F496331

General Info

Members Datasets Scaffolds Average Seq Length
2060 765 1842 234

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0115469|Ga0373934_0115469_291_1049
Length 252
Sequence MRRKPQRRKRVVEGRSARMLELRSVDAGYGTFQALFGVSLEVKAGEAVGVIGPNGAGKTTLMRVISGLIRPRAGTISMEGVDVLKTPEHRIVSLGIAHVPENRRLFPRLTVEDNLKMGAFMPEARARFAERLAFVFDLFPRMKERRHQMAGTMSGGEQQMCAIGRALMSDPKLLLLDEPSAGLAPVIVQQVFELVKRIRANGLTVLIVEQNVQQVLRVVDRAYLLEAGTIRASGKSSEMLADDQIRQAYLGV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
22 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
25 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
26 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
27 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
28 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
31 2791355199
32 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
33 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
34 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
35 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
36 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
37 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
38 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
39 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
40 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
41 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
42 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
43 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
44 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
45 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
46 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
47 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
48 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
49 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
50 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
51 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
52 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
53 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
54 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
55 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
56 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
57 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
58 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
59 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
60 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
61 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
62 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
63 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
64 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
65 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
66 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
67 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
68 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
69 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
70 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
71 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
72 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
73 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
74 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
75 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
76 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
77 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
78 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
79 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
80 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
81 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
82 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
83 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
84 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
85 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
86 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
90 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
91 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
92 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
93 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
94 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
95 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
96 2904699407
97 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
98 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
99 2906610324
100 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
101 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
102 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
103 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
104 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
105 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
106 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
107 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
108 2922368715
109 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
110 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
111 2922425934
112 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
113 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
114 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
115 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
116 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
117 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
118 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
119 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
120 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
121 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
122 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
123 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
124 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
125 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
126 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
127 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
128 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
129 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
130 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
131 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
132 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
133 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
134 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
135 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
136 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
137 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
138 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
139 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
140 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
141 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
142 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
143 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
144 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
145 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
146 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
147 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
148 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
149 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
150 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
151 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
152 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
153 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
154 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
155 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
156 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
157 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
158 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
159 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
160 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
161 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
162 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
163 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
164 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
165 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
166 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
167 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
168 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
169 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
170 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
171 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
172 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
173 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
174 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
175 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
176 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
177 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
178 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
179 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
180 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
181 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
182 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
183 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
184 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
185 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
186 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
187 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
188 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
189 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
190 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
191 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
192 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
193 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
194 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
195 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
196 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
197 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
198 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
199 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
200 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
201 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
202 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
203 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
204 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
205 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
206 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
207 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
208 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
209 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
210 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
211 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
212 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
213 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
214 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
215 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
216 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
217 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
218 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
219 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
220 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
221 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
222 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
223 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
224 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
225 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
226 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
227 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
228 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
229 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
230 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
231 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
232 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
233 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
234 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
235 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
236 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
237 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
238 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
239 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
240 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
241 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
242 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
243 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
244 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
245 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
246 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
247 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
248 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
249 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
250 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
251 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
252 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
253 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
254 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
255 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
256 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
257 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
258 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
259 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
260 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
261 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
262 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
263 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
264 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
265 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
266 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
267 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
268 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
269 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
270 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
271 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
272 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
273 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
274 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
275 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
276 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
277 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
278 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
279 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
280 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
281 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
282 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
283 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
284 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
285 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
286 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
287 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
288 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
289 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
290 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
291 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
292 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
293 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
294 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
295 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
296 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
297 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
298 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
299 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
300 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
301 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
302 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
303 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
304 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
305 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
306 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
307 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
308 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
309 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
310 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
311 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
312 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
313 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
314 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
315 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
316 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
317 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
318 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
319 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
320 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
321 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
322 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
323 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
324 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
325 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
326 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
327 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
328 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
329 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
330 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
331 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
332 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
333 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
334 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
335 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
336 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
337 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
338 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
339 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
340 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
341 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
342 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
343 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
344 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
345 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
346 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
347 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
348 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
349 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
350 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
351 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
352 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
353 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
354 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
357 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
359 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
360 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
361 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
362 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
363 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
364 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
432 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
433 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
434 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
435 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
437 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
438 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
439 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
440 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
444 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
445 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
446 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
447 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
448 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
449 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
450 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
451 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
452 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
453 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
454 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
455 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
456 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
457 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
458 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
459 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
460 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
461 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
462 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
463 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
464 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
465 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
466 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
467 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
468 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
469 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
470 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
471 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
472 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
473 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
474 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
475 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
476 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
477 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
478 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
479 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
480 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
481 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
482 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
483 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
484 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
485 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
486 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
487 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
488 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
489 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
490 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
491 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
492 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
493 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
494 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
495 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
496 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
497 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
498 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
499 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
500 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
501 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
502 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
503 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
504 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
505 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
506 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
507 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
508 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
509 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
510 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
511 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
512 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
513 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
514 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
515 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
516 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
517 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
518 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
519 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
520 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
521 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
522 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
523 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
524 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
525 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
526 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
527 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
528 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
529 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
530 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
531 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
532 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
533 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
534 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
535 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
536 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
537 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
538 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
539 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
540 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
541 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
542 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
543 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
544 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
545 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
546 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
547 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
548 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
549 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
550 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
551 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
552 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
553 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
554 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
555 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
556 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
557 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
558 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
559 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
560 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
561 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
562 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
563 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
564 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
565 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
566 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
567 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
568 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
569 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
570 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
571 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
572 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
573 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
574 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
575 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
576 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
577 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
578 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
579 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
580 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
581 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
582 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
583 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
584 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
585 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
586 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
587 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
588 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
589 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
590 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
591 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
592 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
593 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
594 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
595 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
596 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
597 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
598 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
599 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
600 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
601 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
602 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
603 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
604 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
605 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
606 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
607 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
608 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
609 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
610 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
611 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
612 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
613 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
614 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
615 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
616 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
617 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
618 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
619 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
620 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
621 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
622 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
623 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
624 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
625 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
626 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
627 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
628 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
629 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
630 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
631 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
632 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
633 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
634 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
635 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
636 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
637 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
638 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
639 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
640 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
641 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
642 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
643 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
644 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
645 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
646 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
647 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
