1290	Ga0495645_0748766	3300046543	Bacteria	590
1291	Ga0495622_0002996	3300046557	Bacteria	8018
1292	Ga0495622_0015955	3300046557	Bacteria	3493
1293	Ga0495622_0031914	3300046557	Bacteria	2460
1294	Ga0495622_0046682	3300046557	Bacteria	2012
1295	Ga0495622_0287944	3300046557	Bacteria	717
1296	Ga0495622_0327017	3300046557	Bacteria	665
1297	Ga0495667_0003075	3300046559	Bacteria	11195
1298	Ga0495667_0011132	3300046559	Bacteria	6087
1299	Ga0495667_0024918	3300046559	Bacteria	4030
1300	Ga0495667_0074387	3300046559	Bacteria	2212
1301	Ga0495667_0088315	3300046559	Bacteria	2009
1302	Ga0495667_0121941	3300046559	Bacteria	1683
1303	Ga0495656_0007598	3300046615	Bacteria	3838
1304	Ga0495656_0140181	3300046615	Bacteria	1159
1305	Ga0495656_0199831	3300046615	Bacteria	991
1306	Ga0495656_0269722	3300046615	Bacteria	864
1307	Ga0495656_0308449	3300046615	Bacteria	812
1308	Ga0495656_0815787	3300046615	Bacteria	504
1309	Ga0495668_0131319	3300046616	Bacteria	1371
1310	Ga0495668_0132855	3300046616	Bacteria	1362
1311	Ga0495668_0652047	3300046616	Bacteria	582
1312	Ga0495634_0000354	3300046642	Bacteria	44714
1313	Ga0495634_0002330	3300046642	Bacteria	15886
1314	Ga0495634_0023750	3300046642	Bacteria	4308
1315	Ga0495634_0033779	3300046642	Bacteria	3513
1316	Ga0495634_0037146	3300046642	Bacteria	3329
1317	Ga0495634_0309592	3300046642	Bacteria	953
1318	Ga0495611_0086995	3300046648	Bacteria	1442
1319	Ga0495611_0231836	3300046648	Bacteria	858
1320	Ga0495625_0302138	3300046660	Bacteria	1024
1321	Ga0495625_0423648	3300046660	Bacteria	827
1322	Ga0495635_0000917	3300046663	Bacteria	19365
1323	Ga0495635_0002291	3300046663	Bacteria	13017
1324	Ga0495635_0006214	3300046663	Bacteria	8323
1325	Ga0495635_0221118	3300046663	Bacteria	1281
1326	Ga0495635_0281012	3300046663	Bacteria	1118
1327	Ga0495635_0316753	3300046663	Bacteria	1044
1328	Ga0495659_0092522	3300046664	Bacteria	1162
1329	Ga0495661_0175749	3300046665	Bacteria	1138
1330	Ga0495661_0214543	3300046665	Bacteria	1000
1331	Ga0495661_0247521	3300046665	Bacteria	911
1332	Ga0495588_0009296	3300046674	Bacteria	4539
1333	Ga0495588_0028376	3300046674	Bacteria	2801
1334	Ga0495588_0121742	3300046674	Bacteria	1375
1335	Ga0495588_0571712	3300046674	Bacteria	592
1336	Ga0495657_0003543	3300046675	Bacteria	12725
1337	Ga0495657_0005133	3300046675	Bacteria	10381
1338	Ga0495657_0027263	3300046675	Bacteria	4034
1339	Ga0495657_0066994	3300046675	Bacteria	2358
1340	Ga0495657_0352956	3300046675	Bacteria	870
1341	Ga0495599_0005791	3300046678	Bacteria	7417
1342	Ga0495599_0036803	3300046678	Bacteria	3075
1343	Ga0495599_0038886	3300046678	Bacteria	2990
1344	Ga0495599_0051217	3300046678	Bacteria	2587
1345	Ga0495599_0467094	3300046678	Bacteria	745
1346	Ga0495623_0043318	3300046679	Bacteria	2864
1347	Ga0495623_0091225	3300046679	Bacteria	1870
1348	Ga0495646_0000902	3300046680	Bacteria	16844
1349	Ga0495646_0003762	3300046680	Bacteria	9487
1350	Ga0495646_0037428	3300046680	Bacteria	3001
1351	Ga0495646_0056213	3300046680	Bacteria	2360
1352	Ga0495646_0207256	3300046680	Bacteria	1065
1353	Ga0495647_0002169	3300046681	Bacteria	6134
1354	Ga0495647_0190705	3300046681	Bacteria	895
1355	Ga0495658_0000428	3300046683	Bacteria	23516
1356	Ga0495658_0013755	3300046683	Bacteria	4124
1357	Ga0495669_0364995	3300046684	Bacteria	698
1358	Ga0495669_0411181	3300046684	Bacteria	656
1359	Ga0495613_0001078	3300046689	Bacteria	20808
1360	Ga0495613_0012318	3300046689	Bacteria	6353
1361	Ga0495613_0025741	3300046689	Bacteria	4385
1362	Ga0495613_0067799	3300046689	Bacteria	2604
1363	Ga0495624_0039622	3300046690	Bacteria	3020
1364	Ga0495624_0288327	3300046690	Bacteria	991
1365	Ga0495624_0547005	3300046690	Bacteria	691
1366	Ga0495670_0207610	3300046691	Bacteria	1038
1367	Ga0495671_0095635	3300046692	Bacteria	1453
1368	Ga0495671_0369498	3300046692	Bacteria	687
1369	Ga0495649_0015639	3300046694	Bacteria	4314
1370	Ga0495649_0386262	3300046694	Bacteria	704
1371	Ga0495649_0612794	3300046694	Bacteria	537
1372	Ga0495589_0124161	3300046794	Bacteria	1242
1373	Ga0495600_0002741	3300046809	Bacteria	10203
1374	Ga0495600_0006367	3300046809	Bacteria	7183
1375	Ga0495600_0091394	3300046809	Bacteria	1985
1376	Ga0495600_0105865	3300046809	Bacteria	1833
1377	Ga0495600_0160273	3300046809	Bacteria	1454
1378	Ga0495600_0333100	3300046809	Bacteria	953
1379	Ga0495600_0867384	3300046809	Bacteria	534
1380	Ga0495660_0070035	3300046810	Bacteria	1863
1381	Ga0495581_0000004	3300047315	Bacteria	84424
1382	Ga0495581_0029027	3300047315	Bacteria	3207
1383	Ga0495581_0046985	3300047315	Bacteria	2495
1384	Ga0495581_0064398	3300047315	Bacteria	2118
1385	Ga0495581_0180826	3300047315	Bacteria	1233
1386	Ga0495581_0300584	3300047315	Bacteria	938
1387	Ga0495604_0000678	3300047317	Bacteria	28877
1388	Ga0495604_0007541	3300047317	Bacteria	8607
1389	Ga0495604_0007941	3300047317	Bacteria	8404
1390	Ga0495604_0024945	3300047317	Bacteria	4768
1391	Ga0495604_0498211	3300047317	Bacteria	790
1392	Ga0495636_0273422	3300047318	Bacteria	785
1393	Ga0495674_0000415	3300047319	Bacteria	38235
1394	Ga0495674_0007236	3300047319	Bacteria	10620
1395	Ga0495674_0026281	3300047319	Bacteria	5328
1396	Ga0495674_0138061	3300047319	Bacteria	2050
1397	Ga0495674_0472914	3300047319	Bacteria	1005
1398	Ga0495674_0476089	3300047319	Bacteria	1001
1399	Ga0495674_0529073	3300047319	Bacteria	940
1400	Ga0495672_0041687	3300047320	Bacteria	2774
1401	Ga0495676_0019876	3300047321	Bacteria	5903
1402	Ga0495676_0032444	3300047321	Bacteria	4408
1403	Ga0495676_0037764	3300047321	Bacteria	4016
1404	Ga0495676_0110006	3300047321	Bacteria	2023
1405	Ga0495676_0230096	3300047321	Bacteria	1274
1406	Ga0495680_0001065	3300047322	Bacteria	30372
1407	Ga0495680_0001164	3300047322	Bacteria	28965
1408	Ga0495680_0171432	3300047322	Bacteria	1571
1409	Ga0495680_0186581	3300047322	Bacteria	1494
1410	Ga0495687_063984	3300047443	Bacteria	1504
1411	Ga0495675_0000901	3300047444	Bacteria	18140
1412	Ga0495675_0012017	3300047444	Bacteria	5442
1413	Ga0495675_0029569	3300047444	Bacteria	3495
1414	Ga0495675_0105541	3300047444	Bacteria	1761
1415	Ga0495677_0027542	3300047445	Bacteria	2062
1416	Ga0495685_086663	3300047447	Bacteria	1040
1417	Ga0495673_0028163	3300047469	Bacteria	2664
1418	Ga0495673_0054421	3300047469	Bacteria	1740
1419	Ga0495673_0093444	3300047469	Bacteria	1226
1420	Ga0495673_0098520	3300047469	Bacteria	1185
1421	Ga0495684_0000721	3300047471	Bacteria	26637
1422	Ga0495684_0064676	3300047471	Bacteria	2780
1423	Ga0495684_0132607	3300047471	Bacteria	1870
1424	Ga0495684_0240922	3300047471	Bacteria	1319
1425	Ga0495686_0088359	3300047472	Bacteria	1884
1426	Ga0495686_0147299	3300047472	Bacteria	1385
1427	Ga0495686_0169188	3300047472	Bacteria	1272
1428	Ga0495686_0220036	3300047472	Bacteria	1081
1429	Ga0495686_0331221	3300047472	Bacteria	832
1430	Ga0495686_0515592	3300047472	Bacteria	628
1431	Ga0495593_0000198	3300047673	Bacteria	31587
1432	Ga0495593_0003019	3300047673	Bacteria	10137
1433	Ga0495593_0004072	3300047673	Bacteria	8702
1434	Ga0495593_0012359	3300047673	Bacteria	4879
1435	Ga0495602_0007817	3300048088	Bacteria	11179
1436	Ga0495602_0060850	3300048088	Bacteria	3287
1437	Ga0495602_0066581	3300048088	Bacteria	3102
1438	Ga0495602_0068869	3300048088	Bacteria	3037
1439	Ga0495614_0010431	3300048089	Bacteria	4097
1440	Ga0495614_0054371	3300048089	Bacteria	1717
1441	Ga0495626_0033878	3300048091	Bacteria	2446
1442	Ga0496100_0076187	3300048903	Bacteria	2252
1443	Ga0496100_0104614	3300048903	Bacteria	1956
1444	Ga0496100_0205185	3300048903	Bacteria	1439
1445	Ga0496100_0248530	3300048903	Bacteria	1315
1446	Ga0496100_0442531	3300048903	Bacteria	995
1447	Ga0496100_0734907	3300048903	Bacteria	771
1448	Ga0496100_0848577	3300048903	Bacteria	716
1449	Ga0496100_1270963	3300048903	Bacteria	581
1450	Ga0496100_1280572	3300048903	Bacteria	578
1451	Ga0496101_0035951	3300048904	Bacteria	3506
1452	Ga0496101_0051291	3300048904	Bacteria	2972
1453	Ga0496101_0075732	3300048904	Bacteria	2477
1454	Ga0496101_0239501	3300048904	Bacteria	1412
1455	Ga0496101_1062489	3300048904	Bacteria	636
1456	Ga0496101_1419080	3300048904	Bacteria	541
1457	Ga0496101_1514915	3300048904	Bacteria	522
1458	Ga0496102_0010100	3300048905	Bacteria	8120
1459	Ga0496102_0215412	3300048905	Bacteria	1810
1460	Ga0496102_0414116	3300048905	Bacteria	1266
1461	Ga0496102_0546348	3300048905	Bacteria	1081
1462	Ga0496102_0893063	3300048905	Bacteria	810
1463	Ga0496102_1634588	3300048905	Bacteria	562
1464	Ga0496102_1826394	3300048905	Bacteria	525
1465	Ga0496102_1894271	3300048905	Bacteria	513
1466	Ga0496103_0174441	3300048906	Bacteria	1381
1467	Ga0496103_0363439	3300048906	Bacteria	930
1468	Ga0496103_1019280	3300048906	Bacteria	515
1469	Ga0496103_1027921	3300048906	Bacteria	512
1470	Ga0496104_0069211	3300048907	Bacteria	3354
1471	Ga0496104_0111561	3300048907	Bacteria	2622
1472	Ga0496104_0127620	3300048907	Bacteria	2442
1473	Ga0496104_0152912	3300048907	Bacteria	2214
1474	Ga0496104_0359439	3300048907	Bacteria	1368
1475	Ga0496104_0669216	3300048907	Bacteria	946
1476	Ga0496104_1082961	3300048907	Bacteria	705
1477	Ga0496104_1099501	3300048907	Bacteria	698
1478	Ga0496105_0007733	3300048908	Bacteria	8340
1479	Ga0496105_0023125	3300048908	Bacteria	5040
1480	Ga0496105_0031538	3300048908	Bacteria	4345
1481	Ga0496105_0089641	3300048908	Bacteria	2540
1482	Ga0496105_0104649	3300048908	Bacteria	2337
1483	Ga0496105_0158139	3300048908	Bacteria	1860
1484	Ga0496105_0244586	3300048908	Bacteria	1455
1485	Ga0496105_1006985	3300048908	Bacteria	623
1486	Ga0496105_1177333	3300048908	Bacteria	565
1487	Ga0496106_0001953	3300048909	Bacteria	15491
1488	Ga0496106_0008314	3300048909	Bacteria	7679
1489	Ga0496106_0111956	3300048909	Bacteria	2126
1490	Ga0496106_0238798	3300048909	Bacteria	1452
1491	Ga0496106_0312812	3300048909	Bacteria	1260
1492	Ga0496106_0422003	3300048909	Bacteria	1072
1493	Ga0496106_1517208	3300048909	Bacteria	515
1494	Ga0496107_0026534	3300048910	Bacteria	4108
1495	Ga0496107_0075432	3300048910	Bacteria	2454
1496	Ga0496107_0189454	3300048910	Bacteria	1528
1497	Ga0496107_0345512	3300048910	Bacteria	1107
1498	Ga0496107_0347909	3300048910	Bacteria	1103
1499	Ga0496107_0545759	3300048910	Bacteria	859
1500	Ga0496107_0678942	3300048910	Bacteria	758
1501	Ga0496108_0024837	3300048911	Bacteria	4934
1502	Ga0496108_0084715	3300048911	Bacteria	2690
1503	Ga0496108_0137501	3300048911	Bacteria	2103
1504	Ga0496108_0158978	3300048911	Bacteria	1952
1505	Ga0496108_0162276	3300048911	Bacteria	1932
1506	Ga0496108_0466239	3300048911	Bacteria	1104
1507	Ga0496108_0795115	3300048911	Bacteria	816
1508	Ga0496109_0934451	3300048912	Bacteria	805
1509	Ga0496110_0067758	3300048913	Bacteria	3158
1510	Ga0496110_0097259	3300048913	Bacteria	2638
1511	Ga0496110_0104482	3300048913	Bacteria	2541
1512	Ga0496110_0184677	3300048913	Bacteria	1893
1513	Ga0496110_0184729	3300048913	Bacteria	1893
1514	Ga0496110_0438878	3300048913	Bacteria	1190
1515	Ga0496110_0517987	3300048913	Bacteria	1085
1516	Ga0496110_1161507	3300048913	Bacteria	681
1517	Ga0496111_0039021	3300048914	Bacteria	3403
1518	Ga0496111_0122829	3300048914	Bacteria	1918
1519	Ga0496111_0124557	3300048914	Bacteria	1905
1520	Ga0496111_0299537	3300048914	Bacteria	1192
1521	Ga0496112_0000035	3300048915	Bacteria	106983
1522	Ga0496112_0005407	3300048915	Bacteria	11041
1523	Ga0496112_0012245	3300048915	Bacteria	7876
1524	Ga0496112_0012881	3300048915	Bacteria	7699
1525	Ga0496112_0119383	3300048915	Bacteria	2607
1526	Ga0496112_0150591	3300048915	Bacteria	2293
1527	Ga0496112_0195855	3300048915	Bacteria	1981
1528	Ga0496112_0201148	3300048915	Bacteria	1951
1529	Ga0496112_0205128	3300048915	Bacteria	1929
1530	Ga0496112_0351265	3300048915	Bacteria	1417
1531	Ga0496112_0419009	3300048915	Bacteria	1278
1532	Ga0496112_1215628	3300048915	Bacteria	670
1533	Ga0496112_1411317	3300048915	Bacteria	611
1534	Ga0496113_0012388	3300048916	Bacteria	5730
1535	Ga0496113_0078640	3300048916	Bacteria	2523
1536	Ga0496113_0094872	3300048916	Bacteria	2305
1537	Ga0496113_0366521	3300048916	Bacteria	1156
1538	Ga0496113_0377327	3300048916	Bacteria	1138
1539	Ga0496114_0056820	3300048917	Bacteria	3266
