F496321

General Info

Members Datasets Scaffolds Average Seq Length
2052 671 1940 121

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_1218032_c1|nmdc:mga0yw44_1218032_c1_29_460
Length 143
Sequence MWELTKAFRFEAAHALPGTTLGDASMEIHGHSFRAEVTIRGTPDPETGMVTDLGLLERSMAEVQKTLDHKLLNKVEALGPPTLENLSRFIWEHVAHAGELARVSVYRDSCNESCTYYGPQNVAFSSEADIRSREENPPNFKLK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
10 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
11 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
14 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
15 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
16 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
17 2643221651 Afipia sp. Root123D2 Isolate Unclassified
18 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
19 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
20 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
21 2791355199
22 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
23 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
24 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
25 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
26 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
27 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
28 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
29 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
30 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
31 2922368715
32 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
33 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
34 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
35 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
36 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
37 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
38 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
39 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
40 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
41 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
42 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
43 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
44 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
45 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
46 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
47 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
48 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
49 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
50 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
51 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
52 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
53 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
54 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
55 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
56 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
57 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
58 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
59 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
60 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
61 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
62 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
63 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
64 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
65 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
66 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
67 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
68 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
69 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
70 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
71 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
72 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
73 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
74 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
75 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
76 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
77 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
78 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
79 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
80 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
81 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
82 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
83 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
84 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
85 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
86 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
87 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
88 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
89 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
90 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
91 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
92 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
93 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
94 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
95 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
99 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
100 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
102 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
103 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
104 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
105 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
106 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
107 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
108 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
109 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
110 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
111 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
112 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
113 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
114 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
115 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
116 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
117 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
118 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
119 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
120 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
121 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
122 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
123 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
124 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
125 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
126 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
127 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
128 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
129 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
130 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
131 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
132 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
133 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
134 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
135 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
136 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
137 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
138 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
139 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
140 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
141 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
142 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
143 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
144 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
145 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
146 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
147 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
148 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
149 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
150 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
151 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
152 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
153 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
154 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
155 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
156 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
157 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
158 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
159 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
160 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
161 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
162 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
163 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
164 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
165 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
166 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
167 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
168 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
169 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
170 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
171 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
172 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
173 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
174 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
175 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
176 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
177 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
178 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
179 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
180 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
181 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
182 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
183 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
184 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
185 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
186 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
187 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
188 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
189 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
190 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
191 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
192 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
193 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
194 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
195 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
196 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
197 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
198 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
199 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
200 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
201 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
202 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
203 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
204 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
205 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
206 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
207 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
208 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
209 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
210 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
211 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
212 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
213 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
214 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
215 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
216 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
217 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
218 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
219 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
220 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
221 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
222 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
223 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
224 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
225 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
226 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
227 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
228 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
229 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
230 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
231 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
232 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
233 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
234 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
235 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
236 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
237 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
238 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
242 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
245 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
247 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
313 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
314 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
315 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
318 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
322 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
323 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
324 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
325 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
326 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
327 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
328 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
329 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
330 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
331 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
332 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
333 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
334 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
335 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
336 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
337 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
338 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
339 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
340 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
341 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
342 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
343 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
344 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
345 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
346 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
347 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
348 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
349 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
350 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
351 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
352 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
353 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
354 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
355 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
356 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
357 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
358 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
359 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
360 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
361 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
362 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
363 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
364 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
365 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
366 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
367 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
368 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
369 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
370 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
371 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
372 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
373 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
374 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