648 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
649 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
650 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
651 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
652 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
653 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
654 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
655 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
656 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
657 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
658 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
659 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
660 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
661 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
662 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
663 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
664 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
665 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
666 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
667 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
668 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
669 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
670 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
671 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
672 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
673 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
674 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
675 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
676 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
677 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
678 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
679 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
680 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
681 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
682 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
683 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
684 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
685 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
686 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
687 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
688 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
689 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
690 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
691 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
692 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
693 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
694 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
695 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
696 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
697 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
698 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
699 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
700 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
701 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
702 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
703 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
704 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
705 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
706 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
707 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
708 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
709 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
710 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
711 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
712 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
713 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
714 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
715 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
716 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
717 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
718 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
719 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
720 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
721 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
722 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
723 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
724 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
725 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
726 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
727 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
728 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
729 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
730 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
731 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
732 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
733 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
734 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
735 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
736 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
737 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
738 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
739 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
740 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
741 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
742 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
743 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
744 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
745 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
746 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
747 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
748 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
749 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
750 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
751 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
752 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
753 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
754 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
755 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
756 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
757 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
758 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
759 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
760 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
761 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
762 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
763 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
764 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
765 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.64
Metatranscriptomes 0
Isolates 10.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 8.5
Rhizoplane 4.71
Rhizosphere 74.76
Stem 0
Stem Tuber 0
Unclassified 4.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24032J14994_101455 3300001430 Bacteria 986
2 JGI24752J21851_1008532 3300001976 Bacteria 1337
3 JGI24739J22299_10002831 3300001989 Bacteria 6664
4 JGI24737J22298_10001577 3300001990 Bacteria 8110
5 JGI24750J21931_1000865 3300002070 Bacteria 4151
6 JGI24745J21846_1002353 3300002073 Bacteria 1925
7 JGI24748J21848_1001206 3300002074 Bacteria 2823
8 JGI24749J21850_1011129 3300002076 Bacteria 1262
9 JGI24744J21845_10003221 3300002077 Bacteria 3347
10 JGI24035J26624_1003600 3300002126 Bacteria 1461
11 JGI24034J26672_10004016 3300002239 Bacteria 2073
12 JGI24742J22300_10001206 3300002244 Bacteria 4038
13 JGI24751J29686_10002679 3300002459 Bacteria 3584
14 JGI25406J46586_10000021 3300003203 Bacteria 84514
15 JGI25153J46596_10001764 3300003215 Bacteria 12825
16 JGI25153J46596_10002778 3300003215 Bacteria 9952
17 JGI25153J46596_10007736 3300003215 Bacteria 5231
18 JGI25153J46596_10008618 3300003215 Bacteria 4853
19 JGI25160J50197_1000533 3300003354 Bacteria 21926
20 JGI25160J50197_1027443 3300003354 Bacteria 1549
21 JGI25404J52841_10021647 3300003659 Bacteria 1391
22 Ga0055539_1012039 3300003752 Bacteria 1064
23 Ga0055542_1023720 3300003762 Bacteria 857
24 Ga0055531_10010491 3300003794 Bacteria 4596
25 JGI25405J52794_10004566 3300003911 Bacteria 2470
26 JGI25405J52794_10060051 3300003911 Bacteria 821
27 Ga0065165_1000437 3300005262 Bacteria 65503
28 Ga0065165_1001951 3300005262 Bacteria 19574
29 Ga0065165_1005934 3300005262 Bacteria 6618
30 Ga0065712_10102380 3300005290 Bacteria 2007
31 Ga0065715_10114787 3300005293 Bacteria 2434
32 Ga0065715_10261091 3300005293 Bacteria 1138
33 Ga0070658_10006285 3300005327 Bacteria 9622
34 Ga0070658_10218087 3300005327 Bacteria 1613
35 Ga0070676_10001629 3300005328 Bacteria 11410
36 Ga0070676_10026881 3300005328 Bacteria 3259
37 Ga0070676_10034437 3300005328 Bacteria 2908
38 Ga0070683_100007819 3300005329 Bacteria 9055
39 Ga0070683_100014236 3300005329 Bacteria 6953
40 Ga0070683_100020043 3300005329 Bacteria 5947
41 Ga0070683_100486229 3300005329 Bacteria 1179
42 Ga0070690_100022028 3300005330 Bacteria 3896
43 Ga0070690_100033117 3300005330 Bacteria 3232
44 Ga0070690_100151901 3300005330 Bacteria 1581
45 Ga0070690_100390243 3300005330 Bacteria 1020
46 Ga0070670_100112665 3300005331 Bacteria 2345
47 Ga0070677_10000481 3300005333 Bacteria 13662
48 Ga0068869_100000216 3300005334 Bacteria 29999
49 Ga0068869_100087109 3300005334 Bacteria 2342
50 Ga0070666_10005440 3300005335 Bacteria 7806
51 Ga0070666_10023836 3300005335 Bacteria 3984
52 Ga0070666_10287891 3300005335 Bacteria 1169
53 Ga0070680_100002486 3300005336 Bacteria 13654
54 Ga0070680_100006251 3300005336 Bacteria 9034
55 Ga0070680_100032424 3300005336 Bacteria 4205
56 Ga0070680_100070553 3300005336 Bacteria 2869
57 Ga0070680_100194678 3300005336 Bacteria 1709
58 Ga0070680_100575707 3300005336 Bacteria 966
59 Ga0070682_100000853 3300005337 Bacteria 17853
60 Ga0070682_100022761 3300005337 Bacteria 3715
61 Ga0070682_100221253 3300005337 Bacteria 1348
62 Ga0070682_100468508 3300005337 Bacteria 969
63 Ga0068868_100000474 3300005338 Bacteria 26674
64 Ga0068868_100071341 3300005338 Bacteria 2770
65 Ga0068868_100250174 3300005338 Bacteria 1491
66 Ga0070660_100001322 3300005339 Bacteria 16832
67 Ga0070660_100009076 3300005339 Bacteria 6981
68 Ga0070660_100051630 3300005339 Bacteria 3167
69 Ga0070689_100000240 3300005340 Bacteria 32170
70 Ga0070689_100223665 3300005340 Bacteria 1545
71 Ga0070689_100490729 3300005340 Bacteria 1051
72 Ga0070691_10020949 3300005341 Bacteria 3023
73 Ga0070691_10189075 3300005341 Bacteria 1076
74 Ga0070687_100000302 3300005343 Bacteria 16674
75 Ga0070661_100003117 3300005344 Bacteria 11411
76 Ga0070661_100068426 3300005344 Bacteria 2609
77 Ga0070661_100131740 3300005344 Bacteria 1878
78 Ga0070661_100156278 3300005344 Bacteria 1726
79 Ga0070692_10027705 3300005345 Bacteria 2811
80 Ga0070668_100003449 3300005347 Bacteria 11674
81 Ga0070668_100076646 3300005347 Bacteria 2612
82 Ga0070668_100103710 3300005347 Bacteria 2256
83 Ga0070668_100272139 3300005347 Bacteria 1412
84 Ga0070669_100009578 3300005353 Bacteria 6899
85 Ga0070669_100302641 3300005353 Bacteria 1286
86 Ga0070675_100001762 3300005354 Bacteria 15958
87 Ga0070675_100125583 3300005354 Bacteria 2182
88 Ga0070675_100208241 3300005354 Bacteria 1699
89 Ga0070675_100651086 3300005354 Bacteria 957
90 Ga0070675_100750101 3300005354 Bacteria 891
91 Ga0070671_100002861 3300005355 Bacteria 13424
92 Ga0070671_100117771 3300005355 Bacteria 2233
93 Ga0070671_100499273 3300005355 Bacteria 1047
94 Ga0070671_100519094 3300005355 Bacteria 1026
95 Ga0070674_100002865 3300005356 Bacteria 9536
96 Ga0070674_100625549 3300005356 Bacteria 912
97 Ga0070673_100001019 3300005364 Bacteria 15855
98 Ga0070673_100034773 3300005364 Bacteria 3816
99 Ga0070673_100227232 3300005364 Bacteria 1618
100 Ga0070673_100318795 3300005364 Bacteria 1373
101 Ga0070688_100010793 3300005365 Bacteria 5049
102 Ga0070688_100022950 3300005365 Bacteria 3663
103 Ga0070659_100005117 3300005366 Bacteria 9406
104 Ga0070659_100131998 3300005366 Bacteria 2029
105 Ga0070659_100342439 3300005366 Bacteria 1253
106 Ga0070659_100393710 3300005366 Bacteria 1168
107 Ga0070667_100001650 3300005367 Bacteria 19960
108 Ga0070667_100053374 3300005367 Bacteria 3411
109 Ga0070667_100068279 3300005367 Bacteria 3024
110 Ga0070667_100547268 3300005367 Bacteria 1064
111 Ga0070703_10002778 3300005406 Bacteria 5016
112 Ga0070709_10001960 3300005434 Bacteria 11217
113 Ga0070709_10002079 3300005434 Bacteria 10849
114 Ga0070709_10008334 3300005434 Bacteria 5691
115 Ga0070709_10017458 3300005434 Bacteria 4117
116 Ga0070709_10030167 3300005434 Bacteria 3251
117 Ga0070709_10166061 3300005434 Bacteria 1539
118 Ga0070709_10173191 3300005434 Bacteria 1510
119 Ga0070709_10461647 3300005434 Bacteria 958
120 Ga0070714_100003380 3300005435 Bacteria 11890
121 Ga0070714_100004982 3300005435 Bacteria 10093
122 Ga0070714_100050541 3300005435 Bacteria 3542
123 Ga0070714_100054993 3300005435 Bacteria 3402
124 Ga0070714_100287789 3300005435 Bacteria 1528
125 Ga0070714_100320733 3300005435 Bacteria 1449
126 Ga0070713_100005503 3300005436 Bacteria 8672
127 Ga0070713_100035581 3300005436 Bacteria 4010
128 Ga0070713_100035837 3300005436 Bacteria 3998
129 Ga0070713_100175737 3300005436 Bacteria 1921
130 Ga0070713_100196071 3300005436 Bacteria 1822
131 Ga0070713_100957551 3300005436 Bacteria 825
132 Ga0070710_10005443 3300005437 Bacteria 6048
133 Ga0070701_10000281 3300005438 Bacteria 16629
134 Ga0070711_100003146 3300005439 Bacteria 9574
135 Ga0070711_100022144 3300005439 Bacteria 4115
136 Ga0070711_100039401 3300005439 Bacteria 3183
137 Ga0070711_100046760 3300005439 Bacteria 2950
138 Ga0070711_100454980 3300005439 Bacteria 1048
139 Ga0070705_100001659 3300005440 Bacteria 11660
140 Ga0070705_100025036 3300005440 Bacteria 3230
141 Ga0070700_100001804 3300005441 Bacteria 10802
142 Ga0070700_100041536 3300005441 Bacteria 2820
143 Ga0070700_100216528 3300005441 Bacteria 1354
144 Ga0070700_100498094 3300005441 Bacteria 936
145 Ga0070694_100000576 3300005444 Bacteria 20334
146 Ga0070694_100267427 3300005444 Bacteria 1299
147 Ga0070694_100326738 3300005444 Bacteria 1182
148 Ga0070708_100006158 3300005445 Bacteria 9543
149 Ga0070708_100021331 3300005445 Bacteria 5476
150 Ga0070708_100028554 3300005445 Bacteria 4802
151 Ga0070708_100070172 3300005445 Bacteria 3151
152 Ga0070708_100085640 3300005445 Bacteria 2861
153 Ga0070708_100510048 3300005445 Bacteria 1134
154 Ga0070663_100003664 3300005455 Bacteria 8901
155 Ga0070663_100070816 3300005455 Bacteria 2536
156 Ga0070663_100080851 3300005455 Bacteria 2387
157 Ga0070663_100434989 3300005455 Bacteria 1078
158 Ga0070663_100651899 3300005455 Bacteria 890
159 Ga0070678_100006300 3300005456 Bacteria 6953
160 Ga0070678_100456821 3300005456 Bacteria 1120
161 Ga0070678_100659165 3300005456 Bacteria 939
162 Ga0070662_100194302 3300005457 Bacteria 1607
163 Ga0070681_10010247 3300005458 Bacteria 9248
164 Ga0070681_10020913 3300005458 Bacteria 6554
165 Ga0070681_10150329 3300005458 Bacteria 2255
166 Ga0070681_10150518 3300005458 Bacteria 2254
167 Ga0070681_10167923 3300005458 Bacteria 2116
168 Ga0070681_10191007 3300005458 Bacteria 1967
169 Ga0068867_100002151 3300005459 Bacteria 13821
170 Ga0068867_100064551 3300005459 Bacteria 2723
171 Ga0068867_100198087 3300005459 Bacteria 1606
172 Ga0070685_10049333 3300005466 Bacteria 2428
173 Ga0070706_100084513 3300005467 Bacteria 2940
174 Ga0070706_100107179 3300005467 Bacteria 2599
175 Ga0070706_100238540 3300005467 Bacteria 1698
176 Ga0070706_100261696 3300005467 Bacteria 1615
177 Ga0070706_100609066 3300005467 Bacteria 1015
178 Ga0070706_100722283 3300005467 Bacteria 923
179 Ga0070707_100018938 3300005468 Bacteria 6483
180 Ga0070707_100040622 3300005468 Bacteria 4451
181 Ga0070707_100082900 3300005468 Bacteria 3097
182 Ga0070707_100290348 3300005468 Bacteria 1589
183 Ga0070707_100415591 3300005468 Bacteria 1305
184 Ga0070698_100001171 3300005471 Bacteria 29108
185 Ga0070698_100005791 3300005471 Bacteria 13518
186 Ga0070698_100170211 3300005471 Bacteria 2120
187 Ga0070698_100182392 3300005471 Bacteria 2037
188 Ga0070698_100189075 3300005471 Bacteria 1997
189 Ga0070698_100340811 3300005471 Bacteria 1430
190 Ga0070698_100420205 3300005471 Bacteria 1271
191 Ga0070698_100690413 3300005471 Bacteria 962
192 Ga0070698_100699625 3300005471 Bacteria 955
193 Ga0070699_100006362 3300005518 Bacteria 10297
194 Ga0070699_100006895 3300005518 Bacteria 9881
195 Ga0070699_100022064 3300005518 Bacteria 5484
196 Ga0070699_100162407 3300005518 Bacteria 1977
197 Ga0070699_100299951 3300005518 Bacteria 1441
198 Ga0070679_100003426 3300005530 Bacteria 14521
199 Ga0070679_100005687 3300005530 Bacteria 11562
200 Ga0070679_100027474 3300005530 Bacteria 5601
201 Ga0070679_100215944 3300005530 Bacteria 1880
202 Ga0070679_100239003 3300005530 Bacteria 1774
203 Ga0070679_100326452 3300005530 Bacteria 1483
204 Ga0070679_100358734 3300005530 Bacteria 1405
205 Ga0070679_100379825 3300005530 Bacteria 1360
206 Ga0070684_100011854 3300005535 Bacteria 6960
207 Ga0070684_100012047 3300005535 Bacteria 6912
208 Ga0070684_100033680 3300005535 Bacteria 4376
209 Ga0070684_100086741 3300005535 Bacteria 2778
210 Ga0070697_100019057 3300005536 Bacteria 5415
211 Ga0070697_100023652 3300005536 Bacteria 4887
212 Ga0070697_100191407 3300005536 Bacteria 1736
213 Ga0070697_100302720 3300005536 Bacteria 1374
214 Ga0070697_100444829 3300005536 Bacteria 1128
215 Ga0068853_100004149 3300005539 Bacteria 11169
216 Ga0068853_100007962 3300005539 Bacteria 8498
217 Ga0068853_100084860 3300005539 Bacteria 2775
218 Ga0068853_100266376 3300005539 Bacteria 1577
219 Ga0068853_100498279 3300005539 Bacteria 1150
220 Ga0068853_100518389 3300005539 Bacteria 1127
221 Ga0068853_100602340 3300005539 Bacteria 1043
222 Ga0068853_100731975 3300005539 Bacteria 945
223 Ga0070672_100004101 3300005543 Bacteria 9511
224 Ga0070672_100083906 3300005543 Bacteria 2558
225 Ga0070672_100190388 3300005543 Bacteria 1713
226 Ga0070672_100342323 3300005543 Bacteria 1274
227 Ga0070672_100439458 3300005543 Bacteria 1122
228 Ga0070686_100002850 3300005544 Bacteria 9524
229 Ga0070686_100371033 3300005544 Bacteria 1081
230 Ga0070695_100009940 3300005545 Bacteria 5671
231 Ga0070696_100006975 3300005546 Bacteria 7539
232 Ga0070696_100220734 3300005546 Bacteria 1422
233 Ga0070696_100284480 3300005546 Bacteria 1262
234 Ga0070693_100002142 3300005547 Bacteria 9050
235 Ga0070693_100043501 3300005547 Bacteria 2536
236 Ga0070693_100091281 3300005547 Bacteria 1836
237 Ga0070665_100003622 3300005548 Bacteria 16361
238 Ga0070665_100051658 3300005548 Bacteria 4122
239 Ga0070665_100146230 3300005548 Bacteria 2366
240 Ga0070665_100162015 3300005548 Bacteria 2238
241 Ga0070665_100167853 3300005548 Bacteria 2196
242 Ga0070665_100359247 3300005548 Bacteria 1462
243 Ga0070665_100492077 3300005548 Bacteria 1237
244 Ga0070665_100909538 3300005548 Bacteria 893
245 Ga0070704_100000444 3300005549 Bacteria 19453
246 Ga0070704_100077242 3300005549 Bacteria 2438
247 Ga0070704_100088629 3300005549 Bacteria 2299
248 Ga0068855_100035351 3300005563 Bacteria 5952
249 Ga0068855_100038019 3300005563 Bacteria 5721
250 Ga0068855_100073196 3300005563 Bacteria 3981
251 Ga0068855_100084816 3300005563 Bacteria 3666
252 Ga0068855_100131307 3300005563 Bacteria 2860
253 Ga0068855_100224204 3300005563 Bacteria 2107
254 Ga0068855_100238994 3300005563 Bacteria 2030
255 Ga0068855_100262674 3300005563 Bacteria 1923
256 Ga0068855_100389982 3300005563 Bacteria 1528
257 Ga0068855_100424422 3300005563 Bacteria 1454
258 Ga0068855_100607661 3300005563 Bacteria 1178
259 Ga0070664_100012305 3300005564 Bacteria 6953
260 Ga0070664_100193984 3300005564 Bacteria 1810
261 Ga0070664_100204358 3300005564 Bacteria 1764
262 Ga0070664_100232809 3300005564 Bacteria 1651
263 Ga0070664_100653392 3300005564 Bacteria 977
264 Ga0068857_100004239 3300005577 Bacteria 12087
265 Ga0068857_100020977 3300005577 Bacteria 5748
266 Ga0068857_100070627 3300005577 Bacteria 3111
267 Ga0068857_100168502 3300005577 Bacteria 1990
268 Ga0068857_100248392 3300005577 Bacteria 1630
269 Ga0068857_100371190 3300005577 Bacteria 1327
270 Ga0068854_100005104 3300005578 Bacteria 8270
271 Ga0068854_100137220 3300005578 Bacteria 1873
272 Ga0068856_100038973 3300005614 Bacteria 4666
273 Ga0068856_100059548 3300005614 Bacteria 3772
274 Ga0068856_100219306 3300005614 Bacteria 1917
275 Ga0068856_100242268 3300005614 Bacteria 1818
276 Ga0068856_100683695 3300005614 Bacteria 1047
277 Ga0068856_100815379 3300005614 Bacteria 953
278 Ga0070702_100001491 3300005615 Bacteria 9621
279 Ga0070702_100115063 3300005615 Bacteria 1674
280 Ga0068852_100000932 3300005616 Bacteria 19310
281 Ga0068852_100193681 3300005616 Bacteria 1920
282 Ga0068852_100327950 3300005616 Bacteria 1488
283 Ga0068852_100347483 3300005616 Bacteria 1447
284 Ga0068859_100002825 3300005617 Bacteria 17604
285 Ga0068859_100055931 3300005617 Bacteria 3970
286 Ga0068859_100108703 3300005617 Bacteria 2834
287 Ga0068864_100002030 3300005618 Bacteria 16706
288 Ga0068864_100035218 3300005618 Bacteria 4261
289 Ga0068864_100092544 3300005618 Bacteria 2669
290 Ga0068864_100504424 3300005618 Bacteria 1164
291 Ga0068866_10000638 3300005718 Bacteria 15871
292 Ga0068866_10118537 3300005718 Bacteria 1488
293 Ga0068866_10249854 3300005718 Bacteria 1084
294 Ga0068861_100004452 3300005719 Bacteria 9406
295 Ga0068851_10040747 3300005834 Bacteria 2335
296 Ga0068851_10099516 3300005834 Bacteria 1541
297 Ga0068870_10000048 3300005840 Bacteria 37476
298 Ga0068863_100001975 3300005841 Bacteria 20397
299 Ga0068863_100391832 3300005841 Bacteria 1357
300 Ga0068858_100008206 3300005842 Bacteria 10040
301 Ga0068858_100073450 3300005842 Bacteria 3174
302 Ga0068860_100000933 3300005843 Bacteria 32339
303 Ga0068860_100017528 3300005843 Bacteria 6977
304 Ga0068860_100144851 3300005843 Bacteria 2285
305 Ga0068860_100317585 3300005843 Bacteria 1528
306 Ga0068860_100689963 3300005843 Bacteria 1030
307 Ga0068862_100026562 3300005844 Bacteria 4867
308 Ga0068862_100185846 3300005844 Bacteria 1867
309 Ga0068862_100276122 3300005844 Bacteria 1538
310 Ga0081455_10002021 3300005937 Bacteria 24257
311 Ga0081455_10004363 3300005937 Bacteria 15926
312 Ga0081455_10005161 3300005937 Bacteria 14378
313 Ga0081455_10005318 3300005937 Bacteria 14137
314 Ga0081455_10010563 3300005937 Bacteria 9350
315 Ga0081455_10011965 3300005937 Bacteria 8685
316 Ga0081455_10021579 3300005937 Bacteria 6037
317 Ga0081455_10033400 3300005937 Bacteria 4624
318 Ga0081455_10043525 3300005937 Bacteria 3926
319 Ga0081455_10068940 3300005937 Bacteria 2942
320 Ga0081455_10075291 3300005937 Bacteria 2785
321 Ga0081538_10069563 3300005981 Bacteria 1949
322 Ga0081540_1000280 3300005983 Bacteria 53060
323 Ga0081540_1002252 3300005983 Bacteria 15882
324 Ga0081540_1005512 3300005983 Bacteria 9439
325 Ga0081540_1011141 3300005983 Bacteria 6035
326 Ga0081540_1011980 3300005983 Bacteria 5748
327 Ga0081540_1036034 3300005983 Bacteria 2644
328 Ga0081540_1038641 3300005983 Bacteria 2514
329 Ga0081539_10000051 3300005985 Bacteria 268337
330 Ga0081539_10000486 3300005985 Bacteria 84009
331 Ga0081539_10003351 3300005985 Bacteria 19892
332 Ga0081539_10031311 3300005985 Bacteria 3282
333 Ga0081539_10091328 3300005985 Bacteria 1573
334 Ga0070717_10000150 3300006028 Bacteria 51802
335 Ga0070717_10001555 3300006028 Bacteria 15906
336 Ga0070717_10011942 3300006028 Bacteria 6610
337 Ga0070717_10176264 3300006028 Bacteria 1862
338 Ga0075365_10003263 3300006038 Bacteria 8312
339 Ga0075365_10052047 3300006038 Bacteria 2707
340 Ga0075365_10330084 3300006038 Bacteria 1074
341 Ga0075365_10402045 3300006038 Bacteria 967
342 Ga0075368_10003112 3300006042 Bacteria 5506
343 Ga0075368_10107953 3300006042 Bacteria 1146
344 Ga0075368_10199552 3300006042 Bacteria 846
345 Ga0075363_100022684 3300006048 Bacteria 3175
346 Ga0075363_100166830 3300006048 Bacteria 1249
347 Ga0075364_10026988 3300006051 Bacteria 3666
348 Ga0075364_10085514 3300006051 Bacteria 2089
349 Ga0075364_10368366 3300006051 Bacteria 980
350 Ga0075364_10402808 3300006051 Bacteria 934
351 Ga0070715_10000321 3300006163 Bacteria 11851
352 Ga0070715_10030468 3300006163 Bacteria 2182
353 Ga0070715_10039547 3300006163 Bacteria 1965
354 Ga0070715_10173242 3300006163 Bacteria 1076
355 Ga0070716_100001200 3300006173 Bacteria 11402
356 Ga0070716_100018951 3300006173 Bacteria 3591
357 Ga0070716_100105020 3300006173 Bacteria 1740
358 Ga0070716_100125734 3300006173 Bacteria 1612
359 Ga0070716_100277372 3300006173 Bacteria 1155
360 Ga0070712_100004740 3300006175 Bacteria 8407
361 Ga0070712_100057102 3300006175 Bacteria 2741
362 Ga0070712_100063106 3300006175 Bacteria 2621
363 Ga0070712_100072856 3300006175 Bacteria 2462
364 Ga0070712_100073747 3300006175 Bacteria 2449
365 Ga0070712_100118722 3300006175 Bacteria 1987
366 Ga0070712_100126287 3300006175 Bacteria 1932
367 Ga0070712_100379754 3300006175 Bacteria 1163
368 Ga0075362_10001695 3300006177 Bacteria 7145
369 Ga0075362_10107617 3300006177 Bacteria 1310
370 Ga0075362_10138886 3300006177 Bacteria 1160
371 Ga0075362_10168066 3300006177 Bacteria 1058
372 Ga0075362_10190697 3300006177 Bacteria 995
373 Ga0075367_10018878 3300006178 Bacteria 3812
374 Ga0075367_10022791 3300006178 Bacteria 3516
375 Ga0075367_10170445 3300006178 Bacteria 1356
376 Ga0075367_10247511 3300006178 Bacteria 1117
377 Ga0075367_10413578 3300006178 Bacteria 853
378 Ga0075369_10002166 3300006186 Bacteria 6941
379 Ga0075369_10045606 3300006186 Bacteria 1885
380 Ga0075369_10196443 3300006186 Bacteria 930
381 Ga0075366_10007150 3300006195 Bacteria 6148
382 Ga0075366_10025959 3300006195 Bacteria 3427
383 Ga0075366_10073201 3300006195 Bacteria 2042
384 Ga0097621_100002984 3300006237 Bacteria 11619
385 Ga0097621_100222730 3300006237 Bacteria 1644
386 Ga0097621_100871030 3300006237 Bacteria 837
387 Ga0075370_10101745 3300006353 Bacteria 1663
388 Ga0075370_10104514 3300006353 Bacteria 1641
389 Ga0075370_10110461 3300006353 Bacteria 1597
390 Ga0075370_10162316 3300006353 Bacteria 1312
391 Ga0068871_100000555 3300006358 Bacteria 25466
392 Ga0068871_100004433 3300006358 Bacteria 9765
393 Ga0068871_100447185 3300006358 Bacteria 1158
394 Ga0068871_100624562 3300006358 Bacteria 982
395 Ga0075428_100052861 3300006844 Bacteria 4451
396 Ga0075428_100058497 3300006844 Bacteria 4220
397 Ga0075430_100000042 3300006846 Bacteria 66464
398 Ga0075430_100000534 3300006846 Bacteria 28676
399 Ga0075430_100000826 3300006846 Bacteria 24185
400 Ga0075431_100086521 3300006847 Bacteria 3234
401 Ga0075431_100091253 3300006847 Bacteria 3144
402 Ga0075431_100447718 3300006847 Bacteria 1287
403 Ga0075431_100663262 3300006847 Bacteria 1023
404 Ga0075433_10006248 3300006852 Bacteria 9402
405 Ga0075433_10011316 3300006852 Bacteria 7181
406 Ga0075433_10012151 3300006852 Bacteria 6942
407 Ga0075433_10022378 3300006852 Bacteria 5306
408 Ga0075433_10207998 3300006852 Bacteria 1739
409 Ga0075433_10404271 3300006852 Bacteria 1205
410 Ga0075434_100012903 3300006871 Bacteria 7936
411 Ga0075434_100016644 3300006871 Bacteria 7071
412 Ga0075434_100017132 3300006871 Bacteria 6973
413 Ga0075434_100019982 3300006871 Bacteria 6487
414 Ga0075434_100027752 3300006871 Bacteria 5559
415 Ga0075434_100147528 3300006871 Bacteria 2373
416 Ga0075434_100163062 3300006871 Bacteria 2249
417 Ga0075434_100267252 3300006871 Bacteria 1729
418 Ga0075434_100304674 3300006871 Bacteria 1613
419 Ga0075434_100346490 3300006871 Bacteria 1507
420 Ga0075434_100368028 3300006871 Bacteria 1458
421 Ga0075429_100003563 3300006880 Bacteria 13263
422 Ga0075429_100017797 3300006880 Bacteria 6146
423 Ga0075429_100042041 3300006880 Bacteria 3979
424 Ga0075429_100062288 3300006880 Bacteria 3250
425 Ga0068865_100049753 3300006881 Bacteria 2891
426 Ga0068865_100135239 3300006881 Bacteria 1851
427 Ga0075436_100021433 3300006914 Bacteria 4437
428 Ga0075436_100051974 3300006914 Bacteria 2828
429 Ga0075436_100057781 3300006914 Bacteria 2679
430 Ga0075436_100127649 3300006914 Bacteria 1782
431 Ga0075436_100430729 3300006914 Bacteria 959
432 Ga0097620_100002825 3300006931 Bacteria 17604
433 Ga0097620_100055932 3300006931 Bacteria 3970
434 Ga0097620_100108696 3300006931 Bacteria 2834
435 Ga0099824_1004900 3300006942 Bacteria 19056
436 Ga0099824_1029293 3300006942 Bacteria 2370
437 Ga0099822_1000677 3300006943 Bacteria 34391
438 Ga0075435_100018059 3300007076 Bacteria 5352
439 Ga0075435_100045774 3300007076 Bacteria 3509
440 Ga0075435_100057475 3300007076 Bacteria 3147
441 Ga0075435_100062982 3300007076 Bacteria 3011
442 Ga0075435_100068323 3300007076 Bacteria 2894
443 Ga0075435_100084879 3300007076 Bacteria 2606
444 Ga0075435_100218901 3300007076 Bacteria 1617
445 Ga0075435_100273373 3300007076 Bacteria 1441
446 Ga0075435_100293565 3300007076 Bacteria 1389
447 Ga0075435_100307271 3300007076 Bacteria 1357
448 Ga0099794_10016964 3300007265 Bacteria 3238
449 Ga0099794_10047778 3300007265 Bacteria 2053
450 Ga0099794_10181752 3300007265 Bacteria 1074
451 Ga0099795_10058807 3300007788 Bacteria 1420
452 Ga0099795_10120237 3300007788 Bacteria 1049
453 Ga0105240_10008025 3300009093 Bacteria 15195
454 Ga0105240_10027519 3300009093 Bacteria 7441
455 Ga0105240_10033952 3300009093 Bacteria 6587
456 Ga0105240_10086994 3300009093 Bacteria 3827
457 Ga0105240_10129550 3300009093 Bacteria 3028
458 Ga0105240_10174326 3300009093 Bacteria 2544
459 Ga0105240_10191853 3300009093 Bacteria 2402
460 Ga0111539_10002792 3300009094 Bacteria 23179
461 Ga0111539_10004409 3300009094 Bacteria 18396
462 Ga0111539_10004721 3300009094 Bacteria 17807
463 Ga0111539_10016484 3300009094 Bacteria 9162
464 Ga0111539_10115084 3300009094 Bacteria 3154
465 Ga0111539_10157494 3300009094 Bacteria 2657
466 Ga0111539_10533202 3300009094 Bacteria 1368
467 Ga0111539_10754634 3300009094 Bacteria 1132
468 Ga0105245_10000370 3300009098 Bacteria 41982
469 Ga0105245_10009595 3300009098 Bacteria 8440
470 Ga0105245_10019672 3300009098 Bacteria 5916
471 Ga0105245_10313762 3300009098 Bacteria 1543
472 Ga0105245_10317008 3300009098 Bacteria 1535
473 Ga0105245_10398638 3300009098 Bacteria 1374
474 Ga0105245_10569306 3300009098 Bacteria 1156
475 Ga0105245_10706223 3300009098 Bacteria 1042
476 Ga0105247_10002042 3300009101 Bacteria 13972
477 Ga0114129_10024612 3300009147 Bacteria 8531
478 Ga0114129_10035072 3300009147 Bacteria 7087
479 Ga0114129_10057279 3300009147 Bacteria 5455
480 Ga0114129_10062807 3300009147 Bacteria 5187
481 Ga0114129_10095997 3300009147 Bacteria 4105
482 Ga0114129_10241848 3300009147 Bacteria 2426
483 Ga0114129_10685163 3300009147 Bacteria 1319
484 Ga0114129_10741655 3300009147 Bacteria 1258
485 Ga0114129_10770015 3300009147 Bacteria 1230
486 Ga0114129_11650956 3300009147 Bacteria 783
487 Ga0105243_10003045 3300009148 Bacteria 13818
488 Ga0105243_10009792 3300009148 Bacteria 7296
489 Ga0105243_10174023 3300009148 Bacteria 1867
490 Ga0105243_10632848 3300009148 Bacteria 1034
491 Ga0105243_10646984 3300009148 Bacteria 1024
492 Ga0105243_10736654 3300009148 Bacteria 965
493 Ga0105241_10001352 3300009174 Bacteria 18650
494 Ga0105241_10092438 3300009174 Bacteria 2389
495 Ga0105241_10591021 3300009174 Bacteria 1002
496 Ga0105242_10001245 3300009176 Bacteria 20067
497 Ga0105242_10234816 3300009176 Bacteria 1645
498 Ga0105242_10292772 3300009176 Bacteria 1483
499 Ga0105242_10475396 3300009176 Bacteria 1183
500 Ga0105242_10891089 3300009176 Bacteria 889
501 Ga0105248_10001324 3300009177 Bacteria 27565
502 Ga0105248_10016609 3300009177 Bacteria 8105
503 Ga0105248_10027404 3300009177 Bacteria 6343
504 Ga0105248_10137102 3300009177 Bacteria 2760
505 Ga0105248_10142505 3300009177 Bacteria 2704
506 Ga0105248_10236177 3300009177 Bacteria 2058
507 Ga0105237_10002060 3300009545 Bacteria 25535
508 Ga0105237_10051893 3300009545 Bacteria 4119
509 Ga0105237_10502841 3300009545 Bacteria 1219
510 Ga0105238_10168915 3300009551 Bacteria 2163