1540	Ga0496114_0089409	3300048917	Bacteria	2613
1541	Ga0496114_0258964	3300048917	Bacteria	1531
1542	Ga0496114_0353195	3300048917	Bacteria	1300
1543	Ga0496114_0858646	3300048917	Bacteria	788
1544	Ga0496114_1719069	3300048917	Bacteria	515
1545	Ga0496114_1753861	3300048917	Bacteria	509
1546	Ga0496115_0004493	3300048918	Bacteria	10094
1547	Ga0496115_0064612	3300048918	Bacteria	2954
1548	Ga0496115_0238325	3300048918	Bacteria	1500
1549	Ga0496115_0364285	3300048918	Bacteria	1177
1550	Ga0496115_0431011	3300048918	Bacteria	1067
1551	Ga0496115_0780280	3300048918	Bacteria	745
1552	Ga0496116_0286041	3300048919	Bacteria	795
1553	Ga0496116_0296976	3300048919	Bacteria	771
1554	Ga0496116_0330047	3300048919	Bacteria	709
1555	Ga0496117_0040145	3300048920	Bacteria	3447
1556	Ga0496118_0006555	3300048921	Bacteria	12729
1557	Ga0496118_0212977	3300048921	Bacteria	1132
1558	Ga0496118_0259467	3300048921	Bacteria	982
1559	Ga0496118_0349437	3300048921	Bacteria	789
1560	Ga0496118_0416819	3300048921	Bacteria	692
1561	Ga0496119_0050692	3300048922	Bacteria	2556
1562	Ga0496119_0099718	3300048922	Bacteria	1633
1563	Ga0496119_0129641	3300048922	Bacteria	1376
1564	Ga0496119_0258261	3300048922	Bacteria	875
1565	Ga0496120_0003365	3300048923	Bacteria	14668
1566	Ga0496120_0189369	3300048923	Bacteria	1004
1567	Ga0496120_0306399	3300048923	Bacteria	726
1568	Ga0496121_0001622	3300048924	Bacteria	37285
1569	Ga0496121_0002148	3300048924	Bacteria	30905
1570	Ga0496121_0003594	3300048924	Bacteria	21886
1571	Ga0496121_0017170	3300048924	Bacteria	7411
1572	Ga0496121_0020688	3300048924	Bacteria	6493
1573	Ga0496121_0046952	3300048924	Bacteria	3689
1574	Ga0496121_0054013	3300048924	Bacteria	3361
1575	Ga0496121_0060870	3300048924	Bacteria	3102
1576	Ga0496121_0095914	3300048924	Bacteria	2303
1577	Ga0496121_0116625	3300048924	Bacteria	2025
1578	Ga0496121_0145106	3300048924	Bacteria	1755
1579	Ga0496121_0254825	3300048924	Bacteria	1215
1580	Ga0496121_0404292	3300048924	Bacteria	893
1581	Ga0496121_0468567	3300048924	Bacteria	807
1582	Ga0496121_0567958	3300048924	Bacteria	706
1583	Ga0496121_0587000	3300048924	Bacteria	690
1584	Ga0496123_0323657	3300048926	Bacteria	727
1585	Ga0496124_0009366	3300048927	Bacteria	10092
1586	Ga0496124_0305006	3300048927	Bacteria	1148
1587	Ga0496124_0473042	3300048927	Bacteria	848
1588	Ga0496124_0774686	3300048927	Bacteria	598
1589	Ga0496125_0042831	3300048928	Bacteria	3850
1590	Ga0496125_0060229	3300048928	Bacteria	3053
1591	Ga0496125_0129587	3300048928	Bacteria	1779
1592	Ga0496125_0195754	3300048928	Bacteria	1329
1593	Ga0496125_0479322	3300048928	Bacteria	705
1594	Ga0496126_0003472	3300048929	Bacteria	19892
1595	Ga0496126_0005839	3300048929	Bacteria	13910
1596	Ga0496126_0010376	3300048929	Bacteria	9777
1597	Ga0496126_0017647	3300048929	Bacteria	7109
1598	Ga0496126_0021771	3300048929	Bacteria	6253
1599	Ga0496126_0043071	3300048929	Bacteria	4167
1600	Ga0496126_0101102	3300048929	Bacteria	2522
1601	Ga0496126_0104677	3300048929	Bacteria	2472
1602	Ga0496126_0108764	3300048929	Bacteria	2417
1603	Ga0496126_0110276	3300048929	Bacteria	2397
1604	Ga0496126_0191762	3300048929	Bacteria	1730
1605	Ga0496126_0195056	3300048929	Bacteria	1713
1606	Ga0496126_0204097	3300048929	Bacteria	1667
1607	Ga0496126_0291233	3300048929	Bacteria	1350
1608	Ga0496126_0386199	3300048929	Bacteria	1138
1609	Ga0496126_0490302	3300048929	Bacteria	983
1610	Ga0496126_1060192	3300048929	Bacteria	604
1611	Ga0495678_078961	3300049459	Bacteria	1187
1612	Ga0495678_188393	3300049459	Bacteria	643
1613	Ga0495682_0055599	3300049460	Bacteria	1435
1614	Ga0495682_0205587	3300049460	Bacteria	698
1615	Ga0501031_0001791	3300049568	Bacteria	13478
1616	Ga0501032_0000762	3300049569	Bacteria	26183
1617	Ga0501033_0000136	3300049570	Bacteria	70952
1618	Ga0501033_0014591	3300049570	Bacteria	5965
1619	Ga0501034_0000251	3300049571	Bacteria	99406
1620	Ga0501034_0815316	3300049571	Bacteria	825
1621	Ga0501036_0000036	3300049572	Bacteria	87244
1622	Ga0501036_0085855	3300049572	Bacteria	2660
1623	Ga0501037_0001715	3300049573	Bacteria	15897
1624	Ga0501037_1102719	3300049573	Bacteria	514
1625	Ga0501038_0000428	3300049574	Bacteria	36623
1626	Ga0501038_0520321	3300049574	Bacteria	908
1627	Ga0501039_0000273	3300049575	Bacteria	37431
1628	Ga0501042_0019699	3300049578	Bacteria	4690
1629	Ga0501042_0099665	3300049578	Bacteria	2089
1630	Ga0501043_0000165	3300049579	Bacteria	59980
1631	Ga0501043_0454101	3300049579	Bacteria	962
1632	Ga0501046_0001143	3300049580	Bacteria	25820
1633	Ga0501047_0000340	3300049581	Bacteria	53278
1634	Ga0501047_0276342	3300049581	Bacteria	1525
1635	Ga0501047_0382229	3300049581	Bacteria	1242
1636	Ga0501048_0004509	3300049582	Bacteria	10606
1637	Ga0501048_0115235	3300049582	Bacteria	1899
1638	Ga0501048_0299110	3300049582	Bacteria	1145
1639	Ga0501067_0014425	3300049583	Bacteria	4375
1640	Ga0501067_0039960	3300049583	Bacteria	2605
1641	Ga0501067_0633983	3300049583	Bacteria	600
1642	Ga0501068_0003807	3300049584	Bacteria	8179
1643	Ga0501068_0466996	3300049584	Bacteria	817
1644	Ga0501068_0478744	3300049584	Bacteria	807
1645	Ga0501069_0005466	3300049585	Bacteria	6608
1646	Ga0501069_0201953	3300049585	Bacteria	1152
1647	Ga0501070_0006502	3300049586	Bacteria	9938
1648	Ga0501070_0208129	3300049586	Bacteria	1606
1649	Ga0501071_0148488	3300049587	Bacteria	1747
1650	Ga0501071_0233276	3300049587	Bacteria	1387
1651	Ga0501071_0843080	3300049587	Bacteria	707
1652	Ga0501072_0001213	3300049588	Bacteria	19257
1653	Ga0501073_0000037	3300049589	Bacteria	87345
1654	Ga0501074_0000167	3300049590	Bacteria	35108
1655	Ga0501074_0510076	3300049590	Bacteria	852
1656	Ga0501079_0001057	3300049741	Bacteria	19118
1657	Ga0501080_0003259	3300049742	Bacteria	14325
1658	Ga0501080_0008505	3300049742	Bacteria	9306
1659	Ga0501083_0025461	3300049744	Bacteria	4096
1660	Ga0501035_0000142	3300049822	Bacteria	87561
1661	Ga0501035_0310655	3300049822	Bacteria	1326
1662	Ga0501035_0632162	3300049822	Bacteria	869
1663	Ga0501044_0000414	3300049823	Bacteria	52784
1664	Ga0501044_0840280	3300049823	Bacteria	795
1665	Ga0501045_0147819	3300049824	Bacteria	1748
1666	Ga0501045_0246213	3300049824	Bacteria	1331
1667	nmdc:mga03683_231530_c1	3300050489	Bacteria	854
1668	nmdc:mga03683_259714_c1	3300050489	Bacteria	808
1669	nmdc:mga03683_282986_c1	3300050489	Bacteria	775
1670	nmdc:mga03683_46130_c1	3300050489	Bacteria	1806
1671	nmdc:mga03n38_18684_c1	3300050490	Bacteria	2740
1672	nmdc:mga03n38_957_c1	3300050490	Bacteria	7831
1673	nmdc:mga03n38_99925_c1	3300050490	Bacteria	1398
1674	nmdc:mga00v17_187859_c1	3300050491	Bacteria	1334
1675	nmdc:mga00v17_49103_c1	3300050491	Bacteria	2559
1676	nmdc:mga00v17_844849_c1	3300050491	Bacteria	582
1677	nmdc:mga0yw44_238268_c1	3300050492	Bacteria	1209
1678	nmdc:mga0yw44_302602_c1	3300050492	Bacteria	1072
1679	nmdc:mga0yw44_319673_c1	3300050492	Bacteria	1042
1680	nmdc:mga0yw44_47527_c1	3300050492	Bacteria	2584
1681	nmdc:mga0yw44_50490_c1	3300050492	Bacteria	2515
1682	nmdc:mga0yw44_546371_c1	3300050492	Bacteria	787
1683	nmdc:mga0k408_229900_c1	3300050493	Bacteria	1107
1684	nmdc:mga0k408_279431_c1	3300050493	Bacteria	997
1685	nmdc:mga06z11_122394_c1	3300050494	Bacteria	1453
1686	nmdc:mga06z11_266088_c1	3300050494	Bacteria	1013
1687	nmdc:mga06z11_275371_c1	3300050494	Bacteria	996
1688	nmdc:mga06z11_277842_c1	3300050494	Bacteria	992
1689	nmdc:mga06z11_838166_c1	3300050494	Bacteria	560
1690	nmdc:mga06z11_839284_c1	3300050494	Bacteria	560
1691	nmdc:mga06z11_856533_c1	3300050494	Bacteria	554
1692	nmdc:mga06z11_930797_c1	3300050494	Bacteria	530
1693	nmdc:mga07m45_2419_c1	3300050496	Bacteria	8757
1694	nmdc:mga07m45_294458_c1	3300050496	Bacteria	944
1695	nmdc:mga07m45_35375_c1	3300050496	Bacteria	2777
1696	nmdc:mga07m45_516131_c1	3300050496	Bacteria	692
1697	nmdc:mga07m45_714627_c1	3300050496	Bacteria	576
1698	nmdc:mga07m45_774562_c1	3300050496	Bacteria	550
1699	nmdc:mga07m45_899609_c1	3300050496	Bacteria	506
1700	nmdc:mga05p37_213602_c1	3300050507	Bacteria	2331
1701	nmdc:mga09592_690917_c1	3300050508	Bacteria	869
1702	nmdc:mga0qj67_1339489_c1	3300050509	Bacteria	554
1703	nmdc:mga0qj67_1560114_c1	3300050509	Bacteria	507
1704	nmdc:mga08y16_410062_c1	3300050511	Bacteria	1386
1705	nmdc:mga0n895_326669_c1	3300050512	Bacteria	1554
1706	nmdc:mga0n895_45691_c1	3300050512	Bacteria	4274
1707	nmdc:mga0rr50_834810_c1	3300050513	Bacteria	786
1708	nmdc:mga08x19_124672_c1	3300050514	Bacteria	1729
1709	nmdc:mga08x19_338963_c1	3300050514	Bacteria	1048
1710	nmdc:mga0sz30_109894_c2	3300050516	Bacteria	830
1711	nmdc:mga0sz30_185170_c1	3300050516	Bacteria	924
1712	nmdc:mga0sz30_192155_c1	3300050516	Bacteria	906
1713	nmdc:mga0sz30_248993_c1	3300050516	Bacteria	791
1714	nmdc:mga0sz30_292628_c1	3300050516	Bacteria	726
1715	nmdc:mga0sz30_47985_c1	3300050516	Bacteria	1806
1716	Ga0495601_0020457	3300053077	Bacteria	4044
1717	Ga0495601_0040945	3300053077	Bacteria	2903
1718	Ga0495601_0041651	3300053077	Bacteria	2880
1719	Ga0495601_0233780	3300053077	Bacteria	1200
1720	Ga0495612_0033842	3300053078	Bacteria	2068
1721	Ga0495612_0161517	3300053078	Bacteria	978
1722	Ga0500635_0009854	3300053080	Bacteria	2664
1723	Ga0500635_0117117	3300053080	Bacteria	994
1724	Ga0500635_0320696	3300053080	Bacteria	612
1725	Ga0495595_0000828	3300053084	Bacteria	11843
1726	Ga0495619_0000912	3300053085	Bacteria	19381
1727	Ga0495619_0111092	3300053085	Bacteria	1873
1728	Ga0495619_0233078	3300053085	Bacteria	1275
1729	Ga0495619_0375506	3300053085	Bacteria	982
1730	Ga0495619_0436276	3300053085	Bacteria	903
1731	Ga0495619_1143657	3300053085	Bacteria	517
1732	Ga0500578_0158157	3300053086	Bacteria	1408
1733	Ga0500578_0327255	3300053086	Bacteria	902
1734	Ga0500578_0412596	3300053086	Bacteria	776
1735	Ga0500643_000048	3300053087	Bacteria	147879
1736	Ga0500644_0473465	3300053088	Bacteria	550
1737	Ga0500647_0045982	3300053091	Bacteria	2097
1738	Ga0500647_0343559	3300053091	Bacteria	624
1739	Ga0500583_0019068	3300053092	Bacteria	2804
1740	Ga0500583_0307434	3300053092	Bacteria	775
1741	Ga0500651_0100712	3300053093	Bacteria	1771
1742	Ga0500566_0000223	3300053094	Bacteria	30380
1743	Ga0500566_0004965	3300053094	Bacteria	7920
1744	Ga0500566_0006352	3300053094	Bacteria	7020
1745	Ga0500566_0059836	3300053094	Bacteria	2159
1746	Ga0500640_157019	3300053095	Bacteria	859
1747	Ga0500641_0024453	3300053096	Bacteria	2329
1748	Ga0500641_0041963	3300053096	Bacteria	1852
1749	Ga0500641_0200017	3300053096	Bacteria	853
1750	Ga0500641_0235775	3300053096	Bacteria	772
1751	Ga0500650_0071549	3300053098	Bacteria	1621
1752	Ga0500555_005336	3300053103	Bacteria	3646
1753	Ga0500555_108580	3300053103	Bacteria	700
1754	Ga0500555_153440	3300053103	Bacteria	564
1755	Ga0500556_0002950	3300053104	Bacteria	5142
1756	Ga0500557_000083	3300053105	Bacteria	32931
1757	Ga0500558_201355	3300053106	Bacteria	693
1758	Ga0500562_078848	3300053108	Bacteria	890
1759	Ga0500569_079473	3300053109	Bacteria	1046
1760	Ga0500572_000389	3300053111	Bacteria	15536
1761	Ga0500572_001233	3300053111	Bacteria	7208
1762	Ga0500572_034391	3300053111	Bacteria	1435
1763	Ga0500594_0053406	3300053118	Bacteria	1145
1764	Ga0500595_000333	3300053119	Bacteria	30925
1765	Ga0500595_002703	3300053119	Bacteria	8594
1766	Ga0500595_017370	3300053119	Bacteria	2657
1767	Ga0500595_025546	3300053119	Bacteria	2045
1768	Ga0500595_055278	3300053119	Bacteria	1216
1769	Ga0500595_060161	3300053119	Bacteria	1150
1770	Ga0500595_120077	3300053119	Bacteria	743
1771	Ga0500595_234357	3300053119	Bacteria	503
1772	Ga0500597_229113	3300053120	Bacteria	769
1773	Ga0500607_135588	3300053121	Bacteria	1166
1774	Ga0500608_007296	3300053122	Bacteria	4564
1775	Ga0500608_088564	3300053122	Bacteria	1450
1776	Ga0500608_093171	3300053122	Bacteria	1405
1777	Ga0500621_210281	3300053126	Bacteria	682
1778	Ga0500642_0000642	3300053130	Bacteria	10422
1779	Ga0500642_0359709	3300053130	Bacteria	644
1780	Ga0500655_012425	3300053133	Bacteria	1548
1781	Ga0500655_020330	3300053133	Bacteria	1240
1782	Ga0500559_0000230	3300053136	Bacteria	44504
1783	Ga0500559_0008650	3300053136	Bacteria	4450