375 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
376 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
377 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
378 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
379 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
380 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
381 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
382 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
383 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
384 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
385 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
386 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
387 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
388 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
389 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
390 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
391 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
392 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
393 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
394 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
395 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
396 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
397 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
398 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
399 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
400 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
401 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
402 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
403 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
404 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
405 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
406 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
407 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
408 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
409 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
410 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
411 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
412 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
413 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
414 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
415 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
416 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
417 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
418 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
419 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
420 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
421 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
422 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
423 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
424 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
425 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
426 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
427 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
428 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
429 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
430 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
431 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
432 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
433 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
434 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
435 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
436 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
437 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
438 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
439 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
440 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
441 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
442 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
443 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
444 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
445 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
446 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
447 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
448 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
449 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
450 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
451 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
452 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
453 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
454 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
455 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
456 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
457 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
458 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
459 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
460 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
461 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
462 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
463 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
464 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
465 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
466 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
467 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
468 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
469 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
470 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
471 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
472 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
473 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
474 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
475 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
476 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
477 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
478 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
479 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
480 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
481 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
482 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
483 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
484 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
485 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
486 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
487 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
488 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
489 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
490 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
491 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
492 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
493 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
494 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
495 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
496 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
497 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
498 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
499 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
500 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
501 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
502 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
503 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
504 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
505 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
506 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
507 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
508 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
509 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
510 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
511 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
512 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
513 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
514 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
515 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
516 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
517 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
518 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
519 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
520 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
521 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
522 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
523 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
524 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
525 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
526 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
527 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
528 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
529 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
530 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
531 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
532 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
533 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
534 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
535 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
536 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
537 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
538 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
539 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
540 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
541 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
542 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
543 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
544 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
545 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
546 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
547 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
548 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
549 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
550 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
551 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
552 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
553 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
554 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
555 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
556 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
557 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
558 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
559 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
560 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
561 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
562 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
563 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
564 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
565 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
566 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
567 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
568 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
569 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
570 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
572 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
573 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
574 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
575 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
576 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
577 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
578 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
579 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
580 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
581 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
582 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
583 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
584 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
585 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
586 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
587 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
588 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
589 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
590 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
591 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
592 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
593 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
594 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
595 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
596 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
597 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
598 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
599 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
600 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
601 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
602 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
603 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
604 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
605 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
606 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
607 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
608 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
609 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
610 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
611 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
612 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
613 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
614 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
615 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
616 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
617 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
618 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
619 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
620 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
621 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
622 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
623 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
624 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
625 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
626 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
627 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
628 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
629 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
630 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
631 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
632 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
633 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
634 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
635 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
636 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
637 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
638 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
639 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
640 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
641 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
642 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
643 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
644 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
645 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
646 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
647 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
648 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
649 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
650 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
651 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
652 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
653 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
654 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
655 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
656 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
657 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
658 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
659 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
660 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
661 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
662 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