511 Ga0105238_10519124 3300009551 Bacteria 1194
512 Ga0105249_10011280 3300009553 Bacteria 7845
513 Ga0105249_10044003 3300009553 Bacteria 4061
514 Ga0105249_10243921 3300009553 Bacteria 1778
515 Ga0105239_10018332 3300010375 Bacteria 7738
516 Ga0105239_10046768 3300010375 Bacteria 4743
517 Ga0105239_10063519 3300010375 Bacteria 4054
518 Ga0105239_10132942 3300010375 Bacteria 2768
519 Ga0105239_10240473 3300010375 Bacteria 2032
520 Ga0105239_10326261 3300010375 Bacteria 1731
521 Ga0105239_10390965 3300010375 Bacteria 1573
522 Ga0105239_10524366 3300010375 Bacteria 1348
523 Ga0105239_10642095 3300010375 Bacteria 1212
524 Ga0105246_10000510 3300011119 Bacteria 21126
525 Ga0105246_10070617 3300011119 Bacteria 2457
526 Ga0105246_10169126 3300011119 Bacteria 1672
527 Ga0157315_1005559 3300012508 Bacteria 950
528 Ga0157373_10002949 3300013100 Bacteria 12892
529 Ga0157371_10032190 3300013102 Bacteria 3774
530 Ga0157370_10022603 3300013104 Bacteria 6257
531 Ga0157370_10042139 3300013104 Bacteria 4401
532 Ga0157370_10115657 3300013104 Bacteria 2505
533 Ga0157370_10280866 3300013104 Bacteria 1538
534 Ga0157369_10034680 3300013105 Bacteria 5535
535 Ga0157369_10045599 3300013105 Bacteria 4766
536 Ga0157369_10305824 3300013105 Bacteria 1654
537 Ga0157374_10001994 3300013296 Bacteria 17142
538 Ga0157374_10964442 3300013296 Bacteria 871
539 Ga0157378_10005283 3300013297 Bacteria 11342
540 Ga0157378_10177813 3300013297 Bacteria 2000
541 Ga0157378_10326744 3300013297 Bacteria 1492
542 Ga0163162_10018668 3300013306 Bacteria 6794
543 Ga0163162_10129762 3300013306 Bacteria 2629
544 Ga0163162_10775572 3300013306 Bacteria 1077
545 Ga0157372_10214993 3300013307 Bacteria 2228
546 Ga0157372_10676412 3300013307 Bacteria 1201
547 Ga0157375_10038248 3300013308 Bacteria 4606
548 Ga0157375_10245534 3300013308 Bacteria 1950
549 Ga0157375_10259770 3300013308 Bacteria 1898
550 Ga0157375_10299558 3300013308 Bacteria 1771
551 Ga0163163_10017133 3300014325 Bacteria 6749
552 Ga0163163_10063041 3300014325 Bacteria 3675
553 Ga0163163_10126958 3300014325 Bacteria 2589
554 Ga0163163_10393886 3300014325 Bacteria 1443
555 Ga0163163_10541197 3300014325 Bacteria 1227
556 Ga0163163_10893255 3300014325 Bacteria 952
557 Ga0163163_11035903 3300014325 Bacteria 884
558 Ga0157380_10010558 3300014326 Bacteria 6642
559 Ga0157380_10044784 3300014326 Bacteria 3469
560 Ga0157380_10278226 3300014326 Bacteria 1530
561 Ga0157380_10785985 3300014326 Bacteria 967
562 Ga0182008_10165678 3300014497 Bacteria 1114
563 Ga0182008_10242838 3300014497 Bacteria 927
564 Ga0157377_10001228 3300014745 Bacteria 10949
565 Ga0157379_10001959 3300014968 Bacteria 17038
566 Ga0157379_10133256 3300014968 Bacteria 2238
567 Ga0157379_10206894 3300014968 Bacteria 1775
568 Ga0157376_10017127 3300014969 Bacteria 5520
569 Ga0157376_10066771 3300014969 Bacteria 3041
570 Ga0157376_10739305 3300014969 Bacteria 992
571 Ga0157376_10922161 3300014969 Bacteria 892
572 Ga0182005_1039485 3300015265 Bacteria 1284
573 Ga0163161_10017343 3300017792 Bacteria 5039
574 Ga0163161_10038485 3300017792 Bacteria 3430
575 Ga0163161_10131788 3300017792 Bacteria 1886
576 Ga0214544_1000026 3300021320 Bacteria 161530
577 Ga0214542_1000025 3300021321 Bacteria 183588
578 Ga0214545_1000014 3300021324 Bacteria 183588
579 Ga0214543_1000034 3300021327 Bacteria 183712
580 Ga0213873_10006937 3300021358 Bacteria 2249
581 Ga0213876_10058129 3300021384 Bacteria 2041
582 Ga0213876_10084092 3300021384 Bacteria 1684
583 Ga0213876_10130132 3300021384 Bacteria 1337
584 Ga0213875_10093331 3300021388 Bacteria 1404
585 Ga0213871_10004587 3300021441 Bacteria 2777
586 Ga0213871_10054108 3300021441 Bacteria 1106
587 Ga0213871_10085835 3300021441 Bacteria 907
588 Ga0209677_103618 3300025253 Bacteria 4887
589 Ga0209148_1000376 3300025254 Bacteria 54217
590 Ga0209233_1009577 3300025261 Bacteria 2942
591 Ga0207666_1000081 3300025271 Bacteria 15694
592 Ga0209455_1000714 3300025272 Bacteria 19245
593 Ga0207673_1001727 3300025290 Bacteria 2419
594 Ga0209564_1011304 3300025295 Bacteria 4012
595 Ga0209758_1000141 3300025297 Bacteria 172481
596 Ga0209758_1000324 3300025297 Bacteria 91475
597 Ga0209758_1001019 3300025297 Bacteria 37066
598 Ga0209758_1002338 3300025297 Bacteria 19567
599 Ga0209758_1002921 3300025297 Bacteria 16464
600 Ga0209758_1003483 3300025297 Bacteria 14255
601 Ga0209758_1041951 3300025297 Bacteria 1703
602 Ga0209758_1081463 3300025297 Bacteria 977
603 Ga0209256_1002956 3300025299 Bacteria 12733
604 Ga0209256_1047199 3300025299 Bacteria 1061
605 Ga0207426_1000437 3300025302 Bacteria 67439
606 Ga0207426_1001139 3300025302 Bacteria 24022
607 Ga0207426_1012626 3300025302 Bacteria 3166
608 Ga0207426_1018791 3300025302 Bacteria 2429
609 Ga0207426_1021983 3300025302 Bacteria 2196
610 Ga0209257_1003859 3300025304 Bacteria 12250
611 Ga0209257_1011469 3300025304 Bacteria 4263
612 Ga0209257_1040537 3300025304 Bacteria 1388
613 Ga0207697_10000051 3300025315 Bacteria 47188
614 Ga0207697_10086702 3300025315 Bacteria 1324
615 Ga0207697_10113018 3300025315 Bacteria 1164
616 Ga0207682_10000661 3300025893 Bacteria 16103
617 Ga0207692_10002517 3300025898 Bacteria 7042
618 Ga0207692_10177558 3300025898 Bacteria 1239
619 Ga0207692_10214027 3300025898 Bacteria 1139
620 Ga0207692_10350439 3300025898 Bacteria 910
621 Ga0207642_10001892 3300025899 Bacteria 6454
622 Ga0207710_10016916 3300025900 Bacteria 3088
623 Ga0207710_10038841 3300025900 Bacteria 2105
624 Ga0207710_10079983 3300025900 Bacteria 1515
625 Ga0207688_10000702 3300025901 Bacteria 16518
626 Ga0207688_10114944 3300025901 Bacteria 1565
627 Ga0207688_10167168 3300025901 Bacteria 1306
628 Ga0207688_10411062 3300025901 Bacteria 840
629 Ga0207688_10477369 3300025901 Bacteria 779
630 Ga0207680_10009478 3300025903 Bacteria 4831
631 Ga0207680_10044806 3300025903 Bacteria 2604
632 Ga0207647_10002441 3300025904 Bacteria 14092
633 Ga0207647_10040227 3300025904 Bacteria 2946
634 Ga0207685_10010399 3300025905 Bacteria 2747
635 Ga0207685_10056738 3300025905 Bacteria 1534
636 Ga0207699_10000344 3300025906 Bacteria 24676
637 Ga0207699_10000434 3300025906 Bacteria 21301
638 Ga0207699_10035971 3300025906 Bacteria 2820
639 Ga0207699_10101229 3300025906 Bacteria 1829
640 Ga0207699_10154439 3300025906 Bacteria 1522
641 Ga0207645_10000218 3300025907 Bacteria 47372
642 Ga0207645_10027565 3300025907 Bacteria 3667
643 Ga0207645_10045314 3300025907 Bacteria 2811
644 Ga0207643_10000400 3300025908 Bacteria 28899
645 Ga0207643_10234976 3300025908 Bacteria 1125
646 Ga0207705_10358320 3300025909 Bacteria 1125
647 Ga0207705_10392607 3300025909 Bacteria 1073
648 Ga0207684_10004496 3300025910 Bacteria 13113
649 Ga0207684_10004520 3300025910 Bacteria 13068
650 Ga0207684_10012329 3300025910 Bacteria 7440
651 Ga0207684_10015203 3300025910 Bacteria 6630
652 Ga0207684_10087821 3300025910 Bacteria 2649
653 Ga0207684_10282202 3300025910 Bacteria 1432
654 Ga0207684_10292934 3300025910 Bacteria 1403
655 Ga0207654_10002726 3300025911 Bacteria 8969
656 Ga0207654_10194687 3300025911 Bacteria 1331
657 Ga0207707_10002658 3300025912 Bacteria 15980
658 Ga0207707_10011843 3300025912 Bacteria 7585
659 Ga0207707_10023997 3300025912 Bacteria 5332
660 Ga0207707_10043382 3300025912 Bacteria 3923
661 Ga0207707_10056384 3300025912 Bacteria 3418
662 Ga0207707_10063500 3300025912 Bacteria 3214
663 Ga0207707_10410557 3300025912 Bacteria 1162
664 Ga0207695_10036649 3300025913 Bacteria 5300
665 Ga0207695_10050434 3300025913 Bacteria 4378
666 Ga0207695_10085924 3300025913 Bacteria 3174
667 Ga0207695_10115522 3300025913 Bacteria 2658
668 Ga0207695_10212050 3300025913 Bacteria 1847
669 Ga0207695_10236470 3300025913 Bacteria 1729
670 Ga0207671_10131265 3300025914 Bacteria 1923
671 Ga0207671_10143288 3300025914 Bacteria 1842
672 Ga0207671_10521032 3300025914 Bacteria 948
673 Ga0207671_10529112 3300025914 Bacteria 940
674 Ga0207693_10001161 3300025915 Bacteria 23500
675 Ga0207693_10003608 3300025915 Bacteria 13212
676 Ga0207693_10035323 3300025915 Bacteria 3941
677 Ga0207693_10042279 3300025915 Bacteria 3588
678 Ga0207693_10085481 3300025915 Bacteria 2471
679 Ga0207693_10132528 3300025915 Bacteria 1959
680 Ga0207693_10206011 3300025915 Bacteria 1546
681 Ga0207693_10269282 3300025915 Bacteria 1335
682 Ga0207693_10321843 3300025915 Bacteria 1210
683 Ga0207693_10365645 3300025915 Bacteria 1129
684 Ga0207663_10000926 3300025916 Bacteria 13406
685 Ga0207663_10012457 3300025916 Bacteria 4599
686 Ga0207660_10002897 3300025917 Bacteria 11208
687 Ga0207660_10010384 3300025917 Bacteria 6041
688 Ga0207660_10013462 3300025917 Bacteria 5361
689 Ga0207660_10495516 3300025917 Bacteria 991
690 Ga0207660_10651928 3300025917 Bacteria 858
691 Ga0207662_10000678 3300025918 Bacteria 15500
692 Ga0207657_10003448 3300025919 Bacteria 16876
693 Ga0207657_10075202 3300025919 Bacteria 2851
694 Ga0207657_10095681 3300025919 Bacteria 2471
695 Ga0207657_10138003 3300025919 Bacteria 1994
696 Ga0207657_10166205 3300025919 Bacteria 1789
697 Ga0207657_10560607 3300025919 Bacteria 893
698 Ga0207649_10001450 3300025920 Bacteria 13956
699 Ga0207652_10005840 3300025921 Bacteria 9970
700 Ga0207652_10006902 3300025921 Bacteria 9146
701 Ga0207652_10008077 3300025921 Bacteria 8447
702 Ga0207652_10016789 3300025921 Bacteria 5982
703 Ga0207652_10211430 3300025921 Bacteria 1746
704 Ga0207652_10346504 3300025921 Bacteria 1341
705 Ga0207646_10003037 3300025922 Bacteria 19308
706 Ga0207646_10078591 3300025922 Bacteria 2949
707 Ga0207646_10159870 3300025922 Bacteria 2032
708 Ga0207646_10244434 3300025922 Bacteria 1621
709 Ga0207646_10525802 3300025922 Bacteria 1065
710 Ga0207681_10001264 3300025923 Bacteria 16325
711 Ga0207681_10203390 3300025923 Bacteria 1522
712 Ga0207681_10259340 3300025923 Bacteria 1360
713 Ga0207694_10113941 3300025924 Bacteria 2153
714 Ga0207694_10125399 3300025924 Bacteria 2054
715 Ga0207694_10153373 3300025924 Bacteria 1857
716 Ga0207694_10296268 3300025924 Bacteria 1331
717 Ga0207694_10464238 3300025924 Bacteria 1058
718 Ga0207650_10043914 3300025925 Bacteria 3283
719 Ga0207650_10085722 3300025925 Bacteria 2397
720 Ga0207650_10219732 3300025925 Bacteria 1529
721 Ga0207659_10004045 3300025926 Bacteria 8850
722 Ga0207659_10248312 3300025926 Bacteria 1443
723 Ga0207659_10421962 3300025926 Bacteria 1119
724 Ga0207687_10007913 3300025927 Bacteria 6965
725 Ga0207687_10040438 3300025927 Bacteria 3196
726 Ga0207687_10427047 3300025927 Bacteria 1095
727 Ga0207700_10001395 3300025928 Bacteria 13709
728 Ga0207700_10015437 3300025928 Bacteria 5039
729 Ga0207700_10015756 3300025928 Bacteria 4998
730 Ga0207700_10090002 3300025928 Bacteria 2420
731 Ga0207700_10096610 3300025928 Bacteria 2346
732 Ga0207700_10101360 3300025928 Bacteria 2297
733 Ga0207700_10524626 3300025928 Bacteria 1050
734 Ga0207664_10023034 3300025929 Bacteria 4661
735 Ga0207664_10064254 3300025929 Bacteria 2935
736 Ga0207664_10145777 3300025929 Bacteria 2007
737 Ga0207664_10726649 3300025929 Bacteria 893
738 Ga0207644_10044060 3300025931 Bacteria 3168
739 Ga0207644_10091325 3300025931 Bacteria 2270
740 Ga0207644_10114849 3300025931 Bacteria 2041
741 Ga0207690_10003720 3300025932 Bacteria 9064
742 Ga0207690_10103954 3300025932 Bacteria 2034
743 Ga0207706_10016490 3300025933 Bacteria 6667
744 Ga0207706_10168370 3300025933 Bacteria 1925
745 Ga0207706_10176636 3300025933 Bacteria 1876
746 Ga0207706_10199102 3300025933 Bacteria 1757
747 Ga0207706_10297489 3300025933 Bacteria 1406
748 Ga0207706_10518744 3300025933 Bacteria 1027
749 Ga0207686_10012733 3300025934 Bacteria 4631
750 Ga0207686_10017495 3300025934 Bacteria 4040
751 Ga0207709_10001798 3300025935 Bacteria 14367
752 Ga0207709_10056378 3300025935 Bacteria 2432
753 Ga0207709_10081552 3300025935 Bacteria 2086
754 Ga0207670_10003328 3300025936 Bacteria 8522
755 Ga0207670_10046656 3300025936 Bacteria 2880
756 Ga0207670_10073089 3300025936 Bacteria 2377
757 Ga0207669_10002357 3300025937 Bacteria 8031
758 Ga0207669_10047148 3300025937 Bacteria 2550
759 Ga0207704_10000896 3300025938 Bacteria 13231
760 Ga0207704_10047543 3300025938 Bacteria 2565
761 Ga0207665_10000228 3300025939 Bacteria 38348
762 Ga0207665_10000715 3300025939 Bacteria 22506
763 Ga0207665_10002595 3300025939 Bacteria 12150
764 Ga0207665_10019118 3300025939 Bacteria 4501
765 Ga0207665_10023485 3300025939 Bacteria 4063
766 Ga0207665_10149363 3300025939 Bacteria 1673
767 Ga0207665_10327372 3300025939 Bacteria 1151
768 Ga0207691_10000940 3300025940 Bacteria 28841
769 Ga0207691_10059780 3300025940 Bacteria 3464
770 Ga0207691_10063675 3300025940 Bacteria 3344
771 Ga0207691_10146323 3300025940 Bacteria 2080
772 Ga0207691_10373640 3300025940 Bacteria 1217
773 Ga0207711_10032480 3300025941 Bacteria 4413
774 Ga0207711_10034481 3300025941 Bacteria 4286
775 Ga0207711_10041197 3300025941 Bacteria 3932
776 Ga0207711_10041697 3300025941 Bacteria 3909
777 Ga0207711_10095313 3300025941 Bacteria 2624
778 Ga0207711_10115517 3300025941 Bacteria 2392
779 Ga0207711_10339338 3300025941 Bacteria 1390
780 Ga0207711_10486060 3300025941 Bacteria 1150
781 Ga0207689_10000514 3300025942 Bacteria 36737
782 Ga0207689_10069377 3300025942 Bacteria 2896
783 Ga0207689_10145972 3300025942 Bacteria 1949
784 Ga0207689_10435858 3300025942 Bacteria 1094
785 Ga0207689_10881434 3300025942 Bacteria 755
786 Ga0207661_10001969 3300025944 Bacteria 14136
787 Ga0207661_10012879 3300025944 Bacteria 6097
788 Ga0207661_10029500 3300025944 Bacteria 4214
789 Ga0207661_10125062 3300025944 Bacteria 2195
790 Ga0207661_10208332 3300025944 Bacteria 1722
791 Ga0207661_10297372 3300025944 Bacteria 1446
792 Ga0207679_10000099 3300025945 Bacteria 74047
793 Ga0207679_10224032 3300025945 Bacteria 1584
794 Ga0207679_10598458 3300025945 Bacteria 993
795 Ga0207667_10019759 3300025949 Bacteria 7509
796 Ga0207667_10040667 3300025949 Bacteria 4950
797 Ga0207667_10042644 3300025949 Bacteria 4821
798 Ga0207667_10098778 3300025949 Bacteria 3012
799 Ga0207667_10209760 3300025949 Bacteria 1997
800 Ga0207667_10399499 3300025949 Bacteria 1399
801 Ga0207667_10410416 3300025949 Bacteria 1379
802 Ga0207667_10482505 3300025949 Bacteria 1258
803 Ga0207667_10648856 3300025949 Bacteria 1061
804 Ga0207651_10000609 3300025960 Bacteria 15073
805 Ga0207712_10001402 3300025961 Bacteria 16444
806 Ga0207712_10164503 3300025961 Bacteria 1727
807 Ga0207712_10402077 3300025961 Bacteria 1151
808 Ga0207668_10008221 3300025972 Bacteria 6215
809 Ga0207668_10069987 3300025972 Bacteria 2500
810 Ga0207668_10075220 3300025972 Bacteria 2427
811 Ga0207668_10438243 3300025972 Bacteria 1112
812 Ga0207640_10001310 3300025981 Bacteria 13493
813 Ga0207640_10083988 3300025981 Bacteria 2185
814 Ga0207658_10021213 3300025986 Bacteria 4506
815 Ga0207658_10329427 3300025986 Bacteria 1324
816 Ga0207658_10444865 3300025986 Bacteria 1146
817 Ga0207677_10000495 3300026023 Bacteria 25594
818 Ga0207677_10020041 3300026023 Bacteria 4052
819 Ga0207703_10005812 3300026035 Bacteria 9883
820 Ga0207703_10250211 3300026035 Bacteria 1597
821 Ga0207703_10254113 3300026035 Bacteria 1585
822 Ga0207703_10393259 3300026035 Bacteria 1285
823 Ga0207703_10404414 3300026035 Bacteria 1267
824 Ga0207703_10760488 3300026035 Bacteria 924
825 Ga0207639_10006228 3300026041 Bacteria 8104
826 Ga0207639_10058222 3300026041 Bacteria 2971
827 Ga0207639_10062266 3300026041 Bacteria 2884
828 Ga0207639_10132413 3300026041 Bacteria 2066
829 Ga0207639_10456287 3300026041 Bacteria 1161
830 Ga0207678_10004568 3300026067 Bacteria 12452
831 Ga0207678_10015651 3300026067 Bacteria 6667
832 Ga0207678_10076090 3300026067 Bacteria 2875
833 Ga0207678_10083060 3300026067 Bacteria 2740
834 Ga0207678_10095571 3300026067 Bacteria 2539
835 Ga0207678_10313045 3300026067 Bacteria 1350
836 Ga0207678_10473513 3300026067 Bacteria 1090
837 Ga0207708_10016215 3300026075 Bacteria 5598
838 Ga0207708_10059563 3300026075 Bacteria 2915
839 Ga0207702_10012301 3300026078 Bacteria 7123
840 Ga0207702_10018427 3300026078 Bacteria 5775
841 Ga0207702_10067051 3300026078 Bacteria 3079
842 Ga0207702_10473207 3300026078 Bacteria 1218
843 Ga0207702_10782605 3300026078 Bacteria 943
844 Ga0207641_10021071 3300026088 Bacteria 5357
845 Ga0207641_10204516 3300026088 Bacteria 1823
846 Ga0207648_10000575 3300026089 Bacteria 41197
847 Ga0207648_10179928 3300026089 Bacteria 1871
848 Ga0207676_10006987 3300026095 Bacteria 8001
849 Ga0207676_10011122 3300026095 Bacteria 6424
850 Ga0207676_10263449 3300026095 Bacteria 1557
851 Ga0207676_10551129 3300026095 Bacteria 1101
852 Ga0207676_10797397 3300026095 Bacteria 921
853 Ga0207674_10002439 3300026116 Bacteria 23481
854 Ga0207674_10008791 3300026116 Bacteria 11628
855 Ga0207674_10053695 3300026116 Bacteria 4106
856 Ga0207674_10088944 3300026116 Bacteria 3081
857 Ga0207674_10097261 3300026116 Bacteria 2927
858 Ga0207674_10109561 3300026116 Bacteria 2737
859 Ga0207674_10239446 3300026116 Bacteria 1762
860 Ga0207674_10632272 3300026116 Bacteria 1034
861 Ga0207674_10678099 3300026116 Bacteria 995
862 Ga0207675_100002824 3300026118 Bacteria 17080
863 Ga0207675_100184205 3300026118 Bacteria 2001
864 Ga0207675_100185079 3300026118 Bacteria 1996
865 Ga0207675_100843026 3300026118 Bacteria 931
866 Ga0207683_10093675 3300026121 Bacteria 2677
867 Ga0207683_10107125 3300026121 Bacteria 2500
868 Ga0207683_10159116 3300026121 Bacteria 2041
869 Ga0207683_10484988 3300026121 Bacteria 1141
870 Ga0207698_10002620 3300026142 Bacteria 10693
871 Ga0207698_10083446 3300026142 Bacteria 2586
872 Ga0207698_10178948 3300026142 Bacteria 1876
873 Ga0207698_10435391 3300026142 Bacteria 1262
874 Ga0207698_10536270 3300026142 Bacteria 1144
875 Ga0209389_1000004 3300027296 Bacteria 263759
876 Ga0209389_1000023 3300027296 Bacteria 150730
877 Ga0209589_1000006 3300027357 Bacteria 436292
878 Ga0209589_1000010 3300027357 Bacteria 237657
879 Ga0209489_100007 3300027361 Bacteria 436292
880 Ga0209489_100011 3300027361 Bacteria 244710
881 Ga0209489_100777 3300027361 Bacteria 63061
882 Ga0209700_100008 3300027363 Bacteria 436292
883 Ga0209700_100013 3300027363 Bacteria 341906
884 Ga0209179_1002360 3300027512 Bacteria 2538
885 Ga0209998_10001529 3300027717 Bacteria 5563
886 Ga0209813_10097234 3300027866 Bacteria 997
887 Ga0209974_10007886 3300027876 Bacteria 3654
888 Ga0207428_10000033 3300027907 Bacteria 232081
889 Ga0207428_10000094 3300027907 Bacteria 123649
890 Ga0207428_10000736 3300027907 Bacteria 37641
891 Ga0207428_10034078 3300027907 Bacteria 4176
892 Ga0207428_10318688 3300027907 Bacteria 1148
893 Ga0268266_10007855 3300028379 Bacteria 9556
894 Ga0268266_10060020 3300028379 Bacteria 3277
895 Ga0268266_10150629 3300028379 Bacteria 2096
896 Ga0268266_10203391 3300028379 Bacteria 1813
897 Ga0268266_10205402 3300028379 Bacteria 1804
898 Ga0268266_10588732 3300028379 Bacteria 1068
899 Ga0268266_10734807 3300028379 Bacteria 952
900 Ga0268266_10747995 3300028379 Bacteria 943
901 Ga0268265_10002253 3300028380 Bacteria 14759
902 Ga0268265_10072751 3300028380 Bacteria 2682
903 Ga0268265_10255958 3300028380 Bacteria 1553
904 Ga0268264_10004708 3300028381 Bacteria 11595
905 Ga0268264_10016894 3300028381 Bacteria 5974
906 Ga0268264_10032913 3300028381 Bacteria 4254
907 Ga0268264_10510910 3300028381 Bacteria 1173
908 Ga0307517_10000102 3300028786 Bacteria 123775
909 Ga0307511_10000269 3300030521 Bacteria 54080
910 Ga0265332_10118070 3300031238 Bacteria 1115
911 Ga0265328_10071118 3300031239 Bacteria 1279
912 Ga0265340_10030010 3300031247 Bacteria 2728
913 Ga0265339_10110557 3300031249 Bacteria 1422
914 Ga0265316_10028234 3300031344 Bacteria 4631
915 Ga0265316_10158346 3300031344 Bacteria 1694
916 Ga0307509_10139585 3300031507 Bacteria 2362
917 Ga0307408_100261023 3300031548 Bacteria 1434
918 Ga0307508_10215758 3300031616 Bacteria 1519
919 Ga0307516_10036663 3300031730 Bacteria 4907
920 Ga0307405_10306430 3300031731 Bacteria 1207
921 Ga0307413_10121182 3300031824 Bacteria 1772
922 Ga0307410_10233390 3300031852 Bacteria 1422
923 Ga0307407_10187867 3300031903 Bacteria 1375
924 Ga0307412_10289483 3300031911 Bacteria 1290
925 Ga0307412_10753256 3300031911 Bacteria 841
926 Ga0307409_100448725 3300031995 Bacteria 1244
927 Ga0307409_100952146 3300031995 Bacteria 874
928 Ga0307411_10065049 3300032005 Bacteria 2444
929 Ga0307411_10118477 3300032005 Bacteria 1910
930 Ga0307411_10168777 3300032005 Bacteria 1648
931 Ga0307415_100428961 3300032126 Bacteria 1137
932 Ga0307415_100657546 3300032126 Bacteria 940
933 Ga0307510_10027691 3300033180 Bacteria 6487
934 Ga0307510_10069562 3300033180 Bacteria 3524
935 Ga0315911_1000010 3300033442 Bacteria 322197
936 Ga0373950_0001102 3300034818 Bacteria 3453
937 Ga0373958_0002389 3300034819 Bacteria 2622
938 Ga0373938_0001160 3300034957 Bacteria 4244
939 Ga0373926_0002880 3300035083 Bacteria 5512
940 Ga0373928_0014131 3300035084 Bacteria 1610
941 Ga0373934_0054354 3300035086 Bacteria 1590
942 Ga0373934_0056776 3300035086 Bacteria 1557
943 Ga0373934_0115469 3300035086 Bacteria 1091
944 Ga0373940_0011418 3300035088 Bacteria 2109
945 Ga0373944_0019486 3300035089 Bacteria 1947
946 Ga0373949_0000927 3300035090 Bacteria 9141
947 Ga0373951_0002101 3300035091 Bacteria 5104
948 Ga0373951_0073904 3300035091 Bacteria 873
949 Ga0373923_0002326 3300035111 Bacteria 5821
950 Ga0373923_0040341 3300035111 Bacteria 1921
951 Ga0373932_0006222 3300035112 Bacteria 2820
952 Ga0373932_0014847 3300035112 Bacteria 1965
953 Ga0373932_0058549 3300035112 Bacteria 1164
954 Ga0373936_0005468 3300035113 Bacteria 4793
955 Ga0373936_0018584 3300035113 Bacteria 2686
956 Ga0373936_0150221 3300035113 Bacteria 1010
957 Ga0373939_0001513 3300035114 Bacteria 5637
958 Ga0373939_0029562 3300035114 Bacteria 1569
959 Ga0373939_0041635 3300035114 Bacteria 1385
960 Ga0373941_0000449 3300035115 Bacteria 8206
961 Ga0373941_0002582 3300035115 Bacteria 4010
962 Ga0373941_0004659 3300035115 Bacteria 3181
963 Ga0373941_0105772 3300035115 Bacteria 986
964 Ga0373945_0010695 3300035116 Bacteria 3026
965 Ga0373953_0000420 3300035117 Bacteria 11547
966 Ga0373953_0014626 3300035117 Bacteria 2827
967 Ga0373953_0021876 3300035117 Bacteria 2405
968 Ga0373953_0076725 3300035117 Bacteria 1385
969 Ga0373953_0164912 3300035117 Bacteria 953
970 Ga0373954_0000663 3300035118 Bacteria 13181
971 Ga0373954_0056577 3300035118 Bacteria 1846
972 Ga0373954_0062480 3300035118 Bacteria 1759
973 Ga0373956_0000275 3300035119 Bacteria 20650
974 Ga0373956_0103162 3300035119 Bacteria 1324
975 Ga0373957_0000426 3300035120 Bacteria 10649
976 Ga0373957_0049589 3300035120 Bacteria 1603
977 Ga0373957_0050517 3300035120 Bacteria 1589
978 Ga0373957_0126366 3300035120 Bacteria 1038
979 Ga0373957_0139518 3300035120 Bacteria 990
980 Ga0373957_0151219 3300035120 Bacteria 953
981 Ga0373960_0003445 3300035121 Bacteria 3583
982 Ga0373960_0080636 3300035121 Bacteria 1024
983 Ga0373943_0000424 3300035170 Bacteria 17836
984 Ga0373943_0006136 3300035170 Bacteria 5399
985 Ga0373943_0028636 3300035170 Bacteria 2626
986 Ga0373943_0046732 3300035170 Bacteria 2113
987 Ga0373943_0118531 3300035170 Bacteria 1404
988 Ga0373946_0003275 3300035171 Bacteria 5751
989 Ga0373946_0031028 3300035171 Bacteria 2137
990 Ga0373955_0000510 3300035172 Bacteria 16513
991 Ga0373955_0016347 3300035172 Bacteria 3650
992 Ga0373955_0056665 3300035172 Bacteria 2150
993 Ga0373942_0027753 3300035207 Bacteria 1475
994 Ga0373962_0003492 3300035242 Bacteria 3777
995 Ga0373924_0004208 3300035410 Bacteria 5014
996 Ga0373924_0066506 3300035410 Bacteria 1515
997 Ga0373931_0001672 3300035691 Bacteria 9597
998 Ga0373931_0006356 3300035691 Bacteria 5516
999 Ga0373931_0008479 3300035691 Bacteria 4878
1000 Ga0373931_0066158 3300035691 Bacteria 1960
1001 Ga0373931_0089514 3300035691 Bacteria 1712
1002 Ga0373931_0313329 3300035691 Bacteria 972
1003 Ga0373931_0325217 3300035691 Bacteria 956
1004 Ga0373935_0000229 3300035692 Bacteria 27393
1005 Ga0373935_0000882 3300035692 Bacteria 16207
1006 Ga0373935_0019969 3300035692 Bacteria 4089
1007 Ga0373935_0218091 3300035692 Bacteria 1324
1008 Ga0373935_0286870 3300035692 Bacteria 1160
1009 Ga0373927_0000071 3300035695 Bacteria 73794
1010 Ga0373927_0000414 3300035695 Bacteria 32784
1011 Ga0373927_0007062 3300035695 Bacteria 7614
1012 Ga0373927_0011507 3300035695 Bacteria 5895
1013 Ga0373927_0025829 3300035695 Bacteria 3839
1014 Ga0373927_0030092 3300035695 Bacteria 3542
1015 Ga0373927_0099124 3300035695 Bacteria 1895
1016 Ga0373927_0103253 3300035695 Bacteria 1855
1017 Ga0373927_0284219 3300035695 Bacteria 1088
1018 Ga0373927_0332372 3300035695 Bacteria 1001
1019 Ga0373927_0528331 3300035695 Bacteria 780
1020 Ga0373933_0004204 3300035724 Bacteria 7938
1021 Ga0373933_0029183 3300035724 Bacteria 3187
1022 Ga0373933_0034112 3300035724 Bacteria 2964
1023 Ga0373933_0239607 3300035724 Bacteria 1166
1024 Ga0373933_0286839 3300035724 Bacteria 1064
1025 Ga0373947_0000275 3300035725 Bacteria 29242
1026 Ga0373947_0000540 3300035725 Bacteria 22139
1027 Ga0373947_0003876 3300035725 Bacteria 8805
1028 Ga0373947_0004993 3300035725 Bacteria 7766
1029 Ga0373947_0017419 3300035725 Bacteria 4132
1030 Ga0373947_0036936 3300035725 Bacteria 2897
1031 Ga0373947_0147132 3300035725 Bacteria 1515
1032 Ga0373947_0258951 3300035725 Bacteria 1152
1033 Ga0373937_0031431 3300036401 Bacteria 4811
1034 Ga0373937_0039136 3300036401 Bacteria 4322
1035 Ga0373937_0045462 3300036401 Bacteria 4012
1036 Ga0373937_0045643 3300036401 Bacteria 4004
1037 Ga0373937_0070190 3300036401 Bacteria 3231
1038 Ga0373937_0193491 3300036401 Bacteria 1911
1039 Ga0373937_0212345 3300036401 Bacteria 1821
1040 Ga0373937_0261930 3300036401 Bacteria 1630
1041 Ga0373937_0389320 3300036401 Bacteria 1322
1042 Ga0373925_0002725 3300037068 Bacteria 13982
1043 Ga0373925_0030853 3300037068 Bacteria 3936
1044 Ga0373925_0040457 3300037068 Bacteria 3451
1045 Ga0373925_0054967 3300037068 Bacteria 2979
1046 Ga0373925_0087640 3300037068 Bacteria 2376
1047 Ga0373925_0100456 3300037068 Bacteria 2223
1048 Ga0373925_0120831 3300037068 Bacteria 2033
1049 Ga0373925_0206794 3300037068 Bacteria 1563
1050 Ga0373925_0391554 3300037068 Bacteria 1132
1051 Ga0373925_0457061 3300037068 Bacteria 1046
1052 Ga0373925_0471153 3300037068 Bacteria 1030
1053 Ga0395899_0008599 3300037312 Bacteria 7860
1054 Ga0395899_0171700 3300037312 Bacteria 1527
1055 Ga0395900_0013738 3300037418 Bacteria 8266
1056 Ga0395900_0021345 3300037418 Bacteria 6619
1057 Ga0395900_0054470 3300037418 Bacteria 4119
1058 Ga0395900_0259612 3300037418 Bacteria 1736
1059 Ga0395900_0796875 3300037418 Bacteria 873
1060 Ga0395898_0006919 3300037466 Bacteria 12054
1061 Ga0395898_0024139 3300037466 Bacteria 6136
1062 Ga0395898_0065456 3300037466 Bacteria 3524
1063 Ga0395898_0140754 3300037466 Bacteria 2310
1064 Ga0395905_0030266 3300037471 Bacteria 5102
1065 Ga0395905_0176477 3300037471 Bacteria 2006
1066 Ga0395905_0284582 3300037471 Bacteria 1540
1067 Ga0395905_0577770 3300037471 Bacteria 1025
1068 Ga0436364_0066511 3300037853 Bacteria 1328
1069 Ga0436364_0680312 3300037853 Bacteria 1567
1070 Ga0395901_0005295 3300038443 Bacteria 13040
1071 Ga0395901_0025268 3300038443 Bacteria 6097
1072 Ga0395901_0157594 3300038443 Bacteria 2384
1073 Ga0395901_0222005 3300038443 Bacteria 1975
1074 Ga0395901_0566758 3300038443 Bacteria 1149
1075 Ga0395901_0896520 3300038443 Bacteria 869
1076 Ga0436365_0290905 3300039437 Bacteria 1072
1077 Ga0436365_0643464 3300039437 Bacteria 2985
1078 Ga0436365_0906128 3300039437 Bacteria 7419
1079 Ga0436365_1318098 3300039437 Bacteria 1012
1080 Ga0436365_1835535 3300039437 Bacteria 1691
1081 Ga0436365_1883031 3300039437 Bacteria 10380
1082 Ga0436360_0160052 3300039438 Bacteria 1084
1083 Ga0436360_0336915 3300039438 Bacteria 1525
1084 Ga0436360_0347139 3300039438 Bacteria 1440
1085 Ga0436360_0372244 3300039438 Bacteria 1021
1086 Ga0436360_0467044 3300039438 Bacteria 14377
1087 Ga0436361_0486257 3300039447 Bacteria 2823
1088 Ga0436361_0927272 3300039447 Bacteria 4436
1089 Ga0436361_1221223 3300039447 Bacteria 2181
1090 Ga0436363_1356934 3300039450 Bacteria 848
1091 Ga0436363_1697326 3300039450 Bacteria 1541
1092 Ga0436362_0313826 3300039453 Bacteria 1179
1093 Ga0436362_0755152 3300039453 Bacteria 1378
1094 Ga0436362_0815359 3300039453 Bacteria 2728
1095 Ga0439465_0041847 3300041413 Bacteria 1484
1096 Ga0451793_0668962 3300041452 Bacteria 892
1097 Ga0451795_0064442 3300041456 Bacteria 1167
1098 Ga0451800_0438865 3300041459 Bacteria 1622
1099 Ga0451835_1226713 3300041492 Bacteria 790
1100 Ga0451847_0960825 3300041503 Bacteria 972
1101 Ga0451577_0047462 3300042876 Bacteria 3840
1102 Ga0466969_0016988 3300044656 Bacteria 3802
1103 Ga0466972_0000193 3300044658 Bacteria 46863
1104 Ga0466972_0014447 3300044658 Bacteria 3954
1105 Ga0453683_0025310 3300044673 Bacteria 3772
1106 Ga0466965_0176727 3300044683 Bacteria 1125
1107 Ga0466966_0000551 3300044684 Bacteria 23873
1108 Ga0466961_0000020 3300044693 Bacteria 107610
1109 Ga0466963_0014002 3300044694 Bacteria 4939
1110 Ga0466963_0119916 3300044694 Bacteria 1809
1111 Ga0466963_0231314 3300044694 Bacteria 1295
1112 Ga0453684_0024772 3300044712 Bacteria 8747
1113 Ga0466968_0009179 3300044735 Bacteria 3803
1114 Ga0466957_0076196 3300044842 Bacteria 2082
1115 Ga0466960_0039543 3300044901 Bacteria 2225
1116 Ga0466959_0037674 3300045049 Bacteria 3574
1117 Ga0451576_0030558 3300045051 Bacteria 5756
1118 Ga0451576_0034448 3300045051 Bacteria 5378
1119 Ga0451576_0054640 3300045051 Bacteria 4181
1120 Ga0451576_0076080 3300045051 Bacteria 3494
1121 Ga0451576_0274464 3300045051 Bacteria 1762
1122 Ga0466967_0002756 3300045976 Bacteria 11112
1123 Ga0466967_0014710 3300045976 Bacteria 6109
1124 Ga0466967_0070110 3300045976 Bacteria 3135
1125 Ga0466967_0100278 3300045976 Bacteria 2646
1126 Ga0495617_026442 3300046452 Bacteria 1954
1127 Ga0495592_0003051 3300046454 Bacteria 11938
1128 Ga0495592_0003383 3300046454 Bacteria 11439
1129 Ga0495592_0036322 3300046454 Bacteria 3711
1130 Ga0495592_0049426 3300046454 Bacteria 3126
1131 Ga0495592_0058136 3300046454 Bacteria 2852
1132 Ga0495592_0160159 3300046454 Bacteria 1549
1133 Ga0495603_0000035 3300046455 Bacteria 57510
1134 Ga0495603_0001059 3300046455 Bacteria 15931
1135 Ga0495603_0006718 3300046455 Bacteria 6905
1136 Ga0495603_0007225 3300046455 Bacteria 6667
1137 Ga0495603_0021313 3300046455 Bacteria 3925
1138 Ga0495603_0048434 3300046455 Bacteria 2530
1139 Ga0495603_0132535 3300046455 Bacteria 1451
1140 Ga0495603_0386525 3300046455 Bacteria 802
1141 Ga0495590_0039422 3300046457 Bacteria 1648
1142 Ga0495590_0103306 3300046457 Bacteria 1013
1143 Ga0495590_0172169 3300046457 Bacteria 789
1144 Ga0495629_0000081 3300046459 Bacteria 85305
1145 Ga0495629_0000269 3300046459 Bacteria 45206
1146 Ga0495629_0000612 3300046459 Bacteria 29083
1147 Ga0495629_0011200 3300046459 Bacteria 6512
1148 Ga0495629_0058439 3300046459 Bacteria 2696
1149 Ga0495629_0090143 3300046459 Bacteria 2139
1150 Ga0495629_0129759 3300046459 Bacteria 1756
1151 Ga0495629_0312568 3300046459 Bacteria 1075
1152 Ga0495638_0004483 3300046460 Bacteria 10577
1153 Ga0495638_0105267 3300046460 Bacteria 1681
1154 Ga0495641_0005556 3300046461 Bacteria 8464
1155 Ga0495641_0008400 3300046461 Bacteria 6307
1156 Ga0495641_0019447 3300046461 Bacteria 3473
1157 Ga0495651_0005350 3300046462 Bacteria 9794
1158 Ga0495651_0009999 3300046462 Bacteria 7292
1159 Ga0495651_0030088 3300046462 Bacteria 4234
1160 Ga0495651_0031301 3300046462 Bacteria 4149
1161 Ga0495651_0031832 3300046462 Bacteria 4112
1162 Ga0495651_0113904 3300046462 Bacteria 1996
1163 Ga0495651_0148779 3300046462 Bacteria 1690
1164 Ga0495653_0000399 3300046463 Bacteria 34847
1165 Ga0495653_0036295 3300046463 Bacteria 3883
1166 Ga0495653_0057546 3300046463 Bacteria 2958
1167 Ga0495653_0070117 3300046463 Bacteria 2624
1168 Ga0495653_0153653 3300046463 Bacteria 1605
1169 Ga0495650_0036071 3300046471 Bacteria 2169
1170 Ga0495650_0064595 3300046471 Bacteria 1455
1171 Ga0495580_0000449 3300046472 Bacteria 34081
1172 Ga0495580_0005664 3300046472 Bacteria 10275
1173 Ga0495580_0058049 3300046472 Bacteria 2723
1174 Ga0495580_0058144 3300046472 Bacteria 2721