1784	Ga0500559_0055748	3300053136	Bacteria	1753
1785	Ga0500564_124769	3300053138	Bacteria	1118
1786	Ga0500568_0022304	3300053139	Bacteria	2711
1787	Ga0500568_0141774	3300053139	Bacteria	891
1788	Ga0500568_0198979	3300053139	Bacteria	734
1789	Ga0500577_0073561	3300053142	Bacteria	1346
1790	Ga0500588_0106889	3300053146	Bacteria	972
1791	Ga0500588_0203835	3300053146	Bacteria	733
1792	Ga0500588_0287863	3300053146	Bacteria	621
1793	Ga0500589_103558	3300053147	Bacteria	1232
1794	Ga0500590_053159	3300053148	Bacteria	2054
1795	Ga0500590_134272	3300053148	Bacteria	1140
1796	Ga0500603_000178	3300053150	Bacteria	16265
1797	Ga0500603_013968	3300053150	Bacteria	1870
1798	Ga0500603_032911	3300053150	Bacteria	1347
1799	Ga0500603_239297	3300053150	Bacteria	582
1800	Ga0500604_0081381	3300053151	Bacteria	1046
1801	Ga0500604_0089251	3300053151	Bacteria	1005
1802	Ga0500604_0149586	3300053151	Bacteria	792
1803	Ga0500619_014041	3300053154	Bacteria	2141
1804	Ga0500620_028172	3300053155	Bacteria	1754
1805	Ga0500633_0245910	3300053160	Bacteria	665
1806	Ga0500634_0093674	3300053161	Bacteria	1518
1807	Ga0500638_022654	3300053162	Bacteria	2978
1808	Ga0500638_380902	3300053162	Bacteria	512
1809	Ga0500639_012544	3300053163	Bacteria	4450
1810	Ga0500639_097239	3300053163	Bacteria	1456
1811	Ga0500639_161640	3300053163	Bacteria	1018
1812	Ga0500636_0000148	3300053177	Bacteria	36338
1813	Ga0500636_0029898	3300053177	Bacteria	3220
1814	Ga0500636_0088043	3300053177	Bacteria	1781
1815	Ga0500636_0117759	3300053177	Bacteria	1493
1816	Ga0500636_0150308	3300053177	Bacteria	1279
1817	Ga0500637_0000060	3300053178	Bacteria	38881
1818	Ga0500637_0030606	3300053178	Bacteria	2996
1819	Ga0500637_0038025	3300053178	Bacteria	2709
1820	Ga0500637_0250594	3300053178	Bacteria	988
1821	Ga0500637_0273335	3300053178	Bacteria	933
1822	Ga0500649_215345	3300053722	Bacteria	602
1823	Ga0500576_114615	3300053725	Bacteria	1073
1824	Ga0500625_085052	3300053729	Bacteria	1369
1825	Ga0500645_011592	3300053730	Bacteria	2873
1826	Ga0500645_027147	3300053730	Bacteria	1737
1827	Ga0500596_007061	3300053735	Bacteria	1857
1828	Ga0500596_016176	3300053735	Bacteria	1121
1829	Ga0500596_031534	3300053735	Bacteria	823
1830	Ga0500599_002459	3300053736	Bacteria	2220
1831	Ga0500601_000452	3300053737	Bacteria	6662
1832	Ga0500601_018895	3300053737	Bacteria	792
1833	Ga0501084_0025829	3300054114	Bacteria	4898
1834	Ga0500661_000303	3300055283	Bacteria	8936
1835	Ga0587079_227112	3300059647	Bacteria	521
1836	Ga0501082_0002719	3300060353	Bacteria	15447
1837	Ga0501082_2040691	3300060353	Bacteria	500
1838	Ga0466962_0361257	3300061719	Bacteria	724
1839	2507505891	2507262055	Bacteria	8048963
1840	2508540082	2508501009	Bacteria	7784016
1841	2508696152	2508501042	Bacteria	8719808
1842	2509151551	2508501128	Bacteria	8613869
1843	2511396624	2511231028	Bacteria	8046582
1844	2513627471	2513237092	Bacteria	8341956
1845	2513638785	2513237094	Bacteria	8789602
1846	2513649865	2513237095	Bacteria	8976980
1847	2513659779	2513237096	Bacteria	8722461
1848	2513676896	2513237098	Bacteria	9902361
1849	2513696307	2513237101	Bacteria	7952346
1850	2513704350	2513237102	Bacteria	7703324
1851	2513715419	2513237104	Bacteria	10034502
1852	2513857240	2513237137	Bacteria	9558895
1853	2513877273	2513237139	Bacteria	8737671
1854	2513891632	2513237141	Bacteria	8496279
1855	2513918855	2513237145	Bacteria	8979722
1856	2514011240	2513237161	Bacteria	8871253
1857	2515631366	2515154112	Bacteria	8294334
1858	2517105696	2517093001	Bacteria	9002274
1859	2517888181	2517572143	Bacteria	9484767
1860	2524435440	2524023205	Bacteria	8918781
1861	2524468615	2524023210	Bacteria	9029266
1862	2524533356	2524023228	Bacteria	10118060
1863	2528855127	2528768022	Bacteria	10457665
1864	2617347775	2617270735	Bacteria	9163226
1865	2617374503	2617270741	Bacteria	8201522
1866	2671119360	2667528175	Bacteria	7532676
1867	2723842260	2721755755	Bacteria	8322773
1868	2728753838	2728368998	Bacteria	8720350
1869	2745081396	2744054633	Bacteria	8678936
1870	2793061569	2791355196	Bacteria	7323613
1871	2793073859	2791355197	Bacteria	8420563
1872	2793077970
1873	2805916127	2802429603	Bacteria	8777136
1874	2818240865	2816332527	Bacteria	8933356
1875	2824610828	2824609381	Bacteria	8672835
1876	2824619363	2824617872	Bacteria	8814715
1877	2824627818	2824626560	Bacteria	8813858
1878	2824641890	2824635225	Bacteria	8785348
1879	2824651288	2824644064	Bacteria	8743947
1880	2824653880	2824653114	Bacteria	8493680
1881	2824663767	2824661429	Bacteria	9877870
1882	2824676113	2824671348	Bacteria	8369588
1883	2824680228	2824679649	Bacteria	8248951
1884	2824692466	2824687955	Bacteria	8360029
1885	2824699889	2824696289	Bacteria	8335049
1886	2824706071	2824704595	Bacteria	9667483
1887	2824720082	2824714736	Bacteria	8717648
1888	2824729444	2824723954	Bacteria	8758240
1889	2824737480	2824732956	Bacteria	7810675
1890	2824748035	2824746037	Bacteria	7911610
1891	2824760296	2824753945	Bacteria	9787441
1892	2824771535	2824763712	Bacteria	9792355
1893	2824775745	2824773399	Bacteria	8360218
1894	2838125118	2838122688	Bacteria	8803140
1895	2841945856	2841941048	Bacteria	8688029
1896	2841956817	2841949485	Bacteria	8680857
1897	2841965301	2841957949	Bacteria	8652217
1898	2841973333	2841966195	Bacteria	8673214
1899	2841979503	2841974524	Bacteria	8931498
1900	2841989372	2841983080	Bacteria	8395090
1901	2842044363	2842038055	Bacteria	8002051
1902	2842051648	2842045827	Bacteria	8006841
1903	2844321489	2844315083	Bacteria	8138177
1904	2847939474	2847930680	Bacteria	9342022
1905	2847941222	2847939898	Bacteria	8606328
1906	2849082214	2849076700	Bacteria	7039503
1907	2857513311	2857509624	Bacteria	7472071
1908	2874596371	2874590934	Bacteria	8299676
1909	2874610151	2874604998	Bacteria	7834745
1910	2874620216	2874612657	Bacteria	8252029
1911	2874622439	2874620515	Bacteria	8290088
1912	2874633343	2874628541	Bacteria	8630250
1913	2874650359	2874645413	Bacteria	8214782
1914	2876761696	2876761206	Bacteria	10111113
1915	2876776836	2876771140	Bacteria	8287509
1916	2876815703	2876808645	Bacteria	8824342
1917	2876824626	2876818435	Bacteria	8274608
1918	2879080973	2879074833	Bacteria	8279565
1919	2879091084	2879083081	Bacteria	8587928
1920	2879106649	2879099564	Bacteria	10442239
1921	2879117027	2879110137	Bacteria	8907982
1922	2879128204	2879127579	Bacteria	8294491
1923	2879143553	2879142872	Bacteria	8267021
1924	2881369633	2881364244	Bacteria	7710352
1925	2881670156	2881665667	Bacteria	8175609
1926	2885367717	2885366525	Bacteria	8326213
1927	2885380641	2885374607	Bacteria	8927485
1928	2885392258	2885383462	Bacteria	9473874
1929	2885418258	2885409591	Bacteria	9235467
1930	2888387744	2888378607	Bacteria	9652610
1931	2888389963	2888388044	Bacteria	7304136
1932	2888421137	2888419890	Bacteria	7857137
1933	2889036376	2889033259	Bacteria	9099371
1934	2903727932	2903727486	Bacteria	8281579
1935	2903754032	2903748898	Bacteria	9972761
1936	2903776662	2903768456	Bacteria	9749579
1937	2904671554	2904666416	Bacteria	8226587
1938	2904695754	2904690495	Bacteria	9412302
1939	2904710021
1940	2904718098	2904711408	Bacteria	9771557
1941	2906602584	2906602504	Bacteria	8295279
1942	2906614462
1943	2906629718	2906626472	Bacteria	8826946
1944	2906643415	2906635258	Bacteria	8601019
1945	2906651660	2906643746	Bacteria	8722424
1946	2906666607	2906660503	Bacteria	8595048
1947	2908746708	2908739725	Bacteria	8628932
1948	2908764270	2908756301	Bacteria	8864324
1949	2908776982	2908775508	Bacteria	8092255
1950	2922366741	2922361189	Bacteria	7436256
1951	2922377449
1952	2922389356	2922386360	Bacteria	7017218
1953	2922393376	2922393267	Bacteria	8285685
1954	2922426297
1955	2929622241	2929615660	Bacteria	9193770
1956	2929630112	2929624759	Bacteria	9339455
1957	2932787955	2932784394	Bacteria	9704911
1958	2932799511	2932794094	Bacteria	7915132
1959	2932805183	2932801729	Bacteria	7987968
1960	2932813330	2932809354	Bacteria	9135765
1961	2932820027	2932818245	Bacteria	9955613
1962	2932832909	2932828146	Bacteria	9745859
1963	2933584145	2933577622	Bacteria	9116884
1964	2935614315	2935608549	Bacteria	8203142
1965	2935620394	2935616580	Bacteria	9032984
1966	2935632681	2935630451	Bacteria	8169952
1967	2935640718	2935638405	Bacteria	10015038
1968	2935649343	2935648319	Bacteria	8801166
1969	2935657885	2935656913	Bacteria	8965014
1970	2935668910	2935665750	Bacteria	9571747
1971	2935681364	2935675223	Bacteria	9928132
1972	2935687219	2935684952	Bacteria	9590419
1973	2935696810	2935694250	Bacteria	9291695
1974	2935709098	2935703347	Bacteria	10242284
1975	2935716907	2935713505	Bacteria	9608509
1976	2935722968	2935722832	Bacteria	9608746
1977	2935734525	2935732158	Bacteria	9706831
1978	2935744684	2935741537	Bacteria	9707219
1979	2935753185	2935750917	Bacteria	9590372
1980	2935767589	2935760218	Bacteria	9817913
1981	2935770183	2935769743	Bacteria	7878163
1982	2935777787	2935777560	Bacteria	8077691
1983	2935786763	2935785616	Bacteria	7962367
1984	2935794817	2935793552	Bacteria	8012592
1985	2935804828	2935801545	Bacteria	9301974
1986	2935815977	2935810662	Bacteria	9401221
1987	2935826533	2935819856	Bacteria	8261050
1988	2935832225	2935827899	Bacteria	10038562
1989	2935840945	2935837841	Bacteria	9454360
1990	2935851173	2935847175	Bacteria	8228321
1991	2935859280	2935855204	Bacteria	9035059
1992	2935864464	2935864058	Bacteria	9784707
1993	2935875184	2935873716	Bacteria	9632195
1994	2935887727	2935883170	Bacteria	7964738
1995	2935913222	2935908558	Bacteria	8568796
1996	2935922644	2935916978	Bacteria	9113783
1997	2935930853	2935926038	Bacteria	8601059
1998	2935939813	2935934488	Bacteria	8602579
1999	2935946762	2935942939	Bacteria	8599779
2000	2935956037	2935951376	Bacteria	8602333
2001	2935963883	2935959822	Bacteria	7869783
2002	2935972830	2935967501	Bacteria	8603075
2003	2935978253	2935975950	Bacteria	8347125
2004	2935985619	2935984226	Bacteria	8302647
2005	2935995841	2935992306	Bacteria	9802711
2006	2936005752	2936002035	Bacteria	9362176
2007	2936012104	2936011229	Bacteria	8801034
2008	2936020815	2936019824	Bacteria	8804134
2009	2936029397	2936028420	Bacteria	8965941
2010	2936041880	2936037263	Bacteria	9446081
2011	2936048279	2936046547	Bacteria	8903709
2012	2936056610	2936055302	Bacteria	8785755
2013	2940559098	2940556831	Bacteria	9590747
2014	2941508655	2941507105	Bacteria	8166816
2015	2941516485	2941515067	Bacteria	8166720
2016	2941524499	2941523033	Bacteria	8169134
2017	2941532069	2941531003	Bacteria	7653939
2018	2941541793	2941538514	Bacteria	9402094
2019	3005475660	3005474847	Bacteria	9259049
2020	3005485839	3005483717	Bacteria	7877331
2021	3005510880	3005506211	Bacteria	6943378
2022	3005588829	3005587118	Bacteria	7794411
2023	3005601855	3005594810	Bacteria	8716512
2024	3005717594	3005710791	Bacteria	7622528
2025	3005724642	3005718088	Bacteria	8283608
2026	8006932297	8006926726	Bacteria	6749210
2027	8006937000	8006933436	Bacteria	10410654
2028	8006966339	8006964411	Bacteria	8966052
2029	8006976965	8006973647	Bacteria	10679141
2030	8006993165	8006984368	Bacteria	9651211
2031	8006997004	8006994254	Bacteria	8309700
2032	8016517294	8016511872	Bacteria	9921665
2033	8016526940	8016522445	Bacteria	8156687
2034	8016532025	8016530956	Bacteria	8155261
2035	8016545234	8016539877	Bacteria	8155419
2036	8016556854	8016548790	Bacteria	8155074
2037	8016565207	8016557553	Bacteria	8154380
2038	8016570312	8016566248	Bacteria	8158151
2039	8016582860	8016575299	Bacteria	8154085
2040	8016585434	8016583857	Bacteria	10421953
2041	8016602850	8016595262	Bacteria	8149947
2042	8016605720	8016603502	Bacteria	8731218
2043	8016617627	8016613128	Bacteria	8794220
2044	8016623942	8016622563	Bacteria	7999408
2045	8016634924	8016630954	Bacteria	9217207
2046	8017059303	8017057580	Bacteria	10023680
2047	8019531842	8019530166	Bacteria	8155624
2048	8019539687	8019538911	Bacteria	7872763
2049	8019550960	8019547302	Bacteria	7996444
2050	8019561677	8019555841	Bacteria	9642137
2051	8019571751	8019565922	Bacteria	9639779
2052	8019621998	8019619141	Bacteria	9218857
2053	8019631323	8019629233	Bacteria	8687553
2054	8019639298	8019638758	Bacteria	9062356