663 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
664 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
665 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
666 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
667 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
668 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
669 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
670 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
671 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 0.05
Isolates 5.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.4
Nodule 4.87
Rhizoplane 6.87
Rhizosphere 70.22
Stem 0
Stem Tuber 0
Unclassified 6.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002132 3300001979 Bacteria 9037
2 JGI24739J22299_10000994 3300001989 Bacteria 10559
3 JGI24739J22299_10076384 3300001989 Bacteria 1034
4 JGI24737J22298_10002808 3300001990 Bacteria 6167
5 JGI24735J21928_10027781 3300002067 Bacteria 1694
6 JGI24738J21930_10106588 3300002075 Bacteria 601
7 JGI24742J22300_10004932 3300002244 Bacteria 2190
8 JGI25153J46596_10001471 3300003215 Bacteria 14056
9 JGI25153J46596_10013115 3300003215 Bacteria 3523
10 JGI25160J50197_1000851 3300003354 Bacteria 16211
11 JGI25160J50197_1064782 3300003354 Bacteria 716
12 JGI25404J52841_10007296 3300003659 Bacteria 2336
13 JGI25404J52841_10023210 3300003659 Bacteria 1339
14 Ga0055525_1005103 3300003759 Bacteria 1119
15 Ga0055526_1046137 3300003771 Bacteria 1035
16 JGI25405J52794_10017671 3300003911 Bacteria 1419
17 Ga0065165_1001015 3300005262 Bacteria 34129
18 Ga0065704_10263799 3300005289 Bacteria 959
19 Ga0065715_10465953 3300005293 Bacteria 811
20 Ga0065715_10934983 3300005293 Bacteria 564
21 Ga0065707_10381129 3300005295 Bacteria 877
22 Ga0065707_11024719 3300005295 Bacteria 533
23 Ga0070658_10074317 3300005327 Bacteria 2787
24 Ga0070658_10190980 3300005327 Bacteria 1726
25 Ga0070658_10744815 3300005327 Bacteria 851
26 Ga0070658_10750036 3300005327 Bacteria 848
27 Ga0070658_11214472 3300005327 Bacteria 655
28 Ga0070658_11475700 3300005327 Bacteria 590
29 Ga0070676_10051847 3300005328 Bacteria 2410
30 Ga0070676_10302367 3300005328 Bacteria 1085
31 Ga0070676_10988659 3300005328 Bacteria 631
32 Ga0070683_100041309 3300005329 Bacteria 4242
33 Ga0070683_100732893 3300005329 Bacteria 947
34 Ga0070683_100886376 3300005329 Bacteria 856
35 Ga0070683_101408984 3300005329 Bacteria 670
36 Ga0070690_101568449 3300005330 Bacteria 533
37 Ga0070670_100133386 3300005331 Bacteria 2145
38 Ga0070670_100410388 3300005331 Bacteria 1197
39 Ga0070670_100603834 3300005331 Bacteria 982
40 Ga0068869_100089048 3300005334 Bacteria 2317
41 Ga0068869_100272878 3300005334 Bacteria 1357
42 Ga0068869_101489202 3300005334 Bacteria 601
43 Ga0070666_10183683 3300005335 Bacteria 1467
44 Ga0070666_10218472 3300005335 Bacteria 1344
45 Ga0070666_11079176 3300005335 Bacteria 597
46 Ga0070680_100014862 3300005336 Bacteria 6090
47 Ga0070680_100056438 3300005336 Bacteria 3209
48 Ga0070680_100414086 3300005336 Bacteria 1150
49 Ga0070680_100446075 3300005336 Bacteria 1105
50 Ga0070682_100049913 3300005337 Bacteria 2610
51 Ga0070682_100133688 3300005337 Bacteria 1682
52 Ga0070682_100409477 3300005337 Bacteria 1028
53 Ga0070682_100451019 3300005337 Bacteria 985
54 Ga0070682_100826514 3300005337 Bacteria 755
55 Ga0068868_100019171 3300005338 Bacteria 5125
56 Ga0068868_100128947 3300005338 Bacteria 2068
57 Ga0068868_100538342 3300005338 Bacteria 1028
58 Ga0068868_100583403 3300005338 Bacteria 989
59 Ga0068868_101043893 3300005338 Bacteria 749
60 Ga0070660_100153390 3300005339 Bacteria 1853
61 Ga0070660_100217426 3300005339 Bacteria 1553
62 Ga0070660_100298783 3300005339 Bacteria 1320
63 Ga0070660_100542726 3300005339 Bacteria 970
64 Ga0070660_100659328 3300005339 Bacteria 876
65 Ga0070660_101071719 3300005339 Bacteria 682
66 Ga0070689_100212105 3300005340 Bacteria 1585
67 Ga0070689_100467348 3300005340 Bacteria 1076
68 Ga0070689_100802914 3300005340 Bacteria 827
69 Ga0070691_10164287 3300005341 Bacteria 1146
70 Ga0070691_10272013 3300005341 Bacteria 916
71 Ga0070691_10622127 3300005341 Bacteria 640
72 Ga0070687_100713929 3300005343 Bacteria 702
73 Ga0070661_100256887 3300005344 Bacteria 1350
74 Ga0070661_100410899 3300005344 Bacteria 1071
75 Ga0070661_100649012 3300005344 Bacteria 857
76 Ga0070661_100773847 3300005344 Bacteria 786
77 Ga0070661_100778216 3300005344 Bacteria 784
78 Ga0070661_100970048 3300005344 Bacteria 704
79 Ga0070661_101473349 3300005344 Bacteria 574
80 Ga0070692_10325339 3300005345 Bacteria 947
81 Ga0070668_100011646 3300005347 Bacteria 6546
82 Ga0070668_100093723 3300005347 Bacteria 2370
83 Ga0070668_100181892 3300005347 Bacteria 1718
84 Ga0070668_100250361 3300005347 Bacteria 1470
85 Ga0070668_100440193 3300005347 Bacteria 1119
86 Ga0070668_100504853 3300005347 Bacteria 1047
87 Ga0070668_100631576 3300005347 Bacteria 939
88 Ga0070669_100358241 3300005353 Bacteria 1185
89 Ga0070669_100792759 3300005353 Bacteria 805
90 Ga0070669_101089220 3300005353 Bacteria 688
91 Ga0070669_101128973 3300005353 Bacteria 676
92 Ga0070675_100121009 3300005354 Bacteria 2224
93 Ga0070675_101264484 3300005354 Bacteria 680
94 Ga0070671_100200532 3300005355 Bacteria 1692
95 Ga0070671_100206291 3300005355 Bacteria 1667
96 Ga0070671_100631535 3300005355 Bacteria 927
97 Ga0070671_101214101 3300005355 Bacteria 664
98 Ga0070674_100063873 3300005356 Bacteria 2578
99 Ga0070674_100381720 3300005356 Bacteria 1146
100 Ga0070674_100811882 3300005356 Bacteria 808
101 Ga0070688_100516122 3300005365 Bacteria 903
102 Ga0070688_100664096 3300005365 Bacteria 804
103 Ga0070688_100799348 3300005365 Bacteria 737
104 Ga0070688_101062568 3300005365 Bacteria 646
105 Ga0070659_100018785 3300005366 Bacteria 5218
106 Ga0070659_100153456 3300005366 Bacteria 1880
107 Ga0070659_100349826 3300005366 Bacteria 1239
108 Ga0070659_100363834 3300005366 Bacteria 1216
109 Ga0070659_101369007 3300005366 Bacteria 629
110 Ga0070667_100071421 3300005367 Bacteria 2956
111 Ga0070667_100120955 3300005367 Bacteria 2277
112 Ga0070667_100155565 3300005367 Bacteria 2011
113 Ga0070667_100200543 3300005367 Bacteria 1770
114 Ga0070667_101767786 3300005367 Bacteria 582
115 Ga0070703_10357228 3300005406 Bacteria 625
116 Ga0070709_10005804 3300005434 Bacteria 6688
117 Ga0070709_10032349 3300005434 Bacteria 3153
118 Ga0070709_10070188 3300005434 Bacteria 2257
119 Ga0070709_10379140 3300005434 Bacteria 1051
120 Ga0070709_10443497 3300005434 Bacteria 977
121 Ga0070714_100008494 3300005435 Bacteria 8025
122 Ga0070714_100057152 3300005435 Bacteria 3338
123 Ga0070714_100071409 3300005435 Bacteria 3001
124 Ga0070714_100088227 3300005435 Bacteria 2714
125 Ga0070714_100188936 3300005435 Bacteria 1878
126 Ga0070714_100514544 3300005435 Bacteria 1143
127 Ga0070714_100997547 3300005435 Bacteria 815
128 Ga0070713_100011888 3300005436 Bacteria 6363
129 Ga0070713_100021271 3300005436 Bacteria 4986
130 Ga0070713_100023787 3300005436 Bacteria 4761
131 Ga0070713_100063344 3300005436 Bacteria 3100
132 Ga0070713_100069263 3300005436 Bacteria 2974
133 Ga0070713_100225414 3300005436 Bacteria 1702
134 Ga0070713_100569257 3300005436 Bacteria 1074
135 Ga0070713_100638903 3300005436 Bacteria 1013
136 Ga0070713_100800078 3300005436 Bacteria 904
137 Ga0070710_10000243 3300005437 Bacteria 25537
138 Ga0070710_10645032 3300005437 Bacteria 742
139 Ga0070701_10867840 3300005438 Bacteria 621
140 Ga0070711_100005828 3300005439 Bacteria 7394
141 Ga0070711_100027217 3300005439 Bacteria 3752
142 Ga0070711_100579811 3300005439 Bacteria 934
143 Ga0070700_100030349 3300005441 Bacteria 3230
144 Ga0070700_100341741 3300005441 Bacteria 1106
145 Ga0070700_100451188 3300005441 Bacteria 978
146 Ga0070700_100891242 3300005441 Bacteria 724
147 Ga0070700_101769819 3300005441 Bacteria 532
148 Ga0070663_100015327 3300005455 Bacteria 4945
149 Ga0070663_100029415 3300005455 Bacteria 3754
150 Ga0070663_100043607 3300005455 Bacteria 3158
151 Ga0070663_100053294 3300005455 Bacteria 2887
152 Ga0070663_100189348 3300005455 Bacteria 1600
153 Ga0070663_100210102 3300005455 Bacteria 1524
154 Ga0070663_100295468 3300005455 Bacteria 1295
155 Ga0070663_100311829 3300005455 Bacteria 1262
156 Ga0070663_100358315 3300005455 Bacteria 1183
157 Ga0070663_100630453 3300005455 Bacteria 905
158 Ga0070663_101229843 3300005455 Bacteria 659
159 Ga0070678_100026225 3300005456 Bacteria 3936
160 Ga0070678_100131264 3300005456 Bacteria 1991
161 Ga0070678_100167776 3300005456 Bacteria 1785
162 Ga0070678_100682296 3300005456 Bacteria 924
163 Ga0070678_101755211 3300005456 Bacteria 584
164 Ga0070662_100024830 3300005457 Bacteria 4133
165 Ga0070662_100112688 3300005457 Bacteria 2074
166 Ga0070662_100700957 3300005457 Bacteria 857
167 Ga0070681_10378766 3300005458 Bacteria 1326
168 Ga0070681_10867578 3300005458 Bacteria 820
169 Ga0070681_11219027 3300005458 Bacteria 674
170 Ga0068867_100077824 3300005459 Bacteria 2493
171 Ga0068867_100224348 3300005459 Bacteria 1516
172 Ga0070685_10048997 3300005466 Bacteria 2435
173 Ga0070685_10336469 3300005466 Bacteria 1028
174 Ga0070685_10395641 3300005466 Bacteria 956
175 Ga0070685_10905397 3300005466 Bacteria 657
176 Ga0070698_100095596 3300005471 Bacteria 2949
177 Ga0070698_100181655 3300005471 Bacteria 2042
178 Ga0070679_100109221 3300005530 Bacteria 2752
179 Ga0070679_100207654 3300005530 Bacteria 1923
180 Ga0070679_100373532 3300005530 Bacteria 1373
181 Ga0070679_100381825 3300005530 Bacteria 1355
182 Ga0070679_100834350 3300005530 Bacteria 865
183 Ga0070679_101300999 3300005530 Bacteria 673
184 Ga0070684_100024360 3300005535 Bacteria 5076
185 Ga0070684_100122837 3300005535 Bacteria 2337
186 Ga0070684_100325518 3300005535 Bacteria 1412
187 Ga0070684_100692431 3300005535 Bacteria 950
188 Ga0070697_100117517 3300005536 Bacteria 2221
189 Ga0070697_100821650 3300005536 Bacteria 823
190 Ga0068853_100034208 3300005539 Bacteria 4313
191 Ga0068853_100066013 3300005539 Bacteria 3141
192 Ga0068853_100111232 3300005539 Bacteria 2433
193 Ga0068853_100229348 3300005539 Bacteria 1698
194 Ga0068853_100280940 3300005539 Bacteria 1535
195 Ga0068853_100311651 3300005539 Bacteria 1457
196 Ga0068853_100350062 3300005539 Bacteria 1374
197 Ga0068853_100575384 3300005539 Bacteria 1068
198 Ga0068853_100642182 3300005539 Bacteria 1010
199 Ga0068853_100742973 3300005539 Bacteria 937
200 Ga0068853_100788064 3300005539 Bacteria 910
201 Ga0070672_100240049 3300005543 Bacteria 1524
202 Ga0070672_100317559 3300005543 Bacteria 1324
203 Ga0070672_100813325 3300005543 Bacteria 823
204 Ga0070672_101012122 3300005543 Bacteria 737
205 Ga0070695_100356290 3300005545 Bacteria 1097
206 Ga0070695_100383663 3300005545 Bacteria 1061
207 Ga0070696_100661930 3300005546 Bacteria 848
208 Ga0070696_100698724 3300005546 Bacteria 827
209 Ga0070696_100728310 3300005546 Bacteria 811
210 Ga0070693_100131815 3300005547 Bacteria 1563
211 Ga0070693_100669274 3300005547 Bacteria 757
212 Ga0070693_100820721 3300005547 Bacteria 691
213 Ga0070693_101457154 3300005547 Bacteria 534
214 Ga0070665_100042843 3300005548 Bacteria 4550
215 Ga0070665_100046098 3300005548 Bacteria 4379
216 Ga0070665_100114722 3300005548 Bacteria 2696
217 Ga0070665_100242487 3300005548 Bacteria 1803
218 Ga0070665_100258007 3300005548 Bacteria 1744
219 Ga0070665_100564585 3300005548 Bacteria 1151
220 Ga0068855_100020255 3300005563 Bacteria 7984
221 Ga0068855_100022551 3300005563 Bacteria 7544
222 Ga0068855_100083171 3300005563 Bacteria 3708
223 Ga0068855_100178644 3300005563 Bacteria 2400
224 Ga0068855_100260993 3300005563 Bacteria 1930
225 Ga0068855_100270938 3300005563 Bacteria 1888
226 Ga0068855_100445512 3300005563 Bacteria 1414
227 Ga0068855_100479392 3300005563 Bacteria 1354
228 Ga0068855_100666983 3300005563 Bacteria 1115
229 Ga0068855_100897426 3300005563 Bacteria 936
230 Ga0070664_100631585 3300005564 Bacteria 995
231 Ga0070664_100725443 3300005564 Bacteria 927
232 Ga0070664_101038474 3300005564 Bacteria 771
233 Ga0068857_100010911 3300005577 Bacteria 7909
234 Ga0068857_100068387 3300005577 Bacteria 3161
235 Ga0068857_100344130 3300005577 Bacteria 1380
236 Ga0068854_100027292 3300005578 Bacteria 3934
237 Ga0068854_100347072 3300005578 Bacteria 1214
238 Ga0068854_100514421 3300005578 Bacteria 1010
239 Ga0068854_100628298 3300005578 Bacteria 920
240 Ga0068854_101028234 3300005578 Bacteria 731
241 Ga0068854_101294716 3300005578 Bacteria 656
242 Ga0068856_100000477 3300005614 Bacteria 44284
243 Ga0068856_100013826 3300005614 Bacteria 7803
244 Ga0068856_100039721 3300005614 Bacteria 4620
245 Ga0068856_100080175 3300005614 Bacteria 3238
246 Ga0068856_100107964 3300005614 Bacteria 2779
247 Ga0068856_100406820 3300005614 Bacteria 1380
248 Ga0068856_100637007 3300005614 Bacteria 1087
249 Ga0068856_100991160 3300005614 Bacteria 859
250 Ga0068856_101180566 3300005614 Bacteria 782
251 Ga0070702_100256280 3300005615 Bacteria 1189
252 Ga0070702_100325195 3300005615 Bacteria 1073
253 Ga0070702_100887626 3300005615 Bacteria 697
254 Ga0068852_100038691 3300005616 Bacteria 4010
255 Ga0068852_100124265 3300005616 Bacteria 2367
256 Ga0068852_100262581 3300005616 Bacteria 1658
257 Ga0068852_100325906 3300005616 Bacteria 1493
258 Ga0068852_100494062 3300005616 Bacteria 1218
259 Ga0068852_100646059 3300005616 Bacteria 1065
260 Ga0068852_100653058 3300005616 Bacteria 1059
261 Ga0068852_100655034 3300005616 Bacteria 1058
262 Ga0068852_100850660 3300005616 Bacteria 928
263 Ga0068852_101007822 3300005616 Bacteria 851
264 Ga0068852_101394953 3300005616 Bacteria 723
265 Ga0068859_100191528 3300005617 Bacteria 2129
266 Ga0068859_100590058 3300005617 Bacteria 1204
267 Ga0068859_102227746 3300005617 Bacteria 604
268 Ga0068859_102241510 3300005617 Bacteria 602
269 Ga0068864_100011654 3300005618 Bacteria 7260
270 Ga0068864_100123779 3300005618 Bacteria 2315
271 Ga0068864_100578833 3300005618 Bacteria 1088
272 Ga0068864_100640193 3300005618 Bacteria 1034
273 Ga0068864_100911103 3300005618 Bacteria 868
274 Ga0068864_101146489 3300005618 Bacteria 775
275 Ga0068866_10034581 3300005718 Bacteria 2462
276 Ga0068866_10110361 3300005718 Bacteria 1533
277 Ga0068866_10149166 3300005718 Bacteria 1352
278 Ga0068861_100090532 3300005719 Bacteria 2413
279 Ga0068851_10003264 3300005834 Bacteria 7194
280 Ga0068851_10089268 3300005834 Bacteria 1621
281 Ga0068851_10302565 3300005834 Bacteria 920
282 Ga0068851_11120610 3300005834 Bacteria 500
283 Ga0068870_10041783 3300005840 Bacteria 2384
284 Ga0068870_10388859 3300005840 Bacteria 905
285 Ga0068863_100055359 3300005841 Bacteria 3756
286 Ga0068863_100278792 3300005841 Bacteria 1619
287 Ga0068858_100092104 3300005842 Bacteria 2821
288 Ga0068858_100102877 3300005842 Bacteria 2664
289 Ga0068858_100178235 3300005842 Bacteria 2006
290 Ga0068858_100318188 3300005842 Bacteria 1487
291 Ga0068858_100453025 3300005842 Bacteria 1236
292 Ga0068858_100469589 3300005842 Bacteria 1214
293 Ga0068858_101067021 3300005842 Bacteria 792
294 Ga0068858_101147883 3300005842 Bacteria 763
295 Ga0068858_101286626 3300005842 Bacteria 719
296 Ga0068858_101888172 3300005842 Bacteria 590
297 Ga0068860_100000324 3300005843 Bacteria 64920
298 Ga0068860_101039060 3300005843 Bacteria 838
299 Ga0068860_101451241 3300005843 Bacteria 707
300 Ga0068860_102669186 3300005843 Bacteria 518
301 Ga0068862_100222247 3300005844 Bacteria 1710
302 Ga0068862_100289941 3300005844 Bacteria 1503
303 Ga0068862_100385277 3300005844 Bacteria 1308
304 Ga0068862_100494009 3300005844 Bacteria 1160
305 Ga0068862_101594539 3300005844 Bacteria 660
306 Ga0081455_10001871 3300005937 Bacteria 25308
307 Ga0081455_10011253 3300005937 Bacteria 9002
308 Ga0081455_10044492 3300005937 Bacteria 3872
309 Ga0081455_10058158 3300005937 Bacteria 3273
310 Ga0081455_10142244 3300005937 Bacteria 1861
311 Ga0081455_10220779 3300005937 Bacteria 1405
312 Ga0081455_10232590 3300005937 Bacteria 1359
313 Ga0081455_10257213 3300005937 Bacteria 1273
314 Ga0081538_10022266 3300005981 Bacteria 4595
315 Ga0081538_10057287 3300005981 Bacteria 2272
316 Ga0081540_1004943 3300005983 Bacteria 10022
317 Ga0081540_1007198 3300005983 Bacteria 7982
318 Ga0081540_1011781 3300005983 Bacteria 5816
319 Ga0081540_1018982 3300005983 Bacteria 4198
320 Ga0081540_1021410 3300005983 Bacteria 3851
321 Ga0081540_1021535 3300005983 Bacteria 3833
322 Ga0081540_1030775 3300005983 Bacteria 2966
323 Ga0081540_1036886 3300005983 Bacteria 2599
324 Ga0081540_1051457 3300005983 Bacteria 2036
325 Ga0081540_1105076 3300005983 Bacteria 1207
326 Ga0081540_1136702 3300005983 Bacteria 991
327 Ga0081540_1209542 3300005983 Bacteria 702
328 Ga0081540_1277682 3300005983 Bacteria 579
329 Ga0081539_10035506 3300005985 Bacteria 2995
330 Ga0081539_10065113 3300005985 Bacteria 1980