1175 Ga0495580_0100922 3300046472 Bacteria 2007
1176 Ga0495580_0405326 3300046472 Bacteria 919
1177 Ga0495582_0000021 3300046473 Bacteria 88264
1178 Ga0495582_0024180 3300046473 Bacteria 3322
1179 Ga0495582_0030917 3300046473 Bacteria 2941
1180 Ga0495582_0258821 3300046473 Bacteria 998
1181 Ga0495582_0354229 3300046473 Bacteria 845
1182 Ga0495605_0144926 3300046474 Bacteria 1063
1183 Ga0495639_0000010 3300046475 Bacteria 93685
1184 Ga0495639_0009316 3300046475 Bacteria 4210
1185 Ga0495639_0162912 3300046475 Bacteria 1080
1186 Ga0495639_0196875 3300046475 Bacteria 985
1187 Ga0495662_0000261 3300046476 Bacteria 22323
1188 Ga0495662_0008429 3300046476 Bacteria 5070
1189 Ga0495662_0016950 3300046476 Bacteria 3525
1190 Ga0495662_0025894 3300046476 Bacteria 2833
1191 Ga0495662_0034302 3300046476 Bacteria 2450
1192 Ga0495662_0088131 3300046476 Bacteria 1512
1193 Ga0495664_0000736 3300046477 Bacteria 16729
1194 Ga0495664_0004738 3300046477 Bacteria 7434
1195 Ga0495664_0007307 3300046477 Bacteria 6129
1196 Ga0495664_0007928 3300046477 Bacteria 5912
1197 Ga0495664_0028294 3300046477 Bacteria 3273
1198 Ga0495664_0092367 3300046477 Bacteria 1820
1199 Ga0495664_0238942 3300046477 Bacteria 1099
1200 Ga0495584_0025120 3300046491 Bacteria 3020
1201 Ga0495585_0001696 3300046492 Bacteria 16820
1202 Ga0495585_0189940 3300046492 Bacteria 1051
1203 Ga0495585_0278597 3300046492 Bacteria 827
1204 Ga0495594_0000979 3300046499 Bacteria 14837
1205 Ga0495594_0021023 3300046499 Bacteria 3481
1206 Ga0495594_0292065 3300046499 Bacteria 929
1207 Ga0495607_0014000 3300046501 Bacteria 5238
1208 Ga0495583_0138614 3300046506 Bacteria 1014
1209 Ga0495606_0001170 3300046507 Bacteria 37016
1210 Ga0495606_0146458 3300046507 Bacteria 1390
1211 Ga0495608_0001226 3300046511 Bacteria 18178
1212 Ga0495608_0016478 3300046511 Bacteria 5114
1213 Ga0495608_0021826 3300046511 Bacteria 4391
1214 Ga0495608_0031182 3300046511 Bacteria 3605
1215 Ga0495608_0034772 3300046511 Bacteria 3401
1216 Ga0495608_0069160 3300046511 Bacteria 2307
1217 Ga0495608_0089598 3300046511 Bacteria 1991
1218 Ga0495618_0014879 3300046514 Bacteria 4746
1219 Ga0495618_0014997 3300046514 Bacteria 4726
1220 Ga0495618_0026734 3300046514 Bacteria 3590
1221 Ga0495618_0059293 3300046514 Bacteria 2425
1222 Ga0495618_0078648 3300046514 Bacteria 2102
1223 Ga0495618_0293219 3300046514 Bacteria 1012
1224 Ga0495628_0009019 3300046516 Bacteria 8533
1225 Ga0495628_0012048 3300046516 Bacteria 7293
1226 Ga0495628_0029893 3300046516 Bacteria 4415
1227 Ga0495628_0069679 3300046516 Bacteria 2743
1228 Ga0495628_0106266 3300046516 Bacteria 2162
1229 Ga0495628_0435079 3300046516 Bacteria 954
1230 Ga0495628_0533755 3300046516 Bacteria 844
1231 Ga0495630_0002218 3300046517 Bacteria 13534
1232 Ga0495630_0021361 3300046517 Bacteria 4780
1233 Ga0495630_0280144 3300046517 Bacteria 1274
1234 Ga0495630_0283650 3300046517 Bacteria 1265
1235 Ga0495630_0464862 3300046517 Bacteria 969
1236 Ga0495630_0619573 3300046517 Bacteria 829
1237 Ga0495632_0166000 3300046519 Bacteria 1015
1238 Ga0495637_0067395 3300046520 Bacteria 1453
1239 Ga0495637_0099910 3300046520 Bacteria 1135
1240 Ga0495643_0006750 3300046522 Bacteria 7506
1241 Ga0495644_0003755 3300046523 Bacteria 5977
1242 Ga0495648_0212507 3300046524 Bacteria 960
1243 Ga0495663_0032939 3300046525 Bacteria 1545
1244 Ga0495666_0031225 3300046526 Bacteria 2610
1245 Ga0495666_0108952 3300046526 Bacteria 1302
1246 Ga0495652_0006874 3300046529 Bacteria 10531
1247 Ga0495652_0008672 3300046529 Bacteria 9267
1248 Ga0495652_0019786 3300046529 Bacteria 5990
1249 Ga0495652_0079863 3300046529 Bacteria 2703
1250 Ga0495665_0002966 3300046531 Bacteria 9167
1251 Ga0495665_0009534 3300046531 Bacteria 5259
1252 Ga0495665_0024212 3300046531 Bacteria 3261
1253 Ga0495665_0031922 3300046531 Bacteria 2818
1254 Ga0495640_0002964 3300046533 Bacteria 13677
1255 Ga0495640_0013343 3300046533 Bacteria 6244
1256 Ga0495640_0018374 3300046533 Bacteria 5189
1257 Ga0495640_0027630 3300046533 Bacteria 4090
1258 Ga0495640_0032420 3300046533 Bacteria 3722
1259 Ga0495586_0001814 3300046535 Bacteria 11645
1260 Ga0495586_0034389 3300046535 Bacteria 2722
1261 Ga0495586_0248171 3300046535 Bacteria 1015
1262 Ga0495587_0001432 3300046536 Bacteria 15878
1263 Ga0495587_0006986 3300046536 Bacteria 7331
1264 Ga0495587_0015759 3300046536 Bacteria 4713
1265 Ga0495587_0022963 3300046536 Bacteria 3836
1266 Ga0495587_0034748 3300046536 Bacteria 3039
1267 Ga0495587_0059702 3300046536 Bacteria 2237
1268 Ga0495587_0202228 3300046536 Bacteria 1123
1269 Ga0495587_0347696 3300046536 Bacteria 827
1270 Ga0495598_0085697 3300046537 Bacteria 1018
1271 Ga0495598_0108743 3300046537 Bacteria 927
1272 Ga0495598_0122732 3300046537 Bacteria 882
1273 Ga0495621_0082598 3300046539 Bacteria 1200
1274 Ga0495621_0102940 3300046539 Bacteria 1088
1275 Ga0495597_0067621 3300046542 Bacteria 1545
1276 Ga0495645_0001776 3300046543 Bacteria 14687
1277 Ga0495645_0001836 3300046543 Bacteria 14435
1278 Ga0495645_0002109 3300046543 Bacteria 13497
1279 Ga0495645_0008749 3300046543 Bacteria 7070
1280 Ga0495645_0019408 3300046543 Bacteria 4895
1281 Ga0495645_0148712 3300046543 Bacteria 1629
1282 Ga0495645_0466439 3300046543 Bacteria 794
1283 Ga0495622_0008049 3300046557 Bacteria 4887
1284 Ga0495622_0010565 3300046557 Bacteria 4261
1285 Ga0495622_0127322 3300046557 Bacteria 1161
1286 Ga0495633_0056982 3300046558 Bacteria 1836
1287 Ga0495633_0118360 3300046558 Bacteria 1227
1288 Ga0495633_0262006 3300046558 Bacteria 788
1289 Ga0495667_0001452 3300046559 Bacteria 15607
1290 Ga0495667_0008441 3300046559 Bacteria 6992
1291 Ga0495667_0020781 3300046559 Bacteria 4430
1292 Ga0495667_0021237 3300046559 Bacteria 4380
1293 Ga0495667_0023177 3300046559 Bacteria 4183
1294 Ga0495667_0042971 3300046559 Bacteria 2996
1295 Ga0495667_0044112 3300046559 Bacteria 2953
1296 Ga0495667_0206978 3300046559 Bacteria 1254
1297 Ga0495656_0004963 3300046615 Bacteria 4583
1298 Ga0495656_0012418 3300046615 Bacteria 3142
1299 Ga0495668_0025425 3300046616 Bacteria 3364
1300 Ga0495668_0081519 3300046616 Bacteria 1775
1301 Ga0495668_0196923 3300046616 Bacteria 1103
1302 Ga0495634_0000261 3300046642 Bacteria 49735
1303 Ga0495634_0006321 3300046642 Bacteria 9017
1304 Ga0495634_0011593 3300046642 Bacteria 6413
1305 Ga0495634_0017261 3300046642 Bacteria 5153
1306 Ga0495634_0039498 3300046642 Bacteria 3213
1307 Ga0495634_0072933 3300046642 Bacteria 2257
1308 Ga0495634_0096210 3300046642 Bacteria 1917
1309 Ga0495611_0004521 3300046648 Bacteria 6000
1310 Ga0495611_0054665 3300046648 Bacteria 1805
1311 Ga0495611_0163640 3300046648 Bacteria 1040
1312 Ga0495625_0049301 3300046660 Bacteria 3028
1313 Ga0495625_0256375 3300046660 Bacteria 1133
1314 Ga0495635_0000088 3300046663 Bacteria 54355
1315 Ga0495635_0000438 3300046663 Bacteria 26330
1316 Ga0495635_0001380 3300046663 Bacteria 16199
1317 Ga0495635_0003521 3300046663 Bacteria 10832
1318 Ga0495635_0006545 3300046663 Bacteria 8131
1319 Ga0495635_0017940 3300046663 Bacteria 4943
1320 Ga0495635_0049932 3300046663 Bacteria 2884
1321 Ga0495659_0001977 3300046664 Bacteria 6744
1322 Ga0495661_0054082 3300046665 Bacteria 2412
1323 Ga0495661_0176969 3300046665 Bacteria 1133
1324 Ga0495588_0019653 3300046674 Bacteria 3311
1325 Ga0495588_0051556 3300046674 Bacteria 2119
1326 Ga0495588_0088287 3300046674 Bacteria 1622
1327 Ga0495588_0213546 3300046674 Bacteria 1019
1328 Ga0495657_0008178 3300046675 Bacteria 8016
1329 Ga0495657_0010455 3300046675 Bacteria 6983
1330 Ga0495657_0012948 3300046675 Bacteria 6176
1331 Ga0495657_0041171 3300046675 Bacteria 3164
1332 Ga0495657_0061813 3300046675 Bacteria 2477
1333 Ga0495657_0242498 3300046675 Bacteria 1087
1334 Ga0495657_0319519 3300046675 Bacteria 923
1335 Ga0495599_0001137 3300046678 Bacteria 15035
1336 Ga0495599_0010283 3300046678 Bacteria 5726
1337 Ga0495599_0035710 3300046678 Bacteria 3121
1338 Ga0495599_0082276 3300046678 Bacteria 2011
1339 Ga0495599_0231136 3300046678 Bacteria 1129
1340 Ga0495623_0006628 3300046679 Bacteria 7538
1341 Ga0495623_0010588 3300046679 Bacteria 5969
1342 Ga0495623_0012243 3300046679 Bacteria 5556
1343 Ga0495646_0002433 3300046680 Bacteria 11422
1344 Ga0495646_0022684 3300046680 Bacteria 3957
1345 Ga0495646_0026635 3300046680 Bacteria 3629
1346 Ga0495646_0048965 3300046680 Bacteria 2566
1347 Ga0495646_0057288 3300046680 Bacteria 2333
1348 Ga0495646_0088987 3300046680 Bacteria 1787
1349 Ga0495647_0003550 3300046681 Bacteria 4998
1350 Ga0495647_0054257 3300046681 Bacteria 1565
1351 Ga0495658_0000771 3300046683 Bacteria 17323
1352 Ga0495658_0000892 3300046683 Bacteria 16047
1353 Ga0495613_0027628 3300046689 Bacteria 4223
1354 Ga0495613_0040776 3300046689 Bacteria 3439
1355 Ga0495613_0045342 3300046689 Bacteria 3252
1356 Ga0495613_0053833 3300046689 Bacteria 2960
1357 Ga0495613_0100556 3300046689 Bacteria 2088
1358 Ga0495613_0111521 3300046689 Bacteria 1970
1359 Ga0495613_0181685 3300046689 Bacteria 1489
1360 Ga0495613_0273999 3300046689 Bacteria 1173
1361 Ga0495613_0508572 3300046689 Bacteria 810
1362 Ga0495624_0000682 3300046690 Bacteria 26624
1363 Ga0495624_0001570 3300046690 Bacteria 17622
1364 Ga0495624_0099630 3300046690 Bacteria 1789
1365 Ga0495624_0115349 3300046690 Bacteria 1651
1366 Ga0495624_0120586 3300046690 Bacteria 1610
1367 Ga0495624_0217723 3300046690 Bacteria 1158
1368 Ga0495624_0222201 3300046690 Bacteria 1145
1369 Ga0495624_0236040 3300046690 Bacteria 1107
1370 Ga0495624_0368895 3300046690 Bacteria 863
1371 Ga0495670_0011391 3300046691 Bacteria 4373
1372 Ga0495671_0078355 3300046692 Bacteria 1620
1373 Ga0495671_0320799 3300046692 Bacteria 744
1374 Ga0495649_0119141 3300046694 Bacteria 1396
1375 Ga0495589_0033211 3300046794 Bacteria 2593
1376 Ga0495600_0000484 3300046809 Bacteria 20528
1377 Ga0495600_0010662 3300046809 Bacteria 5709
1378 Ga0495600_0018989 3300046809 Bacteria 4387
1379 Ga0495600_0023629 3300046809 Bacteria 3955
1380 Ga0495600_0041250 3300046809 Bacteria 3007
1381 Ga0495600_0072934 3300046809 Bacteria 2242
1382 Ga0495660_0150270 3300046810 Bacteria 1151
1383 Ga0495581_0000018 3300047315 Bacteria 58791
1384 Ga0495581_0012302 3300047315 Bacteria 4958
1385 Ga0495581_0025033 3300047315 Bacteria 3459
1386 Ga0495581_0077638 3300047315 Bacteria 1922
1387 Ga0495581_0114277 3300047315 Bacteria 1570
1388 Ga0495604_0002253 3300047317 Bacteria 15447
1389 Ga0495604_0005171 3300047317 Bacteria 10334
1390 Ga0495604_0007540 3300047317 Bacteria 8607
1391 Ga0495604_0027161 3300047317 Bacteria 4554
1392 Ga0495604_0048968 3300047317 Bacteria 3285
1393 Ga0495604_0052328 3300047317 Bacteria 3163
1394 Ga0495604_0159461 3300047317 Bacteria 1595
1395 Ga0495604_0223755 3300047317 Bacteria 1294
1396 Ga0495604_0532106 3300047317 Bacteria 759
1397 Ga0495636_0177866 3300047318 Bacteria 964
1398 Ga0495674_0000209 3300047319 Bacteria 48240
1399 Ga0495674_0001257 3300047319 Bacteria 24613
1400 Ga0495674_0006731 3300047319 Bacteria 11003
1401 Ga0495674_0021689 3300047319 Bacteria 5939
1402 Ga0495674_0024470 3300047319 Bacteria 5548
1403 Ga0495674_0074686 3300047319 Bacteria 2918
1404 Ga0495674_0120810 3300047319 Bacteria 2213
1405 Ga0495674_0237631 3300047319 Bacteria 1502
1406 Ga0495674_0708636 3300047319 Bacteria 789
1407 Ga0495672_0039117 3300047320 Bacteria 2886
1408 Ga0495676_0033822 3300047321 Bacteria 4297
1409 Ga0495676_0067018 3300047321 Bacteria 2779
1410 Ga0495676_0086311 3300047321 Bacteria 2362
1411 Ga0495676_0104485 3300047321 Bacteria 2090
1412 Ga0495676_0153223 3300047321 Bacteria 1638
1413 Ga0495676_0244022 3300047321 Bacteria 1228
1414 Ga0495680_0004231 3300047322 Bacteria 13778
1415 Ga0495680_0006139 3300047322 Bacteria 11212
1416 Ga0495680_0013803 3300047322 Bacteria 7030
1417 Ga0495680_0024657 3300047322 Bacteria 4987
1418 Ga0495680_0046879 3300047322 Bacteria 3405
1419 Ga0495680_0064241 3300047322 Bacteria 2815
1420 Ga0495680_0123588 3300047322 Bacteria 1909
1421 Ga0495687_046397 3300047443 Bacteria 1876
1422 Ga0495675_0000977 3300047444 Bacteria 17351
1423 Ga0495675_0006091 3300047444 Bacteria 7382
1424 Ga0495675_0010571 3300047444 Bacteria 5769
1425 Ga0495675_0060191 3300047444 Bacteria 2407
1426 Ga0495675_0069346 3300047444 Bacteria 2226
1427 Ga0495677_0029191 3300047445 Bacteria 2005
1428 Ga0495679_029497 3300047446 Bacteria 1789
1429 Ga0495673_0051765 3300047469 Bacteria 1797
1430 Ga0495681_0038580 3300047470 Bacteria 2340
1431 Ga0495684_0001326 3300047471 Bacteria 19921
1432 Ga0495684_0001766 3300047471 Bacteria 17346
1433 Ga0495684_0003044 3300047471 Bacteria 13189
1434 Ga0495684_0003129 3300047471 Bacteria 12980
1435 Ga0495684_0049314 3300047471 Bacteria 3217
1436 Ga0495684_0052451 3300047471 Bacteria 3112
1437 Ga0495684_0052531 3300047471 Bacteria 3110
1438 Ga0495686_0224797 3300047472 Bacteria 1066
1439 Ga0495593_0000072 3300047673 Bacteria 43039
1440 Ga0495593_0000566 3300047673 Bacteria 21032
1441 Ga0495593_0002269 3300047673 Bacteria 11530
1442 Ga0495593_0015862 3300047673 Bacteria 4257
1443 Ga0495593_0185378 3300047673 Bacteria 1048
1444 Ga0495602_0001719 3300048088 Bacteria 21809
1445 Ga0495602_0004704 3300048088 Bacteria 14269
1446 Ga0495602_0024014 3300048088 Bacteria 5922
1447 Ga0495602_0087538 3300048088 Bacteria 2596
1448 Ga0495602_0430429 3300048088 Bacteria 935
1449 Ga0495602_0649444 3300048088 Bacteria 721
1450 Ga0495614_0036953 3300048089 Bacteria 2096
1451 Ga0495615_0014600 3300048090 Bacteria 1664
1452 Ga0496100_0005319 3300048903 Bacteria 6918
1453 Ga0496100_0153339 3300048903 Bacteria 1646
1454 Ga0496100_0226189 3300048903 Bacteria 1375
1455 Ga0496100_0274498 3300048903 Bacteria 1255
1456 Ga0496101_0001907 3300048904 Bacteria 12604
1457 Ga0496101_0057214 3300048904 Bacteria 2819
1458 Ga0496101_0094499 3300048904 Bacteria 2228
1459 Ga0496101_0292434 3300048904 Bacteria 1275
1460 Ga0496101_0315057 3300048904 Bacteria 1227
1461 Ga0496101_0329958 3300048904 Bacteria 1197
1462 Ga0496101_0378703 3300048904 Bacteria 1113
1463 Ga0496101_0430554 3300048904 Bacteria 1040
1464 Ga0496102_0010809 3300048905 Bacteria 7862
1465 Ga0496102_0017860 3300048905 Bacteria 6220
1466 Ga0496102_0019492 3300048905 Bacteria 5974
1467 Ga0496102_0324782 3300048905 Bacteria 1449
1468 Ga0496102_0611337 3300048905 Bacteria 1013
1469 Ga0496103_0001565 3300048906 Bacteria 15132
1470 Ga0496103_0047327 3300048906 Bacteria 2657
1471 Ga0496103_0080656 3300048906 Bacteria 2046
1472 Ga0496103_0112794 3300048906 Bacteria 1728
1473 Ga0496103_0237458 3300048906 Bacteria 1172
1474 Ga0496104_0002128 3300048907 Bacteria 17188
1475 Ga0496104_0049007 3300048907 Bacteria 3983
1476 Ga0496104_0083814 3300048907 Bacteria 3041
1477 Ga0496104_0106223 3300048907 Bacteria 2690
1478 Ga0496104_0178751 3300048907 Bacteria 2032
1479 Ga0496104_0264469 3300048907 Bacteria 1632
1480 Ga0496105_0022082 3300048908 Bacteria 5153
1481 Ga0496105_0219624 3300048908 Bacteria 1547
1482 Ga0496105_0321217 3300048908 Bacteria 1241
1483 Ga0496106_0019749 3300048909 Bacteria 4997
1484 Ga0496106_0020041 3300048909 Bacteria 4960
1485 Ga0496106_0217121 3300048909 Bacteria 1524
1486 Ga0496106_0251050 3300048909 Bacteria 1414
1487 Ga0496106_0452910 3300048909 Bacteria 1031
1488 Ga0496106_0507082 3300048909 Bacteria 969
1489 Ga0496107_0001840 3300048910 Bacteria 13399
1490 Ga0496107_0057813 3300048910 Bacteria 2803
1491 Ga0496107_0086918 3300048910 Bacteria 2282
1492 Ga0496107_0304359 3300048910 Bacteria 1186
1493 Ga0496107_0328796 3300048910 Bacteria 1137
1494 Ga0496107_0423238 3300048910 Bacteria 990
1495 Ga0496107_0551691 3300048910 Bacteria 853
1496 Ga0496108_0052175 3300048911 Bacteria 3426
1497 Ga0496108_0134651 3300048911 Bacteria 2125
1498 Ga0496108_0207421 3300048911 Bacteria 1701
1499 Ga0496108_0470939 3300048911 Bacteria 1097
1500 Ga0496109_0000150 3300048912 Bacteria 68777
1501 Ga0496109_0016079 3300048912 Bacteria 6538
1502 Ga0496109_0027717 3300048912 Bacteria 5061
1503 Ga0496109_0052091 3300048912 Bacteria 3730
1504 Ga0496109_0052472 3300048912 Bacteria 3716
1505 Ga0496109_0056795 3300048912 Bacteria 3571
1506 Ga0496109_0521510 3300048912 Bacteria 1121
1507 Ga0496110_0028124 3300048913 Bacteria 4825
1508 Ga0496110_0053806 3300048913 Bacteria 3540
1509 Ga0496110_0123850 3300048913 Bacteria 2331
1510 Ga0496110_0640976 3300048913 Bacteria 962
1511 Ga0496111_0016595 3300048914 Bacteria 5078
1512 Ga0496111_0024135 3300048914 Bacteria 4278
1513 Ga0496111_0143132 3300048914 Bacteria 1772
1514 Ga0496111_0149377 3300048914 Bacteria 1733
1515 Ga0496111_0163513 3300048914 Bacteria 1653
1516 Ga0496111_0181744 3300048914 Bacteria 1563
1517 Ga0496111_0290760 3300048914 Bacteria 1212
1518 Ga0496111_0401403 3300048914 Bacteria 1013
1519 Ga0496112_0000004 3300048915 Bacteria 553294
1520 Ga0496112_0017832 3300048915 Bacteria 6681
1521 Ga0496112_0019008 3300048915 Bacteria 6477
1522 Ga0496112_0020263 3300048915 Bacteria 6300
1523 Ga0496112_0044369 3300048915 Bacteria 4355
1524 Ga0496112_0079630 3300048915 Bacteria 3241
1525 Ga0496112_0213500 3300048915 Bacteria 1886
1526 Ga0496112_0256251 3300048915 Bacteria 1700
1527 Ga0496112_0259874 3300048915 Bacteria 1686
1528 Ga0496112_0294237 3300048915 Bacteria 1569
1529 Ga0496112_0748508 3300048915 Bacteria 903
1530 Ga0496113_0035814 3300048916 Bacteria 3632
1531 Ga0496113_0054096 3300048916 Bacteria 3004
1532 Ga0496113_0148147 3300048916 Bacteria 1850
1533 Ga0496113_0259726 3300048916 Bacteria 1387
1534 Ga0496114_0008932 3300048917 Bacteria 7944
1535 Ga0496114_0025141 3300048917 Bacteria 4865
1536 Ga0496114_0028221 3300048917 Bacteria 4604
1537 Ga0496114_0029850 3300048917 Bacteria 4483
1538 Ga0496114_0650014 3300048917 Bacteria 927
1539 Ga0496114_0859466 3300048917 Bacteria 787
1540 Ga0496115_0001528 3300048918 Bacteria 16623
1541 Ga0496115_0014005 3300048918 Bacteria 6071
1542 Ga0496115_0024954 3300048918 Bacteria 4651
1543 Ga0496115_0394046 3300048918 Bacteria 1124
1544 Ga0496115_0521791 3300048918 Bacteria 952
1545 Ga0496117_0148086 3300048920 Bacteria 1394
1546 Ga0496118_0056637 3300048921 Bacteria 2945
1547 Ga0496118_0271058 3300048921 Bacteria 951
1548 Ga0496119_0051978 3300048922 Bacteria 2513
1549 Ga0496120_0009415 3300048923 Bacteria 6938
1550 Ga0496120_0104879 3300048923 Bacteria 1487
1551 Ga0496121_0109905 3300048924 Bacteria 2105
1552 Ga0496121_0141220 3300048924 Bacteria 1786
1553 Ga0496121_0170687 3300048924 Bacteria 1580
1554 Ga0496121_0188737 3300048924 Bacteria 1480
1555 Ga0496121_0212880 3300048924 Bacteria 1368
1556 Ga0496124_0016688 3300048927 Bacteria 6967
1557 Ga0496124_0453357 3300048927 Bacteria 874
1558 Ga0496125_0150162 3300048928 Bacteria 1602
1559 Ga0496125_0160175 3300048928 Bacteria 1530
1560 Ga0496125_0350792 3300048928 Bacteria 881
1561 Ga0496126_0057994 3300048929 Bacteria 3492
1562 Ga0496126_0180399 3300048929 Bacteria 1794
1563 Ga0496126_0199725 3300048929 Bacteria 1689
1564 Ga0496126_0367099 3300048929 Bacteria 1174
1565 Ga0495682_0064921 3300049460 Bacteria 1316
1566 Ga0501031_0043171 3300049568 Bacteria 2943
1567 Ga0501032_0051419 3300049569 Bacteria 2778
1568 Ga0501032_0340751 3300049569 Bacteria 966
1569 Ga0501033_0149871 3300049570 Bacteria 1683
1570 Ga0501033_0179414 3300049570 Bacteria 1518
1571 Ga0501034_0000516 3300049571 Bacteria 62005
1572 Ga0501034_0001552 3300049571 Bacteria 30135
1573 Ga0501034_0003894 3300049571 Bacteria 16794
1574 Ga0501034_0050571 3300049571 Bacteria 4191
1575 Ga0501034_0078997 3300049571 Bacteria 3293
1576 Ga0501034_0586588 3300049571 Bacteria 1021
1577 Ga0501036_0001269 3300049572 Bacteria 19346
1578 Ga0501036_0020963 3300049572 Bacteria 5489
1579 Ga0501036_0043623 3300049572 Bacteria 3798
1580 Ga0501036_0047889 3300049572 Bacteria 3619
1581 Ga0501037_0003480 3300049573 Bacteria 11423
1582 Ga0501037_0045797 3300049573 Bacteria 3209
1583 Ga0501037_0093001 3300049573 Bacteria 2180
1584 Ga0501037_0346723 3300049573 Bacteria 1025
1585 Ga0501038_0028938 3300049574 Bacteria 4915
1586 Ga0501038_0041063 3300049574 Bacteria 4035
1587 Ga0501038_0073051 3300049574 Bacteria 2905
1588 Ga0501039_0021697 3300049575 Bacteria 4927
1589 Ga0501039_0094523 3300049575 Bacteria 2330
1590 Ga0501039_0562619 3300049575 Bacteria 894
1591 Ga0501040_0007018 3300049576 Bacteria 7299
1592 Ga0501041_0016019 3300049577 Bacteria 4455
1593 Ga0501041_0116157 3300049577 Bacteria 1661
1594 Ga0501042_0148565 3300049578 Bacteria 1690
1595 Ga0501043_0000487 3300049579 Bacteria 35542
1596 Ga0501043_0029788 3300049579 Bacteria 4288
1597 Ga0501043_0030237 3300049579 Bacteria 4255
1598 Ga0501046_0087631 3300049580 Bacteria 2398
1599 Ga0501046_0205932 3300049580 Bacteria 1462
1600 Ga0501046_0259680 3300049580 Bacteria 1276
1601 Ga0501046_0281340 3300049580 Bacteria 1218
1602 Ga0501047_0000100 3300049581 Bacteria 105717
1603 Ga0501047_0028382 3300049581 Bacteria 5394
1604 Ga0501047_0083315 3300049581 Bacteria 3073
1605 Ga0501047_0085392 3300049581 Bacteria 3032
1606 Ga0501047_0212292 3300049581 Bacteria 1793
1607 Ga0501047_0304858 3300049581 Bacteria 1434
1608 Ga0501048_0000473 3300049582 Bacteria 28132
1609 Ga0501048_0033115 3300049582 Bacteria 3735
1610 Ga0501048_0035259 3300049582 Bacteria 3602
1611 Ga0501048_0181363 3300049582 Bacteria 1492
1612 Ga0501067_0115028 3300049583 Bacteria 1496
1613 Ga0501067_0178284 3300049583 Bacteria 1183
1614 Ga0501068_0010393 3300049584 Bacteria 5228
1615 Ga0501068_0011379 3300049584 Bacteria 5023
1616 Ga0501068_0252815 3300049584 Bacteria 1123
1617 Ga0501069_0066639 3300049585 Bacteria 2013
1618 Ga0501069_0207053 3300049585 Bacteria 1138
1619 Ga0501069_0287193 3300049585 Bacteria 963
1620 Ga0501070_0011913 3300049586 Bacteria 7345
1621 Ga0501070_0025193 3300049586 Bacteria 4988
1622 Ga0501070_0029112 3300049586 Bacteria 4632
1623 Ga0501070_0075293 3300049586 Bacteria 2794
1624 Ga0501070_0076780 3300049586 Bacteria 2765
1625 Ga0501070_0542075 3300049586 Bacteria 932
1626 Ga0501071_0011457 3300049587 Bacteria 5975
1627 Ga0501071_0166155 3300049587 Bacteria 1651
1628 Ga0501072_0011074 3300049588 Bacteria 6882
1629 Ga0501072_0085609 3300049588 Bacteria 2500
1630 Ga0501073_0132390 3300049589 Bacteria 1728
1631 Ga0501073_0220771 3300049589 Bacteria 1309
1632 Ga0501073_0330382 3300049589 Bacteria 1052
1633 Ga0501074_0022003 3300049590 Bacteria 4631
1634 Ga0501074_0039132 3300049590 Bacteria 3434
1635 Ga0501074_0093316 3300049590 Bacteria 2155
1636 Ga0501074_0184153 3300049590 Bacteria 1489
1637 Ga0501075_0173499 3300049591 Bacteria 1645
1638 Ga0501075_0177078 3300049591 Bacteria 1627
1639 Ga0501075_0215794 3300049591 Bacteria 1463
1640 Ga0501075_0397268 3300049591 Bacteria 1051
1641 Ga0501076_0005575 3300049592 Bacteria 9066
1642 Ga0501076_0082122 3300049592 Bacteria 2587
1643 Ga0501076_0159112 3300049592 Bacteria 1839
1644 Ga0501077_0046434 3300049593 Bacteria 2759
1645 Ga0501079_0063486 3300049741 Bacteria 2849
1646 Ga0501079_0075956 3300049741 Bacteria 2598
1647 Ga0501079_0143903 3300049741 Bacteria 1857
1648 Ga0501079_0173111 3300049741 Bacteria 1683
1649 Ga0501080_0000030 3300049742 Bacteria 87736
1650 Ga0501080_0015129 3300049742 Bacteria 7109
1651 Ga0501080_0092344 3300049742 Bacteria 2811
1652 Ga0501080_0163888 3300049742 Bacteria 2052
1653 Ga0501080_0164174 3300049742 Bacteria 2050
1654 Ga0501080_0476801 3300049742 Bacteria 1117
1655 Ga0501083_0010799 3300049744 Bacteria 6423
1656 Ga0501083_0053257 3300049744 Bacteria 2717
1657 Ga0501083_0097668 3300049744 Bacteria 1938
1658 Ga0501083_0168596 3300049744 Bacteria 1431
1659 Ga0501035_0031108 3300049822 Bacteria 4861
1660 Ga0501035_0091654 3300049822 Bacteria 2674
1661 Ga0501035_0233349 3300049822 Bacteria 1567
1662 Ga0501035_0299506 3300049822 Bacteria 1355
1663 Ga0501044_0004101 3300049823 Bacteria 16333
1664 Ga0501044_0068340 3300049823 Bacteria 3619
1665 Ga0501044_0103293 3300049823 Bacteria 2865
1666 Ga0501044_0127841 3300049823 Bacteria 2537
1667 Ga0501045_0005395 3300049824 Bacteria 8854
1668 Ga0501045_0285430 3300049824 Bacteria 1229
1669 Ga0501045_0290739 3300049824 Bacteria 1216
1670 nmdc:mga03683_2720_c1 3300050489 Bacteria 5547
1671 nmdc:mga03683_8320_c1 3300050489 Bacteria 3642
1672 nmdc:mga03683_86334_c1 3300050489 Bacteria 1362
1673 nmdc:mga03683_96266_c1 3300050489 Bacteria 1296
1674 nmdc:mga03n38_137830_c1 3300050490 Bacteria 1216
1675 nmdc:mga03n38_156905_c1 3300050490 Bacteria 1149
1676 nmdc:mga03n38_28451_c1 3300050490 Bacteria 2330
1677 nmdc:mga03n38_97492_c1 3300050490 Bacteria 1412
1678 nmdc:mga00v17_307382_c1 3300050491 Bacteria 1030
1679 nmdc:mga00v17_346397_c1 3300050491 Bacteria 966
1680 nmdc:mga00v17_9842_c1 3300050491 Bacteria 5195
1681 nmdc:mga0yw44_227931_c1 3300050492 Bacteria 1236
1682 nmdc:mga0yw44_242352_c1 3300050492 Bacteria 1199
1683 nmdc:mga0yw44_39189_c1 3300050492 Bacteria 2808
1684 nmdc:mga0yw44_432270_c1 3300050492 Bacteria 892
1685 nmdc:mga0yw44_6189_c1 3300050492 Bacteria 5755
1686 nmdc:mga0yw44_86569_c1 3300050492 Bacteria 1974
1687 nmdc:mga0yw44_98283_c1 3300050492 Bacteria 1861
1688 nmdc:mga0k408_10484_c1 3300050493 Bacteria 5013
1689 nmdc:mga0k408_160651_c1 3300050493 Bacteria 1338
1690 nmdc:mga0k408_212834_c1 3300050493 Bacteria 1154
1691 nmdc:mga06z11_112858_c1 3300050494 Bacteria 1507
1692 nmdc:mga06z11_131565_c1 3300050494 Bacteria 1406
1693 nmdc:mga06z11_41063_c1 3300050494 Bacteria 2313
1694 nmdc:mga06z11_45012_c1 3300050494 Bacteria 2229
1695 nmdc:mga06z11_9486_c1 3300050494 Bacteria 4103
1696 nmdc:mga07m45_122738_c1 3300050496 Bacteria 1501
1697 nmdc:mga07m45_14653_c2 3300050496 Bacteria 3672
1698 nmdc:mga07m45_259827_c1 3300050496 Bacteria 1010
1699 nmdc:mga07m45_296730_c1 3300050496 Bacteria 940
1700 nmdc:mga07m45_355731_c1 3300050496 Bacteria 851
1701 nmdc:mga07m45_43458_c1 3300050496 Bacteria 2519
1702 nmdc:mga07m45_46368_c1 3300050496 Bacteria 2442
1703 nmdc:mga05p37_135935_c1 3300050507 Bacteria 3014
1704 nmdc:mga05p37_13694_c1 3300050507 Bacteria 9720
1705 nmdc:mga05p37_26731_c1 3300050507 Bacteria 7018
1706 nmdc:mga05p37_33096_c1 3300050507 Bacteria 6331
1707 nmdc:mga05p37_719155_c1 3300050507 Bacteria 1106
1708 nmdc:mga05p37_7310_c1 3300050507 Bacteria 13031
1709 nmdc:mga05p37_76550_c1 3300050507 Bacteria 4119
1710 nmdc:mga09592_22873_c1 3300050508 Bacteria 5157
1711 nmdc:mga09592_42022_c1 3300050508 Bacteria 3846
1712 nmdc:mga09592_59060_c1 3300050508 Bacteria 3243
1713 nmdc:mga0qj67_15559_c1 3300050509 Bacteria 5760
1714 nmdc:mga0qj67_21501_c1 3300050509 Bacteria 4950
1715 nmdc:mga0qj67_4674_c1 3300050509 Bacteria 9939
1716 nmdc:mga06r32_4896_c1 3300050510 Bacteria 12062
1717 nmdc:mga06r32_8384_c1 3300050510 Bacteria 9308
1718 nmdc:mga08y16_12186_c1 3300050511 Bacteria 9038
1719 nmdc:mga08y16_170800_c1 3300050511 Bacteria 2258
1720 nmdc:mga08y16_22091_c1 3300050511 Bacteria 6718
1721 nmdc:mga08y16_243008_c1 3300050511 Bacteria 1861
1722 nmdc:mga08y16_47150_c1 3300050511 Bacteria 4511
1723 nmdc:mga08y16_518_c1 3300050511 Bacteria 35625
1724 nmdc:mga08y16_549471_c1 3300050511 Bacteria 1169
1725 nmdc:mga08y16_6788_c1 3300050511 Bacteria 12011
1726 nmdc:mga0n895_1010768_c1 3300050512 Bacteria 812
1727 nmdc:mga0n895_102857_c1 3300050512 Bacteria 2868
1728 nmdc:mga0n895_121567_c1 3300050512 Bacteria 2632
1729 nmdc:mga0n895_180064_c1 3300050512 Bacteria 2145
1730 nmdc:mga0n895_2094_c1 3300050512 Bacteria 15379
1731 nmdc:mga0n895_22338_c1 3300050512 Bacteria 5932
1732 nmdc:mga0n895_24114_c1 3300050512 Bacteria 5729
1733 nmdc:mga0n895_255905_c1 3300050512 Bacteria 1777
1734 nmdc:mga0n895_27310_c1 3300050512 Bacteria 5421
1735 nmdc:mga0n895_338465_c1 3300050512 Bacteria 1524
1736 nmdc:mga0n895_43907_c1 3300050512 Bacteria 4359
1737 nmdc:mga0n895_460921_c1 3300050512 Bacteria 1283
1738 nmdc:mga0n895_513772_c1 3300050512 Bacteria 1206
1739 nmdc:mga0n895_77721_c1 3300050512 Bacteria 3302
1740 nmdc:mga0rr50_175981_c1 3300050513 Bacteria 1746
1741 nmdc:mga0rr50_260119_c1 3300050513 Bacteria 1444
1742 nmdc:mga0rr50_439470_c1 3300050513 Bacteria 1105
1743 nmdc:mga0rr50_540865_c1 3300050513 Bacteria 992
1744 nmdc:mga0rr50_55745_c1 3300050513 Bacteria 2950
1745 nmdc:mga0rr50_5686_c1 3300050513 Bacteria 7468
1746 nmdc:mga0rr50_64444_c1 3300050513 Bacteria 2772
1747 nmdc:mga0rr50_74118_c1 3300050513 Bacteria 2604
1748 nmdc:mga08x19_102299_c1 3300050514 Bacteria 1902
1749 nmdc:mga08x19_16318_c1 3300050514 Bacteria 4528
1750 nmdc:mga0a205_10809_c1 3300050515 Bacteria 8399
1751 nmdc:mga0a205_13485_c1 3300050515 Bacteria 7610
1752 nmdc:mga0a205_14827_c1 3300050515 Bacteria 7273
1753 nmdc:mga0a205_156394_c1 3300050515 Bacteria 2178
1754 nmdc:mga0a205_218030_c1 3300050515 Bacteria 1795
1755 nmdc:mga0a205_278891_c1 3300050515 Bacteria 1547
1756 nmdc:mga0a205_32169_c1 3300050515 Bacteria 5030
1757 nmdc:mga0a205_401749_c1 3300050515 Bacteria 1234
1758 nmdc:mga0a205_42582_c1 3300050515 Bacteria 4376
1759 nmdc:mga0a205_439879_c1 3300050515 Bacteria 1165
1760 nmdc:mga0a205_830_c1 3300050515 Bacteria 25159
1761 nmdc:mga0sz30_156896_c1 3300050516 Bacteria 1008
1762 nmdc:mga0sz30_16015_c1 3300050516 Bacteria 2970
1763 nmdc:mga0sz30_445_c1 3300050516 Bacteria 15645
1764 Ga0495601_0001195 3300053077 Bacteria 14210
1765 Ga0495601_0001471 3300053077 Bacteria 12982
1766 Ga0495601_0017967 3300053077 Bacteria 4299
1767 Ga0495601_0051327 3300053077 Bacteria 2603
1768 Ga0495601_0144129 3300053077 Bacteria 1554
1769 Ga0495601_0380192 3300053077 Bacteria 916
1770 Ga0495612_0000353 3300053078 Bacteria 18580
1771 Ga0495612_0008637 3300053078 Bacteria 4129
1772 Ga0495612_0009709 3300053078 Bacteria 3897
1773 Ga0495612_0012593 3300053078 Bacteria 3409
1774 Ga0495612_0191469 3300053078 Bacteria 900
1775 Ga0500610_0189819 3300053079 Bacteria 999
1776 Ga0500610_0207161 3300053079 Bacteria 940
1777 Ga0500635_0033796 3300053080 Bacteria 1671
1778 Ga0495595_0000480 3300053084 Bacteria 15215
1779 Ga0495595_0010420 3300053084 Bacteria 3863
1780 Ga0495595_0018087 3300053084 Bacteria 3041
1781 Ga0495595_0018501 3300053084 Bacteria 3011
1782 Ga0495595_0029627 3300053084 Bacteria 2451
1783 Ga0495595_0036616 3300053084 Bacteria 2228
1784 Ga0495595_0088199 3300053084 Bacteria 1485
1785 Ga0495619_0000289 3300053085 Bacteria 35778
1786 Ga0495619_0000332 3300053085 Bacteria 33066
1787 Ga0495619_0001043 3300053085 Bacteria 18161
1788 Ga0495619_0009100 3300053085 Bacteria 6268
1789 Ga0495619_0010184 3300053085 Bacteria 5922
1790 Ga0495619_0028628 3300053085 Bacteria 3595
1791 Ga0495619_0166402 3300053085 Bacteria 1524
1792 Ga0495619_0206487 3300053085 Bacteria 1360
1793 Ga0495619_0219870 3300053085 Bacteria 1316
1794 Ga0495619_0299895 3300053085 Bacteria 1113
1795 Ga0495619_0303757 3300053085 Bacteria 1105
1796 Ga0495619_0315886 3300053085 Bacteria 1082
1797 Ga0500643_000018 3300053087 Bacteria 296505
1798 Ga0500651_0314768 3300053093 Bacteria 895
1799 Ga0500566_0006255 3300053094 Bacteria 7073
1800 Ga0500641_0005072 3300053096 Bacteria 4667
1801 Ga0500641_0119136 3300053096 Bacteria 1137
1802 Ga0500556_0071241 3300053104 Bacteria 1298
1803 Ga0500557_000008 3300053105 Bacteria 127284
1804 Ga0500569_021584 3300053109 Bacteria 1704
1805 Ga0500595_000232 3300053119 Bacteria 37646
1806 Ga0500595_006829 3300053119 Bacteria 4804
1807 Ga0500595_031382 3300053119 Bacteria 1783
1808 Ga0500608_090211 3300053122 Bacteria 1434
1809 Ga0500642_0000067 3300053130 Bacteria 56324
1810 Ga0500642_0210912 3300053130 Bacteria 901
1811 Ga0500655_030900 3300053133 Bacteria 1032
1812 Ga0500559_0014503 3300053136 Bacteria 3330
1813 Ga0500568_0002596 3300053139 Bacteria 10496
1814 Ga0500568_0040908 3300053139 Bacteria 1864
1815 Ga0500568_0042033 3300053139 Bacteria 1833
1816 Ga0500577_0163473 3300053142 Bacteria 949
1817 Ga0500603_005284 3300053150 Bacteria 2772
1818 Ga0500603_048434 3300053150 Bacteria 1156
1819 Ga0500604_0095341 3300053151 Bacteria 976
1820 Ga0500604_0123838 3300053151 Bacteria 866
1821 Ga0500616_0002167 3300053153 Bacteria 16975
1822 Ga0500620_043958 3300053155 Bacteria 1476
1823 Ga0500622_0006295 3300053156 Bacteria 6929
1824 Ga0500638_005675 3300053162 Bacteria 5010
1825 Ga0500639_206626 3300053163 Bacteria 837
1826 Ga0500636_0000847 3300053177 Bacteria 16470