2055	8019651717	8019648815	Bacteria	10014479
2056	8019668128	8019659431	Bacteria	8577854
2057	8019677594	8019668869	Bacteria	8791617
2058	8019687355	8019678201	Bacteria	8863603
2059	8019693331	8019687851	Bacteria	8712826
2060	8055743510	8055742211	Bacteria	9226248
2061	8056678190	8056673599	Bacteria	7871253
2062	8056692717	8056689827	Bacteria	6712655
2063	8056975365	8056967851	Bacteria	9038162
2064	Ga0495603_0011788
2065	JGI24739J22299_10124799
2066	JGI24738J21930_10037237
2067	JGI24034J26672_10055359
2068	JGI25406J46586_10000233
2069	JGI25165J46597_1008525
2070	JGI25165J46597_1011314
2071	JGI25153J46596_10003608
2072	JGI25153J46596_10006371
2073	JGI25153J46596_10013655
2074	JGI25153J46596_10014278
2075	JGI25153J46596_10047158
2076	JGI25153J46596_10073495
2077	rootL2_10188137
2078	JGI25160J50197_1002871
2079	JGI25160J50197_1008049
2080	JGI25160J50197_1035337
2081	JGI25404J52841_10003860
2082	JGI25404J52841_10007829
2083	JGI25404J52841_10010100
2084	JGI25404J52841_10024955
2085	JGI25404J52841_10077074
2086	Ga0055539_1002270
2087	Ga0055542_1012063
2088	Ga0055529_1016643
2089	Ga0055526_1049892
2090	Ga0055531_10011226
2091	JGI25405J52794_10025895
2092	Ga0065165_1000917
2093	Ga0065165_1001167
2094	Ga0065165_1060570
2095	Ga0065712_10350117
2096	Ga0065715_10307557
2097	Ga0070658_10259657
2098	Ga0070676_10216531
2099	Ga0070683_100060073
2100	Ga0070683_100062216
2101	Ga0070683_100139445
2102	Ga0070683_100347351
2103	Ga0070677_10335551
2104	Ga0068869_100013881
2105	Ga0068869_100044308
2106	Ga0068869_100700177
2107	Ga0068869_101535378
2108	Ga0070666_10078034
2109	Ga0070666_10332158
2110	Ga0070680_100172603
2111	Ga0070680_100319101
2112	Ga0070682_100160839
2113	Ga0070682_100237546
2114	Ga0070682_100523821
2115	Ga0070682_100557643
2116	Ga0070682_100915457
2117	Ga0068868_100005952
2118	Ga0068868_100009208
2119	Ga0068868_100498836
2120	Ga0070660_100061594
2121	Ga0070660_100183335
2122	Ga0070660_100258818
2123	Ga0070660_100261744
2124	Ga0070660_100545721
2125	Ga0070660_100739034
2126	Ga0070660_100796375
2127	Ga0070660_101112661
2128	Ga0070689_100469288
2129	Ga0070687_100413356
2130	Ga0070661_100222751
2131	Ga0070661_100424252
2132	Ga0070661_100645758
2133	Ga0070668_100041755
2134	Ga0070668_100325671
2135	Ga0070668_100822166
2136	Ga0070668_101022168
2137	Ga0070668_101044508
2138	Ga0070668_101533663
2139	Ga0070669_100093363
2140	Ga0070675_100826298
2141	Ga0070675_101305984
2142	Ga0070675_102084279
2143	Ga0070671_100138591
2144	Ga0070671_100239690
2145	Ga0070671_100314323
2146	Ga0070671_100391892
2147	Ga0070671_101529435
2148	Ga0070674_100246057
2149	Ga0070674_101191985
2150	Ga0070674_101402435
2151	Ga0070673_100284803
2152	Ga0070673_100720607
2153	Ga0070673_101271596
2154	Ga0070688_100067284
2155	Ga0070688_100465419
2156	Ga0070688_100825585
2157	Ga0070659_100149609
2158	Ga0070659_100172391
2159	Ga0070659_100180187
2160	Ga0070659_100453186
2161	Ga0070659_100860696
2162	Ga0070659_100965790
2163	Ga0070667_100099699
2164	Ga0070667_100701357
2165	Ga0070667_101768297
2166	Ga0070709_10001520
2167	Ga0070709_10011423
2168	Ga0070709_10025696
2169	Ga0070709_10271732
2170	Ga0070709_10639391
2171	Ga0070709_11111162
2172	Ga0070714_100086974
2173	Ga0070714_100488678
2174	Ga0070713_100003802
2175	Ga0070713_100004746
2176	Ga0070713_100032524
2177	Ga0070713_100036537
2178	Ga0070713_100081587
2179	Ga0070713_100128293
2180	Ga0070713_100135629
2181	Ga0070710_10000656
2182	Ga0070710_10002985
2183	Ga0070710_10945793
2184	Ga0070701_10464715
2185	Ga0070711_100004436
2186	Ga0070711_100005326
2187	Ga0070711_100052438
2188	Ga0070711_100065075
2189	Ga0070711_100479027
2190	Ga0070711_100900739
2191	Ga0070711_100960167
2192	Ga0070711_101229329
2193	Ga0070711_102034014
2194	Ga0070700_100373212
2195	Ga0070700_100480586
2196	Ga0070694_100042928
2197	Ga0070663_100034939
2198	Ga0070663_100051373
2199	Ga0070663_100086232
2200	Ga0070663_100165497
2201	Ga0070663_100868032
2202	Ga0070678_100030437
2203	Ga0070678_100031850
2204	Ga0070678_100047100
2205	Ga0070678_100130216
2206	Ga0070678_100403812
2207	Ga0070678_101138721
2208	Ga0070662_100070508
2209	Ga0070662_100399730
2210	Ga0070662_100415085
2211	Ga0070662_100461492
2212	Ga0070662_101625903
2213	Ga0070681_10034725
2214	Ga0070681_10179213
2215	Ga0070681_10263644
2216	Ga0070681_10802403
2217	Ga0070681_11110414
2218	Ga0068867_101168368
2219	Ga0070706_100494868
2220	Ga0070706_100660236
2221	Ga0070706_100761862
2222	Ga0070707_100597574
2223	Ga0070707_100769149
2224	Ga0070707_101273465
2225	Ga0070698_100658171
2226	Ga0070699_100889176
2227	Ga0070679_100017100
2228	Ga0070679_100031850
2229	Ga0070679_100164777
2230	Ga0070679_100482531
2231	Ga0070679_100845287
2232	Ga0070684_100027140
2233	Ga0070684_100041359
2234	Ga0070684_100057856
2235	Ga0070684_100672431
2236	Ga0070684_100886275
2237	Ga0070697_100084079
2238	Ga0070697_100468506
2239	Ga0070697_100648376
2240	Ga0068853_100050201
2241	Ga0068853_100067623
2242	Ga0068853_100100953
2243	Ga0068853_100436177
2244	Ga0068853_100892211
2245	Ga0070672_100148895
2246	Ga0070672_100194595
2247	Ga0070686_100474910
2248	Ga0070696_100776194
2249	Ga0070693_100106549
2250	Ga0070693_100114883
2251	Ga0070693_100428212
2252	Ga0070693_100462570
2253	Ga0070693_100706343
2254	Ga0070693_101311867
2255	Ga0070665_100004629
2256	Ga0070665_100015575
2257	Ga0070665_100151226
2258	Ga0070665_100259675
2259	Ga0070665_100278469
2260	Ga0070665_100520843
2261	Ga0070665_100535932
2262	Ga0070665_100626497
2263	Ga0070665_100917352
2264	Ga0070665_101154974
2265	Ga0070704_100582200
2266	Ga0070704_100852080
2267	Ga0068855_100115681
2268	Ga0068855_100142688
2269	Ga0068855_100181157
2270	Ga0068855_100273742
2271	Ga0068855_100335002
2272	Ga0068855_100354230
2273	Ga0068855_100442905
2274	Ga0068855_100988709
2275	Ga0068855_101536765
2276	Ga0070664_100283740
2277	Ga0070664_100524591
2278	Ga0070664_100645259
2279	Ga0070664_100722888
2280	Ga0070664_101029975
2281	Ga0068857_100084143
2282	Ga0068857_100095998
2283	Ga0068857_100631988
2284	Ga0068857_100657412
2285	Ga0068857_101963032
2286	Ga0068854_100035331
2287	Ga0068854_100144716
2288	Ga0068854_100176550
2289	Ga0068854_100270200
2290	Ga0068854_100297991
2291	Ga0068854_100831851
2292	Ga0068854_100868279
2293	Ga0068856_100000137
2294	Ga0068856_100081950
2295	Ga0068856_100150572
2296	Ga0068856_100151171
2297	Ga0068856_100851816
2298	Ga0068856_100915603
2299	Ga0068856_101375148
2300	Ga0070702_100037542
2301	Ga0070702_100456722
2302	Ga0068852_100041075
2303	Ga0068852_100351507
2304	Ga0068852_100486940
2305	Ga0068852_100532169
2306	Ga0068852_100793539
2307	Ga0068852_101101163
2308	Ga0068859_100119183
2309	Ga0068859_100190632
2310	Ga0068859_100439644
2311	Ga0068859_100757868
2312	Ga0068859_101222379
2313	Ga0068864_100050250
2314	Ga0068866_10085758
2315	Ga0068866_10175721
2316	Ga0068861_100034317
2317	Ga0068861_101070439
2318	Ga0068861_102700276
2319	Ga0068851_10210401
2320	Ga0068851_10554852
2321	Ga0068870_10193910
2322	Ga0068870_10274818
2323	Ga0068863_100186135
2324	Ga0068863_100420950
2325	Ga0068863_100582881
2326	Ga0068863_100596810
2327	Ga0068858_100045860
2328	Ga0068858_100097155
2329	Ga0068858_100127363
2330	Ga0068858_100153712
2331	Ga0068858_100528007
2332	Ga0068858_100994344
2333	Ga0068860_100000313
2334	Ga0068860_100305798
2335	Ga0068860_100350641
2336	Ga0068860_100549852
2337	Ga0068860_100739212
2338	Ga0068860_100996661
2339	Ga0068860_101052254
2340	Ga0068860_102069769
2341	Ga0068862_100060270
2342	Ga0068862_100146849
2343	Ga0068862_101777401
2344	Ga0081455_10023465
2345	Ga0081455_10197216
2346	Ga0081455_10205210
2347	Ga0081455_10217359
2348	Ga0081455_10251587
2349	Ga0081455_10935094
2350	Ga0081538_10047308
2351	Ga0081540_1003389
2352	Ga0081540_1005656
2353	Ga0081540_1005657
2354	Ga0081540_1012479
2355	Ga0081540_1013267
2356	Ga0081540_1019710
2357	Ga0081540_1030350
2358	Ga0081540_1032245
2359	Ga0081540_1060906
2360	Ga0081540_1176736
2361	Ga0081540_1233896
2362	Ga0081539_10000157
2363	Ga0081539_10002599
2364	Ga0081539_10017515
2365	Ga0081539_10022796
2366	Ga0081539_10051720
2367	Ga0081539_10057358
2368	Ga0081539_10488174
2369	Ga0070717_10001671
2370	Ga0070717_10017257
2371	Ga0070717_10743691
2372	Ga0075365_10042277
2373	Ga0075365_10080973
2374	Ga0075365_10100347
2375	Ga0075365_10138586
2376	Ga0075365_10177196
2377	Ga0075368_10047928
2378	Ga0075368_10098548
2379	Ga0075368_10111463
2380	Ga0075363_100002704
2381	Ga0075363_100041425
2382	Ga0075363_100055098
2383	Ga0075363_100269458
2384	Ga0075363_100353481
2385	Ga0075364_10219482
2386	Ga0075364_10543149
2387	Ga0070715_10000590
2388	Ga0070715_10906601
2389	Ga0070716_100015909
2390	Ga0070716_100017234
2391	Ga0070716_100086034
2392	Ga0070716_100247411
2393	Ga0070716_100874762
2394	Ga0070712_100002371
2395	Ga0070712_100021384
2396	Ga0070712_100200762
2397	Ga0070712_100306110
2398	Ga0070712_100444424
2399	Ga0070712_100975851
2400	Ga0070712_101710623
2401	Ga0075362_10051603
2402	Ga0075362_10172173
2403	Ga0075362_10244591
2404	Ga0075362_10373290
2405	Ga0075367_10012975
2406	Ga0075367_10102176
2407	Ga0075367_10264291
2408	Ga0075367_10311218
2409	Ga0075367_10645809
2410	Ga0075367_10962545
2411	Ga0075369_10039962
2412	Ga0075369_10163724
2413	Ga0075369_10266674
2414	Ga0075369_10441589
2415	Ga0075366_10131341
2416	Ga0075366_10287378
2417	Ga0075366_10789630
2418	Ga0097621_100014735
2419	Ga0097621_100688012
2420	Ga0097621_101504491
2421	Ga0075370_10001262
2422	Ga0075370_10189481
2423	Ga0075370_10191797
2424	Ga0075370_10589033
2425	Ga0075370_10841497
2426	Ga0068871_100289957
2427	Ga0068871_100390426
2428	Ga0068871_101450764
2429	Ga0075428_100367202
2430	Ga0075428_100424739
2431	Ga0075430_100788751
2432	Ga0075430_101131487
2433	Ga0075434_100412054
2434	Ga0075434_100486760
2435	Ga0075429_100282742
2436	Ga0068865_100066305
2437	Ga0068865_101009708
2438	Ga0068865_101339002
2439	Ga0075436_100135585
2440	Ga0075436_100831655
2441	Ga0097620_100119191
2442	Ga0097620_100190621
2443	Ga0097620_100439625
2444	Ga0097620_100757865
2445	Ga0097620_101222319
2446	Ga0099825_1041834
2447	Ga0099824_1008303
2448	Ga0099824_1010623
2449	Ga0099822_1000541
2450	Ga0075435_100036950
2451	Ga0075435_100188979
2452	Ga0099795_10012521
2453	Ga0099795_10089424
2454	Ga0099795_10113640
2455	Ga0099795_10177007
2456	Ga0099795_10246643
2457	Ga0105251_10210152
2458	Ga0105240_10013303
2459	Ga0105240_10033967
2460	Ga0105240_10094752
2461	Ga0105240_10136853
2462	Ga0105240_10174427
2463	Ga0105240_10596271
2464	Ga0105240_10919059
2465	Ga0105240_12782948
2466	Ga0111539_10264383
2467	Ga0111539_10464737
2468	Ga0105245_10274375
2469	Ga0105245_10344617
2470	Ga0105245_10478086
2471	Ga0105245_10507544
2472	Ga0105247_10016513
2473	Ga0105247_10044475
2474	Ga0105247_10073098
2475	Ga0105247_10341307
2476	Ga0105247_10363220
2477	Ga0105247_11273866
2478	Ga0114129_10285040
2479	Ga0114129_11660062
2480	Ga0105243_10079455
2481	Ga0105243_10158432
2482	Ga0105243_10361895
2483	Ga0105243_10800944
2484	Ga0105243_11675559
2485	Ga0105243_12055230
2486	Ga0105241_10004267
2487	Ga0105241_10081363
2488	Ga0105241_10083949
2489	Ga0105241_10172549
2490	Ga0105241_10175798
2491	Ga0105241_10364396
2492	Ga0105241_10702151
2493	Ga0105241_11811373
2494	Ga0105242_10626556
2495	Ga0105242_10735085
2496	Ga0105242_12887996
2497	Ga0105248_10306033
2498	Ga0105248_11052858
2499	Ga0105248_11742282
2500	Ga0105237_10017841
2501	Ga0105237_10020621
2502	Ga0105237_10082692
2503	Ga0105237_10111420
2504	Ga0105237_10132493
2505	Ga0105237_10145400
2506	Ga0105237_10312710
2507	Ga0105237_10459852
2508	Ga0105237_10533313
2509	Ga0105237_10646743
2510	Ga0105238_10153984
2511	Ga0105238_10179888
2512	Ga0105238_10220820
2513	Ga0105238_10778791
2514	Ga0105238_11199051
2515	Ga0105238_11606169
2516	Ga0105249_10097572
2517	Ga0105249_10223880
2518	Ga0105249_11920669
2519	Ga0099796_10027886
2520	Ga0099796_10049785
2521	Ga0099796_10244885
2522	Ga0099796_10418346
2523	Ga0105239_10023011
2524	Ga0105239_10031553
2525	Ga0105239_10066232
2526	Ga0105239_10099249
2527	Ga0105239_10135023
2528	Ga0105239_10180495
2529	Ga0105239_10500715
2530	Ga0105239_10832606