331 Ga0070717_10019455 3300006028 Bacteria 5324
332 Ga0070717_10139971 3300006028 Bacteria 2087
333 Ga0070717_10171956 3300006028 Bacteria 1885
334 Ga0070717_10403918 3300006028 Bacteria 1227
335 Ga0070717_10608135 3300006028 Bacteria 992
336 Ga0070717_11279160 3300006028 Bacteria 667
337 Ga0075365_10064317 3300006038 Bacteria 2457
338 Ga0075365_10104896 3300006038 Bacteria 1938
339 Ga0075365_10112194 3300006038 Bacteria 1875
340 Ga0075365_10122601 3300006038 Bacteria 1794
341 Ga0075365_10356032 3300006038 Bacteria 1032
342 Ga0075365_10414869 3300006038 Bacteria 950
343 Ga0075365_10420766 3300006038 Bacteria 943
344 Ga0075368_10030519 3300006042 Bacteria 2088
345 Ga0075368_10044308 3300006042 Bacteria 1755
346 Ga0075368_10126084 3300006042 Bacteria 1062
347 Ga0075368_10265170 3300006042 Bacteria 736
348 Ga0075363_100005107 3300006048 Bacteria 5807
349 Ga0075363_100216294 3300006048 Bacteria 1097
350 Ga0075363_100394420 3300006048 Bacteria 813
351 Ga0075364_10011122 3300006051 Bacteria 5463
352 Ga0075364_10134993 3300006051 Bacteria 1657
353 Ga0075364_10366454 3300006051 Bacteria 982
354 Ga0070715_10034945 3300006163 Bacteria 2064
355 Ga0070715_10108458 3300006163 Bacteria 1306
356 Ga0070715_10205215 3300006163 Bacteria 1004
357 Ga0070715_10240476 3300006163 Bacteria 941
358 Ga0070715_10860550 3300006163 Bacteria 555
359 Ga0070716_100259638 3300006173 Bacteria 1188
360 Ga0070716_100348798 3300006173 Bacteria 1047
361 Ga0070716_100354240 3300006173 Bacteria 1040
362 Ga0070716_100704111 3300006173 Bacteria 772
363 Ga0070716_100745606 3300006173 Bacteria 753
364 Ga0070712_100006981 3300006175 Bacteria 7039
365 Ga0070712_100464311 3300006175 Bacteria 1056
366 Ga0070712_100607825 3300006175 Bacteria 926
367 Ga0070712_100823949 3300006175 Bacteria 797
368 Ga0070712_101176059 3300006175 Bacteria 667
369 Ga0075362_10063047 3300006177 Bacteria 1680
370 Ga0075362_10066879 3300006177 Bacteria 1634
371 Ga0075362_10199116 3300006177 Bacteria 975
372 Ga0075362_10221059 3300006177 Bacteria 926
373 Ga0075367_10016972 3300006178 Bacteria 3986
374 Ga0075367_10025808 3300006178 Bacteria 3325
375 Ga0075367_10033657 3300006178 Bacteria 2955
376 Ga0075367_10127157 3300006178 Bacteria 1573
377 Ga0075367_10315119 3300006178 Bacteria 985
378 Ga0075367_10371339 3300006178 Bacteria 903
379 Ga0075369_10036614 3300006186 Bacteria 2088
380 Ga0075369_10141368 3300006186 Bacteria 1097
381 Ga0075369_10191499 3300006186 Bacteria 942
382 Ga0075369_10192993 3300006186 Bacteria 939
383 Ga0075369_10223204 3300006186 Bacteria 872
384 Ga0075369_10631888 3300006186 Bacteria 514
385 Ga0075366_10009346 3300006195 Bacteria 5471
386 Ga0075366_10050261 3300006195 Bacteria 2475
387 Ga0075366_10219622 3300006195 Bacteria 1158
388 Ga0075366_10264693 3300006195 Bacteria 1050
389 Ga0075366_10743249 3300006195 Bacteria 609
390 Ga0097621_100208844 3300006237 Bacteria 1698
391 Ga0097621_101060625 3300006237 Bacteria 760
392 Ga0097621_101173204 3300006237 Bacteria 723
393 Ga0075370_10007146 3300006353 Bacteria 5669
394 Ga0075370_10044151 3300006353 Bacteria 2519
395 Ga0075370_10156679 3300006353 Bacteria 1335
396 Ga0075370_10168882 3300006353 Bacteria 1285
397 Ga0075370_10187996 3300006353 Bacteria 1216
398 Ga0068871_100087350 3300006358 Bacteria 2592
399 Ga0068871_100113715 3300006358 Bacteria 2280
400 Ga0068871_100281937 3300006358 Bacteria 1454
401 Ga0068871_100342878 3300006358 Bacteria 1320
402 Ga0068871_100417459 3300006358 Bacteria 1198
403 Ga0068871_100490168 3300006358 Bacteria 1107
404 Ga0075428_100502947 3300006844 Bacteria 1297
405 Ga0075428_101930670 3300006844 Bacteria 613
406 Ga0075428_102371727 3300006844 Bacteria 545
407 Ga0075430_101027316 3300006846 Bacteria 679
408 Ga0075433_11180134 3300006852 Bacteria 665
409 Ga0075434_100378768 3300006871 Bacteria 1436
410 Ga0068865_100155130 3300006881 Bacteria 1741
411 Ga0068865_100438092 3300006881 Bacteria 1078
412 Ga0097620_100191521 3300006931 Bacteria 2129
413 Ga0097620_100590056 3300006931 Bacteria 1204
414 Ga0097620_102227745 3300006931 Bacteria 604
415 Ga0097620_102241541 3300006931 Bacteria 602
416 Ga0075435_100538266 3300007076 Bacteria 1011
417 Ga0099794_10244023 3300007265 Bacteria 926
418 Ga0099795_10008505 3300007788 Bacteria 2930
419 Ga0099795_10182915 3300007788 Bacteria 876
420 Ga0099795_10453833 3300007788 Bacteria 591
421 Ga0099795_10479768 3300007788 Bacteria 577
422 Ga0105251_10344434 3300009011 Bacteria 680
423 Ga0105250_10031361 3300009092 Bacteria 2134
424 Ga0105250_10095732 3300009092 Bacteria 1210
425 Ga0105240_10031140 3300009093 Bacteria 6922
426 Ga0105240_10056305 3300009093 Bacteria 4921
427 Ga0105240_10079684 3300009093 Bacteria 4029
428 Ga0105240_10089758 3300009093 Bacteria 3758
429 Ga0105240_10682737 3300009093 Bacteria 1123
430 Ga0105240_10883722 3300009093 Bacteria 962
431 Ga0105240_11597740 3300009093 Bacteria 682
432 Ga0105240_12404679 3300009093 Bacteria 545
433 Ga0111539_10705764 3300009094 Bacteria 1174
434 Ga0111539_12484128 3300009094 Bacteria 601
435 Ga0105245_10084292 3300009098 Bacteria 2911
436 Ga0105245_10190442 3300009098 Bacteria 1964
437 Ga0105245_10232066 3300009098 Bacteria 1785
438 Ga0105245_10631985 3300009098 Bacteria 1099
439 Ga0105245_11338970 3300009098 Bacteria 765
440 Ga0105245_11986696 3300009098 Bacteria 635
441 Ga0105245_12838524 3300009098 Bacteria 537
442 Ga0105247_10022626 3300009101 Bacteria 3785
443 Ga0105247_10062162 3300009101 Bacteria 2316
444 Ga0105247_10084359 3300009101 Bacteria 2007
445 Ga0105247_10394424 3300009101 Bacteria 984
446 Ga0105247_10512108 3300009101 Bacteria 876
447 Ga0105247_10830321 3300009101 Bacteria 708
448 Ga0105247_11435355 3300009101 Bacteria 560
449 Ga0114129_10060760 3300009147 Bacteria 5283
450 Ga0114129_11957674 3300009147 Bacteria 709
451 Ga0114129_12387997 3300009147 Bacteria 633
452 Ga0105243_10033198 3300009148 Bacteria 3991
453 Ga0105243_10047590 3300009148 Bacteria 3377
454 Ga0105243_10267254 3300009148 Bacteria 1534
455 Ga0105243_10740835 3300009148 Bacteria 962
456 Ga0105243_10959550 3300009148 Bacteria 855
457 Ga0105243_11339161 3300009148 Bacteria 734
458 Ga0105243_11573580 3300009148 Bacteria 683
459 Ga0105243_11759420 3300009148 Bacteria 650
460 Ga0105241_10001008 3300009174 Bacteria 21388
461 Ga0105241_10177980 3300009174 Bacteria 1762
462 Ga0105241_10330050 3300009174 Bacteria 1318
463 Ga0105241_11087885 3300009174 Bacteria 752
464 Ga0105241_12551952 3300009174 Bacteria 512
465 Ga0105242_10258033 3300009176 Bacteria 1573
466 Ga0105242_10379507 3300009176 Bacteria 1313
467 Ga0105242_10382084 3300009176 Bacteria 1309
468 Ga0105242_10479372 3300009176 Bacteria 1179
469 Ga0105242_10991146 3300009176 Bacteria 847
470 Ga0105242_11065824 3300009176 Bacteria 820
471 Ga0105242_12853617 3300009176 Bacteria 534
472 Ga0105248_10248781 3300009177 Bacteria 2001
473 Ga0105248_10780762 3300009177 Bacteria 1078
474 Ga0105248_11102413 3300009177 Bacteria 897
475 Ga0105248_11324917 3300009177 Bacteria 814
476 Ga0105248_12059058 3300009177 Bacteria 649
477 Ga0105237_10010908 3300009545 Bacteria 9643
478 Ga0105237_10029563 3300009545 Bacteria 5568
479 Ga0105237_10130582 3300009545 Bacteria 2506
480 Ga0105237_10144948 3300009545 Bacteria 2369
481 Ga0105237_10157999 3300009545 Bacteria 2265
482 Ga0105237_10165660 3300009545 Bacteria 2209
483 Ga0105237_10325017 3300009545 Bacteria 1542
484 Ga0105237_10690455 3300009545 Bacteria 1027
485 Ga0105237_10935486 3300009545 Bacteria 874
486 Ga0105237_11078069 3300009545 Bacteria 810
487 Ga0105238_10017548 3300009551 Bacteria 7278
488 Ga0105238_10057485 3300009551 Bacteria 3900
489 Ga0105238_10095675 3300009551 Bacteria 2957
490 Ga0105238_10202290 3300009551 Bacteria 1962
491 Ga0105238_10415043 3300009551 Bacteria 1340
492 Ga0105238_10731011 3300009551 Bacteria 1003
493 Ga0105238_10802331 3300009551 Bacteria 957
494 Ga0105238_10862861 3300009551 Bacteria 923
495 Ga0105238_11103637 3300009551 Bacteria 816
496 Ga0105238_11121340 3300009551 Bacteria 810
497 Ga0105238_11343932 3300009551 Bacteria 741
498 Ga0105238_11694793 3300009551 Bacteria 663
499 Ga0105249_10820056 3300009553 Bacteria 995
500 Ga0105249_12022726 3300009553 Bacteria 649
501 Ga0099796_10292597 3300010159 Bacteria 688
502 Ga0105239_10034795 3300010375 Bacteria 5533
503 Ga0105239_10075959 3300010375 Bacteria 3695
504 Ga0105239_10301160 3300010375 Bacteria 1805
505 Ga0105239_10659771 3300010375 Bacteria 1195
506 Ga0105239_10860455 3300010375 Bacteria 1040
507 Ga0105239_10977706 3300010375 Bacteria 973
508 Ga0105239_11594185 3300010375 Bacteria 755
509 Ga0105239_11697881 3300010375 Bacteria 731
510 Ga0105239_11746962 3300010375 Bacteria 720
511 Ga0105239_11997844 3300010375 Bacteria 673
512 Ga0105246_10089242 3300011119 Bacteria 2218
513 Ga0105246_10091525 3300011119 Bacteria 2193
514 Ga0105246_10139088 3300011119 Bacteria 1824
515 Ga0105246_10288112 3300011119 Bacteria 1320
516 Ga0105246_10550313 3300011119 Bacteria 989
517 Ga0105246_10713775 3300011119 Bacteria 880
518 Ga0105246_11100399 3300011119 Bacteria 725
519 Ga0105246_11865446 3300011119 Bacteria 576
520 Ga0157343_1019807 3300012488 Bacteria 600
521 Ga0157323_1026230 3300012495 Bacteria 590
522 Ga0157342_1047910 3300012507 Bacteria 593
523 Ga0157373_10089798 3300013100 Bacteria 2164
524 Ga0157373_10895513 3300013100 Bacteria 658
525 Ga0157370_10083446 3300013104 Bacteria 3004
526 Ga0157370_10389912 3300013104 Bacteria 1282
527 Ga0157370_10562320 3300013104 Bacteria 1045
528 Ga0157370_11300671 3300013104 Bacteria 655
529 Ga0157370_11366596 3300013104 Bacteria 638
530 Ga0157370_12064887 3300013104 Bacteria 511
531 Ga0157369_10007048 3300013105 Bacteria 12962
532 Ga0157369_10036963 3300013105 Bacteria 5349
533 Ga0157369_11354013 3300013105 Bacteria 725
534 Ga0157369_11443341 3300013105 Bacteria 700
535 Ga0157369_12393463 3300013105 Bacteria 535
536 Ga0157374_10003779 3300013296 Bacteria 12738
537 Ga0157374_10083182 3300013296 Bacteria 3040
538 Ga0157374_10505077 3300013296 Bacteria 1214
539 Ga0157374_11131641 3300013296 Bacteria 803
540 Ga0157374_11203608 3300013296 Bacteria 779
541 Ga0157374_11893913 3300013296 Bacteria 622
542 Ga0157374_12857768 3300013296 Bacteria 510
543 Ga0157378_10016187 3300013297 Bacteria 6531
544 Ga0157378_10309950 3300013297 Bacteria 1530
545 Ga0157378_10745313 3300013297 Bacteria 1002
546 Ga0157378_11040510 3300013297 Bacteria 854
547 Ga0157378_12023634 3300013297 Bacteria 626
548 Ga0157378_12263818 3300013297 Bacteria 595
549 Ga0163162_10027469 3300013306 Bacteria 5628
550 Ga0163162_10108608 3300013306 Bacteria 2871
551 Ga0163162_10656923 3300013306 Bacteria 1172
552 Ga0163162_10680266 3300013306 Bacteria 1151
553 Ga0163162_10947424 3300013306 Bacteria 972
554 Ga0163162_11530191 3300013306 Bacteria 760
555 Ga0163162_11636737 3300013306 Bacteria 735
556 Ga0163162_11994090 3300013306 Bacteria 665
557 Ga0163162_12451168 3300013306 Bacteria 600
558 Ga0157372_10307105 3300013307 Bacteria 1846
559 Ga0157372_10324395 3300013307 Bacteria 1793
560 Ga0157372_10730602 3300013307 Bacteria 1151
561 Ga0157372_10890254 3300013307 Bacteria 1033
562 Ga0157372_12113724 3300013307 Bacteria 647
563 Ga0157372_12438341 3300013307 Bacteria 601
564 Ga0157372_12904047 3300013307 Bacteria 549
565 Ga0157375_10064609 3300013308 Bacteria 3644
566 Ga0157375_10202740 3300013308 Bacteria 2140
567 Ga0157375_10661934 3300013308 Bacteria 1200
568 Ga0157375_11357165 3300013308 Bacteria 837
569 Ga0157375_11614111 3300013308 Bacteria 767
570 Ga0163163_10126601 3300014325 Bacteria 2593
571 Ga0163163_10282022 3300014325 Bacteria 1713
572 Ga0163163_10336532 3300014325 Bacteria 1564
573 Ga0163163_10402076 3300014325 Bacteria 1428
574 Ga0163163_10883660 3300014325 Bacteria 957
575 Ga0163163_10973155 3300014325 Bacteria 912
576 Ga0163163_12283982 3300014325 Bacteria 600
577 Ga0157380_10178437 3300014326 Bacteria 1864
578 Ga0157380_10551069 3300014326 Bacteria 1131
579 Ga0157380_10813846 3300014326 Bacteria 952
580 Ga0157380_12345519 3300014326 Bacteria 598
581 Ga0157377_10081774 3300014745 Bacteria 1890
582 Ga0157377_10545896 3300014745 Bacteria 818
583 Ga0157377_11010053 3300014745 Bacteria 631
584 Ga0157379_10138920 3300014968 Bacteria 2190
585 Ga0157379_10145562 3300014968 Bacteria 2137
586 Ga0157379_10152708 3300014968 Bacteria 2083
587 Ga0157379_10157951 3300014968 Bacteria 2046
588 Ga0157379_10489103 3300014968 Bacteria 1139
589 Ga0157379_10779432 3300014968 Bacteria 901
590 Ga0157379_11435948 3300014968 Bacteria 670
591 Ga0157379_11601079 3300014968 Bacteria 636
592 Ga0157376_10075336 3300014969 Bacteria 2880
593 Ga0157376_10125927 3300014969 Bacteria 2279
594 Ga0157376_10127844 3300014969 Bacteria 2263
595 Ga0157376_10602861 3300014969 Bacteria 1093
596 Ga0163161_10221975 3300017792 Bacteria 1464
597 Ga0163161_10702580 3300017792 Bacteria 842
598 Ga0213873_10025770 3300021358 Bacteria 1422
599 Ga0213872_10025966 3300021361 Bacteria 2691
600 Ga0213874_10045896 3300021377 Bacteria 1324
601 Ga0213876_10007688 3300021384 Bacteria 5852
602 Ga0213876_10024127 3300021384 Bacteria 3210
603 Ga0213876_10053186 3300021384 Bacteria 2139
604 Ga0213871_10038295 3300021441 Bacteria 1280
605 Ga0224712_10279051 3300022467 Bacteria 777
606 Ga0209563_101314 3300025230 Bacteria 6783
607 Ga0209677_103699 3300025253 Bacteria 4798
608 Ga0209148_1005097 3300025254 Bacteria 3076
609 Ga0209233_1005247 3300025261 Bacteria 4320
610 Ga0209233_1019917 3300025261 Bacteria 1771
611 Ga0209233_1025956 3300025261 Bacteria 1440
612 Ga0209455_1003980 3300025272 Bacteria 5010
613 Ga0209455_1043663 3300025272 Bacteria 666
614 Ga0209564_1021737 3300025295 Bacteria 2295
615 Ga0209758_1000720 3300025297 Bacteria 48767
616 Ga0209758_1001990 3300025297 Bacteria 22036
617 Ga0209758_1011741 3300025297 Bacteria 5022
618 Ga0209758_1029293 3300025297 Bacteria 2306
619 Ga0209758_1036588 3300025297 Bacteria 1913
620 Ga0209256_1034656 3300025299 Bacteria 1341
621 Ga0207426_1000480 3300025302 Bacteria 60866
622 Ga0207426_1001491 3300025302 Bacteria 19157
623 Ga0209257_1060263 3300025304 Bacteria 1033
624 Ga0207697_10091260 3300025315 Bacteria 1291
625 Ga0207697_10142192 3300025315 Bacteria 1041
626 Ga0207656_10002484 3300025321 Bacteria 6226
627 Ga0207656_10133247 3300025321 Bacteria 1166
628 Ga0207682_10093465 3300025893 Bacteria 1307
629 Ga0207692_10003656 3300025898 Bacteria 6025
630 Ga0207692_10005126 3300025898 Bacteria 5229
631 Ga0207692_10097241 3300025898 Bacteria 1609
632 Ga0207692_10616603 3300025898 Bacteria 699
633 Ga0207692_10692408 3300025898 Bacteria 661
634 Ga0207642_10291908 3300025899 Bacteria 942
635 Ga0207642_10371953 3300025899 Bacteria 848
636 Ga0207710_10053419 3300025900 Bacteria 1818
637 Ga0207710_10131847 3300025900 Bacteria 1201
638 Ga0207710_10205416 3300025900 Bacteria 974
639 Ga0207710_10239728 3300025900 Bacteria 904
640 Ga0207710_10257554 3300025900 Bacteria 874
641 Ga0207710_10350614 3300025900 Bacteria 752
642 Ga0207710_10785235 3300025900 Bacteria 501
643 Ga0207688_10056128 3300025901 Bacteria 2212
644 Ga0207688_10289825 3300025901 Bacteria 999
645 Ga0207680_10277414 3300025903 Bacteria 1164
646 Ga0207680_10376179 3300025903 Bacteria 1001
647 Ga0207680_10681953 3300025903 Bacteria 736
648 Ga0207680_10722871 3300025903 Bacteria 714
649 Ga0207680_10968046 3300025903 Bacteria 610
650 Ga0207647_10004039 3300025904 Bacteria 10933
651 Ga0207647_10032878 3300025904 Bacteria 3327
652 Ga0207647_10049888 3300025904 Bacteria 2594
653 Ga0207647_10215640 3300025904 Bacteria 1107
654 Ga0207647_10274464 3300025904 Bacteria 963
655 Ga0207685_10017678 3300025905 Bacteria 2312
656 Ga0207685_10095425 3300025905 Bacteria 1261
657 Ga0207685_10645472 3300025905 Bacteria 572
658 Ga0207699_10000577 3300025906 Bacteria 18050
659 Ga0207699_10006106 3300025906 Bacteria 5806
660 Ga0207699_10024585 3300025906 Bacteria 3296
661 Ga0207699_10049055 3300025906 Bacteria 2483
662 Ga0207699_10256086 3300025906 Bacteria 1208
663 Ga0207645_10049857 3300025907 Bacteria 2674
664 Ga0207645_10349657 3300025907 Bacteria 989
665 Ga0207645_10495702 3300025907 Bacteria 827
666 Ga0207645_10746389 3300025907 Bacteria 665
667 Ga0207643_10088442 3300025908 Bacteria 1803
668 Ga0207643_10133525 3300025908 Bacteria 1478
669 Ga0207643_10557229 3300025908 Bacteria 736
670 Ga0207705_10316793 3300025909 Bacteria 1198
671 Ga0207705_10463695 3300025909 Bacteria 983
672 Ga0207705_10763177 3300025909 Bacteria 751
673 Ga0207705_11142941 3300025909 Bacteria 599
674 Ga0207654_10004108 3300025911 Bacteria 7337
675 Ga0207654_10027201 3300025911 Bacteria 3107
676 Ga0207654_10074355 3300025911 Bacteria 2028
677 Ga0207654_10599922 3300025911 Bacteria 786
678 Ga0207707_10010530 3300025912 Bacteria 8028
679 Ga0207707_10172110 3300025912 Bacteria 1892
680 Ga0207707_10490729 3300025912 Bacteria 1048