1827 Ga0500637_0000260 3300053178 Bacteria 19731
1828 Ga0500637_0000405 3300053178 Bacteria 16453
1829 Ga0500649_094163 3300053722 Bacteria 1196
1830 Ga0500625_012504 3300053729 Bacteria 3881
1831 Ga0500645_026262 3300053730 Bacteria 1771
1832 Ga0500645_031912 3300053730 Bacteria 1582
1833 Ga0500599_000323 3300053736 Bacteria 4694
1834 Ga0500601_000062 3300053737 Bacteria 22260
1835 Ga0501084_0002367 3300054114 Bacteria 15172
1836 Ga0501084_0197701 3300054114 Bacteria 1696
1837 Ga0501084_0214409 3300054114 Bacteria 1624
1838 Ga0500661_000357 3300055283 Bacteria 8385
1839 Ga0501082_0041592 3300060353 Bacteria 3962
1840 Ga0466962_0261961 3300061719 Bacteria 851
1841 Ga0530510_0002069 3300061734 Bacteria 13788
1842 Ga0530510_0291292 3300061734 Bacteria 1220

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_719155_c1 nmdc:mga05p37_719155_c1_168_782 204
2 3300048088 Ga0495602_0649444 Ga0495602_0649444_16_633 205
3 3300050513 nmdc:mga0rr50_439470_c1 nmdc:mga0rr50_439470_c1_10_645 211
4 3300035120 Ga0373957_0139518 Ga0373957_0139518_321_977 218
5 3300050492 nmdc:mga0yw44_432270_c1 nmdc:mga0yw44_432270_c1_225_881 218
6 3300050513 nmdc:mga0rr50_74118_c1 nmdc:mga0rr50_74118_c1_20_676 218
7 3300013308 Ga0157375_10299558 Ga0157375_102995582 227
8 3300047322 Ga0495680_0046879 Ga0495680_0046879_1147_1830 227
9 3300005546 Ga0070696_100220734 Ga0070696_1002207341 228
10 3300035692 Ga0373935_0286870 Ga0373935_0286870_13_699 228
11 iso_pu_bacteria 2507262055 2507510892 230
12 iso_pu_bacteria 2508501009 2508544705 230
13 iso_pu_bacteria 2508501042 2508697067 230
14 iso_pu_bacteria 2511231028 2511394421 230
15 iso_pu_bacteria 2513237092 2513629156 230
16 iso_pu_bacteria 2513237094 2513637597 230
17 iso_pu_bacteria 2513237095 2513649553 230
18 iso_pu_bacteria 2513237096 2513654906 230
19 iso_pu_bacteria 2513237101 2513697329 230
20 iso_pu_bacteria 2513237102 2513700057 230
21 iso_pu_bacteria 2513237104 2513719256 230
22 iso_pu_bacteria 2513237137 2513861296 230
23 iso_pu_bacteria 2513237139 2513874543 230
24 iso_pu_bacteria 2513237145 2513916071 230
25 iso_pu_bacteria 2513237161 2514015555 230
26 iso_pu_bacteria 2515154112 2515625564 230
27 iso_pu_bacteria 2517093001 2517100471 230
28 iso_pu_bacteria 2517572143 2517894626 230
29 iso_pu_bacteria 2524023205 2524437332 230
30 iso_pu_bacteria 2528768022 2528853218 230
31 iso_pu_bacteria 2617270735 2617350649 230
32 iso_pu_bacteria 2617270741 2617377940 230
33 iso_pu_bacteria 2721755755 2723843177 230
34 iso_pu_bacteria 2728368998 2728747713 230
35 iso_pu_bacteria 2744054633 2745076807 230
36 iso_pu_bacteria 2791355196 2793065175 230
37 iso_pu_bacteria 2791355199 2793083114 230
38 iso_pu_bacteria 2802429603 2805916538 230
39 iso_pu_bacteria 2816332527 2818238023 230
40 iso_pu_bacteria 2824600985 2824606125 230
41 iso_pu_bacteria 2824609381 2824616047 230
42 iso_pu_bacteria 2824617872 2824618973 230
43 iso_pu_bacteria 2824626560 2824627507 230
44 iso_pu_bacteria 2824635225 2824638832 230
45 iso_pu_bacteria 2824644064 2824649011 230
46 iso_pu_bacteria 2824653114 2824657345 230
47 iso_pu_bacteria 2824661429 2824663086 230
48 iso_pu_bacteria 2824671348 2824676953 230
49 iso_pu_bacteria 2824679649 2824682052 230
50 iso_pu_bacteria 2824687955 2824693642 230
51 iso_pu_bacteria 2824696289 2824698723 230
52 iso_pu_bacteria 2824704595 2824706497 230
53 iso_pu_bacteria 2824714736 2824716477 230
54 iso_pu_bacteria 2824723954 2824726423 230
55 iso_pu_bacteria 2824732956 2824737952 230
56 iso_pu_bacteria 2824746037 2824753004 230
57 iso_pu_bacteria 2824753945 2824756955 230
58 iso_pu_bacteria 2824763712 2824769751 230
59 iso_pu_bacteria 2838122688 2838127781 230
60 iso_pu_bacteria 2841941048 2841943074 230
61 iso_pu_bacteria 2841949485 2841956095 230
62 iso_pu_bacteria 2841957949 2841960333 230
63 iso_pu_bacteria 2841966195 2841968284 230
64 iso_pu_bacteria 2841974524 2841976502 230
65 iso_pu_bacteria 2841983080 2841987878 230
66 iso_pu_bacteria 2842038055 2842042823 230
67 iso_pu_bacteria 2842045827 2842050864 230
68 iso_pu_bacteria 2844315083 2844317039 230
69 iso_pu_bacteria 2847930680 2847938455 230
70 iso_pu_bacteria 2847939898 2847944347 230
71 iso_pu_bacteria 2849076700 2849081410 230
72 iso_pu_bacteria 2857509624 2857512072 230
73 iso_pu_bacteria 2874590934 2874597617 230
74 iso_pu_bacteria 2874604998 2874612487 230
75 iso_pu_bacteria 2874612657 2874618412 230
76 iso_pu_bacteria 2874620515 2874623542 230
77 iso_pu_bacteria 2874628541 2874630521 230
78 iso_pu_bacteria 2874645413 2874649181 230
79 iso_pu_bacteria 2876761206 2876767783 230
80 iso_pu_bacteria 2876771140 2876774910 230
81 iso_pu_bacteria 2876808645 2876810636 230
82 iso_pu_bacteria 2876818435 2876822338 230
83 iso_pu_bacteria 2879074833 2879077998 230
84 iso_pu_bacteria 2879083081 2879088694 230
85 iso_pu_bacteria 2879099564 2879103945 230
86 iso_pu_bacteria 2879110137 2879117931 230
87 iso_pu_bacteria 2879127579 2879132451 230
88 iso_pu_bacteria 2879142872 2879145250 230
89 iso_pu_bacteria 2881364244 2881370569 230
90 iso_pu_bacteria 2881665667 2881667334 230
91 iso_pu_bacteria 2885366525 2885367041 230
92 iso_pu_bacteria 2885409591 2885416537 230
93 iso_pu_bacteria 2888378607 2888381660 230
94 iso_pu_bacteria 2888388044 2888388973 230
95 iso_pu_bacteria 2888419890 2888422050 230
96 iso_pu_bacteria 2889033259 2889033516 230
97 iso_pu_bacteria 2903727486 2903735005 230
98 iso_pu_bacteria 2904666416 2904667654 230
99 iso_pu_bacteria 2904690495 2904697036 230
100 iso_pu_bacteria 2904711408 2904719081 230
101 iso_pu_bacteria 2906602504 2906604122 230
102 iso_pu_bacteria 2906626472 2906633019 230
103 iso_pu_bacteria 2906635258 2906643464 230
104 iso_pu_bacteria 2906643746 2906648246 230
105 iso_pu_bacteria 2906660503 2906661312 230
106 iso_pu_bacteria 2908739725 2908744942 230
107 iso_pu_bacteria 2908756301 2908762695 230
108 iso_pu_bacteria 2908775508 2908782010 230
109 iso_pu_bacteria 2922361189 2922362693 230
110 iso_pu_bacteria 2922368715 2922371330 230
111 iso_pu_bacteria 2922386360 2922390322 230
112 iso_pu_bacteria 2922393267 2922393766 230
113 iso_pu_bacteria 2929615660 2929619708 230
114 iso_pu_bacteria 2929624759 2929627821 230
115 iso_pu_bacteria 2932784394 2932786040 230
116 iso_pu_bacteria 2932809354 2932817012 230
117 iso_pu_bacteria 2932818245 2932822497 230
118 iso_pu_bacteria 2932828146 2932831084 230
119 iso_pu_bacteria 2933577622 2933581627 230
120 iso_pu_bacteria 2935608549 2935612890 230
121 iso_pu_bacteria 2935616580 2935624129 230
122 iso_pu_bacteria 2935638405 2935640225 230
123 iso_pu_bacteria 2935648319 2935655015 230
124 iso_pu_bacteria 2935656913 2935663895 230
125 iso_pu_bacteria 2935665750 2935666937 230
126 iso_pu_bacteria 2935675223 2935680424 230
127 iso_pu_bacteria 2935684952 2935690068 230
128 iso_pu_bacteria 2935694250 2935699850 230
129 iso_pu_bacteria 2935703347 2935704692 230
130 iso_pu_bacteria 2935713505 2935722220 230
131 iso_pu_bacteria 2935722832 2935731529 230
132 iso_pu_bacteria 2935732158 2935735383 230
133 iso_pu_bacteria 2935741537 2935745346 230
134 iso_pu_bacteria 2935750917 2935755079 230
135 iso_pu_bacteria 2935760218 2935762407 230
136 iso_pu_bacteria 2935769743 2935775442 230
137 iso_pu_bacteria 2935777560 2935780344 230
138 iso_pu_bacteria 2935785616 2935790691 230
139 iso_pu_bacteria 2935793552 2935799126 230
140 iso_pu_bacteria 2935801545 2935803905 230
141 iso_pu_bacteria 2935810662 2935811823 230
142 iso_pu_bacteria 2935819856 2935824378 230
143 iso_pu_bacteria 2935827899 2935829708 230
144 iso_pu_bacteria 2935837841 2935842960 230
145 iso_pu_bacteria 2935847175 2935852477 230
146 iso_pu_bacteria 2935855204 2935862371 230
147 iso_pu_bacteria 2935864058 2935870506 230
148 iso_pu_bacteria 2935873716 2935881088 230
149 iso_pu_bacteria 2935908558 2935912368 230
150 iso_pu_bacteria 2935916978 2935923958 230
151 iso_pu_bacteria 2935926038 2935929397 230
152 iso_pu_bacteria 2935934488 2935936028 230
153 iso_pu_bacteria 2935942939 2935949928 230
154 iso_pu_bacteria 2935951376 2935957306 230
155 iso_pu_bacteria 2935959822 2935962175 230
156 iso_pu_bacteria 2935967501 2935968337 230
157 iso_pu_bacteria 2935975950 2935976523 230
158 iso_pu_bacteria 2935984226 2935988031 230
159 iso_pu_bacteria 2935992306 2935993585 230
160 iso_pu_bacteria 2936002035 2936004481 230
161 iso_pu_bacteria 2936011229 2936018036 230
162 iso_pu_bacteria 2936019824 2936026554 230
163 iso_pu_bacteria 2936028420 2936035297 230
164 iso_pu_bacteria 2936037263 2936038406 230
165 iso_pu_bacteria 2936046547 2936053431 230
166 iso_pu_bacteria 2936055302 2936059412 230
167 iso_pu_bacteria 2940556831 2940561641 230
168 iso_pu_bacteria 2941531003 2941533820 230
169 iso_pu_bacteria 2941538514 2941544184 230
170 iso_pu_bacteria 3005483717 3005485386 230
171 iso_pu_bacteria 3005506211 3005507242 230
172 iso_pu_bacteria 3005587118 3005594602 230
173 iso_pu_bacteria 3005594810 3005596681 230
174 iso_pu_bacteria 3005710791 3005712749 230
175 iso_pu_bacteria 8006926726 8006933140 230
176 iso_pu_bacteria 8006964411 8006971306 230
177 iso_pu_bacteria 8006984368 8006989256 230
178 iso_pu_bacteria 8006994254 8006997731 230
179 iso_pu_bacteria 8016511872 8016516297 230
180 iso_pu_bacteria 8016522445 8016523692 230
181 iso_pu_bacteria 8016539877 8016541474 230
182 iso_pu_bacteria 8016548790 8016551781 230
183 iso_pu_bacteria 8016557553 8016560168 230
184 iso_pu_bacteria 8016566248 8016566866 230
185 iso_pu_bacteria 8016575299 8016579598 230
186 iso_pu_bacteria 8016583857 8016589270 230
187 iso_pu_bacteria 8016595262 8016598085 230
188 iso_pu_bacteria 8016603502 8016604225 230
189 iso_pu_bacteria 8016613128 8016620808 230
190 iso_pu_bacteria 8016622563 8016629181 230
191 iso_pu_bacteria 8016630954 8016633707 230
192 iso_pu_bacteria 8017057580 8017060237 230
193 iso_pu_bacteria 8019530166 8019536904 230
194 iso_pu_bacteria 8019538911 8019542627 230
195 iso_pu_bacteria 8019576017 8019579759 230
196 iso_pu_bacteria 8019586578 8019587469 230
197 iso_pu_bacteria 8019597564 8019603873 230
198 iso_pu_bacteria 8019608314 8019614665 230
199 iso_pu_bacteria 8019629233 8019636906 230
200 iso_pu_bacteria 8019638758 8019642702 230
201 iso_pu_bacteria 8019648815 8019649883 230
202 iso_pu_bacteria 8019659431 8019664725 230
203 iso_pu_bacteria 8019668869 8019674311 230
204 iso_pu_bacteria 8055742211 8055749036 230
205 iso_pu_bacteria 8056673599 8056674772 230
206 iso_pu_bacteria 8056689827 8056695058 230
207 iso_pu_bacteria 2932794094 2932798193 231
208 iso_pu_bacteria 2932801729 2932803986 231
209 iso_pu_bacteria 2935883170 2935884208 231
210 iso_pu_bacteria 8056967851 8056969885 231
211 3300005330 Ga0070690_100151901 Ga0070690_1001519012 232
212 3300005340 Ga0070689_100223665 Ga0070689_1002236652 232
213 3300037853 Ga0436364_0680312 Ga0436364_0680312_612_1310 232
214 3300039447 Ga0436361_0927272 Ga0436361_0927272_2560_3258 232
215 3300005471 Ga0070698_100182392 Ga0070698_1001823922 233
216 3300009147 Ga0114129_10685163 Ga0114129_106851632 233
217 3300037471 Ga0395905_0176477 Ga0395905_0176477_58_759 233
218 3300045051 Ga0451576_0034448 Ga0451576_0034448_1735_2436 233
219 3300048915 Ga0496112_0256251 Ga0496112_0256251_942_1643 233
220 iso_pu_bacteria 2513237141 2513891331 233
221 iso_pu_bacteria 2524023228 2524534357 233
222 iso_pu_bacteria 2667528175 2671119053 233
223 iso_pu_bacteria 2791355197 2793072306 233
224 iso_pu_bacteria 2885374607 2885378084 233
225 iso_pu_bacteria 2903748898 2903754861 233
226 iso_pu_bacteria 2904699407 2904705653 233
227 iso_pu_bacteria 2906610324 2906611360 233
228 iso_pu_bacteria 2922425934 2922428014 233
229 iso_pu_bacteria 2935630451 2935632061 233
230 iso_pu_bacteria 2941507105 2941508009 233
231 iso_pu_bacteria 2941515067 2941515486 233
232 iso_pu_bacteria 2941523033 2941523939 233
233 iso_pu_bacteria 3005474847 3005477713 233
234 iso_pu_bacteria 8006933436 8006933500 233
235 iso_pu_bacteria 8006973647 8006983173 233
236 iso_pu_bacteria 8019555841 8019559416 233
237 3300001430 JGI24032J14994_101455 JGI24032J14994_1014551 234
238 3300001976 JGI24752J21851_1008532 JGI24752J21851_10085322 234
239 3300001989 JGI24739J22299_10002831 JGI24739J22299_100028314 234
240 3300001990 JGI24737J22298_10001577 JGI24737J22298_1000157710 234
241 3300002070 JGI24750J21931_1000865 JGI24750J21931_10008656 234
242 3300002073 JGI24745J21846_1002353 JGI24745J21846_10023532 234
243 3300002074 JGI24748J21848_1001206 JGI24748J21848_10012062 234
244 3300002076 JGI24749J21850_1011129 JGI24749J21850_10111292 234
245 3300002077 JGI24744J21845_10003221 JGI24744J21845_100032214 234
246 3300002126 JGI24035J26624_1003600 JGI24035J26624_10036002 234
247 3300002239 JGI24034J26672_10004016 JGI24034J26672_100040162 234
248 3300002244 JGI24742J22300_10001206 JGI24742J22300_100012066 234
249 3300002459 JGI24751J29686_10002679 JGI24751J29686_100026792 234
250 3300003203 JGI25406J46586_10000021 JGI25406J46586_1000002143 234
251 3300003215 JGI25153J46596_10001764 JGI25153J46596_1000176414 234
252 3300003215 JGI25153J46596_10002778 JGI25153J46596_100027783 234
253 3300003215 JGI25153J46596_10007736 JGI25153J46596_100077363 234
254 3300003215 JGI25153J46596_10008618 JGI25153J46596_100086185 234
255 3300003354 JGI25160J50197_1000533 JGI25160J50197_100053320 234
256 3300003354 JGI25160J50197_1027443 JGI25160J50197_10274431 234
257 3300003659 JGI25404J52841_10021647 JGI25404J52841_100216472 234
258 3300003752 Ga0055539_1012039 Ga0055539_10120392 234
259 3300003762 Ga0055542_1023720 Ga0055542_10237202 234
260 3300003794 Ga0055531_10010491 Ga0055531_100104915 234
261 3300003911 JGI25405J52794_10004566 JGI25405J52794_100045661 234
262 3300003911 JGI25405J52794_10060051 JGI25405J52794_100600511 234
263 3300005262 Ga0065165_1000437 Ga0065165_100043737 234
264 3300005262 Ga0065165_1001951 Ga0065165_100195119 234
265 3300005262 Ga0065165_1005934 Ga0065165_10059343 234
266 3300005290 Ga0065712_10102380 Ga0065712_101023803 234
267 3300005293 Ga0065715_10114787 Ga0065715_101147873 234
268 3300005293 Ga0065715_10261091 Ga0065715_102610912 234
269 3300005327 Ga0070658_10006285 Ga0070658_100062857 234
270 3300005327 Ga0070658_10218087 Ga0070658_102180871 234
271 3300005328 Ga0070676_10001629 Ga0070676_100016295 234
272 3300005328 Ga0070676_10026881 Ga0070676_100268813 234
273 3300005328 Ga0070676_10034437 Ga0070676_100344372 234
274 3300005329 Ga0070683_100007819 Ga0070683_1000078196 234
275 3300005329 Ga0070683_100014236 Ga0070683_1000142365 234
276 3300005329 Ga0070683_100020043 Ga0070683_1000200434 234
277 3300005329 Ga0070683_100486229 Ga0070683_1004862291 234
278 3300005330 Ga0070690_100022028 Ga0070690_1000220284 234
279 3300005330 Ga0070690_100033117 Ga0070690_1000331173 234
280 3300005330 Ga0070690_100390243 Ga0070690_1003902431 234
281 3300005331 Ga0070670_100112665 Ga0070670_1001126652 234
282 3300005333 Ga0070677_10000481 Ga0070677_1000048111 234
283 3300005334 Ga0068869_100000216 Ga0068869_10000021620 234
284 3300005334 Ga0068869_100087109 Ga0068869_1000871092 234
285 3300005335 Ga0070666_10005440 Ga0070666_100054406 234
286 3300005335 Ga0070666_10023836 Ga0070666_100238362 234
287 3300005335 Ga0070666_10287891 Ga0070666_102878911 234
288 3300005336 Ga0070680_100002486 Ga0070680_1000024864 234
289 3300005336 Ga0070680_100006251 Ga0070680_1000062518 234
290 3300005336 Ga0070680_100032424 Ga0070680_1000324244 234
291 3300005336 Ga0070680_100070553 Ga0070680_1000705532 234
292 3300005336 Ga0070680_100194678 Ga0070680_1001946782 234
293 3300005336 Ga0070680_100575707 Ga0070680_1005757071 234
294 3300005337 Ga0070682_100000853 Ga0070682_10000085311 234
295 3300005337 Ga0070682_100022761 Ga0070682_1000227612 234
296 3300005337 Ga0070682_100221253 Ga0070682_1002212532 234
297 3300005337 Ga0070682_100468508 Ga0070682_1004685081 234
298 3300005338 Ga0068868_100000474 Ga0068868_10000047415 234
299 3300005338 Ga0068868_100071341 Ga0068868_1000713413 234
300 3300005338 Ga0068868_100250174 Ga0068868_1002501742 234
301 3300005339 Ga0070660_100001322 Ga0070660_10000132211 234
302 3300005339 Ga0070660_100009076 Ga0070660_1000090763 234
303 3300005339 Ga0070660_100051630 Ga0070660_1000516303 234
304 3300005340 Ga0070689_100000240 Ga0070689_10000024013 234
305 3300005340 Ga0070689_100490729 Ga0070689_1004907292 234
306 3300005341 Ga0070691_10020949 Ga0070691_100209493 234
307 3300005341 Ga0070691_10189075 Ga0070691_101890751 234
308 3300005343 Ga0070687_100000302 Ga0070687_1000003025 234
309 3300005344 Ga0070661_100003117 Ga0070661_1000031175 234
310 3300005344 Ga0070661_100068426 Ga0070661_1000684263 234
311 3300005344 Ga0070661_100131740 Ga0070661_1001317402 234
312 3300005344 Ga0070661_100156278 Ga0070661_1001562782 234
313 3300005345 Ga0070692_10027705 Ga0070692_100277053 234
314 3300005347 Ga0070668_100003449 Ga0070668_1000034496 234
315 3300005347 Ga0070668_100076646 Ga0070668_1000766463 234
316 3300005347 Ga0070668_100103710 Ga0070668_1001037102 234
317 3300005347 Ga0070668_100272139 Ga0070668_1002721392 234
318 3300005353 Ga0070669_100009578 Ga0070669_1000095788 234
319 3300005353 Ga0070669_100302641 Ga0070669_1003026411 234
320 3300005354 Ga0070675_100001762 Ga0070675_10000176212 234
321 3300005354 Ga0070675_100125583 Ga0070675_1001255831 234
322 3300005354 Ga0070675_100208241 Ga0070675_1002082412 234
323 3300005354 Ga0070675_100651086 Ga0070675_1006510861 234
324 3300005354 Ga0070675_100750101 Ga0070675_1007501011 234
325 3300005355 Ga0070671_100002861 Ga0070671_1000028612 234
326 3300005355 Ga0070671_100117771 Ga0070671_1001177712 234
327 3300005355 Ga0070671_100499273 Ga0070671_1004992732 234
328 3300005355 Ga0070671_100519094 Ga0070671_1005190941 234
329 3300005356 Ga0070674_100002865 Ga0070674_1000028655 234
330 3300005356 Ga0070674_100625549 Ga0070674_1006255492 234
331 3300005364 Ga0070673_100001019 Ga0070673_1000010199 234
332 3300005364 Ga0070673_100034773 Ga0070673_1000347733 234
333 3300005364 Ga0070673_100227232 Ga0070673_1002272321 234
334 3300005364 Ga0070673_100318795 Ga0070673_1003187952 234
335 3300005365 Ga0070688_100010793 Ga0070688_1000107932 234
336 3300005365 Ga0070688_100022950 Ga0070688_1000229503 234
337 3300005366 Ga0070659_100005117 Ga0070659_1000051175 234
338 3300005366 Ga0070659_100131998 Ga0070659_1001319982 234
339 3300005366 Ga0070659_100342439 Ga0070659_1003424392 234
340 3300005366 Ga0070659_100393710 Ga0070659_1003937102 234
341 3300005367 Ga0070667_100001650 Ga0070667_10000165018 234
342 3300005367 Ga0070667_100053374 Ga0070667_1000533743 234
343 3300005367 Ga0070667_100068279 Ga0070667_1000682793 234
344 3300005367 Ga0070667_100547268 Ga0070667_1005472682 234
345 3300005406 Ga0070703_10002778 Ga0070703_100027785 234
346 3300005434 Ga0070709_10001960 Ga0070709_100019606 234
347 3300005434 Ga0070709_10002079 Ga0070709_100020794 234
348 3300005434 Ga0070709_10008334 Ga0070709_100083342 234
349 3300005434 Ga0070709_10017458 Ga0070709_100174583 234
350 3300005434 Ga0070709_10030167 Ga0070709_100301672 234
351 3300005434 Ga0070709_10166061 Ga0070709_101660612 234
352 3300005434 Ga0070709_10173191 Ga0070709_101731911 234
353 3300005434 Ga0070709_10461647 Ga0070709_104616471 234
354 3300005435 Ga0070714_100003380 Ga0070714_10000338015 234
355 3300005435 Ga0070714_100004982 Ga0070714_1000049822 234
356 3300005435 Ga0070714_100050541 Ga0070714_1000505414 234
357 3300005435 Ga0070714_100054993 Ga0070714_1000549934 234
358 3300005435 Ga0070714_100287789 Ga0070714_1002877892 234
359 3300005435 Ga0070714_100320733 Ga0070714_1003207332 234
360 3300005436 Ga0070713_100005503 Ga0070713_1000055037 234
361 3300005436 Ga0070713_100035581 Ga0070713_1000355813 234
362 3300005436 Ga0070713_100035837 Ga0070713_1000358373 234
363 3300005436 Ga0070713_100175737 Ga0070713_1001757372 234
364 3300005436 Ga0070713_100196071 Ga0070713_1001960712 234
365 3300005436 Ga0070713_100957551 Ga0070713_1009575511 234
366 3300005437 Ga0070710_10005443 Ga0070710_100054434 234
367 3300005438 Ga0070701_10000281 Ga0070701_1000028114 234
368 3300005439 Ga0070711_100003146 Ga0070711_10000314611 234
369 3300005439 Ga0070711_100022144 Ga0070711_1000221444 234
370 3300005439 Ga0070711_100039401 Ga0070711_1000394013 234
371 3300005439 Ga0070711_100046760 Ga0070711_1000467603 234
372 3300005439 Ga0070711_100454980 Ga0070711_1004549802 234
373 3300005440 Ga0070705_100001659 Ga0070705_1000016597 234
374 3300005440 Ga0070705_100025036 Ga0070705_1000250363 234
375 3300005441 Ga0070700_100001804 Ga0070700_1000018045 234
376 3300005441 Ga0070700_100041536 Ga0070700_1000415363 234
377 3300005441 Ga0070700_100216528 Ga0070700_1002165282 234
378 3300005441 Ga0070700_100498094 Ga0070700_1004980942 234
379 3300005444 Ga0070694_100000576 Ga0070694_10000057617 234
380 3300005444 Ga0070694_100267427 Ga0070694_1002674272 234
381 3300005444 Ga0070694_100326738 Ga0070694_1003267382 234
382 3300005445 Ga0070708_100006158 Ga0070708_1000061583 234
383 3300005445 Ga0070708_100021331 Ga0070708_1000213315 234
384 3300005445 Ga0070708_100028554 Ga0070708_1000285543 234
385 3300005445 Ga0070708_100070172 Ga0070708_1000701722 234
386 3300005445 Ga0070708_100085640 Ga0070708_1000856402 234
387 3300005445 Ga0070708_100510048 Ga0070708_1005100482 234
388 3300005455 Ga0070663_100003664 Ga0070663_1000036647 234
389 3300005455 Ga0070663_100070816 Ga0070663_1000708161 234
390 3300005455 Ga0070663_100080851 Ga0070663_1000808512 234
391 3300005455 Ga0070663_100434989 Ga0070663_1004349891 234
392 3300005455 Ga0070663_100651899 Ga0070663_1006518991 234
393 3300005456 Ga0070678_100006300 Ga0070678_1000063005 234
394 3300005456 Ga0070678_100456821 Ga0070678_1004568212 234
395 3300005456 Ga0070678_100659165 Ga0070678_1006591652 234
396 3300005457 Ga0070662_100194302 Ga0070662_1001943022 234
397 3300005458 Ga0070681_10010247 Ga0070681_100102476 234
398 3300005458 Ga0070681_10020913 Ga0070681_100209134 234
399 3300005458 Ga0070681_10150329 Ga0070681_101503293 234
400 3300005458 Ga0070681_10150518 Ga0070681_101505182 234
401 3300005458 Ga0070681_10167923 Ga0070681_101679233 234
402 3300005458 Ga0070681_10191007 Ga0070681_101910072 234
403 3300005459 Ga0068867_100002151 Ga0068867_10000215110 234
404 3300005459 Ga0068867_100064551 Ga0068867_1000645513 234
405 3300005459 Ga0068867_100198087 Ga0068867_1001980872 234
406 3300005466 Ga0070685_10049333 Ga0070685_100493333 234
407 3300005467 Ga0070706_100084513 Ga0070706_1000845133 234
408 3300005467 Ga0070706_100107179 Ga0070706_1001071793 234
409 3300005467 Ga0070706_100238540 Ga0070706_1002385402 234
410 3300005467 Ga0070706_100261696 Ga0070706_1002616962 234
411 3300005467 Ga0070706_100609066 Ga0070706_1006090661 234
412 3300005467 Ga0070706_100722283 Ga0070706_1007222831 234
413 3300005468 Ga0070707_100018938 Ga0070707_1000189384 234
414 3300005468 Ga0070707_100040622 Ga0070707_1000406223 234
415 3300005468 Ga0070707_100082900 Ga0070707_1000829003 234
416 3300005468 Ga0070707_100290348 Ga0070707_1002903481 234
417 3300005468 Ga0070707_100415591 Ga0070707_1004155912 234
418 3300005471 Ga0070698_100001171 Ga0070698_10000117119 234
419 3300005471 Ga0070698_100005791 Ga0070698_10000579110 234
420 3300005471 Ga0070698_100170211 Ga0070698_1001702113 234
421 3300005471 Ga0070698_100189075 Ga0070698_1001890752 234
422 3300005471 Ga0070698_100340811 Ga0070698_1003408112 234
423 3300005471 Ga0070698_100420205 Ga0070698_1004202052 234
424 3300005471 Ga0070698_100690413 Ga0070698_1006904131 234
425 3300005471 Ga0070698_100699625 Ga0070698_1006996251 234
426 3300005518 Ga0070699_100006362 Ga0070699_1000063622 234
427 3300005518 Ga0070699_100006895 Ga0070699_1000068954 234
428 3300005518 Ga0070699_100022064 Ga0070699_1000220645 234
429 3300005518 Ga0070699_100162407 Ga0070699_1001624073 234
430 3300005518 Ga0070699_100299951 Ga0070699_1002999512 234
431 3300005530 Ga0070679_100003426 Ga0070679_1000034267 234
432 3300005530 Ga0070679_100005687 Ga0070679_1000056879 234
433 3300005530 Ga0070679_100027474 Ga0070679_1000274745 234
434 3300005530 Ga0070679_100215944 Ga0070679_1002159442 234
435 3300005530 Ga0070679_100239003 Ga0070679_1002390032 234
436 3300005530 Ga0070679_100326452 Ga0070679_1003264522 234
437 3300005530 Ga0070679_100358734 Ga0070679_1003587341 234
438 3300005530 Ga0070679_100379825 Ga0070679_1003798252 234
439 3300005535 Ga0070684_100011854 Ga0070684_1000118545 234
440 3300005535 Ga0070684_100012047 Ga0070684_1000120472 234
441 3300005535 Ga0070684_100033680 Ga0070684_1000336803 234
442 3300005535 Ga0070684_100086741 Ga0070684_1000867413 234
443 3300005536 Ga0070697_100019057 Ga0070697_1000190573 234
444 3300005536 Ga0070697_100023652 Ga0070697_1000236525 234
445 3300005536 Ga0070697_100191407 Ga0070697_1001914072 234
446 3300005536 Ga0070697_100302720 Ga0070697_1003027202 234
447 3300005536 Ga0070697_100444829 Ga0070697_1004448292 234
448 3300005539 Ga0068853_100004149 Ga0068853_1000041497 234
449 3300005539 Ga0068853_100007962 Ga0068853_1000079626 234
450 3300005539 Ga0068853_100084860 Ga0068853_1000848603 234
451 3300005539 Ga0068853_100266376 Ga0068853_1002663761 234
452 3300005539 Ga0068853_100498279 Ga0068853_1004982792 234
453 3300005539 Ga0068853_100518389 Ga0068853_1005183892 234
454 3300005539 Ga0068853_100602340 Ga0068853_1006023402 234
455 3300005539 Ga0068853_100731975 Ga0068853_1007319752 234
456 3300005543 Ga0070672_100004101 Ga0070672_1000041018 234
457 3300005543 Ga0070672_100083906 Ga0070672_1000839063 234
458 3300005543 Ga0070672_100190388 Ga0070672_1001903882 234
459 3300005543 Ga0070672_100342323 Ga0070672_1003423232 234
460 3300005543 Ga0070672_100439458 Ga0070672_1004394582 234
461 3300005544 Ga0070686_100002850 Ga0070686_1000028505 234
462 3300005544 Ga0070686_100371033 Ga0070686_1003710331 234
463 3300005545 Ga0070695_100009940 Ga0070695_1000099405 234
464 3300005546 Ga0070696_100006975 Ga0070696_1000069753 234
465 3300005546 Ga0070696_100284480 Ga0070696_1002844802 234
466 3300005547 Ga0070693_100002142 Ga0070693_1000021427 234
467 3300005547 Ga0070693_100043501 Ga0070693_1000435011 234
468 3300005547 Ga0070693_100091281 Ga0070693_1000912811 234
469 3300005548 Ga0070665_100003622 Ga0070665_1000036228 234
470 3300005548 Ga0070665_100051658 Ga0070665_1000516586 234
471 3300005548 Ga0070665_100146230 Ga0070665_1001462302 234
472 3300005548 Ga0070665_100162015 Ga0070665_1001620152 234
473 3300005548 Ga0070665_100167853 Ga0070665_1001678532 234
474 3300005548 Ga0070665_100359247 Ga0070665_1003592472 234
475 3300005548 Ga0070665_100492077 Ga0070665_1004920772 234
476 3300005548 Ga0070665_100909538 Ga0070665_1009095381 234
477 3300005549 Ga0070704_100000444 Ga0070704_1000004445 234
478 3300005549 Ga0070704_100077242 Ga0070704_1000772423 234
479 3300005549 Ga0070704_100088629 Ga0070704_1000886292 234
480 3300005563 Ga0068855_100035351 Ga0068855_1000353513 234
481 3300005563 Ga0068855_100038019 Ga0068855_1000380192 234
482 3300005563 Ga0068855_100073196 Ga0068855_1000731962 234
483 3300005563 Ga0068855_100084816 Ga0068855_1000848163 234
484 3300005563 Ga0068855_100131307 Ga0068855_1001313072 234
485 3300005563 Ga0068855_100224204 Ga0068855_1002242043 234
486 3300005563 Ga0068855_100238994 Ga0068855_1002389941 234
487 3300005563 Ga0068855_100262674 Ga0068855_1002626742 234
488 3300005563 Ga0068855_100389982 Ga0068855_1003899822 234
489 3300005563 Ga0068855_100424422 Ga0068855_1004244222 234
490 3300005563 Ga0068855_100607661 Ga0068855_1006076612 234
491 3300005564 Ga0070664_100012305 Ga0070664_1000123055 234
492 3300005564 Ga0070664_100193984 Ga0070664_1001939842 234
493 3300005564 Ga0070664_100204358 Ga0070664_1002043582 234
494 3300005564 Ga0070664_100232809 Ga0070664_1002328093 234
495 3300005564 Ga0070664_100653392 Ga0070664_1006533922 234
496 3300005577 Ga0068857_100004239 Ga0068857_1000042397 234
497 3300005577 Ga0068857_100020977 Ga0068857_1000209775 234
498 3300005577 Ga0068857_100070627 Ga0068857_1000706272 234
499 3300005577 Ga0068857_100168502 Ga0068857_1001685022 234
500 3300005577 Ga0068857_100248392 Ga0068857_1002483922 234
501 3300005577 Ga0068857_100371190 Ga0068857_1003711902 234
502 3300005578 Ga0068854_100005104 Ga0068854_1000051045 234
503 3300005578 Ga0068854_100137220 Ga0068854_1001372202 234
504 3300005614 Ga0068856_100038973 Ga0068856_1000389734 234
505 3300005614 Ga0068856_100059548 Ga0068856_1000595483 234
506 3300005614 Ga0068856_100219306 Ga0068856_1002193062 234
507 3300005614 Ga0068856_100242268 Ga0068856_1002422682 234
508 3300005614 Ga0068856_100683695 Ga0068856_1006836952 234
509 3300005614 Ga0068856_100815379 Ga0068856_1008153791 234
510 3300005615 Ga0070702_100001491 Ga0070702_1000014915 234
511 3300005615 Ga0070702_100115063 Ga0070702_1001150631 234
512 3300005616 Ga0068852_100000932 Ga0068852_1000009322 234
513 3300005616 Ga0068852_100193681 Ga0068852_1001936812 234
514 3300005616 Ga0068852_100327950 Ga0068852_1003279502 234
515 3300005616 Ga0068852_100347483 Ga0068852_1003474832 234
516 3300005617 Ga0068859_100002825 Ga0068859_1000028252 234
517 3300005617 Ga0068859_100055931 Ga0068859_1000559312 234
518 3300005617 Ga0068859_100108703 Ga0068859_1001087031 234
519 3300005618 Ga0068864_100002030 Ga0068864_1000020307 234
520 3300005618 Ga0068864_100035218 Ga0068864_1000352183 234
521 3300005618 Ga0068864_100092544 Ga0068864_1000925442 234
522 3300005618 Ga0068864_100504424 Ga0068864_1005044242 234
523 3300005718 Ga0068866_10000638 Ga0068866_1000063812 234
524 3300005718 Ga0068866_10118537 Ga0068866_101185372 234
525 3300005718 Ga0068866_10249854 Ga0068866_102498542 234
526 3300005719 Ga0068861_100004452 Ga0068861_1000044527 234
527 3300005834 Ga0068851_10040747 Ga0068851_100407472 234
528 3300005834 Ga0068851_10099516 Ga0068851_100995162 234
529 3300005840 Ga0068870_10000048 Ga0068870_1000004811 234
530 3300005841 Ga0068863_100001975 Ga0068863_1000019755 234
531 3300005841 Ga0068863_100391832 Ga0068863_1003918322 234
532 3300005842 Ga0068858_100008206 Ga0068858_1000082066 234
533 3300005842 Ga0068858_100073450 Ga0068858_1000734503 234
534 3300005843 Ga0068860_100000933 Ga0068860_1000009333 234
535 3300005843 Ga0068860_100017528 Ga0068860_1000175283 234
536 3300005843 Ga0068860_100144851 Ga0068860_1001448512 234
537 3300005843 Ga0068860_100317585 Ga0068860_1003175852 234
538 3300005843 Ga0068860_100689963 Ga0068860_1006899632 234
539 3300005844 Ga0068862_100026562 Ga0068862_1000265622 234
540 3300005844 Ga0068862_100185846 Ga0068862_1001858462 234
541 3300005844 Ga0068862_100276122 Ga0068862_1002761222 234
542 3300005937 Ga0081455_10002021 Ga0081455_100020217 234
543 3300005937 Ga0081455_10004363 Ga0081455_100043632 234
544 3300005937 Ga0081455_10005161 Ga0081455_100051615 234
545 3300005937 Ga0081455_10005318 Ga0081455_100053185 234
546 3300005937 Ga0081455_10010563 Ga0081455_100105636 234
547 3300005937 Ga0081455_10011965 Ga0081455_100119656 234
548 3300005937 Ga0081455_10021579 Ga0081455_100215795 234
549 3300005937 Ga0081455_10033400 Ga0081455_100334003 234
550 3300005937 Ga0081455_10043525 Ga0081455_100435252 234
551 3300005937 Ga0081455_10068940 Ga0081455_100689403 234
552 3300005937 Ga0081455_10075291 Ga0081455_100752913 234
553 3300005981 Ga0081538_10069563 Ga0081538_100695632 234
554 3300005983 Ga0081540_1000280 Ga0081540_100028048 234
555 3300005983 Ga0081540_1002252 Ga0081540_10022525 234
556 3300005983 Ga0081540_1005512 Ga0081540_10055129 234
557 3300005983 Ga0081540_1011141 Ga0081540_10111411 234
558 3300005983 Ga0081540_1011980 Ga0081540_10119804 234
559 3300005983 Ga0081540_1036034 Ga0081540_10360343 234
560 3300005983 Ga0081540_1038641 Ga0081540_10386413 234
561 3300005985 Ga0081539_10000051 Ga0081539_10000051135 234
562 3300005985 Ga0081539_10000486 Ga0081539_1000048649 234
563 3300005985 Ga0081539_10003351 Ga0081539_100033512 234
564 3300005985 Ga0081539_10031311 Ga0081539_100313113 234
565 3300005985 Ga0081539_10091328 Ga0081539_100913282 234
566 3300006028 Ga0070717_10000150 Ga0070717_1000015029 234
567 3300006028 Ga0070717_10001555 Ga0070717_100015552 234
568 3300006028 Ga0070717_10011942 Ga0070717_100119426 234