2531	Ga0105239_10988961
2532	Ga0105239_12726441
2533	Ga0105246_10031978
2534	Ga0105246_10052370
2535	Ga0105246_10198188
2536	Ga0105246_10444436
2537	Ga0105246_11087899
2538	Ga0105246_11245971
2539	Ga0157337_1014589
2540	Ga0157322_1005591
2541	Ga0157347_1037691
2542	Ga0157315_1010385
2543	Ga0157338_1022752
2544	Ga0157373_10181973
2545	Ga0157371_10425358
2546	Ga0157370_10093493
2547	Ga0157370_10184513
2548	Ga0157370_10209538
2549	Ga0157370_10822186
2550	Ga0157369_10006548
2551	Ga0157369_10112437
2552	Ga0157369_10134403
2553	Ga0157369_10341636
2554	Ga0157369_11396543
2555	Ga0157369_11450812
2556	Ga0157374_10179664
2557	Ga0157374_10403436
2558	Ga0157374_11019747
2559	Ga0157374_11349626
2560	Ga0157374_11356245
2561	Ga0157378_10001192
2562	Ga0157378_10031729
2563	Ga0157378_10410477
2564	Ga0157378_10810695
2565	Ga0157378_11075757
2566	Ga0157378_11782155
2567	Ga0157378_12324002
2568	Ga0163162_10081273
2569	Ga0163162_10105428
2570	Ga0163162_10164090
2571	Ga0163162_10234128
2572	Ga0163162_10299853
2573	Ga0163162_10377851
2574	Ga0163162_10628014
2575	Ga0163162_10807234
2576	Ga0163162_10994774
2577	Ga0157372_10139256
2578	Ga0157372_10172733
2579	Ga0157372_10299932
2580	Ga0157372_10500575
2581	Ga0157372_10718321
2582	Ga0157372_10901442
2583	Ga0157372_12195483
2584	Ga0157375_10006444
2585	Ga0157375_10070094
2586	Ga0157375_10195176
2587	Ga0157375_11056116
2588	Ga0157375_11475793
2589	Ga0157375_12095425
2590	Ga0157375_13263587
2591	Ga0163163_10010769
2592	Ga0163163_10270858
2593	Ga0163163_10326252
2594	Ga0163163_10574974
2595	Ga0163163_11331624
2596	Ga0163163_11429976
2597	Ga0157380_10136861
2598	Ga0157380_10574738
2599	Ga0157380_10869541
2600	Ga0157380_10974683
2601	Ga0157380_11485087
2602	Ga0157380_12589352
2603	Ga0157377_10166713
2604	Ga0157377_10743533
2605	Ga0157379_10394413
2606	Ga0157379_11883202
2607	Ga0157379_11935995
2608	Ga0157376_10106890
2609	Ga0157376_10121557
2610	Ga0157376_10179717
2611	Ga0157376_11243925
2612	Ga0157376_12358623
2613	Ga0182006_1137118
2614	Ga0182007_10062995
2615	Ga0163161_10234329
2616	Ga0163161_10555463
2617	Ga0214544_1000003
2618	Ga0214542_1000022
2619	Ga0214545_1000010
2620	Ga0214543_1000035
2621	Ga0213873_10001016
2622	Ga0213872_10300810
2623	Ga0213874_10079548
2624	Ga0213874_10089417
2625	Ga0213876_10017171
2626	Ga0213876_10031721
2627	Ga0213875_10087604
2628	Ga0213871_10068397
2629	Ga0213871_10222011
2630	Ga0209677_100492
2631	Ga0209677_103568
2632	Ga0209148_1000267
2633	Ga0209148_1018192
2634	Ga0209233_1001537
2635	Ga0209233_1004347
2636	Ga0209233_1013744
2637	Ga0209233_1035962
2638	Ga0209455_1004219
2639	Ga0209455_1004254
2640	Ga0209455_1008390
2641	Ga0209455_1015806
2642	Ga0209130_1039522
2643	Ga0209564_1011905
2644	Ga0209564_1022023
2645	Ga0209758_1000015
2646	Ga0209758_1000711
2647	Ga0209758_1000764
2648	Ga0209758_1001094
2649	Ga0209758_1001468
2650	Ga0209758_1004096
2651	Ga0209758_1025205
2652	Ga0209758_1102925
2653	Ga0209256_1002592
2654	Ga0209256_1069845
2655	Ga0207426_1000368
2656	Ga0207426_1005258
2657	Ga0207426_1013131
2658	Ga0209051_1086739
2659	Ga0209257_1070321
2660	Ga0207697_10329959
2661	Ga0207656_10102737
2662	Ga0207656_10137583
2663	Ga0207656_10433794
2664	Ga0207682_10495817
2665	Ga0207692_10004867
2666	Ga0207692_10063797
2667	Ga0207642_10364001
2668	Ga0207642_10472105
2669	Ga0207642_10702272
2670	Ga0207710_10140399
2671	Ga0207710_10214453
2672	Ga0207710_10265166
2673	Ga0207710_10375886
2674	Ga0207710_10509391
2675	Ga0207688_10016777
2676	Ga0207688_10063558
2677	Ga0207688_10117643
2678	Ga0207688_10212700
2679	Ga0207680_10338513
2680	Ga0207647_10211956
2681	Ga0207685_10114155
2682	Ga0207685_10260687
2683	Ga0207685_10527314
2684	Ga0207699_10001435
2685	Ga0207699_10003885
2686	Ga0207699_10006921
2687	Ga0207699_10074346
2688	Ga0207645_10191598
2689	Ga0207645_10238665
2690	Ga0207643_10076315
2691	Ga0207643_10450257
2692	Ga0207705_10029183
2693	Ga0207705_10108063
2694	Ga0207705_10156485
2695	Ga0207684_10142789
2696	Ga0207684_10167560
2697	Ga0207684_10460353
2698	Ga0207654_10103234
2699	Ga0207654_10156794
2700	Ga0207654_10195836
2701	Ga0207654_10283071
2702	Ga0207654_10343098
2703	Ga0207654_10743045
2704	Ga0207707_10000143
2705	Ga0207707_10000613
2706	Ga0207707_10022062
2707	Ga0207707_10030362
2708	Ga0207707_10049787
2709	Ga0207695_10000059
2710	Ga0207695_10020632
2711	Ga0207695_10111764
2712	Ga0207695_10148861
2713	Ga0207695_10213948
2714	Ga0207695_10364142
2715	Ga0207695_10912842
2716	Ga0207671_10106177
2717	Ga0207671_10170809
2718	Ga0207671_10665477
2719	Ga0207671_10676812
2720	Ga0207693_10005195
2721	Ga0207693_10032442
2722	Ga0207693_10088211
2723	Ga0207693_10159692
2724	Ga0207693_10203937
2725	Ga0207693_10403137
2726	Ga0207663_10001411
2727	Ga0207663_10048671
2728	Ga0207663_10100981
2729	Ga0207663_10546993
2730	Ga0207663_10623640
2731	Ga0207663_11049581
2732	Ga0207663_11259923
2733	Ga0207660_10038751
2734	Ga0207660_10429474
2735	Ga0207662_10202787
2736	Ga0207657_10006552
2737	Ga0207657_10151681
2738	Ga0207657_10214450
2739	Ga0207657_10241019
2740	Ga0207657_10296410
2741	Ga0207657_10362729
2742	Ga0207657_10547940
2743	Ga0207657_11496304
2744	Ga0207649_10210448
2745	Ga0207649_10667251
2746	Ga0207652_10023738
2747	Ga0207652_10135112
2748	Ga0207652_10160675
2749	Ga0207652_10553615
2750	Ga0207652_10571516
2751	Ga0207646_10075271
2752	Ga0207646_10224791
2753	Ga0207681_10113273
2754	Ga0207681_11017706
2755	Ga0207694_10017116
2756	Ga0207694_10152670
2757	Ga0207694_10448788
2758	Ga0207694_10747453
2759	Ga0207694_11110992
2760	Ga0207694_11144531
2761	Ga0207694_11779952
2762	Ga0207650_10540788
2763	Ga0207659_10197665
2764	Ga0207687_10089139
2765	Ga0207687_10166677
2766	Ga0207687_10187193
2767	Ga0207687_10205885
2768	Ga0207687_10209382
2769	Ga0207700_10007542
2770	Ga0207700_10064374
2771	Ga0207700_10074059
2772	Ga0207700_10181339
2773	Ga0207700_10203522
2774	Ga0207700_10449883
2775	Ga0207700_10922297
2776	Ga0207664_10064293
2777	Ga0207664_10094469
2778	Ga0207664_11072456
2779	Ga0207644_10037392
2780	Ga0207644_10636309
2781	Ga0207690_10330702
2782	Ga0207690_10849801
2783	Ga0207690_10904412
2784	Ga0207706_10025737
2785	Ga0207706_10054738
2786	Ga0207706_10110925
2787	Ga0207706_10126798
2788	Ga0207706_11049528
2789	Ga0207686_10030104
2790	Ga0207686_10423330
2791	Ga0207686_10748534
2792	Ga0207709_10028400
2793	Ga0207709_10368445
2794	Ga0207670_10531537
2795	Ga0207669_10757337
2796	Ga0207704_10311577
2797	Ga0207704_10409386
2798	Ga0207704_11451316
2799	Ga0207665_10006088
2800	Ga0207665_10021690
2801	Ga0207665_10031878
2802	Ga0207665_10143808
2803	Ga0207665_10580077
2804	Ga0207665_10785304
2805	Ga0207691_10133481
2806	Ga0207691_10135680
2807	Ga0207691_10153971
2808	Ga0207691_10284223
2809	Ga0207711_10052528
2810	Ga0207711_10055306
2811	Ga0207711_10169648
2812	Ga0207711_10608277
2813	Ga0207689_10085839
2814	Ga0207689_10094502
2815	Ga0207689_10600556
2816	Ga0207689_11219657
2817	Ga0207661_10045171
2818	Ga0207661_10065867
2819	Ga0207661_10144436
2820	Ga0207661_10624757
2821	Ga0207679_10148500
2822	Ga0207679_10405909
2823	Ga0207679_10615910
2824	Ga0207679_10759882
2825	Ga0207667_10064954
2826	Ga0207667_10114066
2827	Ga0207667_10114571
2828	Ga0207667_10142047
2829	Ga0207667_10151057
2830	Ga0207667_10165662
2831	Ga0207667_10224237
2832	Ga0207667_10554184
2833	Ga0207651_11740429
2834	Ga0207712_10045213
2835	Ga0207712_10226740
2836	Ga0207712_11771064
2837	Ga0207668_10218356
2838	Ga0207668_10310158
2839	Ga0207668_10786317
2840	Ga0207640_10008004
2841	Ga0207640_10104012
2842	Ga0207640_10953136
2843	Ga0207658_11086894
2844	Ga0207677_10019118
2845	Ga0207677_10060703
2846	Ga0207703_10107143
2847	Ga0207703_10135926
2848	Ga0207703_10530434
2849	Ga0207703_10660613
2850	Ga0207703_11413610
2851	Ga0207639_10066056
2852	Ga0207639_10112546
2853	Ga0207639_10181927
2854	Ga0207639_10207018
2855	Ga0207639_10720806
2856	Ga0207639_10994489
2857	Ga0207678_10017766
2858	Ga0207678_10019513
2859	Ga0207678_10033040
2860	Ga0207678_10059483
2861	Ga0207678_10060315
2862	Ga0207678_10079668
2863	Ga0207678_10090054
2864	Ga0207678_10095764
2865	Ga0207708_10119838
2866	Ga0207702_10000063
2867	Ga0207702_10042949
2868	Ga0207702_10173249
2869	Ga0207702_10198642
2870	Ga0207702_10338836
2871	Ga0207641_10037994
2872	Ga0207641_10079791
2873	Ga0207641_10507102
2874	Ga0207641_10632470
2875	Ga0207648_10023956
2876	Ga0207648_10811332
2877	Ga0207676_10071505
2878	Ga0207676_10328881
2879	Ga0207676_10581514
2880	Ga0207676_10703494
2881	Ga0207676_11951772
2882	Ga0207674_10027211
2883	Ga0207674_10061985
2884	Ga0207674_10289724
2885	Ga0207674_10330258
2886	Ga0207674_10617189
2887	Ga0207674_11710656
2888	Ga0207675_100037599
2889	Ga0207675_100336806
2890	Ga0207675_101200862
2891	Ga0207675_102689779
2892	Ga0207683_10038422
2893	Ga0207683_10040055
2894	Ga0207683_10093362
2895	Ga0207683_10161017
2896	Ga0207683_10445613
2897	Ga0207683_10629477
2898	Ga0207683_10762169
2899	Ga0207683_10829173
2900	Ga0207683_11723529
2901	Ga0207698_10047325
2902	Ga0207698_10087420
2903	Ga0207698_10287855
2904	Ga0207698_10442465
2905	Ga0209389_1000012
2906	Ga0209389_1000069
2907	Ga0209589_1000015
2908	Ga0209589_1000077
2909	Ga0209489_100015
2910	Ga0209489_100019
2911	Ga0209489_100020
2912	Ga0209700_100018
2913	Ga0209700_100025
2914	Ga0209179_1004877
2915	Ga0209179_1065467
2916	Ga0209588_1087090
2917	Ga0207428_10148947
2918	Ga0207428_10671352
2919	Ga0268266_10003840
2920	Ga0268266_10008431
2921	Ga0268266_10034518
2922	Ga0268266_10287401
2923	Ga0268266_10289849
2924	Ga0268266_10682454
2925	Ga0268266_10869747
2926	Ga0268266_11040395
2927	Ga0268265_10110693
2928	Ga0268265_10159172
2929	Ga0268265_10385589
2930	Ga0268265_11917130
2931	Ga0268264_10000356
2932	Ga0268264_10170323
2933	Ga0268264_10296210
2934	Ga0268264_10435357
2935	Ga0268264_10545097
2936	Ga0268264_10884772
2937	Ga0265337_1028183
2938	Ga0265326_10093053
2939	Ga0265319_1094407
2940	Ga0265334_10167391
2941	Ga0265323_10007414
2942	Ga0265336_10000346
2943	Ga0307517_10001423
2944	Ga0307517_10103123
2945	Ga0307515_10032146
2946	Ga0307515_10491678
2947	Ga0265338_10000417
2948	Ga0265324_10053383
2949	Ga0307511_10087863
2950	Ga0265330_10014662
2951	Ga0265330_10265438
2952	Ga0265332_10019479
2953	Ga0265325_10340841
2954	Ga0265340_10002373
2955	Ga0265339_10003359
2956	Ga0265339_10008317
2957	Ga0265339_10067138
2958	Ga0265339_10148864
2959	Ga0265331_10110493
2960	Ga0265331_10342095
2961	Ga0265316_10479568
2962	Ga0307513_10160211
2963	Ga0307509_10103122
2964	Ga0307509_10170540
2965	Ga0307509_10365858
2966	Ga0307408_100508290
2967	Ga0307408_100916392
2968	Ga0307508_10000012
2969	Ga0307508_10013966
2970	Ga0307508_10095708
2971	Ga0307508_10148584
2972	Ga0307508_10238343
2973	Ga0307508_10259862
2974	Ga0307508_10333307
2975	Ga0307508_10507706
2976	Ga0307508_10693837
2977	Ga0265314_10032879
2978	Ga0265314_10043122
2979	Ga0265314_10094223
2980	Ga0265314_10403949
2981	Ga0265342_10003269
2982	Ga0265342_10100726
2983	Ga0265342_10376715
2984	Ga0307516_10074049
2985	Ga0307516_10118097
2986	Ga0307516_10283648
2987	Ga0307516_10840748
2988	Ga0307405_10099808
2989	Ga0307405_10438169
2990	Ga0307405_10517343
2991	Ga0307413_10209419
2992	Ga0307413_10401276
2993	Ga0307413_10789558
2994	Ga0307518_10383323
2995	Ga0307410_10359920
2996	Ga0307410_10961269
2997	Ga0307406_10345595
2998	Ga0307406_11579529
2999	Ga0307412_10581560
3000	Ga0307412_11066495
3001	Ga0307412_11308191
3002	Ga0307409_100615857
3003	Ga0307409_100742023
3004	Ga0307409_100946245
3005	Ga0307416_100165078
3006	Ga0307416_100170057
3007	Ga0307416_100562523
3008	Ga0307416_100572816
3009	Ga0307416_100686280
3010	Ga0307411_10359393
3011	Ga0307411_10776908
3012	Ga0307411_10842386
3013	Ga0307415_100041039
3014	Ga0307415_100074599
3015	Ga0307415_100205605
3016	Ga0307507_10386634
3017	Ga0307507_10465288
3018	Ga0307507_10510608
3019	Ga0307510_10015377
3020	Ga0307510_10023362
3021	Ga0307510_10047751
3022	Ga0307510_10068023
3023	Ga0307510_10100483
3024	Ga0315911_1000037
3025	Ga0316215_1002468
3026	Ga0316215_1005057
3027	Ga0373938_0030358
3028	Ga0373929_0050158
3029	Ga0373934_0002532
3030	Ga0373934_0131191