681 Ga0207695_10001596 3300025913 Bacteria 36807
682 Ga0207695_10040729 3300025913 Bacteria 4977
683 Ga0207695_10047940 3300025913 Bacteria 4516
684 Ga0207695_10227471 3300025913 Bacteria 1771
685 Ga0207695_10247058 3300025913 Bacteria 1684
686 Ga0207695_10357126 3300025913 Bacteria 1348
687 Ga0207695_10440425 3300025913 Bacteria 1186
688 Ga0207695_10851535 3300025913 Bacteria 792
689 Ga0207695_10858845 3300025913 Bacteria 787
690 Ga0207671_10040116 3300025914 Bacteria 3466
691 Ga0207671_10085407 3300025914 Bacteria 2371
692 Ga0207671_10165399 3300025914 Bacteria 1715
693 Ga0207671_10177214 3300025914 Bacteria 1658
694 Ga0207671_10208932 3300025914 Bacteria 1526
695 Ga0207671_10255363 3300025914 Bacteria 1379
696 Ga0207671_10328512 3300025914 Bacteria 1211
697 Ga0207671_10338585 3300025914 Bacteria 1192
698 Ga0207671_10660665 3300025914 Bacteria 832
699 Ga0207671_10678654 3300025914 Bacteria 820
700 Ga0207693_10003944 3300025915 Bacteria 12612
701 Ga0207693_10013523 3300025915 Bacteria 6578
702 Ga0207693_10056474 3300025915 Bacteria 3077
703 Ga0207693_10121734 3300025915 Bacteria 2049
704 Ga0207693_10778654 3300025915 Bacteria 738
705 Ga0207663_10008914 3300025916 Bacteria 5276
706 Ga0207663_10140855 3300025916 Bacteria 1680
707 Ga0207663_10432396 3300025916 Bacteria 1012
708 Ga0207660_10034726 3300025917 Bacteria 3496
709 Ga0207660_10093335 3300025917 Bacteria 2236
710 Ga0207660_10153677 3300025917 Bacteria 1770
711 Ga0207660_10426359 3300025917 Bacteria 1070
712 Ga0207662_10187498 3300025918 Bacteria 1333
713 Ga0207662_10323419 3300025918 Bacteria 1030
714 Ga0207657_10019344 3300025919 Bacteria 6470
715 Ga0207657_10100066 3300025919 Bacteria 2407
716 Ga0207657_10162330 3300025919 Bacteria 1814
717 Ga0207657_10299838 3300025919 Bacteria 1273
718 Ga0207649_10361912 3300025920 Bacteria 1077
719 Ga0207649_10844819 3300025920 Bacteria 716
720 Ga0207649_10847576 3300025920 Bacteria 715
721 Ga0207649_11467170 3300025920 Bacteria 540
722 Ga0207652_10163094 3300025921 Bacteria 1998
723 Ga0207652_10191743 3300025921 Bacteria 1838
724 Ga0207652_11898822 3300025921 Bacteria 501
725 Ga0207681_11028637 3300025923 Bacteria 691
726 Ga0207681_11626970 3300025923 Bacteria 540
727 Ga0207694_10000757 3300025924 Bacteria 28985
728 Ga0207694_10042137 3300025924 Bacteria 3520
729 Ga0207694_10043771 3300025924 Bacteria 3456
730 Ga0207694_10310706 3300025924 Bacteria 1299
731 Ga0207694_10320856 3300025924 Bacteria 1278
732 Ga0207694_10467364 3300025924 Bacteria 1054
733 Ga0207694_10722773 3300025924 Bacteria 840
734 Ga0207694_10795393 3300025924 Bacteria 799
735 Ga0207694_11109796 3300025924 Bacteria 669
736 Ga0207650_10144680 3300025925 Bacteria 1871
737 Ga0207650_10177638 3300025925 Bacteria 1695
738 Ga0207687_10055560 3300025927 Bacteria 2775
739 Ga0207687_10329319 3300025927 Bacteria 1238
740 Ga0207687_10379318 3300025927 Bacteria 1158
741 Ga0207700_10013608 3300025928 Bacteria 5301
742 Ga0207700_10061229 3300025928 Bacteria 2854
743 Ga0207700_10134443 3300025928 Bacteria 2024
744 Ga0207700_10157297 3300025928 Bacteria 1884
745 Ga0207700_10185956 3300025928 Bacteria 1743
746 Ga0207700_10797414 3300025928 Bacteria 845
747 Ga0207700_11410433 3300025928 Bacteria 619
748 Ga0207664_10006915 3300025929 Bacteria 7848
749 Ga0207664_10036913 3300025929 Bacteria 3779
750 Ga0207664_10052569 3300025929 Bacteria 3222
751 Ga0207664_10255823 3300025929 Bacteria 1530
752 Ga0207664_11052701 3300025929 Bacteria 728
753 Ga0207664_11088878 3300025929 Bacteria 715
754 Ga0207644_10158148 3300025931 Bacteria 1759
755 Ga0207644_10161469 3300025931 Bacteria 1742
756 Ga0207644_10172994 3300025931 Bacteria 1687
757 Ga0207644_10193212 3300025931 Bacteria 1601
758 Ga0207644_10990870 3300025931 Bacteria 705
759 Ga0207690_10016718 3300025932 Bacteria 4469
760 Ga0207690_10194786 3300025932 Bacteria 1535
761 Ga0207690_10195520 3300025932 Bacteria 1532
762 Ga0207690_10408447 3300025932 Bacteria 1084
763 Ga0207690_10446977 3300025932 Bacteria 1038
764 Ga0207690_11318982 3300025932 Bacteria 603
765 Ga0207706_10065152 3300025933 Bacteria 3208
766 Ga0207706_10094764 3300025933 Bacteria 2626
767 Ga0207686_10116429 3300025934 Bacteria 1812
768 Ga0207686_10242173 3300025934 Bacteria 1313
769 Ga0207709_10128777 3300025935 Bacteria 1721
770 Ga0207709_10129066 3300025935 Bacteria 1720
771 Ga0207709_10631956 3300025935 Bacteria 851
772 Ga0207709_10648985 3300025935 Bacteria 840
773 Ga0207709_11019103 3300025935 Bacteria 677
774 Ga0207709_11123684 3300025935 Bacteria 646
775 Ga0207670_10391031 3300025936 Bacteria 1110
776 Ga0207670_10410095 3300025936 Bacteria 1085
777 Ga0207670_10917357 3300025936 Bacteria 734
778 Ga0207669_10409929 3300025937 Bacteria 1064
779 Ga0207669_10757109 3300025937 Bacteria 802
780 Ga0207669_11523894 3300025937 Bacteria 570
781 Ga0207704_10021550 3300025938 Bacteria 3435
782 Ga0207704_10104069 3300025938 Bacteria 1900
783 Ga0207665_10004132 3300025939 Bacteria 9671
784 Ga0207665_10079009 3300025939 Bacteria 2261
785 Ga0207665_10103423 3300025939 Bacteria 1992
786 Ga0207665_10281226 3300025939 Bacteria 1238
787 Ga0207665_10395574 3300025939 Bacteria 1051
788 Ga0207665_10443501 3300025939 Bacteria 995
789 Ga0207665_11304768 3300025939 Bacteria 579
790 Ga0207665_11549067 3300025939 Bacteria 526
791 Ga0207665_11575215 3300025939 Bacteria 521
792 Ga0207691_10154001 3300025940 Bacteria 2020
793 Ga0207691_10189182 3300025940 Bacteria 1796
794 Ga0207691_10409365 3300025940 Bacteria 1156
795 Ga0207691_11077790 3300025940 Bacteria 669
796 Ga0207711_10033638 3300025941 Bacteria 4339
797 Ga0207711_10046779 3300025941 Bacteria 3697
798 Ga0207711_10877974 3300025941 Bacteria 834
799 Ga0207711_11936629 3300025941 Bacteria 532
800 Ga0207689_10098724 3300025942 Bacteria 2399
801 Ga0207689_10111351 3300025942 Bacteria 2250
802 Ga0207689_10139060 3300025942 Bacteria 2000
803 Ga0207689_10162827 3300025942 Bacteria 1838
804 Ga0207661_10014836 3300025944 Bacteria 5715
805 Ga0207661_10084573 3300025944 Bacteria 2628
806 Ga0207661_10615211 3300025944 Bacteria 998
807 Ga0207661_11215494 3300025944 Bacteria 693
808 Ga0207679_10025455 3300025945 Bacteria 4070
809 Ga0207679_11076271 3300025945 Bacteria 737
810 Ga0207679_11372118 3300025945 Bacteria 649
811 Ga0207679_11560646 3300025945 Bacteria 605
812 Ga0207667_10061306 3300025949 Bacteria 3935
813 Ga0207667_10109742 3300025949 Bacteria 2846
814 Ga0207667_10158436 3300025949 Bacteria 2329
815 Ga0207667_10349468 3300025949 Bacteria 1508
816 Ga0207667_10527895 3300025949 Bacteria 1195
817 Ga0207667_10609513 3300025949 Bacteria 1100
818 Ga0207667_10852217 3300025949 Bacteria 905
819 Ga0207667_10904720 3300025949 Bacteria 874
820 Ga0207667_11887961 3300025949 Bacteria 560
821 Ga0207667_12148003 3300025949 Bacteria 516
822 Ga0207651_11449804 3300025960 Bacteria 618
823 Ga0207712_10546545 3300025961 Bacteria 996
824 Ga0207712_10893510 3300025961 Bacteria 785
825 Ga0207668_10206410 3300025972 Bacteria 1568
826 Ga0207668_10413199 3300025972 Bacteria 1143
827 Ga0207668_10451147 3300025972 Bacteria 1097
828 Ga0207668_10606382 3300025972 Bacteria 954
829 Ga0207668_10948413 3300025972 Bacteria 767
830 Ga0207668_10986140 3300025972 Bacteria 752
831 Ga0207668_11439104 3300025972 Bacteria 621
832 Ga0207640_10045297 3300025981 Bacteria 2824
833 Ga0207640_10143338 3300025981 Bacteria 1745
834 Ga0207640_10427295 3300025981 Bacteria 1086
835 Ga0207640_10671751 3300025981 Bacteria 885
836 Ga0207640_10814277 3300025981 Bacteria 810
837 Ga0207640_11852295 3300025981 Bacteria 546
838 Ga0207658_10104015 3300025986 Bacteria 2230
839 Ga0207658_10404716 3300025986 Bacteria 1200
840 Ga0207658_10969121 3300025986 Bacteria 775
841 Ga0207658_11077773 3300025986 Bacteria 734
842 Ga0207677_10029898 3300026023 Bacteria 3469
843 Ga0207677_10711426 3300026023 Bacteria 892
844 Ga0207677_10827032 3300026023 Bacteria 831
845 Ga0207677_10833613 3300026023 Bacteria 827
846 Ga0207703_10065585 3300026035 Bacteria 2984
847 Ga0207703_10275413 3300026035 Bacteria 1526
848 Ga0207703_11325748 3300026035 Bacteria 692
849 Ga0207703_11343439 3300026035 Bacteria 687
850 Ga0207639_10012898 3300026041 Bacteria 5830
851 Ga0207639_10014848 3300026041 Bacteria 5485
852 Ga0207639_10019630 3300026041 Bacteria 4824
853 Ga0207639_10088539 3300026041 Bacteria 2471
854 Ga0207639_10161946 3300026041 Bacteria 1886
855 Ga0207639_10262757 3300026041 Bacteria 1510
856 Ga0207639_10410399 3300026041 Bacteria 1222
857 Ga0207639_10542047 3300026041 Bacteria 1067
858 Ga0207639_10579343 3300026041 Bacteria 1033
859 Ga0207639_10786438 3300026041 Bacteria 886
860 Ga0207639_10794264 3300026041 Bacteria 882
861 Ga0207678_10003302 3300026067 Bacteria 14538
862 Ga0207678_10023203 3300026067 Bacteria 5428
863 Ga0207678_10027731 3300026067 Bacteria 4945
864 Ga0207678_10056727 3300026067 Bacteria 3372
865 Ga0207678_10066796 3300026067 Bacteria 3087
866 Ga0207678_10170951 3300026067 Bacteria 1855
867 Ga0207678_10195056 3300026067 Bacteria 1731
868 Ga0207678_10217097 3300026067 Bacteria 1637
869 Ga0207678_10234204 3300026067 Bacteria 1572
870 Ga0207678_10279137 3300026067 Bacteria 1433
871 Ga0207678_10314833 3300026067 Bacteria 1346
872 Ga0207678_10429183 3300026067 Bacteria 1147
873 Ga0207678_10768904 3300026067 Bacteria 850
874 Ga0207678_11002467 3300026067 Bacteria 739
875 Ga0207708_10035518 3300026075 Bacteria 3792
876 Ga0207708_11502925 3300026075 Bacteria 592
877 Ga0207702_10000003 3300026078 Bacteria 434196
878 Ga0207702_10000744 3300026078 Bacteria 34789
879 Ga0207702_10046859 3300026078 Bacteria 3641
880 Ga0207702_10189788 3300026078 Bacteria 1898
881 Ga0207702_10197412 3300026078 Bacteria 1863
882 Ga0207702_10205988 3300026078 Bacteria 1826
883 Ga0207702_10298895 3300026078 Bacteria 1527
884 Ga0207702_10366049 3300026078 Bacteria 1383
885 Ga0207702_10375964 3300026078 Bacteria 1365
886 Ga0207702_10915567 3300026078 Bacteria 869
887 Ga0207702_11090074 3300026078 Bacteria 792
888 Ga0207702_11187701 3300026078 Bacteria 757
889 Ga0207641_11939477 3300026088 Bacteria 590
890 Ga0207648_10088869 3300026089 Bacteria 2698
891 Ga0207648_10164443 3300026089 Bacteria 1960
892 Ga0207648_10465653 3300026089 Bacteria 1153
893 Ga0207648_11122052 3300026089 Bacteria 738
894 Ga0207648_11281186 3300026089 Bacteria 689
895 Ga0207676_10075837 3300026095 Bacteria 2714
896 Ga0207676_10142072 3300026095 Bacteria 2056
897 Ga0207676_10328372 3300026095 Bacteria 1407
898 Ga0207676_10385509 3300026095 Bacteria 1306
899 Ga0207676_10958672 3300026095 Bacteria 841
900 Ga0207676_11108167 3300026095 Bacteria 783
901 Ga0207674_10017516 3300026116 Bacteria 7815
902 Ga0207674_10052521 3300026116 Bacteria 4156
903 Ga0207674_10088541 3300026116 Bacteria 3089
904 Ga0207674_10133243 3300026116 Bacteria 2448
905 Ga0207674_10256684 3300026116 Bacteria 1695
906 Ga0207674_10704318 3300026116 Bacteria 975
907 Ga0207675_100103863 3300026118 Bacteria 2678
908 Ga0207675_100137467 3300026118 Bacteria 2319
909 Ga0207675_100616218 3300026118 Bacteria 1089
910 Ga0207675_101113730 3300026118 Bacteria 809
911 Ga0207683_10065026 3300026121 Bacteria 3215
912 Ga0207683_10075863 3300026121 Bacteria 2977
913 Ga0207683_10168997 3300026121 Bacteria 1980
914 Ga0207683_10294328 3300026121 Bacteria 1485
915 Ga0207683_10738654 3300026121 Bacteria 913
916 Ga0207683_10872335 3300026121 Bacteria 835
917 Ga0207698_10008823 3300026142 Bacteria 6391
918 Ga0207698_10027211 3300026142 Bacteria 4056
919 Ga0207698_10168842 3300026142 Bacteria 1924
920 Ga0207698_10194058 3300026142 Bacteria 1812
921 Ga0207698_10341317 3300026142 Bacteria 1411
922 Ga0207698_10361341 3300026142 Bacteria 1375
923 Ga0207698_10414102 3300026142 Bacteria 1291
924 Ga0207698_10548985 3300026142 Bacteria 1132
925 Ga0207698_10620213 3300026142 Bacteria 1068
926 Ga0207698_10678941 3300026142 Bacteria 1023
927 Ga0207698_10727393 3300026142 Bacteria 989
928 Ga0207698_12654412 3300026142 Bacteria 510
929 Ga0207698_12659955 3300026142 Bacteria 509
930 Ga0207698_12757283 3300026142 Bacteria 500
931 Ga0209389_1000009 3300027296 Bacteria 226873
932 Ga0209489_100050 3300027361 Bacteria 154669
933 Ga0209700_100016 3300027363 Bacteria 252567
934 Ga0209179_1002915 3300027512 Bacteria 2388
935 Ga0209588_1069753 3300027671 Bacteria 1136
936 Ga0209813_10080942 3300027866 Bacteria 1074
937 Ga0209813_10268132 3300027866 Bacteria 654
938 Ga0209813_10309226 3300027866 Bacteria 616
939 Ga0268266_10002325 3300028379 Bacteria 20596
940 Ga0268266_10010017 3300028379 Bacteria 8318
941 Ga0268266_10030342 3300028379 Bacteria 4593
942 Ga0268266_10079541 3300028379 Bacteria 2854
943 Ga0268266_10108109 3300028379 Bacteria 2460
944 Ga0268266_10163306 3300028379 Bacteria 2016
945 Ga0268266_10345523 3300028379 Bacteria 1397
946 Ga0268266_10482117 3300028379 Bacteria 1182
947 Ga0268266_11169379 3300028379 Bacteria 744
948 Ga0268266_11360192 3300028379 Bacteria 685
949 Ga0268265_10067985 3300028380 Bacteria 2760
950 Ga0268265_10149717 3300028380 Bacteria 1967
951 Ga0268265_10259271 3300028380 Bacteria 1544
952 Ga0268265_10823154 3300028380 Bacteria 906
953 Ga0268265_11595115 3300028380 Bacteria 657
954 Ga0268265_11604686 3300028380 Bacteria 655
955 Ga0268264_10000038 3300028381 Bacteria 383623
956 Ga0268264_10044034 3300028381 Bacteria 3701
957 Ga0268264_11692090 3300028381 Bacteria 643
958 Ga0307517_10000512 3300028786 Bacteria 66501
959 Ga0307517_10140807 3300028786 Bacteria 1694
960 Ga0307517_10321581 3300028786 Bacteria 856
961 Ga0307515_10022025 3300028794 Bacteria 11255
962 Ga0307515_10382332 3300028794 Bacteria 1040
963 Ga0307511_10117777 3300030521 Bacteria 1658
964 Ga0307511_10215090 3300030521 Bacteria 974
965 Ga0265330_10003886 3300031235 Bacteria 7683
966 Ga0265332_10034474 3300031238 Bacteria 2199
967 Ga0265332_10103572 3300031238 Bacteria 1200
968 Ga0265328_10037456 3300031239 Bacteria 1791
969 Ga0265340_10005741 3300031247 Bacteria 6857
970 Ga0265340_10419736 3300031247 Bacteria 590
971 Ga0265339_10024640 3300031249 Bacteria 3464
972 Ga0265339_10108566 3300031249 Bacteria 1438
973 Ga0265339_10513904 3300031249 Bacteria 552
974 Ga0265331_10188624 3300031250 Bacteria 930
975 Ga0265331_10397380 3300031250 Bacteria 618
976 Ga0307513_10236595 3300031456 Bacteria 1635
977 Ga0307513_10320835 3300031456 Bacteria 1307
978 Ga0307513_10417631 3300031456 Bacteria 1072
979 Ga0307509_10261922 3300031507 Bacteria 1503
980 Ga0307509_10589968 3300031507 Bacteria 785
981 Ga0307509_10602254 3300031507 Bacteria 771
982 Ga0307408_100075146 3300031548 Bacteria 2510
983 Ga0307408_102321925 3300031548 Bacteria 520
984 Ga0307508_10000008 3300031616 Bacteria 265023
985 Ga0307508_10043701 3300031616 Bacteria 4013
986 Ga0307508_10088541 3300031616 Bacteria 2680
987 Ga0307508_10206983 3300031616 Bacteria 1562
988 Ga0307508_10314525 3300031616 Bacteria 1158
989 Ga0265314_10001759 3300031711 Bacteria 23380
990 Ga0265342_10097288 3300031712 Bacteria 1681
991 Ga0265342_10120667 3300031712 Bacteria 1477
992 Ga0307516_10066581 3300031730 Bacteria 3474
993 Ga0307516_10099474 3300031730 Bacteria 2725
994 Ga0307516_10113504 3300031730 Bacteria 2508
995 Ga0307516_10167947 3300031730 Bacteria 1937
996 Ga0307516_10185470 3300031730 Bacteria 1811
997 Ga0307516_10214139 3300031730 Bacteria 1639
998 Ga0307516_10445570 3300031730 Bacteria 951
999 Ga0307516_10455428 3300031730 Bacteria 935
1000 Ga0307516_10808780 3300031730 Bacteria 599
1001 Ga0307405_10108479 3300031731 Bacteria 1876
1002 Ga0307405_10790815 3300031731 Bacteria 794
1003 Ga0307413_11174437 3300031824 Bacteria 666
1004 Ga0307413_12159251 3300031824 Bacteria 504
1005 Ga0307518_10270366 3300031838 Bacteria 1062
1006 Ga0307410_10407593 3300031852 Bacteria 1100
1007 Ga0307407_10455455 3300031903 Bacteria 929
1008 Ga0307412_10803011 3300031911 Bacteria 817
1009 Ga0307409_100260726 3300031995 Bacteria 1590
1010 Ga0307409_100591857 3300031995 Bacteria 1095
1011 Ga0307416_100668121 3300032002 Bacteria 1125
1012 Ga0307416_100935474 3300032002 Bacteria 968
1013 Ga0307416_101334917 3300032002 Bacteria 823
1014 Ga0307416_103797766 3300032002 Bacteria 506
1015 Ga0307414_10372720 3300032004 Bacteria 1232
1016 Ga0307411_10281482 3300032005 Bacteria 1324
1017 Ga0307411_10405790 3300032005 Bacteria 1128
1018 Ga0307415_100146142 3300032126 Bacteria 1813
1019 Ga0307415_100256944 3300032126 Bacteria 1423
1020 Ga0307415_100542146 3300032126 Bacteria 1025
1021 Ga0307415_100704490 3300032126 Bacteria 911
1022 Ga0307415_102561490 3300032126 Bacteria 503
1023 Ga0307510_10009742 3300033180 Bacteria 11434
1024 Ga0307510_10050764 3300033180 Bacteria 4396
1025 Ga0307510_10275419 3300033180 Bacteria 1156
1026 Ga0315911_1000004 3300033442 Bacteria 472637
1027 Ga0373930_0023681 3300034816 Bacteria 1222
1028 Ga0373938_0009634 3300034957 Bacteria 1755