569 3300006028 Ga0070717_10176264 Ga0070717_101762641 234
570 3300006038 Ga0075365_10003263 Ga0075365_100032635 234
571 3300006038 Ga0075365_10052047 Ga0075365_100520473 234
572 3300006038 Ga0075365_10330084 Ga0075365_103300842 234
573 3300006038 Ga0075365_10402045 Ga0075365_104020452 234
574 3300006042 Ga0075368_10003112 Ga0075368_100031123 234
575 3300006042 Ga0075368_10107953 Ga0075368_101079531 234
576 3300006042 Ga0075368_10199552 Ga0075368_101995521 234
577 3300006048 Ga0075363_100022684 Ga0075363_1000226843 234
578 3300006048 Ga0075363_100166830 Ga0075363_1001668302 234
579 3300006051 Ga0075364_10026988 Ga0075364_100269884 234
580 3300006051 Ga0075364_10085514 Ga0075364_100855143 234
581 3300006051 Ga0075364_10368366 Ga0075364_103683662 234
582 3300006051 Ga0075364_10402808 Ga0075364_104028082 234
583 3300006163 Ga0070715_10000321 Ga0070715_1000032113 234
584 3300006163 Ga0070715_10030468 Ga0070715_100304682 234
585 3300006163 Ga0070715_10039547 Ga0070715_100395471 234
586 3300006163 Ga0070715_10173242 Ga0070715_101732421 234
587 3300006173 Ga0070716_100001200 Ga0070716_10000120011 234
588 3300006173 Ga0070716_100018951 Ga0070716_1000189512 234
589 3300006173 Ga0070716_100105020 Ga0070716_1001050202 234
590 3300006173 Ga0070716_100125734 Ga0070716_1001257342 234
591 3300006173 Ga0070716_100277372 Ga0070716_1002773722 234
592 3300006175 Ga0070712_100004740 Ga0070712_1000047402 234
593 3300006175 Ga0070712_100057102 Ga0070712_1000571023 234
594 3300006175 Ga0070712_100063106 Ga0070712_1000631062 234
595 3300006175 Ga0070712_100072856 Ga0070712_1000728563 234
596 3300006175 Ga0070712_100073747 Ga0070712_1000737472 234
597 3300006175 Ga0070712_100118722 Ga0070712_1001187222 234
598 3300006175 Ga0070712_100126287 Ga0070712_1001262873 234
599 3300006175 Ga0070712_100379754 Ga0070712_1003797541 234
600 3300006177 Ga0075362_10001695 Ga0075362_100016952 234
601 3300006177 Ga0075362_10107617 Ga0075362_101076172 234
602 3300006177 Ga0075362_10138886 Ga0075362_101388862 234
603 3300006177 Ga0075362_10168066 Ga0075362_101680662 234
604 3300006177 Ga0075362_10190697 Ga0075362_101906972 234
605 3300006178 Ga0075367_10018878 Ga0075367_100188783 234
606 3300006178 Ga0075367_10022791 Ga0075367_100227913 234
607 3300006178 Ga0075367_10170445 Ga0075367_101704452 234
608 3300006178 Ga0075367_10247511 Ga0075367_102475112 234
609 3300006178 Ga0075367_10413578 Ga0075367_104135781 234
610 3300006186 Ga0075369_10002166 Ga0075369_100021663 234
611 3300006186 Ga0075369_10045606 Ga0075369_100456062 234
612 3300006186 Ga0075369_10196443 Ga0075369_101964431 234
613 3300006195 Ga0075366_10007150 Ga0075366_100071505 234
614 3300006195 Ga0075366_10025959 Ga0075366_100259593 234
615 3300006195 Ga0075366_10073201 Ga0075366_100732013 234
616 3300006237 Ga0097621_100002984 Ga0097621_1000029845 234
617 3300006237 Ga0097621_100222730 Ga0097621_1002227302 234
618 3300006237 Ga0097621_100871030 Ga0097621_1008710301 234
619 3300006353 Ga0075370_10101745 Ga0075370_101017452 234
620 3300006353 Ga0075370_10104514 Ga0075370_101045142 234
621 3300006353 Ga0075370_10110461 Ga0075370_101104612 234
622 3300006353 Ga0075370_10162316 Ga0075370_101623162 234
623 3300006358 Ga0068871_100000555 Ga0068871_1000005556 234
624 3300006358 Ga0068871_100004433 Ga0068871_1000044331 234
625 3300006358 Ga0068871_100447185 Ga0068871_1004471852 234
626 3300006358 Ga0068871_100624562 Ga0068871_1006245622 234
627 3300006844 Ga0075428_100052861 Ga0075428_1000528613 234
628 3300006844 Ga0075428_100058497 Ga0075428_1000584973 234
629 3300006846 Ga0075430_100000042 Ga0075430_10000004242 234
630 3300006846 Ga0075430_100000534 Ga0075430_10000053424 234
631 3300006846 Ga0075430_100000826 Ga0075430_10000082618 234
632 3300006847 Ga0075431_100086521 Ga0075431_1000865212 234
633 3300006847 Ga0075431_100091253 Ga0075431_1000912533 234
634 3300006847 Ga0075431_100447718 Ga0075431_1004477182 234
635 3300006847 Ga0075431_100663262 Ga0075431_1006632622 234
636 3300006852 Ga0075433_10006248 Ga0075433_100062487 234
637 3300006852 Ga0075433_10011316 Ga0075433_100113165 234
638 3300006852 Ga0075433_10012151 Ga0075433_100121512 234
639 3300006852 Ga0075433_10022378 Ga0075433_100223785 234
640 3300006852 Ga0075433_10207998 Ga0075433_102079982 234
641 3300006852 Ga0075433_10404271 Ga0075433_104042712 234
642 3300006871 Ga0075434_100012903 Ga0075434_1000129037 234
643 3300006871 Ga0075434_100016644 Ga0075434_1000166442 234
644 3300006871 Ga0075434_100017132 Ga0075434_1000171323 234
645 3300006871 Ga0075434_100019982 Ga0075434_1000199823 234
646 3300006871 Ga0075434_100027752 Ga0075434_1000277523 234
647 3300006871 Ga0075434_100147528 Ga0075434_1001475282 234
648 3300006871 Ga0075434_100163062 Ga0075434_1001630622 234
649 3300006871 Ga0075434_100267252 Ga0075434_1002672522 234
650 3300006871 Ga0075434_100304674 Ga0075434_1003046742 234
651 3300006871 Ga0075434_100346490 Ga0075434_1003464902 234
652 3300006871 Ga0075434_100368028 Ga0075434_1003680282 234
653 3300006880 Ga0075429_100003563 Ga0075429_10000356310 234
654 3300006880 Ga0075429_100017797 Ga0075429_1000177977 234
655 3300006880 Ga0075429_100042041 Ga0075429_1000420412 234
656 3300006880 Ga0075429_100062288 Ga0075429_1000622883 234
657 3300006881 Ga0068865_100049753 Ga0068865_1000497532 234
658 3300006881 Ga0068865_100135239 Ga0068865_1001352393 234
659 3300006914 Ga0075436_100021433 Ga0075436_1000214334 234
660 3300006914 Ga0075436_100051974 Ga0075436_1000519743 234
661 3300006914 Ga0075436_100057781 Ga0075436_1000577812 234
662 3300006914 Ga0075436_100127649 Ga0075436_1001276492 234
663 3300006914 Ga0075436_100430729 Ga0075436_1004307292 234
664 3300006931 Ga0097620_100002825 Ga0097620_1000028252 234
665 3300006931 Ga0097620_100055932 Ga0097620_1000559322 234
666 3300006931 Ga0097620_100108696 Ga0097620_1001086961 234
667 3300006942 Ga0099824_1004900 Ga0099824_100490016 234
668 3300006942 Ga0099824_1029293 Ga0099824_10292932 234
669 3300006943 Ga0099822_1000677 Ga0099822_100067715 234
670 3300007076 Ga0075435_100018059 Ga0075435_1000180594 234
671 3300007076 Ga0075435_100045774 Ga0075435_1000457743 234
672 3300007076 Ga0075435_100057475 Ga0075435_1000574752 234
673 3300007076 Ga0075435_100062982 Ga0075435_1000629824 234
674 3300007076 Ga0075435_100068323 Ga0075435_1000683232 234
675 3300007076 Ga0075435_100084879 Ga0075435_1000848792 234
676 3300007076 Ga0075435_100218901 Ga0075435_1002189012 234
677 3300007076 Ga0075435_100273373 Ga0075435_1002733732 234
678 3300007076 Ga0075435_100293565 Ga0075435_1002935652 234
679 3300007076 Ga0075435_100307271 Ga0075435_1003072712 234
680 3300007265 Ga0099794_10016964 Ga0099794_100169643 234
681 3300007265 Ga0099794_10047778 Ga0099794_100477783 234
682 3300007265 Ga0099794_10181752 Ga0099794_101817522 234
683 3300007788 Ga0099795_10058807 Ga0099795_100588072 234
684 3300007788 Ga0099795_10120237 Ga0099795_101202371 234
685 3300009093 Ga0105240_10008025 Ga0105240_1000802511 234
686 3300009093 Ga0105240_10027519 Ga0105240_100275192 234
687 3300009093 Ga0105240_10033952 Ga0105240_100339523 234
688 3300009093 Ga0105240_10086994 Ga0105240_100869943 234
689 3300009093 Ga0105240_10129550 Ga0105240_101295502 234
690 3300009093 Ga0105240_10174326 Ga0105240_101743261 234
691 3300009093 Ga0105240_10191853 Ga0105240_101918533 234
692 3300009094 Ga0111539_10002792 Ga0111539_1000279220 234
693 3300009094 Ga0111539_10004409 Ga0111539_100044093 234
694 3300009094 Ga0111539_10004721 Ga0111539_1000472116 234
695 3300009094 Ga0111539_10016484 Ga0111539_100164844 234
696 3300009094 Ga0111539_10115084 Ga0111539_101150842 234
697 3300009094 Ga0111539_10157494 Ga0111539_101574942 234
698 3300009094 Ga0111539_10533202 Ga0111539_105332022 234
699 3300009094 Ga0111539_10754634 Ga0111539_107546341 234
700 3300009098 Ga0105245_10000370 Ga0105245_1000037016 234
701 3300009098 Ga0105245_10009595 Ga0105245_100095957 234
702 3300009098 Ga0105245_10019672 Ga0105245_100196722 234
703 3300009098 Ga0105245_10313762 Ga0105245_103137622 234
704 3300009098 Ga0105245_10317008 Ga0105245_103170082 234
705 3300009098 Ga0105245_10398638 Ga0105245_103986382 234
706 3300009098 Ga0105245_10569306 Ga0105245_105693062 234
707 3300009098 Ga0105245_10706223 Ga0105245_107062232 234
708 3300009101 Ga0105247_10002042 Ga0105247_1000204212 234
709 3300009147 Ga0114129_10024612 Ga0114129_100246128 234
710 3300009147 Ga0114129_10035072 Ga0114129_100350725 234
711 3300009147 Ga0114129_10057279 Ga0114129_100572796 234
712 3300009147 Ga0114129_10062807 Ga0114129_100628073 234
713 3300009147 Ga0114129_10095997 Ga0114129_100959973 234
714 3300009147 Ga0114129_10241848 Ga0114129_102418482 234
715 3300009147 Ga0114129_10741655 Ga0114129_107416552 234
716 3300009147 Ga0114129_10770015 Ga0114129_107700151 234
717 3300009147 Ga0114129_11650956 Ga0114129_116509561 234
718 3300009148 Ga0105243_10003045 Ga0105243_100030457 234
719 3300009148 Ga0105243_10009792 Ga0105243_100097924 234
720 3300009148 Ga0105243_10174023 Ga0105243_101740232 234
721 3300009148 Ga0105243_10632848 Ga0105243_106328482 234
722 3300009148 Ga0105243_10646984 Ga0105243_106469842 234
723 3300009148 Ga0105243_10736654 Ga0105243_107366542 234
724 3300009174 Ga0105241_10001352 Ga0105241_100013527 234
725 3300009174 Ga0105241_10092438 Ga0105241_100924382 234
726 3300009174 Ga0105241_10591021 Ga0105241_105910211 234
727 3300009176 Ga0105242_10001245 Ga0105242_100012453 234
728 3300009176 Ga0105242_10234816 Ga0105242_102348161 234
729 3300009176 Ga0105242_10292772 Ga0105242_102927722 234
730 3300009176 Ga0105242_10475396 Ga0105242_104753962 234
731 3300009176 Ga0105242_10891089 Ga0105242_108910892 234
732 3300009177 Ga0105248_10001324 Ga0105248_100013243 234
733 3300009177 Ga0105248_10016609 Ga0105248_100166091 234
734 3300009177 Ga0105248_10027404 Ga0105248_100274045 234
735 3300009177 Ga0105248_10137102 Ga0105248_101371023 234
736 3300009177 Ga0105248_10142505 Ga0105248_101425052 234
737 3300009177 Ga0105248_10236177 Ga0105248_102361772 234
738 3300009545 Ga0105237_10002060 Ga0105237_1000206012 234
739 3300009545 Ga0105237_10051893 Ga0105237_100518933 234
740 3300009545 Ga0105237_10502841 Ga0105237_105028412 234
741 3300009551 Ga0105238_10168915 Ga0105238_101689152 234
742 3300009551 Ga0105238_10519124 Ga0105238_105191242 234
743 3300009553 Ga0105249_10011280 Ga0105249_100112804 234
744 3300009553 Ga0105249_10044003 Ga0105249_100440035 234
745 3300009553 Ga0105249_10243921 Ga0105249_102439212 234
746 3300010375 Ga0105239_10018332 Ga0105239_100183328 234
747 3300010375 Ga0105239_10046768 Ga0105239_100467682 234
748 3300010375 Ga0105239_10063519 Ga0105239_100635192 234
749 3300010375 Ga0105239_10132942 Ga0105239_101329422 234
750 3300010375 Ga0105239_10240473 Ga0105239_102404732 234
751 3300010375 Ga0105239_10326261 Ga0105239_103262612 234
752 3300010375 Ga0105239_10390965 Ga0105239_103909652 234
753 3300010375 Ga0105239_10524366 Ga0105239_105243662 234
754 3300010375 Ga0105239_10642095 Ga0105239_106420952 234
755 3300011119 Ga0105246_10000510 Ga0105246_1000051019 234
756 3300011119 Ga0105246_10070617 Ga0105246_100706173 234
757 3300011119 Ga0105246_10169126 Ga0105246_101691262 234
758 3300012508 Ga0157315_1005559 Ga0157315_10055592 234
759 3300013100 Ga0157373_10002949 Ga0157373_1000294911 234
760 3300013102 Ga0157371_10032190 Ga0157371_100321903 234
761 3300013104 Ga0157370_10022603 Ga0157370_100226036 234
762 3300013104 Ga0157370_10042139 Ga0157370_100421392 234
763 3300013104 Ga0157370_10115657 Ga0157370_101156572 234
764 3300013104 Ga0157370_10280866 Ga0157370_102808662 234
765 3300013105 Ga0157369_10034680 Ga0157369_100346803 234
766 3300013105 Ga0157369_10045599 Ga0157369_100455993 234
767 3300013105 Ga0157369_10305824 Ga0157369_103058242 234
768 3300013296 Ga0157374_10001994 Ga0157374_1000199417 234
769 3300013296 Ga0157374_10964442 Ga0157374_109644421 234
770 3300013297 Ga0157378_10005283 Ga0157378_100052837 234
771 3300013297 Ga0157378_10177813 Ga0157378_101778132 234
772 3300013297 Ga0157378_10326744 Ga0157378_103267441 234
773 3300013306 Ga0163162_10018668 Ga0163162_100186683 234
774 3300013306 Ga0163162_10129762 Ga0163162_101297622 234
775 3300013306 Ga0163162_10775572 Ga0163162_107755722 234
776 3300013307 Ga0157372_10214993 Ga0157372_102149932 234
777 3300013307 Ga0157372_10676412 Ga0157372_106764122 234
778 3300013308 Ga0157375_10038248 Ga0157375_100382482 234
779 3300013308 Ga0157375_10245534 Ga0157375_102455343 234
780 3300013308 Ga0157375_10259770 Ga0157375_102597703 234
781 3300014325 Ga0163163_10017133 Ga0163163_100171333 234
782 3300014325 Ga0163163_10063041 Ga0163163_100630413 234
783 3300014325 Ga0163163_10126958 Ga0163163_101269582 234
784 3300014325 Ga0163163_10393886 Ga0163163_103938862 234
785 3300014325 Ga0163163_10541197 Ga0163163_105411972 234
786 3300014325 Ga0163163_10893255 Ga0163163_108932551 234
787 3300014325 Ga0163163_11035903 Ga0163163_110359031 234
788 3300014326 Ga0157380_10010558 Ga0157380_100105583 234
789 3300014326 Ga0157380_10044784 Ga0157380_100447842 234
790 3300014326 Ga0157380_10278226 Ga0157380_102782262 234
791 3300014326 Ga0157380_10785985 Ga0157380_107859852 234
792 3300014497 Ga0182008_10165678 Ga0182008_101656781 234
793 3300014497 Ga0182008_10242838 Ga0182008_102428381 234
794 3300014745 Ga0157377_10001228 Ga0157377_100012287 234
795 3300014968 Ga0157379_10001959 Ga0157379_1000195913 234
796 3300014968 Ga0157379_10133256 Ga0157379_101332562 234
797 3300014968 Ga0157379_10206894 Ga0157379_102068942 234
798 3300014969 Ga0157376_10017127 Ga0157376_100171277 234
799 3300014969 Ga0157376_10066771 Ga0157376_100667713 234
800 3300014969 Ga0157376_10739305 Ga0157376_107393052 234
801 3300014969 Ga0157376_10922161 Ga0157376_109221611 234
802 3300015265 Ga0182005_1039485 Ga0182005_10394852 234
803 3300017792 Ga0163161_10017343 Ga0163161_100173436 234
804 3300017792 Ga0163161_10038485 Ga0163161_100384852 234
805 3300017792 Ga0163161_10131788 Ga0163161_101317883 234
806 3300021320 Ga0214544_1000026 Ga0214544_100002631 234
807 3300021321 Ga0214542_1000025 Ga0214542_1000025130 234
808 3300021324 Ga0214545_1000014 Ga0214545_100001448 234
809 3300021327 Ga0214543_1000034 Ga0214543_1000034129 234
810 3300021358 Ga0213873_10006937 Ga0213873_100069372 234
811 3300021384 Ga0213876_10058129 Ga0213876_100581292 234
812 3300021384 Ga0213876_10084092 Ga0213876_100840922 234
813 3300021384 Ga0213876_10130132 Ga0213876_101301322 234
814 3300021388 Ga0213875_10093331 Ga0213875_100933312 234
815 3300021441 Ga0213871_10004587 Ga0213871_100045873 234
816 3300021441 Ga0213871_10054108 Ga0213871_100541082 234
817 3300021441 Ga0213871_10085835 Ga0213871_100858352 234
818 3300025253 Ga0209677_103618 Ga0209677_1036182 234
819 3300025254 Ga0209148_1000376 Ga0209148_100037653 234
820 3300025261 Ga0209233_1009577 Ga0209233_10095772 234
821 3300025271 Ga0207666_1000081 Ga0207666_10000813 234
822 3300025272 Ga0209455_1000714 Ga0209455_100071410 234
823 3300025290 Ga0207673_1001727 Ga0207673_10017272 234
824 3300025295 Ga0209564_1011304 Ga0209564_10113046 234
825 3300025297 Ga0209758_1000141 Ga0209758_100014137 234
826 3300025297 Ga0209758_1000324 Ga0209758_100032427 234
827 3300025297 Ga0209758_1001019 Ga0209758_100101922 234
828 3300025297 Ga0209758_1002338 Ga0209758_100233817 234
829 3300025297 Ga0209758_1002921 Ga0209758_10029215 234
830 3300025297 Ga0209758_1003483 Ga0209758_10034838 234
831 3300025297 Ga0209758_1041951 Ga0209758_10419511 234
832 3300025297 Ga0209758_1081463 Ga0209758_10814631 234
833 3300025299 Ga0209256_1002956 Ga0209256_10029563 234
834 3300025299 Ga0209256_1047199 Ga0209256_10471992 234
835 3300025302 Ga0207426_1000437 Ga0207426_100043720 234
836 3300025302 Ga0207426_1001139 Ga0207426_10011396 234
837 3300025302 Ga0207426_1012626 Ga0207426_10126263 234
838 3300025302 Ga0207426_1018791 Ga0207426_10187912 234
839 3300025302 Ga0207426_1021983 Ga0207426_10219833 234
840 3300025304 Ga0209257_1003859 Ga0209257_10038597 234
841 3300025304 Ga0209257_1011469 Ga0209257_10114695 234
842 3300025304 Ga0209257_1040537 Ga0209257_10405372 234
843 3300025315 Ga0207697_10000051 Ga0207697_1000005125 234
844 3300025315 Ga0207697_10086702 Ga0207697_100867022 234
845 3300025315 Ga0207697_10113018 Ga0207697_101130182 234
846 3300025893 Ga0207682_10000661 Ga0207682_1000066111 234
847 3300025898 Ga0207692_10002517 Ga0207692_100025172 234
848 3300025898 Ga0207692_10177558 Ga0207692_101775582 234
849 3300025898 Ga0207692_10214027 Ga0207692_102140272 234
850 3300025898 Ga0207692_10350439 Ga0207692_103504391 234
851 3300025899 Ga0207642_10001892 Ga0207642_100018926 234
852 3300025900 Ga0207710_10016916 Ga0207710_100169162 234
853 3300025900 Ga0207710_10038841 Ga0207710_100388413 234
854 3300025900 Ga0207710_10079983 Ga0207710_100799832 234
855 3300025901 Ga0207688_10000702 Ga0207688_1000070212 234
856 3300025901 Ga0207688_10114944 Ga0207688_101149442 234
857 3300025901 Ga0207688_10167168 Ga0207688_101671682 234
858 3300025901 Ga0207688_10411062 Ga0207688_104110621 234
859 3300025901 Ga0207688_10477369 Ga0207688_104773691 234
860 3300025903 Ga0207680_10009478 Ga0207680_100094783 234
861 3300025903 Ga0207680_10044806 Ga0207680_100448063 234
862 3300025904 Ga0207647_10002441 Ga0207647_100024413 234
863 3300025904 Ga0207647_10040227 Ga0207647_100402273 234
864 3300025905 Ga0207685_10010399 Ga0207685_100103993 234
865 3300025905 Ga0207685_10056738 Ga0207685_100567382 234
866 3300025906 Ga0207699_10000344 Ga0207699_1000034416 234
867 3300025906 Ga0207699_10000434 Ga0207699_1000043413 234
868 3300025906 Ga0207699_10035971 Ga0207699_100359713 234
869 3300025906 Ga0207699_10101229 Ga0207699_101012292 234
870 3300025906 Ga0207699_10154439 Ga0207699_101544392 234
871 3300025907 Ga0207645_10000218 Ga0207645_1000021825 234
872 3300025907 Ga0207645_10027565 Ga0207645_100275653 234
873 3300025907 Ga0207645_10045314 Ga0207645_100453143 234
874 3300025908 Ga0207643_10000400 Ga0207643_1000040013 234
875 3300025908 Ga0207643_10234976 Ga0207643_102349762 234
876 3300025909 Ga0207705_10358320 Ga0207705_103583202 234
877 3300025909 Ga0207705_10392607 Ga0207705_103926071 234
878 3300025910 Ga0207684_10004496 Ga0207684_100044963 234
879 3300025910 Ga0207684_10004520 Ga0207684_100045204 234
880 3300025910 Ga0207684_10012329 Ga0207684_100123298 234
881 3300025910 Ga0207684_10015203 Ga0207684_100152034 234
882 3300025910 Ga0207684_10087821 Ga0207684_100878213 234
883 3300025910 Ga0207684_10282202 Ga0207684_102822022 234
884 3300025910 Ga0207684_10292934 Ga0207684_102929342 234
885 3300025911 Ga0207654_10002726 Ga0207654_100027267 234
886 3300025911 Ga0207654_10194687 Ga0207654_101946872 234
887 3300025912 Ga0207707_10002658 Ga0207707_1000265812 234
888 3300025912 Ga0207707_10011843 Ga0207707_100118435 234
889 3300025912 Ga0207707_10023997 Ga0207707_100239974 234
890 3300025912 Ga0207707_10043382 Ga0207707_100433822 234
891 3300025912 Ga0207707_10056384 Ga0207707_100563842 234
892 3300025912 Ga0207707_10063500 Ga0207707_100635003 234
893 3300025912 Ga0207707_10410557 Ga0207707_104105571 234
894 3300025913 Ga0207695_10036649 Ga0207695_100366495 234
895 3300025913 Ga0207695_10050434 Ga0207695_100504343 234
896 3300025913 Ga0207695_10085924 Ga0207695_100859242 234
897 3300025913 Ga0207695_10115522 Ga0207695_101155223 234
898 3300025913 Ga0207695_10212050 Ga0207695_102120502 234
899 3300025913 Ga0207695_10236470 Ga0207695_102364702 234
900 3300025914 Ga0207671_10131265 Ga0207671_101312653 234
901 3300025914 Ga0207671_10143288 Ga0207671_101432882 234
902 3300025914 Ga0207671_10521032 Ga0207671_105210322 234
903 3300025914 Ga0207671_10529112 Ga0207671_105291122 234
904 3300025915 Ga0207693_10001161 Ga0207693_100011616 234
905 3300025915 Ga0207693_10003608 Ga0207693_100036089 234
906 3300025915 Ga0207693_10035323 Ga0207693_100353231 234
907 3300025915 Ga0207693_10042279 Ga0207693_100422793 234
908 3300025915 Ga0207693_10085481 Ga0207693_100854812 234
909 3300025915 Ga0207693_10132528 Ga0207693_101325282 234
910 3300025915 Ga0207693_10206011 Ga0207693_102060112 234
911 3300025915 Ga0207693_10269282 Ga0207693_102692822 234
912 3300025915 Ga0207693_10321843 Ga0207693_103218432 234
913 3300025915 Ga0207693_10365645 Ga0207693_103656452 234
914 3300025916 Ga0207663_10000926 Ga0207663_100009266 234
915 3300025916 Ga0207663_10012457 Ga0207663_100124573 234
916 3300025917 Ga0207660_10002897 Ga0207660_100028979 234
917 3300025917 Ga0207660_10010384 Ga0207660_100103844 234
918 3300025917 Ga0207660_10013462 Ga0207660_100134623 234
919 3300025917 Ga0207660_10495516 Ga0207660_104955162 234
920 3300025917 Ga0207660_10651928 Ga0207660_106519281 234
921 3300025918 Ga0207662_10000678 Ga0207662_100006786 234
922 3300025919 Ga0207657_10003448 Ga0207657_1000344813 234
923 3300025919 Ga0207657_10075202 Ga0207657_100752024 234
924 3300025919 Ga0207657_10095681 Ga0207657_100956813 234
925 3300025919 Ga0207657_10138003 Ga0207657_101380032 234
926 3300025919 Ga0207657_10166205 Ga0207657_101662052 234
927 3300025919 Ga0207657_10560607 Ga0207657_105606072 234
928 3300025920 Ga0207649_10001450 Ga0207649_1000145010 234
929 3300025921 Ga0207652_10005840 Ga0207652_100058409 234
930 3300025921 Ga0207652_10006902 Ga0207652_100069025 234
931 3300025921 Ga0207652_10008077 Ga0207652_100080775 234
932 3300025921 Ga0207652_10016789 Ga0207652_100167897 234
933 3300025921 Ga0207652_10211430 Ga0207652_102114302 234
934 3300025921 Ga0207652_10346504 Ga0207652_103465042 234
935 3300025922 Ga0207646_10003037 Ga0207646_100030375 234
936 3300025922 Ga0207646_10078591 Ga0207646_100785912 234
937 3300025922 Ga0207646_10159870 Ga0207646_101598701 234
938 3300025922 Ga0207646_10244434 Ga0207646_102444342 234
939 3300025922 Ga0207646_10525802 Ga0207646_105258022 234
940 3300025923 Ga0207681_10001264 Ga0207681_100012647 234
941 3300025923 Ga0207681_10203390 Ga0207681_102033902 234
942 3300025923 Ga0207681_10259340 Ga0207681_102593401 234
943 3300025924 Ga0207694_10113941 Ga0207694_101139413 234
944 3300025924 Ga0207694_10125399 Ga0207694_101253993 234
945 3300025924 Ga0207694_10153373 Ga0207694_101533732 234
946 3300025924 Ga0207694_10296268 Ga0207694_102962682 234
947 3300025924 Ga0207694_10464238 Ga0207694_104642381 234
948 3300025925 Ga0207650_10043914 Ga0207650_100439142 234
949 3300025925 Ga0207650_10085722 Ga0207650_100857222 234
950 3300025925 Ga0207650_10219732 Ga0207650_102197322 234
951 3300025926 Ga0207659_10004045 Ga0207659_100040456 234
952 3300025926 Ga0207659_10248312 Ga0207659_102483122 234
953 3300025926 Ga0207659_10421962 Ga0207659_104219622 234
954 3300025927 Ga0207687_10007913 Ga0207687_100079136 234
955 3300025927 Ga0207687_10040438 Ga0207687_100404382 234
956 3300025927 Ga0207687_10427047 Ga0207687_104270472 234
957 3300025928 Ga0207700_10001395 Ga0207700_1000139511 234
958 3300025928 Ga0207700_10015437 Ga0207700_100154373 234
959 3300025928 Ga0207700_10015756 Ga0207700_100157563 234
960 3300025928 Ga0207700_10090002 Ga0207700_100900023 234
961 3300025928 Ga0207700_10096610 Ga0207700_100966102 234
962 3300025928 Ga0207700_10101360 Ga0207700_101013602 234
963 3300025928 Ga0207700_10524626 Ga0207700_105246261 234
964 3300025929 Ga0207664_10023034 Ga0207664_100230344 234
965 3300025929 Ga0207664_10064254 Ga0207664_100642542 234
966 3300025929 Ga0207664_10145777 Ga0207664_101457772 234
967 3300025929 Ga0207664_10726649 Ga0207664_107266492 234
968 3300025931 Ga0207644_10044060 Ga0207644_100440602 234
969 3300025931 Ga0207644_10091325 Ga0207644_100913253 234
970 3300025931 Ga0207644_10114849 Ga0207644_101148493 234
971 3300025932 Ga0207690_10003720 Ga0207690_100037204 234
972 3300025932 Ga0207690_10103954 Ga0207690_101039543 234
973 3300025933 Ga0207706_10016490 Ga0207706_100164907 234
974 3300025933 Ga0207706_10168370 Ga0207706_101683702 234
975 3300025933 Ga0207706_10176636 Ga0207706_101766362 234
976 3300025933 Ga0207706_10199102 Ga0207706_101991022 234
977 3300025933 Ga0207706_10297489 Ga0207706_102974892 234
978 3300025933 Ga0207706_10518744 Ga0207706_105187442 234
979 3300025934 Ga0207686_10012733 Ga0207686_100127332 234
980 3300025934 Ga0207686_10017495 Ga0207686_100174952 234
981 3300025935 Ga0207709_10001798 Ga0207709_1000179811 234
982 3300025935 Ga0207709_10056378 Ga0207709_100563783 234
983 3300025935 Ga0207709_10081552 Ga0207709_100815523 234
984 3300025936 Ga0207670_10003328 Ga0207670_100033286 234
985 3300025936 Ga0207670_10046656 Ga0207670_100466563 234
986 3300025936 Ga0207670_10073089 Ga0207670_100730893 234
987 3300025937 Ga0207669_10002357 Ga0207669_100023576 234
988 3300025937 Ga0207669_10047148 Ga0207669_100471482 234
989 3300025938 Ga0207704_10000896 Ga0207704_1000089612 234
990 3300025938 Ga0207704_10047543 Ga0207704_100475432 234
991 3300025939 Ga0207665_10000228 Ga0207665_1000022812 234
992 3300025939 Ga0207665_10000715 Ga0207665_100007152 234
993 3300025939 Ga0207665_10002595 Ga0207665_100025954 234
994 3300025939 Ga0207665_10019118 Ga0207665_100191183 234
995 3300025939 Ga0207665_10023485 Ga0207665_100234852 234
996 3300025939 Ga0207665_10149363 Ga0207665_101493632 234
997 3300025939 Ga0207665_10327372 Ga0207665_103273722 234
998 3300025940 Ga0207691_10000940 Ga0207691_1000094019 234
999 3300025940 Ga0207691_10059780 Ga0207691_100597803 234
1000 3300025940 Ga0207691_10063675 Ga0207691_100636753 234
1001 3300025940 Ga0207691_10146323 Ga0207691_101463232 234
1002 3300025940 Ga0207691_10373640 Ga0207691_103736402 234
1003 3300025941 Ga0207711_10032480 Ga0207711_100324803 234
1004 3300025941 Ga0207711_10034481 Ga0207711_100344812 234
1005 3300025941 Ga0207711_10041197 Ga0207711_100411974 234
1006 3300025941 Ga0207711_10041697 Ga0207711_100416973 234
1007 3300025941 Ga0207711_10095313 Ga0207711_100953132 234
1008 3300025941 Ga0207711_10115517 Ga0207711_101155172 234
1009 3300025941 Ga0207711_10339338 Ga0207711_103393382 234
1010 3300025941 Ga0207711_10486060 Ga0207711_104860601 234
1011 3300025942 Ga0207689_10000514 Ga0207689_1000051419 234
1012 3300025942 Ga0207689_10069377 Ga0207689_100693772 234
1013 3300025942 Ga0207689_10145972 Ga0207689_101459722 234
1014 3300025942 Ga0207689_10435858 Ga0207689_104358581 234
1015 3300025942 Ga0207689_10881434 Ga0207689_108814341 234
1016 3300025944 Ga0207661_10001969 Ga0207661_100019698 234
1017 3300025944 Ga0207661_10012879 Ga0207661_100128792 234
1018 3300025944 Ga0207661_10029500 Ga0207661_100295002 234
1019 3300025944 Ga0207661_10125062 Ga0207661_101250623 234
1020 3300025944 Ga0207661_10208332 Ga0207661_102083323 234
1021 3300025944 Ga0207661_10297372 Ga0207661_102973722 234
1022 3300025945 Ga0207679_10000099 Ga0207679_1000009978 234
1023 3300025945 Ga0207679_10224032 Ga0207679_102240322 234
1024 3300025945 Ga0207679_10598458 Ga0207679_105984581 234
1025 3300025949 Ga0207667_10019759 Ga0207667_100197595 234
1026 3300025949 Ga0207667_10040667 Ga0207667_100406673 234
1027 3300025949 Ga0207667_10042644 Ga0207667_100426444 234
1028 3300025949 Ga0207667_10098778 Ga0207667_100987783 234
1029 3300025949 Ga0207667_10209760 Ga0207667_102097602 234
1030 3300025949 Ga0207667_10399499 Ga0207667_103994992 234
1031 3300025949 Ga0207667_10410416 Ga0207667_104104162 234
1032 3300025949 Ga0207667_10482505 Ga0207667_104825051 234
1033 3300025949 Ga0207667_10648856 Ga0207667_106488562 234
1034 3300025960 Ga0207651_10000609 Ga0207651_100006096 234
1035 3300025961 Ga0207712_10001402 Ga0207712_100014026 234
1036 3300025961 Ga0207712_10164503 Ga0207712_101645032 234
1037 3300025961 Ga0207712_10402077 Ga0207712_104020772 234
1038 3300025972 Ga0207668_10008221 Ga0207668_100082216 234
1039 3300025972 Ga0207668_10069987 Ga0207668_100699873 234
1040 3300025972 Ga0207668_10075220 Ga0207668_100752202 234
1041 3300025972 Ga0207668_10438243 Ga0207668_104382432 234
1042 3300025981 Ga0207640_10001310 Ga0207640_100013103 234
1043 3300025981 Ga0207640_10083988 Ga0207640_100839881 234
1044 3300025986 Ga0207658_10021213 Ga0207658_100212135 234
1045 3300025986 Ga0207658_10329427 Ga0207658_103294272 234
1046 3300025986 Ga0207658_10444865 Ga0207658_104448652 234
1047 3300026023 Ga0207677_10000495 Ga0207677_1000049515 234
1048 3300026023 Ga0207677_10020041 Ga0207677_100200414 234
1049 3300026035 Ga0207703_10005812 Ga0207703_100058126 234
1050 3300026035 Ga0207703_10250211 Ga0207703_102502112 234
1051 3300026035 Ga0207703_10254113 Ga0207703_102541132 234
1052 3300026035 Ga0207703_10393259 Ga0207703_103932592 234
1053 3300026035 Ga0207703_10404414 Ga0207703_104044142 234
1054 3300026035 Ga0207703_10760488 Ga0207703_107604881 234
1055 3300026041 Ga0207639_10006228 Ga0207639_100062286 234
1056 3300026041 Ga0207639_10058222 Ga0207639_100582224 234
1057 3300026041 Ga0207639_10062266 Ga0207639_100622662 234
1058 3300026041 Ga0207639_10132413 Ga0207639_101324132 234
1059 3300026041 Ga0207639_10456287 Ga0207639_104562872 234
1060 3300026067 Ga0207678_10004568 Ga0207678_100045684 234
1061 3300026067 Ga0207678_10015651 Ga0207678_100156517 234
1062 3300026067 Ga0207678_10076090 Ga0207678_100760903 234
1063 3300026067 Ga0207678_10083060 Ga0207678_100830602 234
1064 3300026067 Ga0207678_10095571 Ga0207678_100955713 234
1065 3300026067 Ga0207678_10313045 Ga0207678_103130452 234
1066 3300026067 Ga0207678_10473513 Ga0207678_104735132 234
1067 3300026075 Ga0207708_10016215 Ga0207708_100162156 234
1068 3300026075 Ga0207708_10059563 Ga0207708_100595633 234
1069 3300026078 Ga0207702_10012301 Ga0207702_100123013 234
1070 3300026078 Ga0207702_10018427 Ga0207702_100184275 234
1071 3300026078 Ga0207702_10067051 Ga0207702_100670512 234
1072 3300026078 Ga0207702_10473207 Ga0207702_104732072 234
1073 3300026078 Ga0207702_10782605 Ga0207702_107826052 234
1074 3300026088 Ga0207641_10021071 Ga0207641_100210716 234
1075 3300026088 Ga0207641_10204516 Ga0207641_102045162 234
1076 3300026089 Ga0207648_10000575 Ga0207648_1000057519 234
1077 3300026089 Ga0207648_10179928 Ga0207648_101799283 234
1078 3300026095 Ga0207676_10006987 Ga0207676_1000698710 234
1079 3300026095 Ga0207676_10011122 Ga0207676_100111226 234
1080 3300026095 Ga0207676_10263449 Ga0207676_102634492 234
1081 3300026095 Ga0207676_10551129 Ga0207676_105511292 234
1082 3300026095 Ga0207676_10797397 Ga0207676_107973972 234
1083 3300026116 Ga0207674_10002439 Ga0207674_1000243919 234
1084 3300026116 Ga0207674_10008791 Ga0207674_100087918 234
1085 3300026116 Ga0207674_10053695 Ga0207674_100536954 234
1086 3300026116 Ga0207674_10088944 Ga0207674_100889442 234
1087 3300026116 Ga0207674_10097261 Ga0207674_100972613 234
1088 3300026116 Ga0207674_10109561 Ga0207674_101095612 234
1089 3300026116 Ga0207674_10239446 Ga0207674_102394462 234
1090 3300026116 Ga0207674_10632272 Ga0207674_106322721 234
1091 3300026116 Ga0207674_10678099 Ga0207674_106780992 234
1092 3300026118 Ga0207675_100002824 Ga0207675_1000028247 234
1093 3300026118 Ga0207675_100184205 Ga0207675_1001842053 234
1094 3300026118 Ga0207675_100185079 Ga0207675_1001850793 234
1095 3300026118 Ga0207675_100843026 Ga0207675_1008430262 234
1096 3300026121 Ga0207683_10093675 Ga0207683_100936753 234
1097 3300026121 Ga0207683_10107125 Ga0207683_101071253 234
1098 3300026121 Ga0207683_10159116 Ga0207683_101591161 234
1099 3300026121 Ga0207683_10484988 Ga0207683_104849882 234
1100 3300026142 Ga0207698_10002620 Ga0207698_100026202 234
1101 3300026142 Ga0207698_10083446 Ga0207698_100834462 234
1102 3300026142 Ga0207698_10178948 Ga0207698_101789482 234
1103 3300026142 Ga0207698_10435391 Ga0207698_104353912 234
1104 3300026142 Ga0207698_10536270 Ga0207698_105362702 234
1105 3300027296 Ga0209389_1000004 Ga0209389_1000004111 234
1106 3300027296 Ga0209389_1000023 Ga0209389_1000023108 234
1107 3300027357 Ga0209589_1000006 Ga0209589_1000006268 234
1108 3300027357 Ga0209589_1000010 Ga0209589_100001050 234
1109 3300027361 Ga0209489_100007 Ga0209489_100007268 234
1110 3300027361 Ga0209489_100011 Ga0209489_100011185 234
1111 3300027361 Ga0209489_100777 Ga0209489_10077743 234
1112 3300027363 Ga0209700_100008 Ga0209700_100008268 234
1113 3300027363 Ga0209700_100013 Ga0209700_100013197 234
1114 3300027512 Ga0209179_1002360 Ga0209179_10023602 234