3031	Ga0373934_0368895
3032	Ga0373934_0402812
3033	Ga0373940_0149301
3034	Ga0373944_0013773
3035	Ga0373951_0058726
3036	Ga0373952_0049196
3037	Ga0373923_0003267
3038	Ga0373923_0107440
3039	Ga0373932_0076704
3040	Ga0373932_0078908
3041	Ga0373936_0001098
3042	Ga0373936_0010885
3043	Ga0373939_0309195
3044	Ga0373945_0001922
3045	Ga0373953_0001769
3046	Ga0373953_0009391
3047	Ga0373953_0136825
3048	Ga0373953_0302542
3049	Ga0373954_0006705
3050	Ga0373954_0021038
3051	Ga0373954_0109116
3052	Ga0373954_0248741
3053	Ga0373956_0000376
3054	Ga0373957_0005684
3055	Ga0373957_0126643
3056	Ga0373957_0165487
3057	Ga0373960_0039504
3058	Ga0373943_0013877
3059	Ga0373943_0021992
3060	Ga0373943_0071667
3061	Ga0373943_0991274
3062	Ga0373946_0003124
3063	Ga0373946_0114177
3064	Ga0373946_0263791
3065	Ga0373955_0000325
3066	Ga0373955_0067917
3067	Ga0373955_0086410
3068	Ga0373955_0493345
3069	Ga0373955_0552862
3070	Ga0373961_0096129
3071	Ga0373924_0007619
3072	Ga0373931_0009747
3073	Ga0373931_0109888
3074	Ga0373931_1204276
3075	Ga0373935_0050257
3076	Ga0373935_1405015
3077	Ga0373927_0000137
3078	Ga0373927_0023546
3079	Ga0373927_0036587
3080	Ga0373927_0056610
3081	Ga0373927_0068754
3082	Ga0373927_0073602
3083	Ga0373933_0000108
3084	Ga0373933_0005894
3085	Ga0373933_0074164
3086	Ga0373933_0154167
3087	Ga0373947_0000902
3088	Ga0373947_0012959
3089	Ga0373947_0103699
3090	Ga0373937_0007855
3091	Ga0373937_0024716
3092	Ga0373937_0041640
3093	Ga0373937_0085096
3094	Ga0373937_0206959
3095	Ga0373937_0353280
3096	Ga0373925_0002159
3097	Ga0373925_0010829
3098	Ga0373925_0027502
3099	Ga0373925_0036147
3100	Ga0373925_0166377
3101	Ga0373925_0314821
3102	Ga0373925_0393001
3103	Ga0395899_0069956
3104	Ga0395899_0741913
3105	Ga0395900_0001756
3106	Ga0395900_0010446
3107	Ga0395900_0310507
3108	Ga0395900_1133459
3109	Ga0395898_0014127
3110	Ga0395898_0058280
3111	Ga0395898_0070167
3112	Ga0395898_0114507
3113	Ga0395898_0125707
3114	Ga0395905_0033826
3115	Ga0395905_0098242
3116	Ga0395905_0367275
3117	Ga0395905_0788484
3118	Ga0395905_1370841
3119	Ga0436364_0461113
3120	Ga0436364_0567719
3121	Ga0436364_0755715
3122	Ga0436364_1480697
3123	Ga0395901_0028786
3124	Ga0395901_0033726
3125	Ga0395901_0382530
3126	Ga0395901_1401679
3127	Ga0436365_0457714
3128	Ga0436365_0465888
3129	Ga0436365_0470267
3130	Ga0436365_0535532
3131	Ga0436365_0567755
3132	Ga0436365_0592130
3133	Ga0436365_1055631
3134	Ga0436365_1318311
3135	Ga0436365_1766966
3136	Ga0436365_1822955
3137	Ga0436360_0271275
3138	Ga0436360_0728475
3139	Ga0436361_0162931
3140	Ga0436361_0176045
3141	Ga0436361_1053264
3142	Ga0436363_0131451
3143	Ga0436363_0277737
3144	Ga0436363_0667058
3145	Ga0436363_0811316
3146	Ga0436363_1163541
3147	Ga0436363_1295760
3148	Ga0436362_0664428
3149	Ga0436362_0666664
3150	Ga0439465_0051910
3151	Ga0439465_0131803
3152	Ga0439465_0233931
3153	Ga0451787_779488
3154	Ga0451789_1128803
3155	Ga0451795_0601895
3156	Ga0451795_1712836
3157	Ga0451798_0080004
3158	Ga0451800_1177411
3159	Ga0451802_0212299
3160	Ga0451804_0051753
3161	Ga0451833_0611562
3162	Ga0451835_0949682
3163	Ga0451837_0744389
3164	Ga0451841_0624660
3165	Ga0451845_0566838
3166	Ga0451847_0531524
3167	Ga0451849_1377632
3168	Ga0439445_0232531
3169	Ga0439452_085843
3170	Ga0466969_0128244
3171	Ga0466969_0299876
3172	Ga0466972_0000100
3173	Ga0466972_0014629
3174	Ga0466965_0011221
3175	Ga0466966_0001463
3176	Ga0466961_0000601
3177	Ga0466963_0058249
3178	Ga0466963_0139843
3179	Ga0466963_0143314
3180	Ga0466964_0020493
3181	Ga0466964_0629609
3182	Ga0466971_0305191
3183	Ga0466968_0008001
3184	Ga0466968_0027271
3185	Ga0466968_0513968
3186	Ga0466970_0306927
3187	Ga0466957_0298086
3188	Ga0466957_0775164
3189	Ga0466957_1169032
3190	Ga0466960_0200413
3191	Ga0466960_0386850
3192	Ga0466959_0000634
3193	Ga0466959_0054194
3194	Ga0466959_0059778
3195	Ga0466959_0179892
3196	Ga0466958_0012458
3197	Ga0466967_0161245
3198	Ga0466967_0227567
3199	Ga0466967_0294185
3200	Ga0466967_0820019
3201	Ga0466967_1402699
3202	Ga0495617_189794
3203	Ga0495627_194441
3204	Ga0495592_0000339
3205	Ga0495592_0008958
3206	Ga0495592_0033013
3207	Ga0495592_0034020
3208	Ga0495592_0058113
3209	Ga0495592_0103564
3210	Ga0495592_0406878
3211	Ga0495603_0000277
3212	Ga0495603_0030355
3213	Ga0495603_0030573
3214	Ga0495603_0058565
3215	Ga0495603_0064886
3216	Ga0495603_0599734
3217	Ga0495590_0074315
3218	Ga0495590_0170149
3219	Ga0495590_0356297
3220	Ga0495629_0000029
3221	Ga0495629_0001483
3222	Ga0495629_0038459
3223	Ga0495629_0043490
3224	Ga0495629_0056255
3225	Ga0495629_0087111
3226	Ga0495629_0438206
3227	Ga0495638_0014467
3228	Ga0495638_0017657
3229	Ga0495638_0069511
3230	Ga0495638_0376448
3231	Ga0495638_0431987
3232	Ga0495641_0003605
3233	Ga0495641_0033063
3234	Ga0495641_0119785
3235	Ga0495651_0031486
3236	Ga0495651_0034091
3237	Ga0495651_0042153
3238	Ga0495651_0053385
3239	Ga0495651_0165251
3240	Ga0495651_0635518
3241	Ga0495653_0001063
3242	Ga0495653_0141058
3243	Ga0495653_0164002
3244	Ga0495580_0002567
3245	Ga0495580_0094251
3246	Ga0495580_0135806
3247	Ga0495582_0000024
3248	Ga0495582_0076346
3249	Ga0495582_0313738
3250	Ga0495582_0582550
3251	Ga0495605_0045762
3252	Ga0495605_0218294
3253	Ga0495605_0258450
3254	Ga0495639_0000006
3255	Ga0495639_0027634
3256	Ga0495639_0029660
3257	Ga0495639_0188269
3258	Ga0495639_0194114
3259	Ga0495639_0329034
3260	Ga0495639_0413937
3261	Ga0495662_0000348
3262	Ga0495662_0143009
3263	Ga0495662_0273781
3264	Ga0495662_0417645
3265	Ga0495662_0541660
3266	Ga0495664_0007034
3267	Ga0495664_0013716
3268	Ga0495664_0041673
3269	Ga0495664_0042709
3270	Ga0495664_0183695
3271	Ga0495664_0394411
3272	Ga0495664_0413932
3273	Ga0495584_0172906
3274	Ga0495584_0187522
3275	Ga0495584_0228178
3276	Ga0495584_0321919
3277	Ga0495585_0105730
3278	Ga0495585_0112852
3279	Ga0495585_0315756
3280	Ga0495594_0000170
3281	Ga0495596_0231163
3282	Ga0495596_0259217
3283	Ga0495596_0378352
3284	Ga0495606_0011270
3285	Ga0495606_0013516
3286	Ga0495606_0124831
3287	Ga0495606_0194509
3288	Ga0495606_0285811
3289	Ga0495608_0002749
3290	Ga0495608_0071053
3291	Ga0495608_0075302
3292	Ga0495608_0340730
3293	Ga0495610_0044538
3294	Ga0495610_0263438
3295	Ga0495616_0158585
3296	Ga0495616_0285692
3297	Ga0495618_0018824
3298	Ga0495618_0097183
3299	Ga0495620_0069579
3300	Ga0495628_0010789
3301	Ga0495628_0014226
3302	Ga0495628_0040319
3303	Ga0495628_0074634
3304	Ga0495628_0074994
3305	Ga0495628_0079529
3306	Ga0495630_0003257
3307	Ga0495630_0543444
3308	Ga0495630_0902054
3309	Ga0495631_0132036
3310	Ga0495631_0242852
3311	Ga0495631_0362040
3312	Ga0495632_0383115
3313	Ga0495643_0157573
3314	Ga0495643_0250024
3315	Ga0495648_0019778
3316	Ga0495648_0470391
3317	Ga0495663_0058748
3318	Ga0495666_0011725
3319	Ga0495666_0031438
3320	Ga0495666_0115215
3321	Ga0495652_0021359
3322	Ga0495652_0040442
3323	Ga0495652_0047155
3324	Ga0495652_0061633
3325	Ga0495652_0101400
3326	Ga0495652_0105377
3327	Ga0495652_0179399
3328	Ga0495652_0182406
3329	Ga0495665_0000178
3330	Ga0495665_0044353
3331	Ga0495665_0528883
3332	Ga0495640_0003797
3333	Ga0495640_0004410
3334	Ga0495640_0008433
3335	Ga0495640_0022850
3336	Ga0495640_0060314
3337	Ga0495640_0101453
3338	Ga0495640_0286250
3339	Ga0495586_0116006
3340	Ga0495587_0010898
3341	Ga0495587_0087441
3342	Ga0495587_0246208
3343	Ga0495587_0253739
3344	Ga0495587_0285249
3345	Ga0495598_0054147
3346	Ga0495609_0058832
3347	Ga0495645_0004746
3348	Ga0495645_0033925
3349	Ga0495645_0052192
3350	Ga0495645_0068585
3351	Ga0495645_0100650
3352	Ga0495645_0279368
3353	Ga0495645_0748766
3354	Ga0495622_0002996
3355	Ga0495622_0015955
3356	Ga0495622_0031914
3357	Ga0495622_0046682
3358	Ga0495622_0287944
3359	Ga0495622_0327017
3360	Ga0495667_0003075
3361	Ga0495667_0011132
3362	Ga0495667_0024918
3363	Ga0495667_0074387
3364	Ga0495667_0088315
3365	Ga0495667_0121941
3366	Ga0495656_0007598
3367	Ga0495656_0140181
3368	Ga0495656_0199831
3369	Ga0495656_0269722
3370	Ga0495656_0308449
3371	Ga0495656_0815787
3372	Ga0495668_0131319
3373	Ga0495668_0132855
3374	Ga0495668_0652047
3375	Ga0495634_0000354
3376	Ga0495634_0002330
3377	Ga0495634_0023750
3378	Ga0495634_0033779
3379	Ga0495634_0037146
3380	Ga0495634_0309592
3381	Ga0495611_0086995
3382	Ga0495611_0231836
3383	Ga0495625_0302138
3384	Ga0495625_0423648
3385	Ga0495635_0000917
3386	Ga0495635_0002291
3387	Ga0495635_0006214
3388	Ga0495635_0221118
3389	Ga0495635_0281012
3390	Ga0495635_0316753
3391	Ga0495659_0092522
3392	Ga0495661_0175749
3393	Ga0495661_0214543
3394	Ga0495661_0247521
3395	Ga0495588_0009296
3396	Ga0495588_0028376
3397	Ga0495588_0121742
3398	Ga0495588_0571712
3399	Ga0495657_0003543
3400	Ga0495657_0005133
3401	Ga0495657_0027263
3402	Ga0495657_0066994
3403	Ga0495657_0352956
3404	Ga0495599_0005791
3405	Ga0495599_0036803
3406	Ga0495599_0038886
3407	Ga0495599_0051217
3408	Ga0495599_0467094
3409	Ga0495623_0043318
3410	Ga0495623_0091225
3411	Ga0495646_0000902
3412	Ga0495646_0003762
3413	Ga0495646_0037428
3414	Ga0495646_0056213
3415	Ga0495646_0207256
3416	Ga0495647_0002169
3417	Ga0495647_0190705
3418	Ga0495658_0000428
3419	Ga0495658_0013755
3420	Ga0495669_0364995
3421	Ga0495669_0411181
3422	Ga0495613_0001078
3423	Ga0495613_0012318
3424	Ga0495613_0025741
3425	Ga0495613_0067799
3426	Ga0495624_0039622
3427	Ga0495624_0288327
3428	Ga0495624_0547005
3429	Ga0495670_0207610
3430	Ga0495671_0095635
3431	Ga0495671_0369498
3432	Ga0495649_0015639
3433	Ga0495649_0386262
3434	Ga0495649_0612794
3435	Ga0495589_0124161
3436	Ga0495600_0002741
3437	Ga0495600_0006367
3438	Ga0495600_0091394
3439	Ga0495600_0105865
3440	Ga0495600_0160273
3441	Ga0495600_0333100
3442	Ga0495600_0867384
3443	Ga0495660_0070035
3444	Ga0495581_0000004
3445	Ga0495581_0029027
3446	Ga0495581_0046985
3447	Ga0495581_0064398
3448	Ga0495581_0180826
3449	Ga0495581_0300584
3450	Ga0495604_0000678
3451	Ga0495604_0007541
3452	Ga0495604_0007941
3453	Ga0495604_0024945
3454	Ga0495604_0498211
3455	Ga0495636_0273422
3456	Ga0495674_0000415
3457	Ga0495674_0007236
3458	Ga0495674_0026281
3459	Ga0495674_0138061
3460	Ga0495674_0472914
3461	Ga0495674_0476089
3462	Ga0495674_0529073
3463	Ga0495672_0041687
3464	Ga0495676_0019876
3465	Ga0495676_0032444
3466	Ga0495676_0037764
3467	Ga0495676_0110006
3468	Ga0495676_0230096
3469	Ga0495680_0001065
3470	Ga0495680_0001164
3471	Ga0495680_0171432
3472	Ga0495680_0186581
3473	Ga0495687_063984
3474	Ga0495675_0000901
3475	Ga0495675_0012017
3476	Ga0495675_0029569
3477	Ga0495675_0105541
3478	Ga0495677_0027542
3479	Ga0495685_086663
3480	Ga0495673_0028163
3481	Ga0495673_0054421
3482	Ga0495673_0093444
3483	Ga0495673_0098520
3484	Ga0495684_0000721
3485	Ga0495684_0064676
3486	Ga0495684_0132607
3487	Ga0495684_0240922
3488	Ga0495686_0088359
3489	Ga0495686_0147299
3490	Ga0495686_0169188
3491	Ga0495686_0220036
3492	Ga0495686_0331221
3493	Ga0495686_0515592
3494	Ga0495593_0000198
3495	Ga0495593_0003019
3496	Ga0495593_0004072
3497	Ga0495593_0012359
3498	Ga0495602_0007817
3499	Ga0495602_0060850
3500	Ga0495602_0066581
3501	Ga0495602_0068869
3502	Ga0495614_0010431
3503	Ga0495614_0054371
3504	Ga0495626_0033878
3505	Ga0496100_0076187
3506	Ga0496100_0104614
3507	Ga0496100_0205185
3508	Ga0496100_0248530
3509	Ga0496100_0442531
3510	Ga0496100_0734907
3511	Ga0496100_0848577
3512	Ga0496100_1270963
3513	Ga0496100_1280572
3514	Ga0496101_0035951
3515	Ga0496101_0051291
3516	Ga0496101_0075732
3517	Ga0496101_0239501
3518	Ga0496101_1062489
3519	Ga0496101_1419080
3520	Ga0496101_1514915
3521	Ga0496102_0010100
3522	Ga0496102_0215412
3523	Ga0496102_0414116
3524	Ga0496102_0546348
3525	Ga0496102_0893063
3526	Ga0496102_1634588
3527	Ga0496102_1826394
3528	Ga0496102_1894271
3529	Ga0496103_0174441
3530	Ga0496103_0363439
3531	Ga0496103_1019280
3532	Ga0496103_1027921
3533	Ga0496104_0069211
3534	Ga0496104_0111561
3535	Ga0496104_0127620
3536	Ga0496104_0152912
3537	Ga0496104_0359439
3538	Ga0496104_0669216
3539	Ga0496104_1082961
3540	Ga0496104_1099501
3541	Ga0496105_0007733
3542	Ga0496105_0023125
3543	Ga0496105_0031538
3544	Ga0496105_0089641
3545	Ga0496105_0104649
3546	Ga0496105_0158139
3547	Ga0496105_0244586
3548	Ga0496105_1006985
3549	Ga0496105_1177333
3550	Ga0496106_0001953