1029 Ga0373926_0170234 3300035083 Bacteria 833
1030 Ga0373926_0179436 3300035083 Bacteria 812
1031 Ga0373928_0030900 3300035084 Bacteria 1186
1032 Ga0373949_0068913 3300035090 Bacteria 923
1033 Ga0373952_0186611 3300035092 Bacteria 601
1034 Ga0373923_0024351 3300035111 Bacteria 2388
1035 Ga0373923_0065895 3300035111 Bacteria 1547
1036 Ga0373932_0043651 3300035112 Bacteria 1305
1037 Ga0373936_0078266 3300035113 Bacteria 1373
1038 Ga0373936_0489931 3300035113 Bacteria 571
1039 Ga0373939_0067628 3300035114 Bacteria 1155
1040 Ga0373939_0172438 3300035114 Bacteria 802
1041 Ga0373941_0062019 3300035115 Bacteria 1219
1042 Ga0373945_0106342 3300035116 Bacteria 1103
1043 Ga0373945_0336143 3300035116 Bacteria 653
1044 Ga0373945_0473287 3300035116 Bacteria 556
1045 Ga0373953_0008522 3300035117 Bacteria 3487
1046 Ga0373954_0188554 3300035118 Bacteria 1012
1047 Ga0373960_0153340 3300035121 Bacteria 788
1048 Ga0373943_0003068 3300035170 Bacteria 7590
1049 Ga0373943_0247281 3300035170 Bacteria 1001
1050 Ga0373943_0358814 3300035170 Bacteria 836
1051 Ga0373943_0374906 3300035170 Bacteria 818
1052 Ga0373943_0456947 3300035170 Bacteria 743
1053 Ga0373946_0029683 3300035171 Bacteria 2178
1054 Ga0373946_0052697 3300035171 Bacteria 1707
1055 Ga0373955_0030906 3300035172 Bacteria 2801
1056 Ga0373961_0009070 3300035241 Bacteria 2428
1057 Ga0373924_0094211 3300035410 Bacteria 1283
1058 Ga0373931_0003601 3300035691 Bacteria 6992
1059 Ga0373931_0083348 3300035691 Bacteria 1769
1060 Ga0373931_0328557 3300035691 Bacteria 952
1061 Ga0373935_0001766 3300035692 Bacteria 12152
1062 Ga0373935_1021568 3300035692 Bacteria 614
1063 Ga0373927_0000346 3300035695 Bacteria 36389
1064 Ga0373927_0003142 3300035695 Bacteria 11934
1065 Ga0373927_0018992 3300035695 Bacteria 4510
1066 Ga0373927_0021985 3300035695 Bacteria 4180
1067 Ga0373927_0028798 3300035695 Bacteria 3622
1068 Ga0373927_0046710 3300035695 Bacteria 2801
1069 Ga0373927_0073207 3300035695 Bacteria 2218
1070 Ga0373927_0231107 3300035695 Bacteria 1215
1071 Ga0373927_0252436 3300035695 Bacteria 1159
1072 Ga0373927_0408378 3300035695 Bacteria 896
1073 Ga0373933_0004420 3300035724 Bacteria 7717
1074 Ga0373933_0024198 3300035724 Bacteria 3476
1075 Ga0373933_0362937 3300035724 Bacteria 942
1076 Ga0373933_1167544 3300035724 Bacteria 507
1077 Ga0373947_0001267 3300035725 Bacteria 15562
1078 Ga0373947_0036794 3300035725 Bacteria 2903
1079 Ga0373947_0066104 3300035725 Bacteria 2206
1080 Ga0373947_0138555 3300035725 Bacteria 1559
1081 Ga0373937_0023839 3300036401 Bacteria 5517
1082 Ga0373937_0038979 3300036401 Bacteria 4329
1083 Ga0373937_1364881 3300036401 Bacteria 657
1084 Ga0373925_0001404 3300037068 Bacteria 20938
1085 Ga0373925_0017538 3300037068 Bacteria 5191
1086 Ga0373925_0030842 3300037068 Bacteria 3937
1087 Ga0373925_0098512 3300037068 Bacteria 2244
1088 Ga0373925_0435487 3300037068 Bacteria 1072
1089 Ga0373925_0879586 3300037068 Bacteria 738
1090 Ga0373925_1015961 3300037068 Bacteria 683
1091 Ga0373925_1741326 3300037068 Bacteria 509
1092 Ga0395899_0069735 3300037312 Bacteria 2574
1093 Ga0395899_0562304 3300037312 Bacteria 731
1094 Ga0395900_0000134 3300037418 Bacteria 124444
1095 Ga0395900_0044996 3300037418 Bacteria 4546
1096 Ga0395900_0122865 3300037418 Bacteria 2663
1097 Ga0395900_0439665 3300037418 Bacteria 1262
1098 Ga0395900_1256167 3300037418 Bacteria 655
1099 Ga0395900_1346056 3300037418 Bacteria 627
1100 Ga0395898_0006221 3300037466 Bacteria 12787
1101 Ga0395898_0037354 3300037466 Bacteria 4819
1102 Ga0395898_0428621 3300037466 Bacteria 1260
1103 Ga0395898_1097266 3300037466 Bacteria 729
1104 Ga0395905_0074148 3300037471 Bacteria 3189
1105 Ga0395905_0252906 3300037471 Bacteria 1646
1106 Ga0395905_0478329 3300037471 Bacteria 1145
1107 Ga0395905_0529899 3300037471 Bacteria 1078
1108 Ga0395905_1861925 3300037471 Bacteria 508
1109 Ga0395901_0084968 3300038443 Bacteria 3308
1110 Ga0395901_0128573 3300038443 Bacteria 2663
1111 Ga0395901_0367001 3300038443 Bacteria 1483
1112 Ga0395901_0856042 3300038443 Bacteria 894
1113 Ga0436365_0124625 3300039437 Bacteria 1275
1114 Ga0436365_0481444 3300039437 Bacteria 17117
1115 Ga0436365_0507971 3300039437 Bacteria 2584
1116 Ga0436365_0788813 3300039437 Bacteria 7082
1117 Ga0436365_1710304 3300039437 Bacteria 4348
1118 Ga0436360_0137740 3300039438 Bacteria 764
1119 Ga0436360_0165980 3300039438 Bacteria 912
1120 Ga0436361_0448890 3300039447 Bacteria 5038
1121 Ga0436361_0566914 3300039447 Bacteria 659
1122 Ga0436361_1070161 3300039447 Bacteria 1140
1123 Ga0436363_0361191 3300039450 Bacteria 679
1124 Ga0436363_0535409 3300039450 Bacteria 1436
1125 Ga0436363_0636413 3300039450 Bacteria 518
1126 Ga0436363_0668617 3300039450 Bacteria 539
1127 Ga0436363_1471097 3300039450 Bacteria 7386
1128 Ga0436362_0429757 3300039453 Bacteria 6386
1129 Ga0439465_0047696 3300041413 Bacteria 1397
1130 Ga0439465_0085144 3300041413 Bacteria 1076
1131 Ga0451789_0634394 3300041443 Bacteria 917
1132 Ga0451793_0652808 3300041452 Bacteria 1887
1133 Ga0451793_1091092 3300041452 Bacteria 549
1134 Ga0451797_0395902 3300041453 Bacteria 743
1135 Ga0451795_0707023 3300041456 Bacteria 598
1136 Ga0451798_0489730 3300041458 Bacteria 542
1137 Ga0451798_0737230 3300041458 Bacteria 595
1138 Ga0451798_1101150 3300041458 Bacteria 723
1139 Ga0451800_1437687 3300041459 Bacteria 1070
1140 Ga0451802_1523859 3300041460 Bacteria 525
1141 Ga0451804_0724896 3300041463 Bacteria 945
1142 Ga0451807_1402442 3300041486 Bacteria 598
1143 Ga0451807_2336714 3300041486 Bacteria 1513
1144 Ga0451833_0925663 3300041491 Bacteria 717
1145 Ga0451845_0841671 3300041501 Bacteria 817
1146 Ga0451847_0122684 3300041503 Bacteria 649
1147 Ga0451851_0480271 3300041507 Bacteria 805
1148 Ga0451843_1105407 3300041509 Bacteria 545
1149 Ga0451855_0889375 3300041511 Bacteria 1034
1150 Ga0451853_1195350 3300041512 Bacteria 2888
1151 Ga0450905_015473 3300042142 Bacteria 1094
1152 Ga0466969_0058119 3300044656 Bacteria 1883
1153 Ga0466969_0422981 3300044656 Bacteria 605
1154 Ga0466965_0020828 3300044683 Bacteria 3155
1155 Ga0466966_0005030 3300044684 Bacteria 8695
1156 Ga0466961_0000060 3300044693 Bacteria 65360
1157 Ga0466963_0052710 3300044694 Bacteria 2700
1158 Ga0466963_0605779 3300044694 Bacteria 773
1159 Ga0466963_1254748 3300044694 Bacteria 520
1160 Ga0466964_0148605 3300044706 Bacteria 1084
1161 Ga0466970_0303716 3300044765 Bacteria 900
1162 Ga0466957_0038885 3300044842 Bacteria 2869
1163 Ga0466959_0001866 3300045049 Bacteria 13243
1164 Ga0466959_0027870 3300045049 Bacteria 4190
1165 Ga0466959_0424406 3300045049 Bacteria 902
1166 Ga0466958_0310852 3300045836 Bacteria 1012
1167 Ga0466967_0042613 3300045976 Bacteria 3923
1168 Ga0466967_0440312 3300045976 Bacteria 1272
1169 Ga0466967_0571107 3300045976 Bacteria 1114
1170 Ga0495617_110013 3300046452 Bacteria 891
1171 Ga0495627_043963 3300046453 Bacteria 1365
1172 Ga0495592_0006304 3300046454 Bacteria 8827
1173 Ga0495592_0063692 3300046454 Bacteria 2704
1174 Ga0495592_0575481 3300046454 Bacteria 690
1175 Ga0495603_0000092 3300046455 Bacteria 40980
1176 Ga0495603_0002928 3300046455 Bacteria 10092
1177 Ga0495603_0031557 3300046455 Bacteria 3190
1178 Ga0495603_0035014 3300046455 Bacteria 3017
1179 Ga0495603_0063024 3300046455 Bacteria 2188
1180 Ga0495603_0205860 3300046455 Bacteria 1137
1181 Ga0495603_0323113 3300046455 Bacteria 886
1182 Ga0495603_0618801 3300046455 Bacteria 620
1183 Ga0495603_0667937 3300046455 Bacteria 594
1184 Ga0495590_0078639 3300046457 Bacteria 1161
1185 Ga0495590_0129365 3300046457 Bacteria 907
1186 Ga0495590_0265856 3300046457 Bacteria 640
1187 Ga0495591_093915 3300046458 Bacteria 750
1188 Ga0495629_0000181 3300046459 Bacteria 56739
1189 Ga0495629_0026471 3300046459 Bacteria 4119
1190 Ga0495629_0096249 3300046459 Bacteria 2065
1191 Ga0495629_0329397 3300046459 Bacteria 1043
1192 Ga0495629_0504118 3300046459 Bacteria 816
1193 Ga0495638_0009594 3300046460 Bacteria 6776
1194 Ga0495638_0122532 3300046460 Bacteria 1535
1195 Ga0495638_0356008 3300046460 Bacteria 771
1196 Ga0495638_0572123 3300046460 Bacteria 559
1197 Ga0495641_0001499 3300046461 Bacteria 19900
1198 Ga0495641_0250807 3300046461 Bacteria 796
1199 Ga0495641_0309271 3300046461 Bacteria 713
1200 Ga0495651_0034560 3300046462 Bacteria 3940
1201 Ga0495653_0031775 3300046463 Bacteria 4195
1202 Ga0495653_0143164 3300046463 Bacteria 1679
1203 Ga0495653_0337590 3300046463 Bacteria 972
1204 Ga0495650_0078066 3300046471 Bacteria 1283
1205 Ga0495650_0115316 3300046471 Bacteria 993
1206 Ga0495580_0001467 3300046472 Bacteria 20684
1207 Ga0495580_0063846 3300046472 Bacteria 2582
1208 Ga0495580_0334737 3300046472 Bacteria 1027
1209 Ga0495582_0000039 3300046473 Bacteria 66883
1210 Ga0495582_0433269 3300046473 Bacteria 759
1211 Ga0495605_0176195 3300046474 Bacteria 942
1212 Ga0495639_0000489 3300046475 Bacteria 18815
1213 Ga0495639_0031876 3300046475 Bacteria 2349
1214 Ga0495639_0049551 3300046475 Bacteria 1906
1215 Ga0495639_0316490 3300046475 Bacteria 780
1216 Ga0495662_0000343 3300046476 Bacteria 20338
1217 Ga0495662_0221448 3300046476 Bacteria 933
1218 Ga0495664_0002664 3300046477 Bacteria 9612
1219 Ga0495664_0007350 3300046477 Bacteria 6117
1220 Ga0495664_0107854 3300046477 Bacteria 1680
1221 Ga0495664_0183729 3300046477 Bacteria 1267
1222 Ga0495664_0402126 3300046477 Bacteria 822
1223 Ga0495664_0537935 3300046477 Bacteria 697
1224 Ga0495584_0130199 3300046491 Bacteria 1276
1225 Ga0495584_0382590 3300046491 Bacteria 715
1226 Ga0495584_0512257 3300046491 Bacteria 611
1227 Ga0495584_0642228 3300046491 Bacteria 541
1228 Ga0495585_0091525 3300046492 Bacteria 1637
1229 Ga0495585_0165821 3300046492 Bacteria 1144
1230 Ga0495585_0315699 3300046492 Bacteria 765
1231 Ga0495585_0390440 3300046492 Bacteria 671
1232 Ga0495594_0000619 3300046499 Bacteria 18269
1233 Ga0495594_0038266 3300046499 Bacteria 2619
1234 Ga0495594_0118635 3300046499 Bacteria 1495
1235 Ga0495594_0189332 3300046499 Bacteria 1172
1236 Ga0495594_0303961 3300046499 Bacteria 909
1237 Ga0495596_0068936 3300046500 Bacteria 1374
1238 Ga0495607_0113657 3300046501 Bacteria 1432
1239 Ga0495607_0260255 3300046501 Bacteria 831
1240 Ga0495583_0132290 3300046506 Bacteria 1043
1241 Ga0495583_0144248 3300046506 Bacteria 990
1242 Ga0495583_0325018 3300046506 Bacteria 609
1243 Ga0495606_0233103 3300046507 Bacteria 1030
1244 Ga0495606_0268487 3300046507 Bacteria 938
1245 Ga0495606_0298171 3300046507 Bacteria 874
1246 Ga0495608_0111928 3300046511 Bacteria 1755
1247 Ga0495608_0264021 3300046511 Bacteria 1071
1248 Ga0495610_0043579 3300046512 Bacteria 2234
1249 Ga0495610_0121716 3300046512 Bacteria 1143
1250 Ga0495616_0092338 3300046513 Bacteria 1431
1251 Ga0495616_0159820 3300046513 Bacteria 1014
1252 Ga0495616_0235628 3300046513 Bacteria 791
1253 Ga0495618_0038467 3300046514 Bacteria 3007
1254 Ga0495620_0057718 3300046515 Bacteria 1628
1255 Ga0495620_0082866 3300046515 Bacteria 1296
1256 Ga0495628_0073295 3300046516 Bacteria 2668
1257 Ga0495628_0212146 3300046516 Bacteria 1456
1258 Ga0495628_0217572 3300046516 Bacteria 1436
1259 Ga0495628_0433109 3300046516 Bacteria 957
1260 Ga0495628_0527982 3300046516 Bacteria 849
1261 Ga0495630_0001653 3300046517 Bacteria 15507
1262 Ga0495630_0015746 3300046517 Bacteria 5525
1263 Ga0495630_0509395 3300046517 Bacteria 923
1264 Ga0495631_0053389 3300046518 Bacteria 1764
1265 Ga0495631_0121277 3300046518 Bacteria 1124
1266 Ga0495631_0438174 3300046518 Bacteria 556
1267 Ga0495631_0512031 3300046518 Bacteria 511
1268 Ga0495637_0073275 3300046520 Bacteria 1378
1269 Ga0495643_0032803 3300046522 Bacteria 2879
1270 Ga0495643_0225144 3300046522 Bacteria 887
1271 Ga0495643_0394406 3300046522 Bacteria 612
1272 Ga0495644_0029123 3300046523 Bacteria 2087
1273 Ga0495644_0167214 3300046523 Bacteria 844
1274 Ga0495644_0343599 3300046523 Bacteria 587
1275 Ga0495648_0002556 3300046524 Bacteria 16672
1276 Ga0495648_0004859 3300046524 Bacteria 11342
1277 Ga0495648_0088987 3300046524 Bacteria 1734
1278 Ga0495648_0098432 3300046524 Bacteria 1620
1279 Ga0495648_0125201 3300046524 Bacteria 1375
1280 Ga0495648_0156134 3300046524 Bacteria 1185
1281 Ga0495663_0099294 3300046525 Bacteria 957
1282 Ga0495663_0300246 3300046525 Bacteria 578
1283 Ga0495666_0003729 3300046526 Bacteria 7699
1284 Ga0495666_0053055 3300046526 Bacteria 1947
1285 Ga0495666_0107369 3300046526 Bacteria 1313
1286 Ga0495642_0279935 3300046528 Bacteria 730
1287 Ga0495642_0412792 3300046528 Bacteria 596
1288 Ga0495652_0074129 3300046529 Bacteria 2831
1289 Ga0495652_0138411 3300046529 Bacteria 1917
1290 Ga0495652_0192655 3300046529 Bacteria 1554
1291 Ga0495652_0586571 3300046529 Bacteria 762
1292 Ga0495654_0070152 3300046530 Bacteria 1662
1293 Ga0495654_0303895 3300046530 Bacteria 651
1294 Ga0495665_0000079 3300046531 Bacteria 42321
1295 Ga0495665_0194356 3300046531 Bacteria 1053
1296 Ga0495665_0500693 3300046531 Bacteria 612
1297 Ga0495640_0003085 3300046533 Bacteria 13431
1298 Ga0495640_0009778 3300046533 Bacteria 7451
1299 Ga0495640_0101698 3300046533 Bacteria 1886
1300 Ga0495640_0230633 3300046533 Bacteria 1164
1301 Ga0495640_0257977 3300046533 Bacteria 1090
1302 Ga0495586_0356199 3300046535 Bacteria 841
1303 Ga0495587_0095791 3300046536 Bacteria 1713
1304 Ga0495598_0024134 3300046537 Bacteria 1645
1305 Ga0495598_0261654 3300046537 Bacteria 644
1306 Ga0495609_0241387 3300046538 Bacteria 746
1307 Ga0495609_0278685 3300046538 Bacteria 684
1308 Ga0495621_0015968 3300046539 Bacteria 2402
1309 Ga0495621_0245217 3300046539 Bacteria 731
1310 Ga0495597_0024560 3300046542 Bacteria 2781
1311 Ga0495645_0026869 3300046543 Bacteria 4180
1312 Ga0495645_0145598 3300046543 Bacteria 1650
1313 Ga0495645_0191461 3300046543 Bacteria 1393
1314 Ga0495622_0000987 3300046557 Bacteria 15239
1315 Ga0495622_0042359 3300046557 Bacteria 2116
1316 Ga0495622_0054930 3300046557 Bacteria 1847
1317 Ga0495622_0096896 3300046557 Bacteria 1353
1318 Ga0495622_0136598 3300046557 Bacteria 1115
1319 Ga0495622_0234591 3300046557 Bacteria 810
1320 Ga0495633_0067968 3300046558 Bacteria 1663
1321 Ga0495633_0167832 3300046558 Bacteria 1012
1322 Ga0495667_0006293 3300046559 Bacteria 8054
1323 Ga0495667_0056782 3300046559 Bacteria 2574
1324 Ga0495667_0167941 3300046559 Bacteria 1410
1325 Ga0495656_0220575 3300046615 Bacteria 948
1326 Ga0495656_0643083 3300046615 Bacteria 569
1327 Ga0495668_0009486 3300046616 Bacteria 5975
1328 Ga0495668_0290774 3300046616 Bacteria 895
1329 Ga0495668_0335735 3300046616 Bacteria 829
1330 Ga0495668_0675600 3300046616 Bacteria 571
1331 Ga0495634_0004026 3300046642 Bacteria 11657
1332 Ga0495634_0089976 3300046642 Bacteria 1994
1333 Ga0495634_0122922 3300046642 Bacteria 1661
1334 Ga0495634_0184954 3300046642 Bacteria 1302
1335 Ga0495611_0058626 3300046648 Bacteria 1746
1336 Ga0495611_0063062 3300046648 Bacteria 1686
1337 Ga0495611_0591444 3300046648 Bacteria 501
1338 Ga0495625_0117994 3300046660 Bacteria 1808
1339 Ga0495625_0133759 3300046660 Bacteria 1678
1340 Ga0495625_0163761 3300046660 Bacteria 1488
1341 Ga0495625_0301434 3300046660 Bacteria 1025
1342 Ga0495625_0337774 3300046660 Bacteria 955
1343 Ga0495625_0695992 3300046660 Bacteria 601
1344 Ga0495635_0004998 3300046663 Bacteria 9230
1345 Ga0495635_0006922 3300046663 Bacteria 7920
1346 Ga0495635_0020339 3300046663 Bacteria 4624
1347 Ga0495635_0834212 3300046663 Bacteria 593
1348 Ga0495659_0031542 3300046664 Bacteria 1850
1349 Ga0495659_0133826 3300046664 Bacteria 985
1350 Ga0495661_0352845 3300046665 Bacteria 724
1351 Ga0495661_0597316 3300046665 Bacteria 519
1352 Ga0495588_0008456 3300046674 Bacteria 4726
1353 Ga0495588_0071953 3300046674 Bacteria 1798
1354 Ga0495588_0106193 3300046674 Bacteria 1478
1355 Ga0495588_0156932 3300046674 Bacteria 1203
1356 Ga0495588_0199666 3300046674 Bacteria 1056
1357 Ga0495588_0267486 3300046674 Bacteria 901
1358 Ga0495588_0272901 3300046674 Bacteria 891
1359 Ga0495588_0715067 3300046674 Bacteria 524
1360 Ga0495657_0042155 3300046675 Bacteria 3118
1361 Ga0495657_0047199 3300046675 Bacteria 2912
1362 Ga0495599_0012657 3300046678 Bacteria 5203
1363 Ga0495599_0061226 3300046678 Bacteria 2352
1364 Ga0495646_0038525 3300046680 Bacteria 2951
1365 Ga0495646_0120188 3300046680 Bacteria 1487
1366 Ga0495646_0721580 3300046680 Bacteria 500
1367 Ga0495647_0000562 3300046681 Bacteria 10934
1368 Ga0495647_0114159 3300046681 Bacteria 1130
1369 Ga0495647_0551393 3300046681 Bacteria 539
1370 Ga0495658_0000733 3300046683 Bacteria 17682
1371 Ga0495658_0018540 3300046683 Bacteria 3620
1372 Ga0495658_0483337 3300046683 Bacteria 792
1373 Ga0495669_0012302 3300046684 Bacteria 3641
1374 Ga0495669_0041442 3300046684 Bacteria 2045
1375 Ga0495669_0053561 3300046684 Bacteria 1814
1376 Ga0495669_0081198 3300046684 Bacteria 1488