1115 3300027717 Ga0209998_10001529 Ga0209998_100015295 234
1116 3300027866 Ga0209813_10097234 Ga0209813_100972342 234
1117 3300027876 Ga0209974_10007886 Ga0209974_100078866 234
1118 3300027907 Ga0207428_10000033 Ga0207428_10000033208 234
1119 3300027907 Ga0207428_10000094 Ga0207428_100000942 234
1120 3300027907 Ga0207428_10000736 Ga0207428_1000073629 234
1121 3300027907 Ga0207428_10034078 Ga0207428_100340784 234
1122 3300027907 Ga0207428_10318688 Ga0207428_103186881 234
1123 3300028379 Ga0268266_10007855 Ga0268266_100078557 234
1124 3300028379 Ga0268266_10060020 Ga0268266_100600202 234
1125 3300028379 Ga0268266_10150629 Ga0268266_101506293 234
1126 3300028379 Ga0268266_10203391 Ga0268266_102033912 234
1127 3300028379 Ga0268266_10205402 Ga0268266_102054022 234
1128 3300028379 Ga0268266_10588732 Ga0268266_105887322 234
1129 3300028379 Ga0268266_10734807 Ga0268266_107348071 234
1130 3300028379 Ga0268266_10747995 Ga0268266_107479952 234
1131 3300028380 Ga0268265_10002253 Ga0268265_100022537 234
1132 3300028380 Ga0268265_10072751 Ga0268265_100727512 234
1133 3300028380 Ga0268265_10255958 Ga0268265_102559581 234
1134 3300028381 Ga0268264_10004708 Ga0268264_1000470810 234
1135 3300028381 Ga0268264_10016894 Ga0268264_100168944 234
1136 3300028381 Ga0268264_10032913 Ga0268264_100329133 234
1137 3300028381 Ga0268264_10510910 Ga0268264_105109102 234
1138 3300028786 Ga0307517_10000102 Ga0307517_100001026 234
1139 3300030521 Ga0307511_10000269 Ga0307511_1000026925 234
1140 3300031238 Ga0265332_10118070 Ga0265332_101180702 234
1141 3300031239 Ga0265328_10071118 Ga0265328_100711182 234
1142 3300031247 Ga0265340_10030010 Ga0265340_100300102 234
1143 3300031249 Ga0265339_10110557 Ga0265339_101105572 234
1144 3300031344 Ga0265316_10028234 Ga0265316_100282343 234
1145 3300031344 Ga0265316_10158346 Ga0265316_101583462 234
1146 3300031507 Ga0307509_10139585 Ga0307509_101395853 234
1147 3300031548 Ga0307408_100261023 Ga0307408_1002610232 234
1148 3300031616 Ga0307508_10215758 Ga0307508_102157582 234
1149 3300031730 Ga0307516_10036663 Ga0307516_100366632 234
1150 3300031731 Ga0307405_10306430 Ga0307405_103064302 234
1151 3300031824 Ga0307413_10121182 Ga0307413_101211822 234
1152 3300031852 Ga0307410_10233390 Ga0307410_102333902 234
1153 3300031903 Ga0307407_10187867 Ga0307407_101878671 234
1154 3300031911 Ga0307412_10289483 Ga0307412_102894832 234
1155 3300031911 Ga0307412_10753256 Ga0307412_107532562 234
1156 3300031995 Ga0307409_100448725 Ga0307409_1004487252 234
1157 3300031995 Ga0307409_100952146 Ga0307409_1009521461 234
1158 3300032005 Ga0307411_10065049 Ga0307411_100650492 234
1159 3300032005 Ga0307411_10118477 Ga0307411_101184772 234
1160 3300032005 Ga0307411_10168777 Ga0307411_101687772 234
1161 3300032126 Ga0307415_100428961 Ga0307415_1004289612 234
1162 3300032126 Ga0307415_100657546 Ga0307415_1006575462 234
1163 3300033180 Ga0307510_10027691 Ga0307510_100276912 234
1164 3300033180 Ga0307510_10069562 Ga0307510_100695623 234
1165 3300033442 Ga0315911_1000010 Ga0315911_1000010277 234
1166 3300034818 Ga0373950_0001102 Ga0373950_0001102_1378_2082 234
1167 3300034819 Ga0373958_0002389 Ga0373958_0002389_36_740 234
1168 3300034957 Ga0373938_0001160 Ga0373938_0001160_139_843 234
1169 3300035083 Ga0373926_0002880 Ga0373926_0002880_2465_3169 234
1170 3300035084 Ga0373928_0014131 Ga0373928_0014131_763_1467 234
1171 3300035086 Ga0373934_0054354 Ga0373934_0054354_169_873 234
1172 3300035086 Ga0373934_0056776 Ga0373934_0056776_625_1329 234
1173 3300035086 Ga0373934_0115469 Ga0373934_0115469_291_1049 234
1174 3300035088 Ga0373940_0011418 Ga0373940_0011418_132_836 234
1175 3300035089 Ga0373944_0019486 Ga0373944_0019486_64_768 234
1176 3300035090 Ga0373949_0000927 Ga0373949_0000927_3507_4211 234
1177 3300035091 Ga0373951_0002101 Ga0373951_0002101_2731_3435 234
1178 3300035091 Ga0373951_0073904 Ga0373951_0073904_62_769 234
1179 3300035111 Ga0373923_0002326 Ga0373923_0002326_3924_4628 234
1180 3300035111 Ga0373923_0040341 Ga0373923_0040341_803_1507 234
1181 3300035112 Ga0373932_0006222 Ga0373932_0006222_1479_2183 234
1182 3300035112 Ga0373932_0014847 Ga0373932_0014847_110_814 234
1183 3300035112 Ga0373932_0058549 Ga0373932_0058549_290_994 234
1184 3300035113 Ga0373936_0005468 Ga0373936_0005468_30_734 234
1185 3300035113 Ga0373936_0018584 Ga0373936_0018584_1830_2534 234
1186 3300035113 Ga0373936_0150221 Ga0373936_0150221_239_943 234
1187 3300035114 Ga0373939_0001513 Ga0373939_0001513_1524_2228 234
1188 3300035114 Ga0373939_0029562 Ga0373939_0029562_621_1325 234
1189 3300035114 Ga0373939_0041635 Ga0373939_0041635_656_1360 234
1190 3300035115 Ga0373941_0000449 Ga0373941_0000449_1034_1738 234
1191 3300035115 Ga0373941_0002582 Ga0373941_0002582_3090_3794 234
1192 3300035115 Ga0373941_0004659 Ga0373941_0004659_1113_1817 234
1193 3300035115 Ga0373941_0105772 Ga0373941_0105772_75_779 234
1194 3300035116 Ga0373945_0010695 Ga0373945_0010695_1283_2041 234
1195 3300035117 Ga0373953_0000420 Ga0373953_0000420_1376_2080 234
1196 3300035117 Ga0373953_0014626 Ga0373953_0014626_1869_2573 234
1197 3300035117 Ga0373953_0021876 Ga0373953_0021876_1425_2129 234
1198 3300035117 Ga0373953_0076725 Ga0373953_0076725_67_771 234
1199 3300035117 Ga0373953_0164912 Ga0373953_0164912_238_942 234
1200 3300035118 Ga0373954_0000663 Ga0373954_0000663_1906_2610 234
1201 3300035118 Ga0373954_0056577 Ga0373954_0056577_1089_1793 234
1202 3300035118 Ga0373954_0062480 Ga0373954_0062480_590_1294 234
1203 3300035119 Ga0373956_0000275 Ga0373956_0000275_12379_13083 234
1204 3300035119 Ga0373956_0103162 Ga0373956_0103162_190_894 234
1205 3300035120 Ga0373957_0000426 Ga0373957_0000426_9396_10100 234
1206 3300035120 Ga0373957_0049589 Ga0373957_0049589_477_1181 234
1207 3300035120 Ga0373957_0050517 Ga0373957_0050517_573_1277 234
1208 3300035120 Ga0373957_0126366 Ga0373957_0126366_269_973 234
1209 3300035120 Ga0373957_0151219 Ga0373957_0151219_178_882 234
1210 3300035121 Ga0373960_0003445 Ga0373960_0003445_139_843 234
1211 3300035121 Ga0373960_0080636 Ga0373960_0080636_116_820 234
1212 3300035170 Ga0373943_0000424 Ga0373943_0000424_2569_3273 234
1213 3300035170 Ga0373943_0006136 Ga0373943_0006136_1763_2467 234
1214 3300035170 Ga0373943_0028636 Ga0373943_0028636_329_1033 234
1215 3300035170 Ga0373943_0046732 Ga0373943_0046732_578_1282 234
1216 3300035170 Ga0373943_0118531 Ga0373943_0118531_394_1098 234
1217 3300035171 Ga0373946_0003275 Ga0373946_0003275_2395_3099 234
1218 3300035171 Ga0373946_0031028 Ga0373946_0031028_876_1580 234
1219 3300035172 Ga0373955_0000510 Ga0373955_0000510_15353_16057 234
1220 3300035172 Ga0373955_0016347 Ga0373955_0016347_1380_2084 234
1221 3300035172 Ga0373955_0056665 Ga0373955_0056665_252_956 234
1222 3300035207 Ga0373942_0027753 Ga0373942_0027753_11_715 234
1223 3300035242 Ga0373962_0003492 Ga0373962_0003492_360_1064 234
1224 3300035410 Ga0373924_0004208 Ga0373924_0004208_1650_2354 234
1225 3300035410 Ga0373924_0066506 Ga0373924_0066506_485_1189 234
1226 3300035691 Ga0373931_0001672 Ga0373931_0001672_2521_3225 234
1227 3300035691 Ga0373931_0006356 Ga0373931_0006356_1868_2572 234
1228 3300035691 Ga0373931_0008479 Ga0373931_0008479_1180_1884 234
1229 3300035691 Ga0373931_0066158 Ga0373931_0066158_683_1402 234
1230 3300035691 Ga0373931_0089514 Ga0373931_0089514_541_1245 234
1231 3300035691 Ga0373931_0313329 Ga0373931_0313329_235_939 234
1232 3300035691 Ga0373931_0325217 Ga0373931_0325217_26_730 234
1233 3300035692 Ga0373935_0000229 Ga0373935_0000229_20087_20791 234
1234 3300035692 Ga0373935_0000882 Ga0373935_0000882_13968_14672 234
1235 3300035692 Ga0373935_0019969 Ga0373935_0019969_35_739 234
1236 3300035692 Ga0373935_0218091 Ga0373935_0218091_267_971 234
1237 3300035695 Ga0373927_0000071 Ga0373927_0000071_14902_15660 234
1238 3300035695 Ga0373927_0000414 Ga0373927_0000414_18437_19141 234
1239 3300035695 Ga0373927_0007062 Ga0373927_0007062_5109_5813 234
1240 3300035695 Ga0373927_0011507 Ga0373927_0011507_879_1607 234
1241 3300035695 Ga0373927_0025829 Ga0373927_0025829_2290_2994 234
1242 3300035695 Ga0373927_0030092 Ga0373927_0030092_2663_3367 234
1243 3300035695 Ga0373927_0099124 Ga0373927_0099124_725_1429 234
1244 3300035695 Ga0373927_0103253 Ga0373927_0103253_381_1085 234
1245 3300035695 Ga0373927_0284219 Ga0373927_0284219_17_721 234
1246 3300035695 Ga0373927_0332372 Ga0373927_0332372_47_751 234
1247 3300035695 Ga0373927_0528331 Ga0373927_0528331_65_769 234
1248 3300035724 Ga0373933_0004204 Ga0373933_0004204_1683_2387 234
1249 3300035724 Ga0373933_0029183 Ga0373933_0029183_2176_2880 234
1250 3300035724 Ga0373933_0034112 Ga0373933_0034112_1499_2203 234
1251 3300035724 Ga0373933_0239607 Ga0373933_0239607_260_964 234
1252 3300035724 Ga0373933_0286839 Ga0373933_0286839_334_1038 234
1253 3300035725 Ga0373947_0000275 Ga0373947_0000275_15963_16667 234
1254 3300035725 Ga0373947_0000540 Ga0373947_0000540_8834_9592 234
1255 3300035725 Ga0373947_0003876 Ga0373947_0003876_4859_5587 234
1256 3300035725 Ga0373947_0004993 Ga0373947_0004993_6398_7102 234
1257 3300035725 Ga0373947_0017419 Ga0373947_0017419_540_1244 234
1258 3300035725 Ga0373947_0036936 Ga0373947_0036936_1404_2108 234
1259 3300035725 Ga0373947_0147132 Ga0373947_0147132_308_1012 234
1260 3300035725 Ga0373947_0258951 Ga0373947_0258951_404_1108 234
1261 3300036401 Ga0373937_0031431 Ga0373937_0031431_1404_2108 234
1262 3300036401 Ga0373937_0039136 Ga0373937_0039136_320_1024 234
1263 3300036401 Ga0373937_0045462 Ga0373937_0045462_3262_3966 234
1264 3300036401 Ga0373937_0045643 Ga0373937_0045643_2765_3469 234
1265 3300036401 Ga0373937_0070190 Ga0373937_0070190_1959_2663 234
1266 3300036401 Ga0373937_0193491 Ga0373937_0193491_288_992 234
1267 3300036401 Ga0373937_0212345 Ga0373937_0212345_710_1468 234
1268 3300036401 Ga0373937_0261930 Ga0373937_0261930_611_1315 234
1269 3300036401 Ga0373937_0389320 Ga0373937_0389320_531_1235 234
1270 3300037068 Ga0373925_0002725 Ga0373925_0002725_4017_4721 234
1271 3300037068 Ga0373925_0030853 Ga0373925_0030853_2016_2720 234
1272 3300037068 Ga0373925_0040457 Ga0373925_0040457_1332_2036 234
1273 3300037068 Ga0373925_0054967 Ga0373925_0054967_2103_2807 234
1274 3300037068 Ga0373925_0087640 Ga0373925_0087640_1274_1978 234
1275 3300037068 Ga0373925_0100456 Ga0373925_0100456_525_1229 234
1276 3300037068 Ga0373925_0120831 Ga0373925_0120831_843_1547 234
1277 3300037068 Ga0373925_0206794 Ga0373925_0206794_100_813 234
1278 3300037068 Ga0373925_0391554 Ga0373925_0391554_53_757 234
1279 3300037068 Ga0373925_0457061 Ga0373925_0457061_217_921 234
1280 3300037068 Ga0373925_0471153 Ga0373925_0471153_140_856 234
1281 3300037312 Ga0395899_0008599 Ga0395899_0008599_2385_3089 234
1282 3300037312 Ga0395899_0171700 Ga0395899_0171700_489_1193 234
1283 3300037418 Ga0395900_0013738 Ga0395900_0013738_1809_2513 234
1284 3300037418 Ga0395900_0021345 Ga0395900_0021345_2889_3593 234
1285 3300037418 Ga0395900_0054470 Ga0395900_0054470_913_1617 234
1286 3300037418 Ga0395900_0259612 Ga0395900_0259612_361_1065 234
1287 3300037418 Ga0395900_0796875 Ga0395900_0796875_82_786 234
1288 3300037466 Ga0395898_0006919 Ga0395898_0006919_3136_3840 234
1289 3300037466 Ga0395898_0024139 Ga0395898_0024139_5047_5751 234
1290 3300037466 Ga0395898_0065456 Ga0395898_0065456_1834_2538 234
1291 3300037466 Ga0395898_0140754 Ga0395898_0140754_689_1393 234
1292 3300037471 Ga0395905_0030266 Ga0395905_0030266_2318_3022 234
1293 3300037471 Ga0395905_0284582 Ga0395905_0284582_761_1465 234
1294 3300037471 Ga0395905_0577770 Ga0395905_0577770_32_736 234
1295 3300037853 Ga0436364_0066511 Ga0436364_0066511_340_1044 234
1296 3300038443 Ga0395901_0005295 Ga0395901_0005295_5793_6497 234
1297 3300038443 Ga0395901_0025268 Ga0395901_0025268_3192_3896 234
1298 3300038443 Ga0395901_0157594 Ga0395901_0157594_980_1684 234
1299 3300038443 Ga0395901_0222005 Ga0395901_0222005_100_804 234
1300 3300038443 Ga0395901_0566758 Ga0395901_0566758_219_923 234
1301 3300038443 Ga0395901_0896520 Ga0395901_0896520_143_847 234
1302 3300039437 Ga0436365_0290905 Ga0436365_0290905_246_950 234
1303 3300039437 Ga0436365_0643464 Ga0436365_0643464_75_779 234
1304 3300039437 Ga0436365_0906128 Ga0436365_0906128_479_1183 234
1305 3300039437 Ga0436365_1318098 Ga0436365_1318098_131_835 234
1306 3300039437 Ga0436365_1835535 Ga0436365_1835535_251_955 234
1307 3300039437 Ga0436365_1883031 Ga0436365_1883031_9579_10283 234
1308 3300039438 Ga0436360_0160052 Ga0436360_0160052_264_968 234
1309 3300039438 Ga0436360_0336915 Ga0436360_0336915_225_929 234
1310 3300039438 Ga0436360_0347139 Ga0436360_0347139_479_1183 234
1311 3300039438 Ga0436360_0372244 Ga0436360_0372244_167_871 234
1312 3300039438 Ga0436360_0467044 Ga0436360_0467044_8735_9439 234
1313 3300039447 Ga0436361_0486257 Ga0436361_0486257_807_1511 234
1314 3300039447 Ga0436361_1221223 Ga0436361_1221223_1227_1940 234
1315 3300039450 Ga0436363_1356934 Ga0436363_1356934_80_784 234
1316 3300039450 Ga0436363_1697326 Ga0436363_1697326_360_1064 234
1317 3300039453 Ga0436362_0313826 Ga0436362_0313826_386_1090 234
1318 3300039453 Ga0436362_0755152 Ga0436362_0755152_129_833 234
1319 3300039453 Ga0436362_0815359 Ga0436362_0815359_1753_2457 234
1320 3300041413 Ga0439465_0041847 Ga0439465_0041847_142_873 234
1321 3300041452 Ga0451793_0668962 Ga0451793_0668962_41_745 234
1322 3300041456 Ga0451795_0064442 Ga0451795_0064442_352_1056 234
1323 3300041459 Ga0451800_0438865 Ga0451800_0438865_417_1121 234
1324 3300041492 Ga0451835_1226713 Ga0451835_1226713_29_754 234
1325 3300041503 Ga0451847_0960825 Ga0451847_0960825_71_775 234
1326 3300042876 Ga0451577_0047462 Ga0451577_0047462_2301_3005 234
1327 3300044656 Ga0466969_0016988 Ga0466969_0016988_2932_3636 234
1328 3300044658 Ga0466972_0000193 Ga0466972_0000193_11981_12688 234
1329 3300044658 Ga0466972_0014447 Ga0466972_0014447_2228_2932 234
1330 3300044673 Ga0453683_0025310 Ga0453683_0025310_1102_1806 234
1331 3300044683 Ga0466965_0176727 Ga0466965_0176727_92_799 234
1332 3300044684 Ga0466966_0000551 Ga0466966_0000551_16168_16872 234
1333 3300044693 Ga0466961_0000020 Ga0466961_0000020_49731_50435 234
1334 3300044694 Ga0466963_0014002 Ga0466963_0014002_2226_2930 234
1335 3300044694 Ga0466963_0119916 Ga0466963_0119916_790_1497 234
1336 3300044694 Ga0466963_0231314 Ga0466963_0231314_158_862 234
1337 3300044712 Ga0453684_0024772 Ga0453684_0024772_1213_1917 234
1338 3300044735 Ga0466968_0009179 Ga0466968_0009179_2230_2934 234
1339 3300044842 Ga0466957_0076196 Ga0466957_0076196_443_1147 234
1340 3300044901 Ga0466960_0039543 Ga0466960_0039543_707_1411 234
1341 3300045049 Ga0466959_0037674 Ga0466959_0037674_2797_3501 234
1342 3300045051 Ga0451576_0030558 Ga0451576_0030558_3963_4667 234
1343 3300045051 Ga0451576_0054640 Ga0451576_0054640_2486_3190 234
1344 3300045051 Ga0451576_0076080 Ga0451576_0076080_1432_2136 234
1345 3300045051 Ga0451576_0274464 Ga0451576_0274464_364_1068 234
1346 3300045976 Ga0466967_0002756 Ga0466967_0002756_2586_3293 234
1347 3300045976 Ga0466967_0014710 Ga0466967_0014710_2524_3228 234
1348 3300045976 Ga0466967_0070110 Ga0466967_0070110_1762_2466 234
1349 3300045976 Ga0466967_0100278 Ga0466967_0100278_1902_2606 234
1350 3300046452 Ga0495617_026442 Ga0495617_026442_1221_1925 234
1351 3300046454 Ga0495592_0003051 Ga0495592_0003051_7386_8144 234
1352 3300046454 Ga0495592_0003383 Ga0495592_0003383_2775_3479 234
1353 3300046454 Ga0495592_0036322 Ga0495592_0036322_2767_3471 234
1354 3300046454 Ga0495592_0049426 Ga0495592_0049426_1373_2077 234
1355 3300046454 Ga0495592_0058136 Ga0495592_0058136_2137_2841 234
1356 3300046454 Ga0495592_0160159 Ga0495592_0160159_446_1150 234
1357 3300046455 Ga0495603_0000035 Ga0495603_0000035_11264_12022 234
1358 3300046455 Ga0495603_0001059 Ga0495603_0001059_1692_2396 234
1359 3300046455 Ga0495603_0006718 Ga0495603_0006718_73_777 234
1360 3300046455 Ga0495603_0007225 Ga0495603_0007225_3468_4196 234
1361 3300046455 Ga0495603_0021313 Ga0495603_0021313_2270_2974 234
1362 3300046455 Ga0495603_0048434 Ga0495603_0048434_1620_2324 234
1363 3300046455 Ga0495603_0132535 Ga0495603_0132535_595_1299 234
1364 3300046455 Ga0495603_0386525 Ga0495603_0386525_43_747 234
1365 3300046457 Ga0495590_0039422 Ga0495590_0039422_753_1457 234
1366 3300046457 Ga0495590_0103306 Ga0495590_0103306_48_752 234
1367 3300046457 Ga0495590_0172169 Ga0495590_0172169_18_722 234
1368 3300046459 Ga0495629_0000081 Ga0495629_0000081_69072_69776 234
1369 3300046459 Ga0495629_0000269 Ga0495629_0000269_39673_40377 234
1370 3300046459 Ga0495629_0000612 Ga0495629_0000612_15527_16231 234
1371 3300046459 Ga0495629_0011200 Ga0495629_0011200_1803_2507 234
1372 3300046459 Ga0495629_0058439 Ga0495629_0058439_1496_2203 234
1373 3300046459 Ga0495629_0090143 Ga0495629_0090143_702_1406 234
1374 3300046459 Ga0495629_0129759 Ga0495629_0129759_791_1495 234
1375 3300046459 Ga0495629_0312568 Ga0495629_0312568_293_997 234
1376 3300046460 Ga0495638_0004483 Ga0495638_0004483_9187_9891 234
1377 3300046460 Ga0495638_0105267 Ga0495638_0105267_585_1289 234
1378 3300046461 Ga0495641_0005556 Ga0495641_0005556_6095_6853 234
1379 3300046461 Ga0495641_0008400 Ga0495641_0008400_1237_1941 234
1380 3300046461 Ga0495641_0019447 Ga0495641_0019447_1761_2465 234
1381 3300046462 Ga0495651_0005350 Ga0495651_0005350_3970_4674 234
1382 3300046462 Ga0495651_0009999 Ga0495651_0009999_3841_4545 234
1383 3300046462 Ga0495651_0030088 Ga0495651_0030088_2705_3409 234
1384 3300046462 Ga0495651_0031301 Ga0495651_0031301_3144_3851 234
1385 3300046462 Ga0495651_0031832 Ga0495651_0031832_3227_3931 234
1386 3300046462 Ga0495651_0113904 Ga0495651_0113904_572_1276 234
1387 3300046462 Ga0495651_0148779 Ga0495651_0148779_752_1456 234
1388 3300046463 Ga0495653_0000399 Ga0495653_0000399_19513_20217 234
1389 3300046463 Ga0495653_0036295 Ga0495653_0036295_1482_2186 234
1390 3300046463 Ga0495653_0057546 Ga0495653_0057546_654_1358 234
1391 3300046463 Ga0495653_0070117 Ga0495653_0070117_649_1353 234
1392 3300046463 Ga0495653_0153653 Ga0495653_0153653_68_772 234
1393 3300046471 Ga0495650_0036071 Ga0495650_0036071_963_1667 234
1394 3300046471 Ga0495650_0064595 Ga0495650_0064595_613_1317 234
1395 3300046472 Ga0495580_0000449 Ga0495580_0000449_29473_30177 234
1396 3300046472 Ga0495580_0005664 Ga0495580_0005664_285_1043 234
1397 3300046472 Ga0495580_0058049 Ga0495580_0058049_1333_2037 234
1398 3300046472 Ga0495580_0058144 Ga0495580_0058144_935_1639 234
1399 3300046472 Ga0495580_0100922 Ga0495580_0100922_1046_1750 234
1400 3300046472 Ga0495580_0405326 Ga0495580_0405326_146_850 234
1401 3300046473 Ga0495582_0000021 Ga0495582_0000021_3694_4398 234
1402 3300046473 Ga0495582_0024180 Ga0495582_0024180_696_1400 234
1403 3300046473 Ga0495582_0030917 Ga0495582_0030917_536_1240 234
1404 3300046473 Ga0495582_0258821 Ga0495582_0258821_135_842 234
1405 3300046473 Ga0495582_0354229 Ga0495582_0354229_74_778 234
1406 3300046474 Ga0495605_0144926 Ga0495605_0144926_261_965 234
1407 3300046475 Ga0495639_0000010 Ga0495639_0000010_7158_7916 234
1408 3300046475 Ga0495639_0009316 Ga0495639_0009316_3000_3704 234
1409 3300046475 Ga0495639_0162912 Ga0495639_0162912_294_1022 234
1410 3300046475 Ga0495639_0196875 Ga0495639_0196875_241_945 234
1411 3300046476 Ga0495662_0000261 Ga0495662_0000261_10526_11230 234
1412 3300046476 Ga0495662_0008429 Ga0495662_0008429_3505_4209 234
1413 3300046476 Ga0495662_0016950 Ga0495662_0016950_1682_2386 234
1414 3300046476 Ga0495662_0025894 Ga0495662_0025894_536_1240 234
1415 3300046476 Ga0495662_0034302 Ga0495662_0034302_373_1077 234
1416 3300046476 Ga0495662_0088131 Ga0495662_0088131_139_843 234
1417 3300046477 Ga0495664_0000736 Ga0495664_0000736_9065_9769 234
1418 3300046477 Ga0495664_0004738 Ga0495664_0004738_5370_6074 234
1419 3300046477 Ga0495664_0007307 Ga0495664_0007307_1518_2222 234
1420 3300046477 Ga0495664_0007928 Ga0495664_0007928_3817_4521 234
1421 3300046477 Ga0495664_0028294 Ga0495664_0028294_1381_2139 234
1422 3300046477 Ga0495664_0092367 Ga0495664_0092367_427_1131 234
1423 3300046477 Ga0495664_0238942 Ga0495664_0238942_352_1056 234
1424 3300046491 Ga0495584_0025120 Ga0495584_0025120_272_976 234
1425 3300046492 Ga0495585_0001696 Ga0495585_0001696_5762_6466 234
1426 3300046492 Ga0495585_0189940 Ga0495585_0189940_12_716 234
1427 3300046492 Ga0495585_0278597 Ga0495585_0278597_31_735 234
1428 3300046499 Ga0495594_0000979 Ga0495594_0000979_3506_4210 234
1429 3300046499 Ga0495594_0021023 Ga0495594_0021023_2185_2889 234
1430 3300046499 Ga0495594_0292065 Ga0495594_0292065_152_856 234
1431 3300046501 Ga0495607_0014000 Ga0495607_0014000_1193_1897 234
1432 3300046506 Ga0495583_0138614 Ga0495583_0138614_151_855 234
1433 3300046507 Ga0495606_0001170 Ga0495606_0001170_20591_21295 234
1434 3300046507 Ga0495606_0146458 Ga0495606_0146458_630_1334 234
1435 3300046511 Ga0495608_0001226 Ga0495608_0001226_2748_3452 234
1436 3300046511 Ga0495608_0016478 Ga0495608_0016478_2680_3384 234
1437 3300046511 Ga0495608_0021826 Ga0495608_0021826_1271_1975 234
1438 3300046511 Ga0495608_0031182 Ga0495608_0031182_1721_2425 234
1439 3300046511 Ga0495608_0034772 Ga0495608_0034772_2230_2934 234
1440 3300046511 Ga0495608_0069160 Ga0495608_0069160_420_1124 234
1441 3300046511 Ga0495608_0089598 Ga0495608_0089598_463_1167 234
1442 3300046514 Ga0495618_0014879 Ga0495618_0014879_201_905 234
1443 3300046514 Ga0495618_0014997 Ga0495618_0014997_3220_3924 234
1444 3300046514 Ga0495618_0026734 Ga0495618_0026734_2187_2891 234
1445 3300046514 Ga0495618_0059293 Ga0495618_0059293_468_1172 234
1446 3300046514 Ga0495618_0078648 Ga0495618_0078648_968_1672 234
1447 3300046514 Ga0495618_0293219 Ga0495618_0293219_162_866 234
1448 3300046516 Ga0495628_0009019 Ga0495628_0009019_1899_2603 234
1449 3300046516 Ga0495628_0012048 Ga0495628_0012048_1965_2669 234
1450 3300046516 Ga0495628_0029893 Ga0495628_0029893_145_849 234
1451 3300046516 Ga0495628_0069679 Ga0495628_0069679_180_884 234
1452 3300046516 Ga0495628_0106266 Ga0495628_0106266_1431_2135 234
1453 3300046516 Ga0495628_0435079 Ga0495628_0435079_66_770 234
1454 3300046516 Ga0495628_0533755 Ga0495628_0533755_21_725 234
1455 3300046517 Ga0495630_0002218 Ga0495630_0002218_5110_5814 234
1456 3300046517 Ga0495630_0021361 Ga0495630_0021361_854_1558 234
1457 3300046517 Ga0495630_0280144 Ga0495630_0280144_400_1104 234
1458 3300046517 Ga0495630_0283650 Ga0495630_0283650_180_884 234
1459 3300046517 Ga0495630_0464862 Ga0495630_0464862_176_880 234
1460 3300046517 Ga0495630_0619573 Ga0495630_0619573_89_793 234
1461 3300046519 Ga0495632_0166000 Ga0495632_0166000_182_886 234
1462 3300046520 Ga0495637_0067395 Ga0495637_0067395_456_1160 234
1463 3300046520 Ga0495637_0099910 Ga0495637_0099910_409_1113 234
1464 3300046522 Ga0495643_0006750 Ga0495643_0006750_2246_2950 234
1465 3300046523 Ga0495644_0003755 Ga0495644_0003755_2368_3072 234
1466 3300046524 Ga0495648_0212507 Ga0495648_0212507_100_804 234
1467 3300046525 Ga0495663_0032939 Ga0495663_0032939_794_1498 234
1468 3300046526 Ga0495666_0031225 Ga0495666_0031225_887_1645 234
1469 3300046526 Ga0495666_0108952 Ga0495666_0108952_91_795 234
1470 3300046529 Ga0495652_0006874 Ga0495652_0006874_9181_9885 234
1471 3300046529 Ga0495652_0008672 Ga0495652_0008672_5258_5962 234
1472 3300046529 Ga0495652_0019786 Ga0495652_0019786_5236_5940 234
1473 3300046529 Ga0495652_0079863 Ga0495652_0079863_416_1120 234
1474 3300046531 Ga0495665_0002966 Ga0495665_0002966_5087_5791 234
1475 3300046531 Ga0495665_0009534 Ga0495665_0009534_2696_3400 234
1476 3300046531 Ga0495665_0024212 Ga0495665_0024212_1374_2078 234
1477 3300046531 Ga0495665_0031922 Ga0495665_0031922_897_1601 234
1478 3300046533 Ga0495640_0002964 Ga0495640_0002964_1488_2192 234
1479 3300046533 Ga0495640_0013343 Ga0495640_0013343_2371_3075 234
1480 3300046533 Ga0495640_0018374 Ga0495640_0018374_3747_4451 234
1481 3300046533 Ga0495640_0027630 Ga0495640_0027630_174_878 234
1482 3300046533 Ga0495640_0032420 Ga0495640_0032420_2214_2918 234
1483 3300046535 Ga0495586_0001814 Ga0495586_0001814_8907_9611 234
1484 3300046535 Ga0495586_0034389 Ga0495586_0034389_540_1244 234
1485 3300046535 Ga0495586_0248171 Ga0495586_0248171_152_856 234
1486 3300046536 Ga0495587_0001432 Ga0495587_0001432_254_958 234
1487 3300046536 Ga0495587_0006986 Ga0495587_0006986_4767_5471 234
1488 3300046536 Ga0495587_0015759 Ga0495587_0015759_3003_3707 234
1489 3300046536 Ga0495587_0022963 Ga0495587_0022963_1252_1956 234
1490 3300046536 Ga0495587_0034748 Ga0495587_0034748_1090_1794 234
1491 3300046536 Ga0495587_0059702 Ga0495587_0059702_1025_1729 234
1492 3300046536 Ga0495587_0202228 Ga0495587_0202228_95_799 234
1493 3300046536 Ga0495587_0347696 Ga0495587_0347696_107_811 234
1494 3300046537 Ga0495598_0085697 Ga0495598_0085697_269_973 234
1495 3300046537 Ga0495598_0108743 Ga0495598_0108743_36_740 234
1496 3300046537 Ga0495598_0122732 Ga0495598_0122732_11_715 234
1497 3300046539 Ga0495621_0082598 Ga0495621_0082598_205_909 234
1498 3300046539 Ga0495621_0102940 Ga0495621_0102940_44_748 234
1499 3300046542 Ga0495597_0067621 Ga0495597_0067621_647_1351 234
1500 3300046543 Ga0495645_0001776 Ga0495645_0001776_4523_5227 234
1501 3300046543 Ga0495645_0001836 Ga0495645_0001836_2877_3581 234
1502 3300046543 Ga0495645_0002109 Ga0495645_0002109_5688_6392 234
1503 3300046543 Ga0495645_0008749 Ga0495645_0008749_3089_3793 234
1504 3300046543 Ga0495645_0019408 Ga0495645_0019408_3257_3961 234
1505 3300046543 Ga0495645_0148712 Ga0495645_0148712_653_1357 234
1506 3300046543 Ga0495645_0466439 Ga0495645_0466439_70_774 234
1507 3300046557 Ga0495622_0008049 Ga0495622_0008049_3309_4013 234
1508 3300046557 Ga0495622_0010565 Ga0495622_0010565_2727_3431 234
1509 3300046557 Ga0495622_0127322 Ga0495622_0127322_243_947 234
1510 3300046558 Ga0495633_0056982 Ga0495633_0056982_98_802 234
1511 3300046558 Ga0495633_0118360 Ga0495633_0118360_462_1166 234
1512 3300046558 Ga0495633_0262006 Ga0495633_0262006_21_725 234
1513 3300046559 Ga0495667_0001452 Ga0495667_0001452_14631_15335 234
1514 3300046559 Ga0495667_0008441 Ga0495667_0008441_3960_4718 234
1515 3300046559 Ga0495667_0020781 Ga0495667_0020781_645_1349 234
1516 3300046559 Ga0495667_0021237 Ga0495667_0021237_1464_2168 234
1517 3300046559 Ga0495667_0023177 Ga0495667_0023177_2847_3551 234
1518 3300046559 Ga0495667_0042971 Ga0495667_0042971_81_785 234
1519 3300046559 Ga0495667_0044112 Ga0495667_0044112_276_980 234
1520 3300046559 Ga0495667_0206978 Ga0495667_0206978_489_1193 234
1521 3300046615 Ga0495656_0004963 Ga0495656_0004963_2764_3468 234
1522 3300046615 Ga0495656_0012418 Ga0495656_0012418_133_837 234
1523 3300046616 Ga0495668_0025425 Ga0495668_0025425_2112_2816 234
1524 3300046616 Ga0495668_0081519 Ga0495668_0081519_621_1325 234
1525 3300046616 Ga0495668_0196923 Ga0495668_0196923_324_1028 234
1526 3300046642 Ga0495634_0000261 Ga0495634_0000261_10640_11398 234
1527 3300046642 Ga0495634_0006321 Ga0495634_0006321_654_1358 234
1528 3300046642 Ga0495634_0011593 Ga0495634_0011593_3443_4147 234
1529 3300046642 Ga0495634_0017261 Ga0495634_0017261_3219_3923 234
1530 3300046642 Ga0495634_0039498 Ga0495634_0039498_1875_2579 234
1531 3300046642 Ga0495634_0072933 Ga0495634_0072933_356_1060 234
1532 3300046642 Ga0495634_0096210 Ga0495634_0096210_834_1538 234
1533 3300046648 Ga0495611_0004521 Ga0495611_0004521_3566_4270 234
1534 3300046648 Ga0495611_0054665 Ga0495611_0054665_354_1058 234
1535 3300046648 Ga0495611_0163640 Ga0495611_0163640_313_1017 234
1536 3300046660 Ga0495625_0049301 Ga0495625_0049301_339_1043 234
1537 3300046660 Ga0495625_0256375 Ga0495625_0256375_224_928 234
1538 3300046663 Ga0495635_0000088 Ga0495635_0000088_38233_38937 234
1539 3300046663 Ga0495635_0000438 Ga0495635_0000438_9760_10464 234
1540 3300046663 Ga0495635_0001380 Ga0495635_0001380_14735_15442 234
1541 3300046663 Ga0495635_0003521 Ga0495635_0003521_3865_4569 234
1542 3300046663 Ga0495635_0006545 Ga0495635_0006545_1584_2288 234
1543 3300046663 Ga0495635_0017940 Ga0495635_0017940_1748_2452 234
1544 3300046663 Ga0495635_0049932 Ga0495635_0049932_1857_2561 234
1545 3300046664 Ga0495659_0001977 Ga0495659_0001977_1777_2481 234
1546 3300046665 Ga0495661_0054082 Ga0495661_0054082_422_1126 234
1547 3300046665 Ga0495661_0176969 Ga0495661_0176969_96_800 234
1548 3300046674 Ga0495588_0019653 Ga0495588_0019653_2264_3022 234
1549 3300046674 Ga0495588_0051556 Ga0495588_0051556_376_1080 234
1550 3300046674 Ga0495588_0088287 Ga0495588_0088287_882_1586 234
1551 3300046674 Ga0495588_0213546 Ga0495588_0213546_186_890 234
1552 3300046675 Ga0495657_0008178 Ga0495657_0008178_5154_5858 234
1553 3300046675 Ga0495657_0010455 Ga0495657_0010455_5295_6002 234
1554 3300046675 Ga0495657_0012948 Ga0495657_0012948_4047_4751 234
1555 3300046675 Ga0495657_0041171 Ga0495657_0041171_954_1658 234
1556 3300046675 Ga0495657_0061813 Ga0495657_0061813_1236_1940 234
1557 3300046675 Ga0495657_0242498 Ga0495657_0242498_175_879 234
1558 3300046675 Ga0495657_0319519 Ga0495657_0319519_12_770 234
1559 3300046678 Ga0495599_0001137 Ga0495599_0001137_9181_9885 234
1560 3300046678 Ga0495599_0010283 Ga0495599_0010283_3909_4613 234
1561 3300046678 Ga0495599_0035710 Ga0495599_0035710_1814_2518 234
1562 3300046678 Ga0495599_0082276 Ga0495599_0082276_1040_1744 234
1563 3300046678 Ga0495599_0231136 Ga0495599_0231136_101_805 234
1564 3300046679 Ga0495623_0006628 Ga0495623_0006628_6562_7266 234
1565 3300046679 Ga0495623_0010588 Ga0495623_0010588_49_753 234
1566 3300046679 Ga0495623_0012243 Ga0495623_0012243_2032_2736 234
1567 3300046680 Ga0495646_0002433 Ga0495646_0002433_9876_10580 234
1568 3300046680 Ga0495646_0022684 Ga0495646_0022684_2354_3058 234
1569 3300046680 Ga0495646_0026635 Ga0495646_0026635_2193_2897 234
1570 3300046680 Ga0495646_0048965 Ga0495646_0048965_1203_1907 234
1571 3300046680 Ga0495646_0057288 Ga0495646_0057288_742_1446 234
1572 3300046680 Ga0495646_0088987 Ga0495646_0088987_362_1066 234
1573 3300046681 Ga0495647_0003550 Ga0495647_0003550_1352_2110 234
1574 3300046681 Ga0495647_0054257 Ga0495647_0054257_506_1210 234
1575 3300046683 Ga0495658_0000771 Ga0495658_0000771_12333_13037 234
1576 3300046683 Ga0495658_0000892 Ga0495658_0000892_2329_3033 234
1577 3300046689 Ga0495613_0027628 Ga0495613_0027628_2556_3260 234
1578 3300046689 Ga0495613_0040776 Ga0495613_0040776_797_1501 234
1579 3300046689 Ga0495613_0045342 Ga0495613_0045342_1375_2082 234
1580 3300046689 Ga0495613_0053833 Ga0495613_0053833_12_716 234
1581 3300046689 Ga0495613_0100556 Ga0495613_0100556_812_1570 234
1582 3300046689 Ga0495613_0111521 Ga0495613_0111521_1180_1884 234
1583 3300046689 Ga0495613_0181685 Ga0495613_0181685_242_946 234
1584 3300046689 Ga0495613_0273999 Ga0495613_0273999_261_965 234
1585 3300046689 Ga0495613_0508572 Ga0495613_0508572_13_717 234
1586 3300046690 Ga0495624_0000682 Ga0495624_0000682_17700_18458 234
1587 3300046690 Ga0495624_0001570 Ga0495624_0001570_11964_12668 234
1588 3300046690 Ga0495624_0099630 Ga0495624_0099630_70_774 234
1589 3300046690 Ga0495624_0115349 Ga0495624_0115349_846_1574 234
1590 3300046690 Ga0495624_0120586 Ga0495624_0120586_130_834 234
1591 3300046690 Ga0495624_0217723 Ga0495624_0217723_175_879 234
1592 3300046690 Ga0495624_0222201 Ga0495624_0222201_216_923 234
1593 3300046690 Ga0495624_0236040 Ga0495624_0236040_179_883 234
1594 3300046690 Ga0495624_0368895 Ga0495624_0368895_50_754 234
1595 3300046691 Ga0495670_0011391 Ga0495670_0011391_677_1381 234
1596 3300046692 Ga0495671_0078355 Ga0495671_0078355_223_927 234
1597 3300046692 Ga0495671_0320799 Ga0495671_0320799_16_720 234
1598 3300046694 Ga0495649_0119141 Ga0495649_0119141_188_892 234
1599 3300046794 Ga0495589_0033211 Ga0495589_0033211_955_1659 234
1600 3300046809 Ga0495600_0000484 Ga0495600_0000484_5098_5802 234
1601 3300046809 Ga0495600_0010662 Ga0495600_0010662_453_1157 234
1602 3300046809 Ga0495600_0018989 Ga0495600_0018989_1220_1924 234
1603 3300046809 Ga0495600_0023629 Ga0495600_0023629_201_905 234
1604 3300046809 Ga0495600_0041250 Ga0495600_0041250_2223_2927 234
1605 3300046809 Ga0495600_0072934 Ga0495600_0072934_880_1584 234
1606 3300046810 Ga0495660_0150270 Ga0495660_0150270_259_963 234
1607 3300047315 Ga0495581_0000018 Ga0495581_0000018_9542_10300 234