3551	Ga0496106_0008314
3552	Ga0496106_0111956
3553	Ga0496106_0238798
3554	Ga0496106_0312812
3555	Ga0496106_0422003
3556	Ga0496106_1517208
3557	Ga0496107_0026534
3558	Ga0496107_0075432
3559	Ga0496107_0189454
3560	Ga0496107_0345512
3561	Ga0496107_0347909
3562	Ga0496107_0545759
3563	Ga0496107_0678942
3564	Ga0496108_0024837
3565	Ga0496108_0084715
3566	Ga0496108_0137501
3567	Ga0496108_0158978
3568	Ga0496108_0162276
3569	Ga0496108_0466239
3570	Ga0496108_0795115
3571	Ga0496109_0934451
3572	Ga0496110_0067758
3573	Ga0496110_0097259
3574	Ga0496110_0104482
3575	Ga0496110_0184677
3576	Ga0496110_0184729
3577	Ga0496110_0438878
3578	Ga0496110_0517987
3579	Ga0496110_1161507
3580	Ga0496111_0039021
3581	Ga0496111_0122829
3582	Ga0496111_0124557
3583	Ga0496111_0299537
3584	Ga0496112_0000035
3585	Ga0496112_0005407
3586	Ga0496112_0012245
3587	Ga0496112_0012881
3588	Ga0496112_0119383
3589	Ga0496112_0150591
3590	Ga0496112_0195855
3591	Ga0496112_0201148
3592	Ga0496112_0205128
3593	Ga0496112_0351265
3594	Ga0496112_0419009
3595	Ga0496112_1215628
3596	Ga0496112_1411317
3597	Ga0496113_0012388
3598	Ga0496113_0078640
3599	Ga0496113_0094872
3600	Ga0496113_0366521
3601	Ga0496113_0377327
3602	Ga0496114_0056820
3603	Ga0496114_0089409
3604	Ga0496114_0258964
3605	Ga0496114_0353195
3606	Ga0496114_0858646
3607	Ga0496114_1719069
3608	Ga0496114_1753861
3609	Ga0496115_0004493
3610	Ga0496115_0064612
3611	Ga0496115_0238325
3612	Ga0496115_0364285
3613	Ga0496115_0431011
3614	Ga0496115_0780280
3615	Ga0496116_0286041
3616	Ga0496116_0296976
3617	Ga0496116_0330047
3618	Ga0496117_0040145
3619	Ga0496118_0006555
3620	Ga0496118_0212977
3621	Ga0496118_0259467
3622	Ga0496118_0349437
3623	Ga0496118_0416819
3624	Ga0496119_0050692
3625	Ga0496119_0099718
3626	Ga0496119_0129641
3627	Ga0496119_0258261
3628	Ga0496120_0003365
3629	Ga0496120_0189369
3630	Ga0496120_0306399
3631	Ga0496121_0001622
3632	Ga0496121_0002148
3633	Ga0496121_0003594
3634	Ga0496121_0017170
3635	Ga0496121_0020688
3636	Ga0496121_0046952
3637	Ga0496121_0054013
3638	Ga0496121_0060870
3639	Ga0496121_0095914
3640	Ga0496121_0116625
3641	Ga0496121_0145106
3642	Ga0496121_0254825
3643	Ga0496121_0404292
3644	Ga0496121_0468567
3645	Ga0496121_0567958
3646	Ga0496121_0587000
3647	Ga0496123_0323657
3648	Ga0496124_0009366
3649	Ga0496124_0305006
3650	Ga0496124_0473042
3651	Ga0496124_0774686
3652	Ga0496125_0042831
3653	Ga0496125_0060229
3654	Ga0496125_0129587
3655	Ga0496125_0195754
3656	Ga0496125_0479322
3657	Ga0496126_0003472
3658	Ga0496126_0005839
3659	Ga0496126_0010376
3660	Ga0496126_0017647
3661	Ga0496126_0021771
3662	Ga0496126_0043071
3663	Ga0496126_0101102
3664	Ga0496126_0104677
3665	Ga0496126_0108764
3666	Ga0496126_0110276
3667	Ga0496126_0191762
3668	Ga0496126_0195056
3669	Ga0496126_0204097
3670	Ga0496126_0291233
3671	Ga0496126_0386199
3672	Ga0496126_0490302
3673	Ga0496126_1060192
3674	Ga0495678_078961
3675	Ga0495678_188393
3676	Ga0495682_0055599
3677	Ga0495682_0205587
3678	Ga0501031_0001791
3679	Ga0501032_0000762
3680	Ga0501033_0000136
3681	Ga0501033_0014591
3682	Ga0501034_0000251
3683	Ga0501034_0815316
3684	Ga0501036_0000036
3685	Ga0501036_0085855
3686	Ga0501037_0001715
3687	Ga0501037_1102719
3688	Ga0501038_0000428
3689	Ga0501038_0520321
3690	Ga0501039_0000273
3691	Ga0501042_0019699
3692	Ga0501042_0099665
3693	Ga0501043_0000165
3694	Ga0501043_0454101
3695	Ga0501046_0001143
3696	Ga0501047_0000340
3697	Ga0501047_0276342
3698	Ga0501047_0382229
3699	Ga0501048_0004509
3700	Ga0501048_0115235
3701	Ga0501048_0299110
3702	Ga0501067_0014425
3703	Ga0501067_0039960
3704	Ga0501067_0633983
3705	Ga0501068_0003807
3706	Ga0501068_0466996
3707	Ga0501068_0478744
3708	Ga0501069_0005466
3709	Ga0501069_0201953
3710	Ga0501070_0006502
3711	Ga0501070_0208129
3712	Ga0501071_0148488
3713	Ga0501071_0233276
3714	Ga0501071_0843080
3715	Ga0501072_0001213
3716	Ga0501073_0000037
3717	Ga0501074_0000167
3718	Ga0501074_0510076
3719	Ga0501079_0001057
3720	Ga0501080_0003259
3721	Ga0501080_0008505
3722	Ga0501083_0025461
3723	Ga0501035_0000142
3724	Ga0501035_0310655
3725	Ga0501035_0632162
3726	Ga0501044_0000414
3727	Ga0501044_0840280
3728	Ga0501045_0147819
3729	Ga0501045_0246213
3730	nmdc:mga03683_231530_c1
3731	nmdc:mga03683_259714_c1
3732	nmdc:mga03683_282986_c1
3733	nmdc:mga03683_46130_c1
3734	nmdc:mga03n38_18684_c1
3735	nmdc:mga03n38_957_c1
3736	nmdc:mga03n38_99925_c1
3737	nmdc:mga00v17_187859_c1
3738	nmdc:mga00v17_49103_c1
3739	nmdc:mga00v17_844849_c1
3740	nmdc:mga0yw44_238268_c1
3741	nmdc:mga0yw44_302602_c1
3742	nmdc:mga0yw44_319673_c1
3743	nmdc:mga0yw44_47527_c1
3744	nmdc:mga0yw44_50490_c1
3745	nmdc:mga0yw44_546371_c1
3746	nmdc:mga0k408_229900_c1
3747	nmdc:mga0k408_279431_c1
3748	nmdc:mga06z11_122394_c1
3749	nmdc:mga06z11_266088_c1
3750	nmdc:mga06z11_275371_c1
3751	nmdc:mga06z11_277842_c1
3752	nmdc:mga06z11_838166_c1
3753	nmdc:mga06z11_839284_c1
3754	nmdc:mga06z11_856533_c1
3755	nmdc:mga06z11_930797_c1
3756	nmdc:mga07m45_2419_c1
3757	nmdc:mga07m45_294458_c1
3758	nmdc:mga07m45_35375_c1
3759	nmdc:mga07m45_516131_c1
3760	nmdc:mga07m45_714627_c1
3761	nmdc:mga07m45_774562_c1
3762	nmdc:mga07m45_899609_c1
3763	nmdc:mga05p37_213602_c1
3764	nmdc:mga09592_690917_c1
3765	nmdc:mga0qj67_1339489_c1
3766	nmdc:mga0qj67_1560114_c1
3767	nmdc:mga08y16_410062_c1
3768	nmdc:mga0n895_326669_c1
3769	nmdc:mga0n895_45691_c1
3770	nmdc:mga0rr50_834810_c1
3771	nmdc:mga08x19_124672_c1
3772	nmdc:mga08x19_338963_c1
3773	nmdc:mga0sz30_109894_c2
3774	nmdc:mga0sz30_185170_c1
3775	nmdc:mga0sz30_192155_c1
3776	nmdc:mga0sz30_248993_c1
3777	nmdc:mga0sz30_292628_c1
3778	nmdc:mga0sz30_47985_c1
3779	Ga0495601_0020457
3780	Ga0495601_0040945
3781	Ga0495601_0041651
3782	Ga0495601_0233780
3783	Ga0495612_0033842
3784	Ga0495612_0161517
3785	Ga0500635_0009854
3786	Ga0500635_0117117
3787	Ga0500635_0320696
3788	Ga0495595_0000828
3789	Ga0495619_0000912
3790	Ga0495619_0111092
3791	Ga0495619_0233078
3792	Ga0495619_0375506
3793	Ga0495619_0436276
3794	Ga0495619_1143657
3795	Ga0500578_0158157
3796	Ga0500578_0327255
3797	Ga0500578_0412596
3798	Ga0500643_000048
3799	Ga0500644_0473465
3800	Ga0500647_0045982
3801	Ga0500647_0343559
3802	Ga0500583_0019068
3803	Ga0500583_0307434
3804	Ga0500651_0100712
3805	Ga0500566_0000223
3806	Ga0500566_0004965
3807	Ga0500566_0006352
3808	Ga0500566_0059836
3809	Ga0500640_157019
3810	Ga0500641_0024453
3811	Ga0500641_0041963
3812	Ga0500641_0200017
3813	Ga0500641_0235775
3814	Ga0500650_0071549
3815	Ga0500555_005336
3816	Ga0500555_108580
3817	Ga0500555_153440
3818	Ga0500556_0002950
3819	Ga0500557_000083
3820	Ga0500558_201355
3821	Ga0500562_078848
3822	Ga0500569_079473
3823	Ga0500572_000389
3824	Ga0500572_001233
3825	Ga0500572_034391
3826	Ga0500594_0053406
3827	Ga0500595_000333
3828	Ga0500595_002703
3829	Ga0500595_017370
3830	Ga0500595_025546
3831	Ga0500595_055278
3832	Ga0500595_060161
3833	Ga0500595_120077
3834	Ga0500595_234357
3835	Ga0500597_229113
3836	Ga0500607_135588
3837	Ga0500608_007296
3838	Ga0500608_088564
3839	Ga0500608_093171
3840	Ga0500621_210281
3841	Ga0500642_0000642
3842	Ga0500642_0359709
3843	Ga0500655_012425
3844	Ga0500655_020330
3845	Ga0500559_0000230
3846	Ga0500559_0008650
3847	Ga0500559_0055748
3848	Ga0500564_124769
3849	Ga0500568_0022304
3850	Ga0500568_0141774
3851	Ga0500568_0198979
3852	Ga0500577_0073561
3853	Ga0500588_0106889
3854	Ga0500588_0203835
3855	Ga0500588_0287863
3856	Ga0500589_103558
3857	Ga0500590_053159
3858	Ga0500590_134272
3859	Ga0500603_000178
3860	Ga0500603_013968
3861	Ga0500603_032911
3862	Ga0500603_239297
3863	Ga0500604_0081381
3864	Ga0500604_0089251
3865	Ga0500604_0149586
3866	Ga0500619_014041
3867	Ga0500620_028172
3868	Ga0500633_0245910
3869	Ga0500634_0093674
3870	Ga0500638_022654
3871	Ga0500638_380902
3872	Ga0500639_012544
3873	Ga0500639_097239
3874	Ga0500639_161640
3875	Ga0500636_0000148
3876	Ga0500636_0029898
3877	Ga0500636_0088043
3878	Ga0500636_0117759
3879	Ga0500636_0150308
3880	Ga0500637_0000060
3881	Ga0500637_0030606
3882	Ga0500637_0038025
3883	Ga0500637_0250594
3884	Ga0500637_0273335
3885	Ga0500649_215345
3886	Ga0500576_114615
3887	Ga0500625_085052
3888	Ga0500645_011592
3889	Ga0500645_027147
3890	Ga0500596_007061
3891	Ga0500596_016176
3892	Ga0500596_031534
3893	Ga0500599_002459
3894	Ga0500601_000452
3895	Ga0500601_018895
3896	Ga0501084_0025829
3897	Ga0500661_000303
3898	Ga0587079_227112
3899	Ga0501082_0002719
3900	Ga0501082_2040691
3901	Ga0466962_0361257
3902	2507505891
3903	2508540082
3904	2508696152
3905	2509151551
3906	2511396624
3907	2513627471
3908	2513638785
3909	2513649865
3910	2513659779
3911	2513676896
3912	2513696307
3913	2513704350
3914	2513715419
3915	2513857240
3916	2513877273
3917	2513891632
3918	2513918855
3919	2514011240
3920	2515631366
3921	2517105696
3922	2517888181
3923	2524435440
3924	2524468615
3925	2524533356
3926	2528855127
3927	2617347775
3928	2617374503
3929	2671119360
3930	2723842260
3931	2728753838
3932	2745081396
3933	2793061569
3934	2793073859
3935	2793077970
3936	2805916127
3937	2818240865
3938	2824610828
3939	2824619363
3940	2824627818
3941	2824641890
3942	2824651288
3943	2824653880
3944	2824663767
3945	2824676113
3946	2824680228
3947	2824692466
3948	2824699889
3949	2824706071
3950	2824720082
3951	2824729444
3952	2824737480
3953	2824748035
3954	2824760296
3955	2824771535
3956	2824775745
3957	2838125118
3958	2841945856
3959	2841956817
3960	2841965301
3961	2841973333
3962	2841979503
3963	2841989372
3964	2842044363
3965	2842051648
3966	2844321489
3967	2847939474
3968	2847941222
3969	2849082214
3970	2857513311
3971	2874596371
3972	2874610151
3973	2874620216
3974	2874622439
3975	2874633343
3976	2874650359
3977	2876761696
3978	2876776836
3979	2876815703
3980	2876824626
3981	2879080973
3982	2879091084
3983	2879106649
3984	2879117027
3985	2879128204
3986	2879143553
3987	2881369633
3988	2881670156
3989	2885367717
3990	2885380641
3991	2885392258
3992	2885418258
3993	2888387744
3994	2888389963
3995	2888421137
3996	2889036376
3997	2903727932
3998	2903754032
3999	2903776662
4000	2904671554
4001	2904695754
4002	2904710021
4003	2904718098
4004	2906602584
4005	2906614462
4006	2906629718
4007	2906643415
4008	2906651660
4009	2906666607
4010	2908746708
4011	2908764270
4012	2908776982
4013	2922366741
4014	2922377449
4015	2922389356
4016	2922393376
4017	2922426297
4018	2929622241
4019	2929630112
4020	2932787955
4021	2932799511
4022	2932805183
4023	2932813330
4024	2932820027
4025	2932832909
4026	2933584145
4027	2935614315
4028	2935620394
4029	2935632681
4030	2935640718
4031	2935649343
4032	2935657885
4033	2935668910
4034	2935681364
4035	2935687219
4036	2935696810
4037	2935709098
4038	2935716907
4039	2935722968
4040	2935734525
4041	2935744684
4042	2935753185
4043	2935767589
4044	2935770183
4045	2935777787
4046	2935786763
4047	2935794817
4048	2935804828
4049	2935815977
4050	2935826533
4051	2935832225
4052	2935840945
4053	2935851173
4054	2935859280
4055	2935864464
4056	2935875184
4057	2935887727
4058	2935913222
4059	2935922644
4060	2935930853
4061	2935939813
4062	2935946762
4063	2935956037
4064	2935963883
4065	2935972830
4066	2935978253
4067	2935985619
4068	2935995841
4069	2936005752
4070	2936012104
4071	2936020815
4072	2936029397
4073	2936041880
4074	2936048279
4075	2936056610
4076	2940559098
4077	2941508655
4078	2941516485
4079	2941524499
4080	2941532069
4081	2941541793
4082	3005475660
4083	3005485839
4084	3005510880
4085	3005588829
4086	3005601855
4087	3005717594
4088	3005724642
4089	8006932297
4090	8006937000
4091	8006966339
4092	8006976965
4093	8006993165
4094	8006997004
4095	8016517294
4096	8016526940
4097	8016532025
4098	8016545234
4099	8016556854
4100	8016565207
4101	8016570312
4102	8016582860
4103	8016585434
4104	8016602850
4105	8016605720
4106	8016617627
4107	8016623942
4108	8016634924
4109	8017059303
4110	8019531842
4111	8019539687
4112	8019550960
4113	8019561677
4114	8019571751
4115	8019621998
4116	8019631323
4117	8019639298
4118	8019651717
4119	8019668128
4120	8019677594
4121	8019687355
4122	8019693331
4123	8055743510
4124	8056678190
4125	8056692717
4126	8056975365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