1377 Ga0495669_0277938 3300046684 Bacteria 805
1378 Ga0495613_0000543 3300046689 Bacteria 31253
1379 Ga0495613_0014301 3300046689 Bacteria 5889
1380 Ga0495613_0121804 3300046689 Bacteria 1873
1381 Ga0495613_0159879 3300046689 Bacteria 1603
1382 Ga0495613_0289013 3300046689 Bacteria 1137
1383 Ga0495624_0006648 3300046690 Bacteria 8175
1384 Ga0495624_0039648 3300046690 Bacteria 3019
1385 Ga0495624_0056351 3300046690 Bacteria 2473
1386 Ga0495624_0215206 3300046690 Bacteria 1165
1387 Ga0495670_0085783 3300046691 Bacteria 1607
1388 Ga0495670_0536036 3300046691 Bacteria 637
1389 Ga0495670_0763446 3300046691 Bacteria 527
1390 Ga0495671_0112377 3300046692 Bacteria 1330
1391 Ga0495649_0109123 3300046694 Bacteria 1468
1392 Ga0495649_0160422 3300046694 Bacteria 1179
1393 Ga0495649_0331197 3300046694 Bacteria 771
1394 Ga0495649_0409246 3300046694 Bacteria 680
1395 Ga0495589_0129158 3300046794 Bacteria 1214
1396 Ga0495589_0194737 3300046794 Bacteria 958
1397 Ga0495589_0446771 3300046794 Bacteria 592
1398 Ga0495589_0557142 3300046794 Bacteria 522
1399 Ga0495600_0104073 3300046809 Bacteria 1849
1400 Ga0495600_0564172 3300046809 Bacteria 694
1401 Ga0495660_0358492 3300046810 Bacteria 647
1402 Ga0495581_0000024 3300047315 Bacteria 55574
1403 Ga0495581_0101334 3300047315 Bacteria 1673
1404 Ga0495581_0239724 3300047315 Bacteria 1060
1405 Ga0495604_0017775 3300047317 Bacteria 5689
1406 Ga0495604_0051100 3300047317 Bacteria 3206
1407 Ga0495604_0129697 3300047317 Bacteria 1814
1408 Ga0495604_0141596 3300047317 Bacteria 1718
1409 Ga0495604_0886737 3300047317 Bacteria 558
1410 Ga0495674_0001161 3300047319 Bacteria 25370
1411 Ga0495674_0091080 3300047319 Bacteria 2605
1412 Ga0495674_0120872 3300047319 Bacteria 2213
1413 Ga0495674_0197545 3300047319 Bacteria 1670
1414 Ga0495674_0349990 3300047319 Bacteria 1199
1415 Ga0495674_0660428 3300047319 Bacteria 824
1416 Ga0495672_0017804 3300047320 Bacteria 4740
1417 Ga0495672_0051366 3300047320 Bacteria 2428
1418 Ga0495672_0097550 3300047320 Bacteria 1600
1419 Ga0495676_0040839 3300047321 Bacteria 3825
1420 Ga0495676_0154833 3300047321 Bacteria 1627
1421 Ga0495680_0008182 3300047322 Bacteria 9536
1422 Ga0495680_0373738 3300047322 Bacteria 988
1423 Ga0495680_1010063 3300047322 Bacteria 531
1424 Ga0495683_0123351 3300047323 Bacteria 1228
1425 Ga0495683_0197350 3300047323 Bacteria 909
1426 Ga0495687_018321 3300047443 Bacteria 3463
1427 Ga0495675_0058711 3300047444 Bacteria 2439
1428 Ga0495675_0061217 3300047444 Bacteria 2385
1429 Ga0495677_0044541 3300047445 Bacteria 1627
1430 Ga0495685_153467 3300047447 Bacteria 748
1431 Ga0495673_0020913 3300047469 Bacteria 3246
1432 Ga0495673_0037380 3300047469 Bacteria 2217
1433 Ga0495673_0048974 3300047469 Bacteria 1861
1434 Ga0495673_0062519 3300047469 Bacteria 1590
1435 Ga0495673_0083166 3300047469 Bacteria 1322
1436 Ga0495673_0090752 3300047469 Bacteria 1249
1437 Ga0495681_0068429 3300047470 Bacteria 1616
1438 Ga0495684_0009222 3300047471 Bacteria 7619
1439 Ga0495684_0025703 3300047471 Bacteria 4524
1440 Ga0495684_0123972 3300047471 Bacteria 1944
1441 Ga0495686_0065312 3300047472 Bacteria 2250
1442 Ga0495686_0216738 3300047472 Bacteria 1091
1443 Ga0495593_0000019 3300047673 Bacteria 74042
1444 Ga0495593_0023313 3300047673 Bacteria 3442
1445 Ga0495593_0078136 3300047673 Bacteria 1714
1446 Ga0495593_0415239 3300047673 Bacteria 673
1447 Ga0495602_0042945 3300048088 Bacteria 4115
1448 Ga0495602_0068416 3300048088 Bacteria 3049
1449 Ga0495602_0346218 3300048088 Bacteria 1074
1450 Ga0495602_0346446 3300048088 Bacteria 1073
1451 Ga0495614_0003524 3300048089 Bacteria 7011
1452 Ga0495614_0140469 3300048089 Bacteria 1073
1453 Ga0495614_0490888 3300048089 Bacteria 584
1454 Ga0495615_0259734 3300048090 Bacteria 553
1455 Ga0496100_0008443 3300048903 Bacteria 5744
1456 Ga0496100_0020444 3300048903 Bacteria 3969
1457 Ga0496100_0029450 3300048903 Bacteria 3396
1458 Ga0496100_0159747 3300048903 Bacteria 1615
1459 Ga0496100_0325012 3300048903 Bacteria 1156
1460 Ga0496100_0373230 3300048903 Bacteria 1082
1461 Ga0496100_0375138 3300048903 Bacteria 1079
1462 Ga0496100_0825864 3300048903 Bacteria 726
1463 Ga0496101_0004532 3300048904 Bacteria 8770
1464 Ga0496101_0010276 3300048904 Bacteria 6179
1465 Ga0496101_0075808 3300048904 Bacteria 2476
1466 Ga0496101_0199933 3300048904 Bacteria 1545
1467 Ga0496101_0481795 3300048904 Bacteria 980
1468 Ga0496101_0548328 3300048904 Bacteria 914
1469 Ga0496101_0568716 3300048904 Bacteria 896
1470 Ga0496101_0573018 3300048904 Bacteria 893
1471 Ga0496101_0671440 3300048904 Bacteria 818
1472 Ga0496102_0009611 3300048905 Bacteria 8317
1473 Ga0496102_0089830 3300048905 Bacteria 2842
1474 Ga0496102_0129157 3300048905 Bacteria 2364
1475 Ga0496102_0208546 3300048905 Bacteria 1842
1476 Ga0496102_0272046 3300048905 Bacteria 1597
1477 Ga0496102_0323965 3300048905 Bacteria 1452
1478 Ga0496102_0341741 3300048905 Bacteria 1409
1479 Ga0496102_0380041 3300048905 Bacteria 1329
1480 Ga0496102_0418036 3300048905 Bacteria 1259
1481 Ga0496102_0495187 3300048905 Bacteria 1144
1482 Ga0496102_0666739 3300048905 Bacteria 963
1483 Ga0496102_0710004 3300048905 Bacteria 928
1484 Ga0496102_1034212 3300048905 Bacteria 742
1485 Ga0496102_1193922 3300048905 Bacteria 680
1486 Ga0496102_1216807 3300048905 Bacteria 673
1487 Ga0496102_1699500 3300048905 Bacteria 549
1488 Ga0496103_0021349 3300048906 Bacteria 3894
1489 Ga0496103_0157563 3300048906 Bacteria 1456
1490 Ga0496103_0165810 3300048906 Bacteria 1417
1491 Ga0496103_0285776 3300048906 Bacteria 1061
1492 Ga0496104_0007514 3300048907 Bacteria 9635
1493 Ga0496104_0009587 3300048907 Bacteria 8619
1494 Ga0496104_0014513 3300048907 Bacteria 7116
1495 Ga0496104_0014678 3300048907 Bacteria 7076
1496 Ga0496104_0021951 3300048907 Bacteria 5863
1497 Ga0496104_0091129 3300048907 Bacteria 2913
1498 Ga0496104_0321942 3300048907 Bacteria 1459
1499 Ga0496104_0439668 3300048907 Bacteria 1216
1500 Ga0496104_1192104 3300048907 Bacteria 665
1501 Ga0496105_0002708 3300048908 Bacteria 12919
1502 Ga0496105_0013076 3300048908 Bacteria 6581
1503 Ga0496105_0032830 3300048908 Bacteria 4260
1504 Ga0496105_0177009 3300048908 Bacteria 1747
1505 Ga0496105_0220271 3300048908 Bacteria 1545
1506 Ga0496105_0537766 3300048908 Bacteria 913
1507 Ga0496105_1077999 3300048908 Bacteria 597
1508 Ga0496106_0000634 3300048909 Bacteria 25214
1509 Ga0496106_0003207 3300048909 Bacteria 12247
1510 Ga0496106_0006039 3300048909 Bacteria 8965
1511 Ga0496106_0018657 3300048909 Bacteria 5135
1512 Ga0496106_0029256 3300048909 Bacteria 4105
1513 Ga0496106_0145610 3300048909 Bacteria 1866
1514 Ga0496106_0356026 3300048909 Bacteria 1176
1515 Ga0496106_0413195 3300048909 Bacteria 1084
1516 Ga0496106_0642329 3300048909 Bacteria 848
1517 Ga0496107_0002095 3300048910 Bacteria 12782
1518 Ga0496107_0008466 3300048910 Bacteria 7119
1519 Ga0496107_0009028 3300048910 Bacteria 6913
1520 Ga0496107_0253852 3300048910 Bacteria 1308
1521 Ga0496107_0365932 3300048910 Bacteria 1073
1522 Ga0496107_0373784 3300048910 Bacteria 1060
1523 Ga0496107_0658926 3300048910 Bacteria 771
1524 Ga0496108_0001003 3300048911 Bacteria 22020
1525 Ga0496108_0110277 3300048911 Bacteria 2352
1526 Ga0496108_0134259 3300048911 Bacteria 2128
1527 Ga0496108_0256534 3300048911 Bacteria 1521
1528 Ga0496108_0404982 3300048911 Bacteria 1191
1529 Ga0496108_0925492 3300048911 Bacteria 747
1530 Ga0496108_1360054 3300048911 Bacteria 595
1531 Ga0496108_1604092 3300048911 Bacteria 538
1532 Ga0496109_0000166 3300048912 Bacteria 64848
1533 Ga0496109_0036779 3300048912 Bacteria 4420
1534 Ga0496109_0046847 3300048912 Bacteria 3928
1535 Ga0496109_0072226 3300048912 Bacteria 3169
1536 Ga0496109_0312146 3300048912 Bacteria 1483
1537 Ga0496109_0434667 3300048912 Bacteria 1240
1538 Ga0496110_0012878 3300048913 Bacteria 6894
1539 Ga0496110_0049864 3300048913 Bacteria 3674
1540 Ga0496110_0104638 3300048913 Bacteria 2539
1541 Ga0496110_0186693 3300048913 Bacteria 1883
1542 Ga0496110_0326335 3300048913 Bacteria 1398
1543 Ga0496110_0886357 3300048913 Bacteria 798
1544 Ga0496111_0007619 3300048914 Bacteria 7113
1545 Ga0496111_0059949 3300048914 Bacteria 2758
1546 Ga0496111_0094947 3300048914 Bacteria 2187
1547 Ga0496111_0169739 3300048914 Bacteria 1621
1548 Ga0496111_0304276 3300048914 Bacteria 1182
1549 Ga0496111_0380164 3300048914 Bacteria 1044
1550 Ga0496112_0000142 3300048915 Bacteria 44742
1551 Ga0496112_0000358 3300048915 Bacteria 29716
1552 Ga0496112_0006785 3300048915 Bacteria 10091
1553 Ga0496112_0009986 3300048915 Bacteria 8591
1554 Ga0496112_0048503 3300048915 Bacteria 4163
1555 Ga0496112_0126707 3300048915 Bacteria 2524
1556 Ga0496112_0139196 3300048915 Bacteria 2396
1557 Ga0496112_0511953 3300048915 Bacteria 1135
1558 Ga0496112_0917188 3300048915 Bacteria 798
1559 Ga0496112_0950595 3300048915 Bacteria 780
1560 Ga0496113_0004839 3300048916 Bacteria 8333
1561 Ga0496113_0017042 3300048916 Bacteria 5033
1562 Ga0496113_0108009 3300048916 Bacteria 2163
1563 Ga0496113_0290303 3300048916 Bacteria 1308
1564 Ga0496113_0321488 3300048916 Bacteria 1240
1565 Ga0496113_0673665 3300048916 Bacteria 826
1566 Ga0496114_0029897 3300048917 Bacteria 4479
1567 Ga0496114_0085730 3300048917 Bacteria 2668
1568 Ga0496114_0142918 3300048917 Bacteria 2073
1569 Ga0496114_0226811 3300048917 Bacteria 1641
1570 Ga0496114_0323900 3300048917 Bacteria 1362
1571 Ga0496114_0438542 3300048917 Bacteria 1157
1572 Ga0496114_1370654 3300048917 Bacteria 594
1573 Ga0496115_0008444 3300048918 Bacteria 7619
1574 Ga0496115_0017339 3300048918 Bacteria 5503
1575 Ga0496115_0034316 3300048918 Bacteria 4010
1576 Ga0496115_0124043 3300048918 Bacteria 2127
1577 Ga0496115_0241782 3300048918 Bacteria 1488
1578 Ga0496115_0463012 3300048918 Bacteria 1023
1579 Ga0496115_0469357 3300048918 Bacteria 1014
1580 Ga0496115_0977835 3300048918 Bacteria 648
1581 Ga0496115_1074825 3300048918 Bacteria 611
1582 Ga0496116_0049903 3300048919 Bacteria 2793
1583 Ga0496116_0117670 3300048919 Bacteria 1546
1584 Ga0496116_0223207 3300048919 Bacteria 963
1585 Ga0496116_0439558 3300048919 Bacteria 563
1586 Ga0496117_0019227 3300048920 Bacteria 5618
1587 Ga0496117_0064198 3300048920 Bacteria 2505
1588 Ga0496117_0132591 3300048920 Bacteria 1507
1589 Ga0496117_0169117 3300048920 Bacteria 1271
1590 Ga0496117_0220670 3300048920 Bacteria 1055
1591 Ga0496117_0239331 3300048920 Bacteria 998
1592 Ga0496117_0339337 3300048920 Bacteria 780
1593 Ga0496118_0008409 3300048921 Bacteria 10672
1594 Ga0496118_0052322 3300048921 Bacteria 3116
1595 Ga0496118_0070455 3300048921 Bacteria 2524
1596 Ga0496118_0112306 3300048921 Bacteria 1804
1597 Ga0496118_0182500 3300048921 Bacteria 1266
1598 Ga0496118_0409147 3300048921 Bacteria 702
1599 Ga0496118_0559443 3300048921 Bacteria 556
1600 Ga0496119_0044246 3300048922 Bacteria 2805
1601 Ga0496119_0078320 3300048922 Bacteria 1912
1602 Ga0496120_0007337 3300048923 Bacteria 8224
1603 Ga0496120_0078523 3300048923 Bacteria 1794
1604 Ga0496120_0102455 3300048923 Bacteria 1509
1605 Ga0496121_0000221 3300048924 Bacteria 123829
1606 Ga0496121_0000365 3300048924 Bacteria 92822
1607 Ga0496121_0001293 3300048924 Bacteria 43066
1608 Ga0496121_0005804 3300048924 Bacteria 15651
1609 Ga0496121_0005812 3300048924 Bacteria 15639
1610 Ga0496121_0052411 3300048924 Bacteria 3427
1611 Ga0496121_0127644 3300048924 Bacteria 1909
1612 Ga0496121_0168558 3300048924 Bacteria 1593
1613 Ga0496121_0259923 3300048924 Bacteria 1199
1614 Ga0496121_0310485 3300048924 Bacteria 1066
1615 Ga0496121_0344754 3300048924 Bacteria 994
1616 Ga0496121_0464329 3300048924 Bacteria 812
1617 Ga0496121_0750172 3300048924 Bacteria 580
1618 Ga0496121_0750307 3300048924 Bacteria 580
1619 Ga0496121_0813933 3300048924 Bacteria 547
1620 Ga0496122_0019295 3300048925 Bacteria 6237
1621 Ga0496122_0125363 3300048925 Bacteria 1645
1622 Ga0496122_0170955 3300048925 Bacteria 1310
1623 Ga0496123_0050852 3300048926 Bacteria 2765
1624 Ga0496124_0002671 3300048927 Bacteria 22854
1625 Ga0496124_0085140 3300048927 Bacteria 2591
1626 Ga0496124_0310015 3300048927 Bacteria 1135
1627 Ga0496125_0018856 3300048928 Bacteria 6531
1628 Ga0496125_0019036 3300048928 Bacteria 6496
1629 Ga0496125_0056031 3300048928 Bacteria 3205
1630 Ga0496125_0061650 3300048928 Bacteria 3006
1631 Ga0496125_0198508 3300048928 Bacteria 1316
1632 Ga0496125_0425842 3300048928 Bacteria 768
1633 Ga0496126_0001612 3300048929 Bacteria 34184
1634 Ga0496126_0009177 3300048929 Bacteria 10550
1635 Ga0496126_0023193 3300048929 Bacteria 6016
1636 Ga0496126_0054516 3300048929 Bacteria 3621
1637 Ga0496126_0074388 3300048929 Bacteria 3017
1638 Ga0496126_0078076 3300048929 Bacteria 2934
1639 Ga0496126_0080441 3300048929 Bacteria 2884
1640 Ga0496126_0080901 3300048929 Bacteria 2873
1641 Ga0496126_0093679 3300048929 Bacteria 2637
1642 Ga0496126_0100547 3300048929 Bacteria 2530
1643 Ga0496126_0135659 3300048929 Bacteria 2123
1644 Ga0496126_0179139 3300048929 Bacteria 1801
1645 Ga0496126_0216255 3300048929 Bacteria 1612
1646 Ga0496126_0318897 3300048929 Bacteria 1278
1647 Ga0496126_0357452 3300048929 Bacteria 1193
1648 Ga0496126_0384848 3300048929 Bacteria 1141
1649 Ga0496126_0398787 3300048929 Bacteria 1116
1650 Ga0496126_0570780 3300048929 Bacteria 895
1651 Ga0496126_0587538 3300048929 Bacteria 879
1652 Ga0496126_1119713 3300048929 Bacteria 583
1653 Ga0495678_042737 3300049459 Bacteria 1805
1654 Ga0495682_0099152 3300049460 Bacteria 1045
1655 Ga0495682_0227744 3300049460 Bacteria 660
1656 Ga0495682_0266300 3300049460 Bacteria 605
1657 Ga0495682_0281499 3300049460 Bacteria 587
1658 Ga0501031_0198369 3300049568 Bacteria 1310
1659 Ga0501031_0201817 3300049568 Bacteria 1297
1660 Ga0501031_0269712 3300049568 Bacteria 1105
1661 Ga0501032_0014139 3300049569 Bacteria 5658
1662 Ga0501032_0072883 3300049569 Bacteria 2288
1663 Ga0501032_0120880 3300049569 Bacteria 1731
1664 Ga0501033_0018372 3300049570 Bacteria 5281
1665 Ga0501033_0072403 3300049570 Bacteria 2530
1666 Ga0501033_0089241 3300049570 Bacteria 2255
1667 Ga0501033_0198215 3300049570 Bacteria 1435
1668 Ga0501033_0325495 3300049570 Bacteria 1079
1669 Ga0501033_0456047 3300049570 Bacteria 887
1670 Ga0501034_0029876 3300049571 Bacteria 5540
1671 Ga0501034_0051508 3300049571 Bacteria 4151
1672 Ga0501034_0076670 3300049571 Bacteria 3349
1673 Ga0501034_0127654 3300049571 Bacteria 2528
1674 Ga0501034_0130450 3300049571 Bacteria 2497
1675 Ga0501034_0187640 3300049571 Bacteria 2030
1676 Ga0501034_0286335 3300049571 Bacteria 1587
1677 Ga0501036_0130240 3300049572 Bacteria 2124
1678 Ga0501036_0150317 3300049572 Bacteria 1964
1679 Ga0501036_0158697 3300049572 Bacteria 1907
1680 Ga0501036_0338565 3300049572 Bacteria 1256
1681 Ga0501036_0404601 3300049572 Bacteria 1138
1682 Ga0501037_0024204 3300049573 Bacteria 4490
1683 Ga0501037_0099222 3300049573 Bacteria 2103
1684 Ga0501037_0212826 3300049573 Bacteria 1362
1685 Ga0501037_0401235 3300049573 Bacteria 940
1686 Ga0501037_0573889 3300049573 Bacteria 759
1687 Ga0501037_1048488 3300049573 Bacteria 529
1688 Ga0501038_0164206 3300049574 Bacteria 1802
1689 Ga0501038_0284266 3300049574 Bacteria 1301
1690 Ga0501038_0464710 3300049574 Bacteria 971
1691 Ga0501038_0583103 3300049574 Bacteria 848
1692 Ga0501039_0075802 3300049575 Bacteria 2614
1693 Ga0501039_0143126 3300049575 Bacteria 1878
1694 Ga0501039_0260038 3300049575 Bacteria 1364
1695 Ga0501040_0021329 3300049576 Bacteria 4325
1696 Ga0501041_0194479 3300049577 Bacteria 1271
1697 Ga0501042_0231619 3300049578 Bacteria 1332
1698 Ga0501042_0312633 3300049578 Bacteria 1135
1699 Ga0501043_0018518 3300049579 Bacteria 5463
1700 Ga0501043_0018792 3300049579 Bacteria 5424
1701 Ga0501043_0341172 3300049579 Bacteria 1139
1702 Ga0501043_0363216 3300049579 Bacteria 1098
1703 Ga0501046_0036035 3300049580 Bacteria 3983
1704 Ga0501046_0108943 3300049580 Bacteria 2118
1705 Ga0501046_0233471 3300049580 Bacteria 1358
1706 Ga0501047_0008451 3300049581 Bacteria 9715
1707 Ga0501047_0124677 3300049581 Bacteria 2456
1708 Ga0501047_0481812 3300049581 Bacteria 1068
1709 Ga0501047_1324072 3300049581 Bacteria 534
1710 Ga0501048_0028074 3300049582 Bacteria 4086
1711 Ga0501067_0021403 3300049583 Bacteria 3578
1712 Ga0501067_0046127 3300049583 Bacteria 2419
1713 Ga0501067_0584534 3300049583 Bacteria 626
1714 Ga0501068_0025230 3300049584 Bacteria 3496
1715 Ga0501068_0324512 3300049584 Bacteria 987
1716 Ga0501069_0022072 3300049585 Bacteria 3459
1717 Ga0501069_0456452 3300049585 Bacteria 760
1718 Ga0501069_0596458 3300049585 Bacteria 663
1719 Ga0501069_0871642 3300049585 Bacteria 547
1720 Ga0501070_0125601 3300049586 Bacteria 2120
1721 Ga0501070_0164843 3300049586 Bacteria 1826
1722 Ga0501070_0271587 3300049586 Bacteria 1384
1723 Ga0501070_0478767 3300049586 Bacteria 1001
1724 Ga0501070_0973018 3300049586 Bacteria 659