1608 3300047315 Ga0495581_0012302 Ga0495581_0012302_3281_4009 234
1609 3300047315 Ga0495581_0025033 Ga0495581_0025033_1769_2473 234
1610 3300047315 Ga0495581_0077638 Ga0495581_0077638_24_728 234
1611 3300047315 Ga0495581_0114277 Ga0495581_0114277_47_754 234
1612 3300047317 Ga0495604_0002253 Ga0495604_0002253_6562_7266 234
1613 3300047317 Ga0495604_0005171 Ga0495604_0005171_3315_4019 234
1614 3300047317 Ga0495604_0007540 Ga0495604_0007540_2098_2805 234
1615 3300047317 Ga0495604_0027161 Ga0495604_0027161_2878_3582 234
1616 3300047317 Ga0495604_0048968 Ga0495604_0048968_857_1561 234
1617 3300047317 Ga0495604_0052328 Ga0495604_0052328_400_1104 234
1618 3300047317 Ga0495604_0159461 Ga0495604_0159461_189_893 234
1619 3300047317 Ga0495604_0223755 Ga0495604_0223755_564_1268 234
1620 3300047317 Ga0495604_0532106 Ga0495604_0532106_18_722 234
1621 3300047318 Ga0495636_0177866 Ga0495636_0177866_140_844 234
1622 3300047319 Ga0495674_0000209 Ga0495674_0000209_30459_31163 234
1623 3300047319 Ga0495674_0001257 Ga0495674_0001257_2490_3194 234
1624 3300047319 Ga0495674_0006731 Ga0495674_0006731_2974_3678 234
1625 3300047319 Ga0495674_0021689 Ga0495674_0021689_4066_4770 234
1626 3300047319 Ga0495674_0024470 Ga0495674_0024470_409_1113 234
1627 3300047319 Ga0495674_0074686 Ga0495674_0074686_2046_2750 234
1628 3300047319 Ga0495674_0120810 Ga0495674_0120810_1080_1784 234
1629 3300047319 Ga0495674_0237631 Ga0495674_0237631_150_854 234
1630 3300047319 Ga0495674_0708636 Ga0495674_0708636_21_725 234
1631 3300047320 Ga0495672_0039117 Ga0495672_0039117_1624_2328 234
1632 3300047321 Ga0495676_0033822 Ga0495676_0033822_1226_1930 234
1633 3300047321 Ga0495676_0067018 Ga0495676_0067018_832_1560 234
1634 3300047321 Ga0495676_0086311 Ga0495676_0086311_1269_1973 234
1635 3300047321 Ga0495676_0104485 Ga0495676_0104485_39_743 234
1636 3300047321 Ga0495676_0153223 Ga0495676_0153223_280_984 234
1637 3300047321 Ga0495676_0244022 Ga0495676_0244022_356_1060 234
1638 3300047322 Ga0495680_0004231 Ga0495680_0004231_10063_10767 234
1639 3300047322 Ga0495680_0006139 Ga0495680_0006139_3342_4046 234
1640 3300047322 Ga0495680_0013803 Ga0495680_0013803_1236_1940 234
1641 3300047322 Ga0495680_0024657 Ga0495680_0024657_3748_4452 234
1642 3300047322 Ga0495680_0064241 Ga0495680_0064241_1990_2694 234
1643 3300047322 Ga0495680_0123588 Ga0495680_0123588_781_1485 234
1644 3300047443 Ga0495687_046397 Ga0495687_046397_104_808 234
1645 3300047444 Ga0495675_0000977 Ga0495675_0000977_5512_6216 234
1646 3300047444 Ga0495675_0006091 Ga0495675_0006091_5960_6664 234
1647 3300047444 Ga0495675_0010571 Ga0495675_0010571_1477_2181 234
1648 3300047444 Ga0495675_0060191 Ga0495675_0060191_1351_2055 234
1649 3300047444 Ga0495675_0069346 Ga0495675_0069346_219_923 234
1650 3300047445 Ga0495677_0029191 Ga0495677_0029191_636_1340 234
1651 3300047446 Ga0495679_029497 Ga0495679_029497_919_1623 234
1652 3300047469 Ga0495673_0051765 Ga0495673_0051765_365_1069 234
1653 3300047470 Ga0495681_0038580 Ga0495681_0038580_161_865 234
1654 3300047471 Ga0495684_0001326 Ga0495684_0001326_16470_17174 234
1655 3300047471 Ga0495684_0001766 Ga0495684_0001766_5872_6576 234
1656 3300047471 Ga0495684_0003044 Ga0495684_0003044_8958_9662 234
1657 3300047471 Ga0495684_0003129 Ga0495684_0003129_3852_4556 234
1658 3300047471 Ga0495684_0049314 Ga0495684_0049314_1279_1983 234
1659 3300047471 Ga0495684_0052451 Ga0495684_0052451_740_1444 234
1660 3300047471 Ga0495684_0052531 Ga0495684_0052531_877_1581 234
1661 3300047472 Ga0495686_0224797 Ga0495686_0224797_71_775 234
1662 3300047673 Ga0495593_0000072 Ga0495593_0000072_14082_14840 234
1663 3300047673 Ga0495593_0000566 Ga0495593_0000566_2285_2989 234
1664 3300047673 Ga0495593_0002269 Ga0495593_0002269_2067_2771 234
1665 3300047673 Ga0495593_0015862 Ga0495593_0015862_3494_4198 234
1666 3300047673 Ga0495593_0185378 Ga0495593_0185378_177_881 234
1667 3300048088 Ga0495602_0001719 Ga0495602_0001719_12511_13215 234
1668 3300048088 Ga0495602_0004704 Ga0495602_0004704_11136_11840 234
1669 3300048088 Ga0495602_0024014 Ga0495602_0024014_1771_2475 234
1670 3300048088 Ga0495602_0087538 Ga0495602_0087538_947_1651 234
1671 3300048088 Ga0495602_0430429 Ga0495602_0430429_140_844 234
1672 3300048089 Ga0495614_0036953 Ga0495614_0036953_181_885 234
1673 3300048090 Ga0495615_0014600 Ga0495615_0014600_897_1601 234
1674 3300048903 Ga0496100_0005319 Ga0496100_0005319_2578_3282 234
1675 3300048903 Ga0496100_0153339 Ga0496100_0153339_338_1042 234
1676 3300048903 Ga0496100_0226189 Ga0496100_0226189_453_1157 234
1677 3300048903 Ga0496100_0274498 Ga0496100_0274498_207_911 234
1678 3300048904 Ga0496101_0001907 Ga0496101_0001907_7533_8237 234
1679 3300048904 Ga0496101_0057214 Ga0496101_0057214_1304_2008 234
1680 3300048904 Ga0496101_0094499 Ga0496101_0094499_1398_2102 234
1681 3300048904 Ga0496101_0292434 Ga0496101_0292434_276_980 234
1682 3300048904 Ga0496101_0315057 Ga0496101_0315057_311_1015 234
1683 3300048904 Ga0496101_0329958 Ga0496101_0329958_30_734 234
1684 3300048904 Ga0496101_0378703 Ga0496101_0378703_133_837 234
1685 3300048904 Ga0496101_0430554 Ga0496101_0430554_72_776 234
1686 3300048905 Ga0496102_0010809 Ga0496102_0010809_5938_6642 234
1687 3300048905 Ga0496102_0017860 Ga0496102_0017860_2306_3010 234
1688 3300048905 Ga0496102_0019492 Ga0496102_0019492_4461_5165 234
1689 3300048905 Ga0496102_0324782 Ga0496102_0324782_480_1184 234
1690 3300048905 Ga0496102_0611337 Ga0496102_0611337_86_790 234
1691 3300048906 Ga0496103_0001565 Ga0496103_0001565_4752_5456 234
1692 3300048906 Ga0496103_0047327 Ga0496103_0047327_979_1683 234
1693 3300048906 Ga0496103_0080656 Ga0496103_0080656_868_1587 234
1694 3300048906 Ga0496103_0112794 Ga0496103_0112794_333_1037 234
1695 3300048906 Ga0496103_0237458 Ga0496103_0237458_307_1011 234
1696 3300048907 Ga0496104_0002128 Ga0496104_0002128_3564_4271 234
1697 3300048907 Ga0496104_0049007 Ga0496104_0049007_398_1102 234
1698 3300048907 Ga0496104_0083814 Ga0496104_0083814_1450_2154 234
1699 3300048907 Ga0496104_0106223 Ga0496104_0106223_750_1454 234
1700 3300048907 Ga0496104_0178751 Ga0496104_0178751_1229_1933 234
1701 3300048907 Ga0496104_0264469 Ga0496104_0264469_436_1140 234
1702 3300048908 Ga0496105_0022082 Ga0496105_0022082_3951_4655 234
1703 3300048908 Ga0496105_0219624 Ga0496105_0219624_807_1511 234
1704 3300048908 Ga0496105_0321217 Ga0496105_0321217_336_1040 234
1705 3300048909 Ga0496106_0019749 Ga0496106_0019749_116_820 234
1706 3300048909 Ga0496106_0020041 Ga0496106_0020041_3844_4548 234
1707 3300048909 Ga0496106_0217121 Ga0496106_0217121_106_810 234
1708 3300048909 Ga0496106_0251050 Ga0496106_0251050_521_1225 234
1709 3300048909 Ga0496106_0452910 Ga0496106_0452910_79_798 234
1710 3300048909 Ga0496106_0507082 Ga0496106_0507082_224_928 234
1711 3300048910 Ga0496107_0001840 Ga0496107_0001840_524_1228 234
1712 3300048910 Ga0496107_0057813 Ga0496107_0057813_2017_2721 234
1713 3300048910 Ga0496107_0086918 Ga0496107_0086918_767_1471 234
1714 3300048910 Ga0496107_0304359 Ga0496107_0304359_34_738 234
1715 3300048910 Ga0496107_0328796 Ga0496107_0328796_61_765 234
1716 3300048910 Ga0496107_0423238 Ga0496107_0423238_263_967 234
1717 3300048910 Ga0496107_0551691 Ga0496107_0551691_67_771 234
1718 3300048911 Ga0496108_0052175 Ga0496108_0052175_1713_2417 234
1719 3300048911 Ga0496108_0134651 Ga0496108_0134651_745_1449 234
1720 3300048911 Ga0496108_0207421 Ga0496108_0207421_241_945 234
1721 3300048911 Ga0496108_0470939 Ga0496108_0470939_194_898 234
1722 3300048912 Ga0496109_0000150 Ga0496109_0000150_11818_12522 234
1723 3300048912 Ga0496109_0016079 Ga0496109_0016079_4099_4803 234
1724 3300048912 Ga0496109_0027717 Ga0496109_0027717_4115_4819 234
1725 3300048912 Ga0496109_0052091 Ga0496109_0052091_2478_3185 234
1726 3300048912 Ga0496109_0052472 Ga0496109_0052472_65_769 234
1727 3300048912 Ga0496109_0056795 Ga0496109_0056795_610_1314 234
1728 3300048912 Ga0496109_0521510 Ga0496109_0521510_252_956 234
1729 3300048913 Ga0496110_0028124 Ga0496110_0028124_3053_3757 234
1730 3300048913 Ga0496110_0053806 Ga0496110_0053806_719_1423 234
1731 3300048913 Ga0496110_0123850 Ga0496110_0123850_586_1290 234
1732 3300048913 Ga0496110_0640976 Ga0496110_0640976_14_718 234
1733 3300048914 Ga0496111_0016595 Ga0496111_0016595_1514_2218 234
1734 3300048914 Ga0496111_0024135 Ga0496111_0024135_2130_2834 234
1735 3300048914 Ga0496111_0143132 Ga0496111_0143132_976_1680 234
1736 3300048914 Ga0496111_0149377 Ga0496111_0149377_526_1230 234
1737 3300048914 Ga0496111_0163513 Ga0496111_0163513_770_1477 234
1738 3300048914 Ga0496111_0181744 Ga0496111_0181744_412_1116 234
1739 3300048914 Ga0496111_0290760 Ga0496111_0290760_230_934 234
1740 3300048914 Ga0496111_0401403 Ga0496111_0401403_155_859 234
1741 3300048915 Ga0496112_0000004 Ga0496112_0000004_475798_476502 234
1742 3300048915 Ga0496112_0017832 Ga0496112_0017832_4317_5021 234
1743 3300048915 Ga0496112_0019008 Ga0496112_0019008_1123_1827 234
1744 3300048915 Ga0496112_0020263 Ga0496112_0020263_4180_4884 234
1745 3300048915 Ga0496112_0044369 Ga0496112_0044369_1771_2475 234
1746 3300048915 Ga0496112_0079630 Ga0496112_0079630_2190_2894 234
1747 3300048915 Ga0496112_0213500 Ga0496112_0213500_960_1664 234
1748 3300048915 Ga0496112_0259874 Ga0496112_0259874_112_816 234
1749 3300048915 Ga0496112_0294237 Ga0496112_0294237_473_1177 234
1750 3300048915 Ga0496112_0748508 Ga0496112_0748508_135_839 234
1751 3300048916 Ga0496113_0035814 Ga0496113_0035814_609_1313 234
1752 3300048916 Ga0496113_0054096 Ga0496113_0054096_314_1027 234
1753 3300048916 Ga0496113_0148147 Ga0496113_0148147_1074_1778 234
1754 3300048916 Ga0496113_0259726 Ga0496113_0259726_448_1152 234
1755 3300048917 Ga0496114_0008932 Ga0496114_0008932_4895_5599 234
1756 3300048917 Ga0496114_0025141 Ga0496114_0025141_2926_3630 234
1757 3300048917 Ga0496114_0028221 Ga0496114_0028221_3645_4349 234
1758 3300048917 Ga0496114_0029850 Ga0496114_0029850_1327_2031 234
1759 3300048917 Ga0496114_0650014 Ga0496114_0650014_94_798 234
1760 3300048917 Ga0496114_0859466 Ga0496114_0859466_32_736 234
1761 3300048918 Ga0496115_0001528 Ga0496115_0001528_4277_4981 234
1762 3300048918 Ga0496115_0014005 Ga0496115_0014005_634_1338 234
1763 3300048918 Ga0496115_0024954 Ga0496115_0024954_381_1085 234
1764 3300048918 Ga0496115_0394046 Ga0496115_0394046_135_842 234
1765 3300048918 Ga0496115_0521791 Ga0496115_0521791_125_829 234
1766 3300048920 Ga0496117_0148086 Ga0496117_0148086_286_990 234
1767 3300048921 Ga0496118_0056637 Ga0496118_0056637_737_1441 234
1768 3300048921 Ga0496118_0271058 Ga0496118_0271058_61_765 234
1769 3300048922 Ga0496119_0051978 Ga0496119_0051978_1053_1760 234
1770 3300048923 Ga0496120_0009415 Ga0496120_0009415_3618_4325 234
1771 3300048923 Ga0496120_0104879 Ga0496120_0104879_99_803 234
1772 3300048924 Ga0496121_0109905 Ga0496121_0109905_373_1077 234
1773 3300048924 Ga0496121_0141220 Ga0496121_0141220_922_1626 234
1774 3300048924 Ga0496121_0170687 Ga0496121_0170687_198_902 234
1775 3300048924 Ga0496121_0188737 Ga0496121_0188737_65_769 234
1776 3300048924 Ga0496121_0212880 Ga0496121_0212880_378_1082 234
1777 3300048927 Ga0496124_0016688 Ga0496124_0016688_2920_3624 234
1778 3300048927 Ga0496124_0453357 Ga0496124_0453357_22_726 234
1779 3300048928 Ga0496125_0150162 Ga0496125_0150162_216_920 234
1780 3300048928 Ga0496125_0160175 Ga0496125_0160175_107_814 234
1781 3300048928 Ga0496125_0350792 Ga0496125_0350792_147_851 234
1782 3300048929 Ga0496126_0057994 Ga0496126_0057994_1855_2559 234
1783 3300048929 Ga0496126_0180399 Ga0496126_0180399_219_923 234
1784 3300048929 Ga0496126_0199725 Ga0496126_0199725_785_1489 234
1785 3300048929 Ga0496126_0367099 Ga0496126_0367099_323_1027 234
1786 3300049460 Ga0495682_0064921 Ga0495682_0064921_243_947 234
1787 3300049568 Ga0501031_0043171 Ga0501031_0043171_866_1570 234
1788 3300049569 Ga0501032_0051419 Ga0501032_0051419_1213_1917 234
1789 3300049569 Ga0501032_0340751 Ga0501032_0340751_65_769 234
1790 3300049570 Ga0501033_0149871 Ga0501033_0149871_768_1472 234
1791 3300049570 Ga0501033_0179414 Ga0501033_0179414_802_1506 234
1792 3300049571 Ga0501034_0000516 Ga0501034_0000516_9632_10336 234
1793 3300049571 Ga0501034_0001552 Ga0501034_0001552_6123_6827 234
1794 3300049571 Ga0501034_0003894 Ga0501034_0003894_5993_6697 234
1795 3300049571 Ga0501034_0050571 Ga0501034_0050571_1390_2094 234
1796 3300049571 Ga0501034_0078997 Ga0501034_0078997_841_1545 234
1797 3300049571 Ga0501034_0586588 Ga0501034_0586588_144_848 234
1798 3300049572 Ga0501036_0001269 Ga0501036_0001269_17039_17743 234
1799 3300049572 Ga0501036_0020963 Ga0501036_0020963_3203_3907 234
1800 3300049572 Ga0501036_0043623 Ga0501036_0043623_155_859 234
1801 3300049572 Ga0501036_0047889 Ga0501036_0047889_1272_1976 234
1802 3300049573 Ga0501037_0003480 Ga0501037_0003480_206_910 234
1803 3300049573 Ga0501037_0045797 Ga0501037_0045797_706_1410 234
1804 3300049573 Ga0501037_0093001 Ga0501037_0093001_779_1483 234
1805 3300049573 Ga0501037_0346723 Ga0501037_0346723_48_752 234
1806 3300049574 Ga0501038_0028938 Ga0501038_0028938_3920_4624 234
1807 3300049574 Ga0501038_0041063 Ga0501038_0041063_1539_2243 234
1808 3300049574 Ga0501038_0073051 Ga0501038_0073051_2106_2810 234
1809 3300049575 Ga0501039_0021697 Ga0501039_0021697_862_1566 234
1810 3300049575 Ga0501039_0094523 Ga0501039_0094523_63_767 234
1811 3300049575 Ga0501039_0562619 Ga0501039_0562619_75_779 234
1812 3300049576 Ga0501040_0007018 Ga0501040_0007018_212_916 234
1813 3300049577 Ga0501041_0016019 Ga0501041_0016019_598_1302 234
1814 3300049577 Ga0501041_0116157 Ga0501041_0116157_508_1212 234
1815 3300049578 Ga0501042_0148565 Ga0501042_0148565_454_1158 234
1816 3300049579 Ga0501043_0000487 Ga0501043_0000487_26935_27639 234
1817 3300049579 Ga0501043_0029788 Ga0501043_0029788_194_898 234
1818 3300049579 Ga0501043_0030237 Ga0501043_0030237_2935_3639 234
1819 3300049580 Ga0501046_0087631 Ga0501046_0087631_1481_2185 234
1820 3300049580 Ga0501046_0205932 Ga0501046_0205932_280_984 234
1821 3300049580 Ga0501046_0259680 Ga0501046_0259680_410_1114 234
1822 3300049580 Ga0501046_0281340 Ga0501046_0281340_486_1190 234
1823 3300049581 Ga0501047_0000100 Ga0501047_0000100_78232_78936 234
1824 3300049581 Ga0501047_0028382 Ga0501047_0028382_2537_3241 234
1825 3300049581 Ga0501047_0083315 Ga0501047_0083315_1671_2375 234
1826 3300049581 Ga0501047_0085392 Ga0501047_0085392_696_1400 234
1827 3300049581 Ga0501047_0212292 Ga0501047_0212292_19_723 234
1828 3300049581 Ga0501047_0304858 Ga0501047_0304858_54_758 234
1829 3300049582 Ga0501048_0000473 Ga0501048_0000473_9828_10532 234
1830 3300049582 Ga0501048_0033115 Ga0501048_0033115_2942_3646 234
1831 3300049582 Ga0501048_0035259 Ga0501048_0035259_2583_3287 234
1832 3300049582 Ga0501048_0181363 Ga0501048_0181363_49_753 234
1833 3300049583 Ga0501067_0115028 Ga0501067_0115028_496_1200 234
1834 3300049583 Ga0501067_0178284 Ga0501067_0178284_268_972 234
1835 3300049584 Ga0501068_0010393 Ga0501068_0010393_3281_3985 234
1836 3300049584 Ga0501068_0011379 Ga0501068_0011379_1787_2491 234
1837 3300049584 Ga0501068_0252815 Ga0501068_0252815_348_1052 234
1838 3300049585 Ga0501069_0066639 Ga0501069_0066639_341_1045 234
1839 3300049585 Ga0501069_0207053 Ga0501069_0207053_205_909 234
1840 3300049585 Ga0501069_0287193 Ga0501069_0287193_89_793 234
1841 3300049586 Ga0501070_0011913 Ga0501070_0011913_5983_6687 234
1842 3300049586 Ga0501070_0025193 Ga0501070_0025193_1806_2510 234
1843 3300049586 Ga0501070_0029112 Ga0501070_0029112_525_1229 234
1844 3300049586 Ga0501070_0075293 Ga0501070_0075293_1492_2196 234
1845 3300049586 Ga0501070_0076780 Ga0501070_0076780_1249_1953 234
1846 3300049586 Ga0501070_0542075 Ga0501070_0542075_117_821 234
1847 3300049587 Ga0501071_0011457 Ga0501071_0011457_5100_5804 234
1848 3300049587 Ga0501071_0166155 Ga0501071_0166155_608_1312 234
1849 3300049588 Ga0501072_0011074 Ga0501072_0011074_1411_2115 234
1850 3300049588 Ga0501072_0085609 Ga0501072_0085609_1320_2024 234
1851 3300049589 Ga0501073_0132390 Ga0501073_0132390_699_1403 234
1852 3300049589 Ga0501073_0220771 Ga0501073_0220771_572_1276 234
1853 3300049589 Ga0501073_0330382 Ga0501073_0330382_305_1009 234
1854 3300049590 Ga0501074_0022003 Ga0501074_0022003_3631_4335 234
1855 3300049590 Ga0501074_0039132 Ga0501074_0039132_1457_2161 234
1856 3300049590 Ga0501074_0093316 Ga0501074_0093316_175_879 234
1857 3300049590 Ga0501074_0184153 Ga0501074_0184153_331_1035 234
1858 3300049591 Ga0501075_0173499 Ga0501075_0173499_885_1589 234
1859 3300049591 Ga0501075_0177078 Ga0501075_0177078_830_1534 234
1860 3300049591 Ga0501075_0215794 Ga0501075_0215794_319_1023 234
1861 3300049591 Ga0501075_0397268 Ga0501075_0397268_54_758 234
1862 3300049592 Ga0501076_0005575 Ga0501076_0005575_42_746 234
1863 3300049592 Ga0501076_0082122 Ga0501076_0082122_269_973 234
1864 3300049592 Ga0501076_0159112 Ga0501076_0159112_181_885 234
1865 3300049593 Ga0501077_0046434 Ga0501077_0046434_1492_2196 234
1866 3300049741 Ga0501079_0063486 Ga0501079_0063486_2103_2807 234
1867 3300049741 Ga0501079_0075956 Ga0501079_0075956_1671_2375 234
1868 3300049741 Ga0501079_0143903 Ga0501079_0143903_221_925 234
1869 3300049741 Ga0501079_0173111 Ga0501079_0173111_117_821 234
1870 3300049742 Ga0501080_0000030 Ga0501080_0000030_9978_10682 234
1871 3300049742 Ga0501080_0015129 Ga0501080_0015129_1626_2330 234
1872 3300049742 Ga0501080_0092344 Ga0501080_0092344_1425_2129 234
1873 3300049742 Ga0501080_0163888 Ga0501080_0163888_267_971 234
1874 3300049742 Ga0501080_0164174 Ga0501080_0164174_462_1166 234
1875 3300049742 Ga0501080_0476801 Ga0501080_0476801_57_761 234
1876 3300049744 Ga0501083_0010799 Ga0501083_0010799_5343_6047 234
1877 3300049744 Ga0501083_0053257 Ga0501083_0053257_14_718 234
1878 3300049744 Ga0501083_0097668 Ga0501083_0097668_912_1616 234
1879 3300049744 Ga0501083_0168596 Ga0501083_0168596_77_781 234
1880 3300049822 Ga0501035_0031108 Ga0501035_0031108_1355_2059 234
1881 3300049822 Ga0501035_0091654 Ga0501035_0091654_1272_1976 234
1882 3300049822 Ga0501035_0233349 Ga0501035_0233349_308_1012 234
1883 3300049822 Ga0501035_0299506 Ga0501035_0299506_66_770 234
1884 3300049823 Ga0501044_0004101 Ga0501044_0004101_6846_7550 234
1885 3300049823 Ga0501044_0068340 Ga0501044_0068340_1749_2453 234
1886 3300049823 Ga0501044_0103293 Ga0501044_0103293_2108_2812 234
1887 3300049823 Ga0501044_0127841 Ga0501044_0127841_342_1046 234
1888 3300049824 Ga0501045_0005395 Ga0501045_0005395_2020_2724 234
1889 3300049824 Ga0501045_0285430 Ga0501045_0285430_513_1217 234
1890 3300049824 Ga0501045_0290739 Ga0501045_0290739_193_897 234
1891 3300050489 nmdc:mga03683_2720_c1 nmdc:mga03683_2720_c1_4648_5352 234
1892 3300050489 nmdc:mga03683_8320_c1 nmdc:mga03683_8320_c1_1998_2702 234
1893 3300050489 nmdc:mga03683_86334_c1 nmdc:mga03683_86334_c1_340_1062 234
1894 3300050489 nmdc:mga03683_96266_c1 nmdc:mga03683_96266_c1_397_1101 234
1895 3300050490 nmdc:mga03n38_137830_c1 nmdc:mga03n38_137830_c1_398_1102 234
1896 3300050490 nmdc:mga03n38_156905_c1 nmdc:mga03n38_156905_c1_234_938 234
1897 3300050490 nmdc:mga03n38_28451_c1 nmdc:mga03n38_28451_c1_294_998 234
1898 3300050490 nmdc:mga03n38_97492_c1 nmdc:mga03n38_97492_c1_306_1010 234
1899 3300050491 nmdc:mga00v17_307382_c1 nmdc:mga00v17_307382_c1_178_882 234
1900 3300050491 nmdc:mga00v17_346397_c1 nmdc:mga00v17_346397_c1_221_925 234
1901 3300050491 nmdc:mga00v17_9842_c1 nmdc:mga00v17_9842_c1_3232_3936 234
1902 3300050492 nmdc:mga0yw44_227931_c1 nmdc:mga0yw44_227931_c1_311_1039 234
1903 3300050492 nmdc:mga0yw44_242352_c1 nmdc:mga0yw44_242352_c1_54_758 234
1904 3300050492 nmdc:mga0yw44_39189_c1 nmdc:mga0yw44_39189_c1_220_924 234
1905 3300050492 nmdc:mga0yw44_6189_c1 nmdc:mga0yw44_6189_c1_3777_4481 234
1906 3300050492 nmdc:mga0yw44_86569_c1 nmdc:mga0yw44_86569_c1_422_1126 234
1907 3300050492 nmdc:mga0yw44_98283_c1 nmdc:mga0yw44_98283_c1_268_972 234
1908 3300050493 nmdc:mga0k408_10484_c1 nmdc:mga0k408_10484_c1_4013_4717 234
1909 3300050493 nmdc:mga0k408_160651_c1 nmdc:mga0k408_160651_c1_253_957 234
1910 3300050493 nmdc:mga0k408_212834_c1 nmdc:mga0k408_212834_c1_180_884 234
1911 3300050494 nmdc:mga06z11_112858_c1 nmdc:mga06z11_112858_c1_353_1057 234
1912 3300050494 nmdc:mga06z11_131565_c1 nmdc:mga06z11_131565_c1_470_1174 234
1913 3300050494 nmdc:mga06z11_41063_c1 nmdc:mga06z11_41063_c1_195_899 234
1914 3300050494 nmdc:mga06z11_45012_c1 nmdc:mga06z11_45012_c1_819_1523 234
1915 3300050494 nmdc:mga06z11_9486_c1 nmdc:mga06z11_9486_c1_2524_3228 234
1916 3300050496 nmdc:mga07m45_122738_c1 nmdc:mga07m45_122738_c1_289_993 234
1917 3300050496 nmdc:mga07m45_14653_c2 nmdc:mga07m45_14653_c2_2537_3250 234
1918 3300050496 nmdc:mga07m45_259827_c1 nmdc:mga07m45_259827_c1_158_871 234
1919 3300050496 nmdc:mga07m45_296730_c1 nmdc:mga07m45_296730_c1_83_787 234
1920 3300050496 nmdc:mga07m45_355731_c1 nmdc:mga07m45_355731_c1_113_817 234
1921 3300050496 nmdc:mga07m45_43458_c1 nmdc:mga07m45_43458_c1_822_1526 234
1922 3300050496 nmdc:mga07m45_46368_c1 nmdc:mga07m45_46368_c1_233_937 234
1923 3300050507 nmdc:mga05p37_135935_c1 nmdc:mga05p37_135935_c1_406_1110 234
1924 3300050507 nmdc:mga05p37_13694_c1 nmdc:mga05p37_13694_c1_242_946 234
1925 3300050507 nmdc:mga05p37_26731_c1 nmdc:mga05p37_26731_c1_5315_6019 234
1926 3300050507 nmdc:mga05p37_33096_c1 nmdc:mga05p37_33096_c1_1567_2271 234
1927 3300050507 nmdc:mga05p37_7310_c1 nmdc:mga05p37_7310_c1_6910_7614 234
1928 3300050507 nmdc:mga05p37_76550_c1 nmdc:mga05p37_76550_c1_2343_3047 234
1929 3300050508 nmdc:mga09592_22873_c1 nmdc:mga09592_22873_c1_2122_2826 234
1930 3300050508 nmdc:mga09592_42022_c1 nmdc:mga09592_42022_c1_2548_3252 234
1931 3300050508 nmdc:mga09592_59060_c1 nmdc:mga09592_59060_c1_1398_2102 234
1932 3300050509 nmdc:mga0qj67_15559_c1 nmdc:mga0qj67_15559_c1_2857_3561 234
1933 3300050509 nmdc:mga0qj67_21501_c1 nmdc:mga0qj67_21501_c1_723_1427 234
1934 3300050509 nmdc:mga0qj67_4674_c1 nmdc:mga0qj67_4674_c1_1270_1974 234
1935 3300050510 nmdc:mga06r32_4896_c1 nmdc:mga06r32_4896_c1_10953_11657 234
1936 3300050510 nmdc:mga06r32_8384_c1 nmdc:mga06r32_8384_c1_6647_7351 234
1937 3300050511 nmdc:mga08y16_12186_c1 nmdc:mga08y16_12186_c1_2338_3042 234
1938 3300050511 nmdc:mga08y16_170800_c1 nmdc:mga08y16_170800_c1_147_851 234
1939 3300050511 nmdc:mga08y16_22091_c1 nmdc:mga08y16_22091_c1_546_1250 234
1940 3300050511 nmdc:mga08y16_243008_c1 nmdc:mga08y16_243008_c1_194_898 234
1941 3300050511 nmdc:mga08y16_47150_c1 nmdc:mga08y16_47150_c1_1674_2378 234
1942 3300050511 nmdc:mga08y16_518_c1 nmdc:mga08y16_518_c1_3233_3937 234
1943 3300050511 nmdc:mga08y16_549471_c1 nmdc:mga08y16_549471_c1_69_773 234
1944 3300050511 nmdc:mga08y16_6788_c1 nmdc:mga08y16_6788_c1_113_817 234
1945 3300050512 nmdc:mga0n895_1010768_c1 nmdc:mga0n895_1010768_c1_30_734 234
1946 3300050512 nmdc:mga0n895_102857_c1 nmdc:mga0n895_102857_c1_158_862 234
1947 3300050512 nmdc:mga0n895_121567_c1 nmdc:mga0n895_121567_c1_850_1554 234
1948 3300050512 nmdc:mga0n895_180064_c1 nmdc:mga0n895_180064_c1_922_1626 234
1949 3300050512 nmdc:mga0n895_2094_c1 nmdc:mga0n895_2094_c1_11323_12027 234
1950 3300050512 nmdc:mga0n895_22338_c1 nmdc:mga0n895_22338_c1_4868_5572 234
1951 3300050512 nmdc:mga0n895_24114_c1 nmdc:mga0n895_24114_c1_3726_4430 234
1952 3300050512 nmdc:mga0n895_255905_c1 nmdc:mga0n895_255905_c1_180_884 234
1953 3300050512 nmdc:mga0n895_27310_c1 nmdc:mga0n895_27310_c1_1140_1844 234
1954 3300050512 nmdc:mga0n895_338465_c1 nmdc:mga0n895_338465_c1_337_1041 234
1955 3300050512 nmdc:mga0n895_43907_c1 nmdc:mga0n895_43907_c1_2676_3380 234
1956 3300050512 nmdc:mga0n895_460921_c1 nmdc:mga0n895_460921_c1_272_976 234
1957 3300050512 nmdc:mga0n895_513772_c1 nmdc:mga0n895_513772_c1_439_1143 234
1958 3300050512 nmdc:mga0n895_77721_c1 nmdc:mga0n895_77721_c1_838_1542 234
1959 3300050513 nmdc:mga0rr50_175981_c1 nmdc:mga0rr50_175981_c1_405_1118 234
1960 3300050513 nmdc:mga0rr50_260119_c1 nmdc:mga0rr50_260119_c1_688_1392 234
1961 3300050513 nmdc:mga0rr50_540865_c1 nmdc:mga0rr50_540865_c1_66_770 234
1962 3300050513 nmdc:mga0rr50_55745_c1 nmdc:mga0rr50_55745_c1_1109_1813 234
1963 3300050513 nmdc:mga0rr50_5686_c1 nmdc:mga0rr50_5686_c1_1864_2568 234
1964 3300050513 nmdc:mga0rr50_64444_c1 nmdc:mga0rr50_64444_c1_653_1357 234
1965 3300050514 nmdc:mga08x19_102299_c1 nmdc:mga08x19_102299_c1_1041_1745 234
1966 3300050514 nmdc:mga08x19_16318_c1 nmdc:mga08x19_16318_c1_1465_2169 234
1967 3300050515 nmdc:mga0a205_10809_c1 nmdc:mga0a205_10809_c1_980_1684 234
1968 3300050515 nmdc:mga0a205_13485_c1 nmdc:mga0a205_13485_c1_2122_2826 234
1969 3300050515 nmdc:mga0a205_14827_c1 nmdc:mga0a205_14827_c1_5007_5711 234
1970 3300050515 nmdc:mga0a205_156394_c1 nmdc:mga0a205_156394_c1_144_848 234
1971 3300050515 nmdc:mga0a205_218030_c1 nmdc:mga0a205_218030_c1_878_1582 234
1972 3300050515 nmdc:mga0a205_278891_c1 nmdc:mga0a205_278891_c1_810_1514 234
1973 3300050515 nmdc:mga0a205_32169_c1 nmdc:mga0a205_32169_c1_707_1411 234
1974 3300050515 nmdc:mga0a205_401749_c1 nmdc:mga0a205_401749_c1_33_737 234
1975 3300050515 nmdc:mga0a205_42582_c1 nmdc:mga0a205_42582_c1_1473_2177 234
1976 3300050515 nmdc:mga0a205_439879_c1 nmdc:mga0a205_439879_c1_303_1007 234
1977 3300050515 nmdc:mga0a205_830_c1 nmdc:mga0a205_830_c1_17552_18256 234
1978 3300050516 nmdc:mga0sz30_156896_c1 nmdc:mga0sz30_156896_c1_68_772 234
1979 3300050516 nmdc:mga0sz30_16015_c1 nmdc:mga0sz30_16015_c1_2217_2921 234
1980 3300050516 nmdc:mga0sz30_445_c1 nmdc:mga0sz30_445_c1_11456_12160 234
1981 3300053077 Ga0495601_0001195 Ga0495601_0001195_3525_4229 234
1982 3300053077 Ga0495601_0001471 Ga0495601_0001471_2819_3523 234
1983 3300053077 Ga0495601_0017967 Ga0495601_0017967_2088_2792 234
1984 3300053077 Ga0495601_0051327 Ga0495601_0051327_1235_1939 234
1985 3300053077 Ga0495601_0144129 Ga0495601_0144129_527_1231 234
1986 3300053077 Ga0495601_0380192 Ga0495601_0380192_164_868 234
1987 3300053078 Ga0495612_0000353 Ga0495612_0000353_7532_8236 234
1988 3300053078 Ga0495612_0008637 Ga0495612_0008637_1744_2448 234
1989 3300053078 Ga0495612_0009709 Ga0495612_0009709_1860_2564 234
1990 3300053078 Ga0495612_0012593 Ga0495612_0012593_887_1591 234
1991 3300053078 Ga0495612_0191469 Ga0495612_0191469_139_843 234
1992 3300053079 Ga0500610_0189819 Ga0500610_0189819_196_900 234
1993 3300053079 Ga0500610_0207161 Ga0500610_0207161_47_751 234
1994 3300053080 Ga0500635_0033796 Ga0500635_0033796_952_1656 234
1995 3300053084 Ga0495595_0000480 Ga0495595_0000480_3377_4081 234
1996 3300053084 Ga0495595_0010420 Ga0495595_0010420_768_1472 234
1997 3300053084 Ga0495595_0018087 Ga0495595_0018087_1659_2363 234
1998 3300053084 Ga0495595_0018501 Ga0495595_0018501_831_1535 234
1999 3300053084 Ga0495595_0029627 Ga0495595_0029627_1287_1991 234
2000 3300053084 Ga0495595_0036616 Ga0495595_0036616_534_1238 234
2001 3300053084 Ga0495595_0088199 Ga0495595_0088199_25_729 234
2002 3300053085 Ga0495619_0000289 Ga0495619_0000289_5079_5783 234
2003 3300053085 Ga0495619_0000332 Ga0495619_0000332_17636_18340 234
2004 3300053085 Ga0495619_0001043 Ga0495619_0001043_16638_17342 234
2005 3300053085 Ga0495619_0009100 Ga0495619_0009100_5524_6228 234
2006 3300053085 Ga0495619_0010184 Ga0495619_0010184_5104_5808 234
2007 3300053085 Ga0495619_0028628 Ga0495619_0028628_2137_2841 234
2008 3300053085 Ga0495619_0166402 Ga0495619_0166402_291_995 234
2009 3300053085 Ga0495619_0206487 Ga0495619_0206487_178_882 234
2010 3300053085 Ga0495619_0219870 Ga0495619_0219870_321_1028 234
2011 3300053085 Ga0495619_0299895 Ga0495619_0299895_342_1046 234
2012 3300053085 Ga0495619_0303757 Ga0495619_0303757_382_1086 234
2013 3300053085 Ga0495619_0315886 Ga0495619_0315886_353_1057 234
2014 3300053087 Ga0500643_000018 Ga0500643_000018_266493_267197 234
2015 3300053093 Ga0500651_0314768 Ga0500651_0314768_131_835 234
2016 3300053094 Ga0500566_0006255 Ga0500566_0006255_4552_5256 234
2017 3300053096 Ga0500641_0005072 Ga0500641_0005072_1470_2174 234
2018 3300053096 Ga0500641_0119136 Ga0500641_0119136_219_923 234
2019 3300053104 Ga0500556_0071241 Ga0500556_0071241_277_981 234
2020 3300053105 Ga0500557_000008 Ga0500557_000008_88649_89353 234
2021 3300053109 Ga0500569_021584 Ga0500569_021584_54_758 234
2022 3300053119 Ga0500595_000232 Ga0500595_000232_23472_24176 234
2023 3300053119 Ga0500595_006829 Ga0500595_006829_1888_2592 234
2024 3300053119 Ga0500595_031382 Ga0500595_031382_993_1697 234
2025 3300053122 Ga0500608_090211 Ga0500608_090211_245_949 234
2026 3300053130 Ga0500642_0000067 Ga0500642_0000067_54906_55610 234
2027 3300053130 Ga0500642_0210912 Ga0500642_0210912_70_774 234
2028 3300053133 Ga0500655_030900 Ga0500655_030900_162_866 234
2029 3300053136 Ga0500559_0014503 Ga0500559_0014503_1721_2425 234
2030 3300053139 Ga0500568_0002596 Ga0500568_0002596_1606_2310 234
2031 3300053139 Ga0500568_0040908 Ga0500568_0040908_800_1504 234
2032 3300053139 Ga0500568_0042033 Ga0500568_0042033_930_1634 234
2033 3300053142 Ga0500577_0163473 Ga0500577_0163473_217_921 234
2034 3300053150 Ga0500603_005284 Ga0500603_005284_146_850 234
2035 3300053150 Ga0500603_048434 Ga0500603_048434_190_894 234
2036 3300053151 Ga0500604_0095341 Ga0500604_0095341_146_850 234
2037 3300053151 Ga0500604_0123838 Ga0500604_0123838_70_774 234
2038 3300053153 Ga0500616_0002167 Ga0500616_0002167_10603_11316 234
2039 3300053155 Ga0500620_043958 Ga0500620_043958_570_1274 234
2040 3300053156 Ga0500622_0006295 Ga0500622_0006295_5411_6115 234
2041 3300053162 Ga0500638_005675 Ga0500638_005675_3381_4085 234
2042 3300053163 Ga0500639_206626 Ga0500639_206626_76_780 234
2043 3300053177 Ga0500636_0000847 Ga0500636_0000847_2132_2836 234
2044 3300053178 Ga0500637_0000260 Ga0500637_0000260_6212_6916 234
2045 3300053178 Ga0500637_0000405 Ga0500637_0000405_9137_9841 234
2046 3300053722 Ga0500649_094163 Ga0500649_094163_234_941 234
2047 3300053729 Ga0500625_012504 Ga0500625_012504_1262_1966 234
2048 3300053730 Ga0500645_026262 Ga0500645_026262_409_1116 234
2049 3300053730 Ga0500645_031912 Ga0500645_031912_537_1241 234
2050 3300053736 Ga0500599_000323 Ga0500599_000323_3689_4393 234
2051 3300053737 Ga0500601_000062 Ga0500601_000062_11663_12367 234
2052 3300054114 Ga0501084_0002367 Ga0501084_0002367_9144_9848 234
2053 3300054114 Ga0501084_0197701 Ga0501084_0197701_844_1548 234
2054 3300054114 Ga0501084_0214409 Ga0501084_0214409_656_1360 234
2055 3300055283 Ga0500661_000357 Ga0500661_000357_4586_5290 234
2056 3300060353 Ga0501082_0041592 Ga0501082_0041592_1538_2242 234
2057 3300061719 Ga0466962_0261961 Ga0466962_0261961_115_822 234
2058 3300061734 Ga0530510_0002069 Ga0530510_0002069_4678_5382 234
2059 3300061734 Ga0530510_0291292 Ga0530510_0291292_272_976 234
2060 iso_pu_bacteria 2841966195 2841970328 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

35

181

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9525 2 234
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9446 2 234
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9302 2 221
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9191 2 221
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9136 2 221
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.979 1 234 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9708 1 234 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9524 1 233 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9448 2 234 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9444 1 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q3SXW4-F1-model_v4 ABC transporter ATP-binding protein 0.9891 2 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1V4MHS7-F1-model_v4 ABC transporter ATP-binding protein 0.9851 1 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A2N9MLZ7-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2, HAAT family 0.9832 2 234 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A2E7F6C8-F1-model_v4 ABC transporter ATP-binding protein 0.9818 1 233 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A417Z7G5-F1-model_v4 ABC transporter ATP-binding protein 0.981 2 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
95.23 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map