30

88

0.89 PF13279

4HBT_2

Thioesterase-like superfamily

10

120

0.87 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3rd7-assembly1.cif.gz_A	crystal structure of acyl-coa thioesterase from mycobacterium avium	0.9021	56	111
3e29-assembly1.cif.gz_D	x-ray structure of the protein q7we92_borbr from thioesterase superfamily. northeast structural genomics consortium target bor214a.	0.8813	56	110
4qda-assembly4.cif.gz_F	crystal structure of mutant thioesterase pa1618 (e64a) from pseudomonas aeruginosa	0.8756	56	111
5t06-assembly1.cif.gz_C	crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa	0.8688	1	135
5kl9-assembly1.cif.gz_B	crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa	0.8648	3	135

ID	Description	Score	Start	End	Superfamily
1c8uB02	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.9068	56	111	3.10.129.10
3rd7B00	Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain	0.9018	56	111	2.40.160.210
4gwhA00	Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain	0.8895	52	111	2.40.160.210
5t06C00	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.8688	1	135	3.10.129.10
af_P38172_82_257_3.10.129.10	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.8686	55	110	3.10.129.10

ID	Description	Score	Start	End	GO Terms
AF-A0A537PKA7-F1-model_v4	Acyl-CoA thioesterase	0.9367	21	135
AF-A0A534SPR3-F1-model_v4	Acyl-CoA thioesterase	0.9306	1	136
AF-A0A2N7TH14-F1-model_v4	Acyl-CoA thioesterase	0.9288	1	138	GO:0047617
AF-A0A329Q3W5-F1-model_v4	deleted	0.9274	1	135
AF-A0A1F4CWR8-F1-model_v4	4-hydroxybenzoyl-CoA thioesterase	0.9273	1	135

F496337

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03061

4HBT

Thioesterase superfamily

30

88

0.89

PF13279

4HBT_2

Thioesterase-like superfamily

10

120

0.87

Structural Annotation

Top 5 Hits

Map