1725 Ga0501070_1215909 3300049586 Bacteria 578
1726 Ga0501070_1335692 3300049586 Bacteria 546
1727 Ga0501071_0041872 3300049587 Bacteria 3280
1728 Ga0501071_0224990 3300049587 Bacteria 1413
1729 Ga0501072_0008410 3300049588 Bacteria 7832
1730 Ga0501073_0045956 3300049589 Bacteria 3073
1731 Ga0501073_0097002 3300049589 Bacteria 2047
1732 Ga0501073_0145857 3300049589 Bacteria 1640
1733 Ga0501074_0659113 3300049590 Bacteria 739
1734 Ga0501076_0220427 3300049592 Bacteria 1550
1735 Ga0501077_0046293 3300049593 Bacteria 2764
1736 Ga0501079_0073394 3300049741 Bacteria 2644
1737 Ga0501079_0704273 3300049741 Bacteria 795
1738 Ga0501080_0030857 3300049742 Bacteria 4994
1739 Ga0501080_0147179 3300049742 Bacteria 2177
1740 Ga0501080_0154727 3300049742 Bacteria 2118
1741 Ga0501080_0604375 3300049742 Bacteria 973
1742 Ga0501081_0062666 3300049743 Bacteria 2580
1743 Ga0501081_0330659 3300049743 Bacteria 1121
1744 Ga0501035_0051610 3300049822 Bacteria 3681
1745 Ga0501035_0056002 3300049822 Bacteria 3520
1746 Ga0501035_0072618 3300049822 Bacteria 3045
1747 Ga0501035_0193170 3300049822 Bacteria 1749
1748 Ga0501044_0008204 3300049823 Bacteria 11460
1749 Ga0501044_0009213 3300049823 Bacteria 10783
1750 Ga0501044_0043044 3300049823 Bacteria 4692
1751 Ga0501044_0160361 3300049823 Bacteria 2226
1752 Ga0501044_0435537 3300049823 Bacteria 1219
1753 Ga0501045_0020077 3300049824 Bacteria 4769
1754 Ga0501045_0135403 3300049824 Bacteria 1832
1755 nmdc:mga03683_167172_c1 3300050489 Bacteria 998
1756 nmdc:mga03683_269600_c1 3300050489 Bacteria 794
1757 nmdc:mga03683_270889_c1 3300050489 Bacteria 792
1758 nmdc:mga03683_359252_c1 3300050489 Bacteria 690
1759 nmdc:mga03683_534536_c1 3300050489 Bacteria 570
1760 nmdc:mga03683_581804_c1 3300050489 Bacteria 547
1761 nmdc:mga03n38_1841_c1 3300050490 Bacteria 6321
1762 nmdc:mga03n38_21432_c1 3300050490 Bacteria 2600
1763 nmdc:mga03n38_53405_c1 3300050490 Bacteria 1812
1764 nmdc:mga03n38_66814_c1 3300050490 Bacteria 1653
1765 nmdc:mga00v17_134798_c1 3300050491 Bacteria 1580
1766 nmdc:mga00v17_162975_c1 3300050491 Bacteria 1436
1767 nmdc:mga00v17_403989_c1 3300050491 Bacteria 888
1768 nmdc:mga00v17_58269_c1 3300050491 Bacteria 2366
1769 nmdc:mga0yw44_108567_c1 3300050492 Bacteria 1776
1770 nmdc:mga0yw44_115170_c1 3300050492 Bacteria 1726
1771 nmdc:mga0yw44_1218032_c1 3300050492 Bacteria 508
1772 nmdc:mga0yw44_355487_c1 3300050492 Bacteria 987
1773 nmdc:mga0yw44_612951_c1 3300050492 Bacteria 740
1774 nmdc:mga0yw44_626702_c1 3300050492 Bacteria 731
1775 nmdc:mga0yw44_64077_c1 3300050492 Bacteria 2261
1776 nmdc:mga0yw44_721487_c1 3300050492 Bacteria 677
1777 nmdc:mga0yw44_731195_c1 3300050492 Bacteria 672
1778 nmdc:mga0yw44_80485_c1 3300050492 Bacteria 2041
1779 nmdc:mga0k408_116939_c1 3300050493 Bacteria 1578
1780 nmdc:mga0k408_176479_c1 3300050493 Bacteria 1274
1781 nmdc:mga0k408_281867_c1 3300050493 Bacteria 992
1782 nmdc:mga0k408_299560_c1 3300050493 Bacteria 960
1783 nmdc:mga0k408_85015_c1 3300050493 Bacteria 1857
1784 nmdc:mga06z11_12290_c1 3300050494 Bacteria 3720
1785 nmdc:mga06z11_171882_c1 3300050494 Bacteria 1245
1786 nmdc:mga06z11_173619_c1 3300050494 Bacteria 1239
1787 nmdc:mga06z11_28342_c1 3300050494 Bacteria 2686
1788 nmdc:mga06z11_357025_c1 3300050494 Bacteria 876
1789 nmdc:mga06z11_389790_c1 3300050494 Bacteria 838
1790 nmdc:mga06z11_416901_c1 3300050494 Bacteria 809
1791 nmdc:mga06z11_45947_c1 3300050494 Bacteria 2210
1792 nmdc:mga06z11_525265_c1 3300050494 Bacteria 718
1793 nmdc:mga04h51_179964_c1 3300050495 Bacteria 823
1794 nmdc:mga04h51_205924_c1 3300050495 Bacteria 775
1795 nmdc:mga04h51_242357_c1 3300050495 Bacteria 720
1796 nmdc:mga04h51_84180_c1 3300050495 Bacteria 1134
1797 nmdc:mga07m45_114066_c1 3300050496 Bacteria 1558
1798 nmdc:mga07m45_158126_c1 3300050496 Bacteria 1315
1799 nmdc:mga07m45_19367_c1 3300050496 Bacteria 3687
1800 nmdc:mga07m45_297378_c1 3300050496 Bacteria 939
1801 nmdc:mga07m45_55283_c1 3300050496 Bacteria 2244
1802 nmdc:mga07m45_599194_c1 3300050496 Bacteria 636
1803 nmdc:mga07m45_66972_c1 3300050496 Bacteria 2041
1804 nmdc:mga07m45_763100_c1 3300050496 Bacteria 555
1805 nmdc:mga07m45_7723_c1 3300050496 Bacteria 5504
1806 nmdc:mga05p37_145109_c1 3300050507 Bacteria 2907
1807 nmdc:mga05p37_2092563_c1 3300050507 Bacteria 531
1808 nmdc:mga09592_679646_c1 3300050508 Bacteria 877
1809 nmdc:mga0qj67_187067_c1 3300050509 Bacteria 1682
1810 nmdc:mga08y16_821765_c1 3300050511 Bacteria 921
1811 nmdc:mga0n895_431346_c1 3300050512 Bacteria 1332
1812 nmdc:mga0rr50_94735_c1 3300050513 Bacteria 2332
1813 nmdc:mga0a205_157818_c1 3300050515 Bacteria 2166
1814 nmdc:mga0sz30_13149_c1 3300050516 Bacteria 3235
1815 nmdc:mga0sz30_145628_c1 3300050516 Bacteria 1047
1816 nmdc:mga0sz30_21231_c2 3300050516 Bacteria 1549
1817 nmdc:mga0sz30_215343_c1 3300050516 Bacteria 854
1818 nmdc:mga0sz30_226095_c1 3300050516 Bacteria 832
1819 nmdc:mga0sz30_82852_c1 3300050516 Bacteria 1389
1820 Ga0495601_0112862 3300053077 Bacteria 1761
1821 Ga0495601_0222298 3300053077 Bacteria 1233
1822 Ga0495601_0243806 3300053077 Bacteria 1173
1823 Ga0495601_0310054 3300053077 Bacteria 1028
1824 Ga0495612_0013700 3300053078 Bacteria 3266
1825 Ga0495612_0109903 3300053078 Bacteria 1179
1826 Ga0500610_0303834 3300053079 Bacteria 702
1827 Ga0500610_0428140 3300053079 Bacteria 527
1828 Ga0500635_0001213 3300053080 Bacteria 6165
1829 Ga0500635_0284343 3300053080 Bacteria 651
1830 Ga0500635_0353477 3300053080 Bacteria 582
1831 Ga0495655_0044181 3300053083 Bacteria 1152
1832 Ga0495655_0189143 3300053083 Bacteria 668
1833 Ga0495595_0143395 3300053084 Bacteria 1173
1834 Ga0495619_0211036 3300053085 Bacteria 1345
1835 Ga0495619_0552000 3300053085 Bacteria 790
1836 Ga0500578_0081194 3300053086 Bacteria 2062
1837 Ga0500578_0108041 3300053086 Bacteria 1756
1838 Ga0500578_0382313 3300053086 Bacteria 816
1839 Ga0500643_000042 3300053087 Bacteria 158933
1840 Ga0500643_224451 3300053087 Bacteria 505
1841 Ga0500644_0045629 3300053088 Bacteria 1478
1842 Ga0500583_0046184 3300053092 Bacteria 2003
1843 Ga0500583_0125348 3300053092 Bacteria 1272
1844 Ga0500651_0000628 3300053093 Bacteria 17559
1845 Ga0500651_0153849 3300053093 Bacteria 1379
1846 Ga0500566_0010268 3300053094 Bacteria 5520
1847 Ga0500566_0026880 3300053094 Bacteria 3368
1848 Ga0500566_0428635 3300053094 Bacteria 584
1849 Ga0500566_0532268 3300053094 Bacteria 501
1850 Ga0500641_0010282 3300053096 Bacteria 3377
1851 Ga0500641_0044466 3300053096 Bacteria 1806
1852 Ga0500641_0059365 3300053096 Bacteria 1590
1853 Ga0500641_0067877 3300053096 Bacteria 1496
1854 Ga0500648_036088 3300053097 Bacteria 2798
1855 Ga0500650_0323244 3300053098 Bacteria 679
1856 Ga0500654_164771 3300053099 Bacteria 743
1857 Ga0500554_045258 3300053102 Bacteria 1366
1858 Ga0500555_000735 3300053103 Bacteria 12142
1859 Ga0500555_019657 3300053103 Bacteria 1945
1860 Ga0500556_0004619 3300053104 Bacteria 3913
1861 Ga0500558_070584 3300053106 Bacteria 1442
1862 Ga0500562_031716 3300053108 Bacteria 1394
1863 Ga0500569_019439 3300053109 Bacteria 1767
1864 Ga0500569_141199 3300053109 Bacteria 810
1865 Ga0500592_037057 3300053116 Bacteria 788
1866 Ga0500594_0075582 3300053118 Bacteria 998
1867 Ga0500595_001597 3300053119 Bacteria 11940
1868 Ga0500595_003957 3300053119 Bacteria 6772
1869 Ga0500595_009190 3300053119 Bacteria 3999
1870 Ga0500595_034703 3300053119 Bacteria 1667
1871 Ga0500595_035518 3300053119 Bacteria 1640
1872 Ga0500595_035816 3300053119 Bacteria 1632
1873 Ga0500595_151313 3300053119 Bacteria 648
1874 Ga0500617_136715 3300053124 Bacteria 989
1875 Ga0500642_0022271 3300053130 Bacteria 2525
1876 Ga0500642_0105216 3300053130 Bacteria 1315
1877 Ga0500642_0184531 3300053130 Bacteria 974
1878 Ga0500642_0342224 3300053130 Bacteria 666
1879 Ga0500642_0379414 3300053130 Bacteria 621
1880 Ga0500658_0037343 3300053134 Bacteria 1932
1881 Ga0500658_0157707 3300053134 Bacteria 1026
1882 Ga0500559_0031655 3300053136 Bacteria 2269
1883 Ga0500559_0097797 3300053136 Bacteria 1350
1884 Ga0500559_0148736 3300053136 Bacteria 1098
1885 Ga0500561_0009191 3300053137 Bacteria 1997
1886 Ga0500568_0003788 3300053139 Bacteria 8277
1887 Ga0500568_0056943 3300053139 Bacteria 1522
1888 Ga0500568_0127282 3300053139 Bacteria 948
1889 Ga0500568_0209033 3300053139 Bacteria 714
1890 Ga0500573_0025465 3300053140 Bacteria 3401
1891 Ga0500574_219006 3300053141 Bacteria 528
1892 Ga0500577_0000545 3300053142 Bacteria 9732
1893 Ga0500585_067408 3300053144 Bacteria 1291
1894 Ga0500588_0102452 3300053146 Bacteria 988
1895 Ga0500589_106325 3300053147 Bacteria 1211
1896 Ga0500589_158557 3300053147 Bacteria 912
1897 Ga0500589_251655 3300053147 Bacteria 648
1898 Ga0500590_261082 3300053148 Bacteria 680
1899 Ga0500603_000400 3300053150 Bacteria 11359
1900 Ga0500603_050379 3300053150 Bacteria 1138
1901 Ga0500603_099696 3300053150 Bacteria 862
1902 Ga0500604_0016250 3300053151 Bacteria 2048
1903 Ga0500616_0000048 3300053153 Bacteria 313108
1904 Ga0500622_0012774 3300053156 Bacteria 4537
1905 Ga0500622_0412359 3300053156 Bacteria 545
1906 Ga0500627_0247775 3300053158 Bacteria 789
1907 Ga0500633_0065795 3300053160 Bacteria 1285
1908 Ga0500634_0036445 3300053161 Bacteria 2678
1909 Ga0500634_0237939 3300053161 Bacteria 767
1910 Ga0500638_001878 3300053162 Bacteria 6970
1911 Ga0500638_107729 3300053162 Bacteria 1291
1912 Ga0500638_213645 3300053162 Bacteria 806
1913 Ga0500638_233150 3300053162 Bacteria 754
1914 Ga0500638_361195 3300053162 Bacteria 535
1915 Ga0500639_089484 3300053163 Bacteria 1536
1916 Ga0500636_0113963 3300053177 Bacteria 1524
1917 Ga0500636_0139657 3300053177 Bacteria 1342
1918 Ga0500636_0423344 3300053177 Bacteria 610
1919 Ga0500637_0000215 3300053178 Bacteria 21698
1920 Ga0500637_0001951 3300053178 Bacteria 8975
1921 Ga0500637_0171763 3300053178 Bacteria 1246
1922 Ga0500637_0355367 3300053178 Bacteria 777
1923 Ga0500611_081987 3300053727 Bacteria 807
1924 Ga0500611_200808 3300053727 Bacteria 565
1925 Ga0500645_042505 3300053730 Bacteria 1340
1926 Ga0500645_104554 3300053730 Bacteria 797
1927 Ga0500645_109345 3300053730 Bacteria 776
1928 Ga0500609_004989 3300053731 Bacteria 1817
1929 Ga0500609_014421 3300053731 Bacteria 1070
1930 Ga0500656_008183 3300053732 Bacteria 1105
1931 Ga0500596_017117 3300053735 Bacteria 1087
1932 Ga0500596_021342 3300053735 Bacteria 976
1933 Ga0500599_006905 3300053736 Bacteria 1452
1934 Ga0500601_000682 3300053737 Bacteria 4577
1935 Ga0501084_0013841 3300054114 Bacteria 6678
1936 Ga0501084_0512371 3300054114 Bacteria 1014
1937 Ga0500661_003253 3300055283 Bacteria 3055
1938 Ga0500661_006979 3300055283 Bacteria 2096
1939 Ga0501082_0154093 3300060353 Bacteria 1996
1940 Ga0466962_0633959 3300061719 Bacteria 546

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006846 Ga0075430_101027316 Ga0075430_1010273162 104
2 3300022467 Ga0224712_10279051 Ga0224712_102790511 115
3 iso_pu_bacteria 2507262055 2507507204 117
4 iso_pu_bacteria 2508501009 2508541258 117
5 iso_pu_bacteria 2511231028 2511397755 117
6 iso_pu_bacteria 2513237094 2513637167 117
7 iso_pu_bacteria 2513237096 2513655771 117
8 iso_pu_bacteria 2513237098 2513677752 117
9 iso_pu_bacteria 2513237101 2513693267 117
10 iso_pu_bacteria 2513237104 2513717463 117
11 iso_pu_bacteria 2513237137 2513856735 117
12 iso_pu_bacteria 2513237141 2513887471 117
13 iso_pu_bacteria 2513237145 2513917316 117
14 iso_pu_bacteria 2515154112 2515628773 117
15 iso_pu_bacteria 2517572143 2517895398 117
16 iso_pu_bacteria 2524023205 2524440676 117
17 iso_pu_bacteria 2524023210 2524467738 117
18 iso_pu_bacteria 2528768022 2528857426 117
19 iso_pu_bacteria 2643221651 2644289453 117
20 iso_pu_bacteria 2667528175 2671122073 117
21 iso_pu_bacteria 2728368998 2728750868 117
22 iso_pu_bacteria 2744054633 2745077478 117
23 iso_pu_bacteria 2791355199 2793078113 117
24 iso_pu_bacteria 2874604998 2874608835 117
25 iso_pu_bacteria 2876761206 2876769075 117
26 iso_pu_bacteria 2876808645 2876813898 117
27 iso_pu_bacteria 2889033259 2889037307 117
28 iso_pu_bacteria 2922361189 2922361437 117
29 iso_pu_bacteria 2922368715 2922376299 117
30 iso_pu_bacteria 2922386360 2922388860 117
31 iso_pu_bacteria 2932794094 2932797785 117
32 iso_pu_bacteria 2932801729 2932804302 117
33 iso_pu_bacteria 2932828146 2932832056 117
34 iso_pu_bacteria 2935608549 2935610418 117
35 iso_pu_bacteria 2935616580 2935621995 117
36 iso_pu_bacteria 2935648319 2935654379 117
37 iso_pu_bacteria 2935656913 2935663259 117
38 iso_pu_bacteria 2935684952 2935692293 117
39 iso_pu_bacteria 2935694250 2935700536 117
40 iso_pu_bacteria 2935713505 2935720469 117
41 iso_pu_bacteria 2935722832 2935729750 117
42 iso_pu_bacteria 2935732158 2935739268 117
43 iso_pu_bacteria 2935741537 2935748191 117
44 iso_pu_bacteria 2935750917 2935758394 117
45 iso_pu_bacteria 2935819856 2935823579 117
46 iso_pu_bacteria 2935837841 2935843178 117
47 iso_pu_bacteria 2935847175 2935849104 117
48 iso_pu_bacteria 2935855204 2935860242 117
49 iso_pu_bacteria 2935864058 2935867639 117
50 iso_pu_bacteria 2935873716 2935878551 117
51 iso_pu_bacteria 2935883170 2935888329 117
52 iso_pu_bacteria 2935908558 2935912806 117
53 iso_pu_bacteria 2935916978 2935922875 117
54 iso_pu_bacteria 2935926038 2935930300 117
55 iso_pu_bacteria 2935934488 2935939200 117
56 iso_pu_bacteria 2935942939 2935946148 117
57 iso_pu_bacteria 2935951376 2935955485 117
58 iso_pu_bacteria 2935959822 2935965310 117
59 iso_pu_bacteria 2935967501 2935972144 117
60 iso_pu_bacteria 2935975950 2935976073 117
61 iso_pu_bacteria 2935984226 2935986432 117
62 iso_pu_bacteria 2936002035 2936006872 117
63 iso_pu_bacteria 2936011229 2936017415 117
64 iso_pu_bacteria 2936019824 2936025917 117
65 iso_pu_bacteria 2936028420 2936034675 117
66 iso_pu_bacteria 2936046547 2936052732 117
67 iso_pu_bacteria 2936055302 2936059927 117
68 iso_pu_bacteria 2940556831 2940564298 117
69 iso_pu_bacteria 2941531003 2941531678 117
70 iso_pu_bacteria 3005594810 3005600847 117
71 iso_pu_bacteria 3005710791 3005716260 117
72 iso_pu_bacteria 3005718088 3005723640 117
73 iso_pu_bacteria 8006926726 8006931417 117
74 iso_pu_bacteria 8006933436 8006934482 117
75 iso_pu_bacteria 8006964411 8006968887 117
76 iso_pu_bacteria 8006973647 8006974452 117
77 iso_pu_bacteria 8006984368 8006985232 117
78 iso_pu_bacteria 8006994254 8006998551 117
79 iso_pu_bacteria 8016511872 8016520111 117
80 iso_pu_bacteria 8017057580 8017065443 117
81 iso_pu_bacteria 8019555841 8019564200 117
82 iso_pu_bacteria 8019565922 8019574277 117
83 iso_pu_bacteria 8019576017 8019584840 117
84 iso_pu_bacteria 8019586578 8019592789 117
85 iso_pu_bacteria 8019597564 8019598660 117
86 iso_pu_bacteria 8019608314 8019609710 117
87 iso_pu_bacteria 8019629233 8019632800 117
88 iso_pu_bacteria 8019648815 8019655565 117
89 iso_pu_bacteria 8019659431 8019660663 117
90 iso_pu_bacteria 8019668869 8019670078 117
91 iso_pu_bacteria 8019678201 8019686015 117
92 iso_pu_bacteria 8019687851 8019692180 117
93 iso_pu_bacteria 8056681323 8056682183 117
94 iso_pu_bacteria 8056689827 8056690332 117
95 3300005327 Ga0070658_10190980 Ga0070658_101909802 118
96 3300005435 Ga0070714_100188936 Ga0070714_1001889363 118
97 3300005436 Ga0070713_100800078 Ga0070713_1008000781 118
98 3300025929 Ga0207664_10052569 Ga0207664_100525692 118
99 3300048924 Ga0496121_0750307 Ga0496121_0750307_67_423 118
100 3300046491 Ga0495584_0382590 Ga0495584_0382590_275_634 119
101 3300005295 Ga0065707_11024719 Ga0065707_110247191 120
102 3300005614 Ga0068856_101180566 Ga0068856_1011805662 120
103 3300005937 Ga0081455_10220779 Ga0081455_102207792 120
104 3300006844 Ga0075428_102371727 Ga0075428_1023717272 120
105 3300009545 Ga0105237_10010908 Ga0105237_100109089 120
106 3300009545 Ga0105237_11078069 Ga0105237_110780692 120
107 3300009551 Ga0105238_10095675 Ga0105238_100956752 120
108 3300010375 Ga0105239_10977706 Ga0105239_109777062 120
109 3300010375 Ga0105239_11594185 Ga0105239_115941852 120
110 3300021358 Ga0213873_10025770 Ga0213873_100257702 120
111 3300021384 Ga0213876_10024127 Ga0213876_100241274 120
112 3300025914 Ga0207671_10338585 Ga0207671_103385851 120
113 3300025924 Ga0207694_10042137 Ga0207694_100421374 120
114 3300026078 Ga0207702_10366049 Ga0207702_103660492 120
115 3300031249 Ga0265339_10108566 Ga0265339_101085663 120
116 3300035113 Ga0373936_0078266 Ga0373936_0078266_457_819 120
117 3300035113 Ga0373936_0489931 Ga0373936_0489931_19_396 120
118 3300039437 Ga0436365_0481444 Ga0436365_0481444_5640_6002 120
119 3300044656 Ga0466969_0058119 Ga0466969_0058119_473_844 120
120 3300044765 Ga0466970_0303716 Ga0466970_0303716_483_854 120
121 3300045049 Ga0466959_0424406 Ga0466959_0424406_397_768 120
122 3300046454 Ga0495592_0575481 Ga0495592_0575481_32_394 120
123 3300046680 Ga0495646_0721580 Ga0495646_0721580_12_374 120
124 3300048088 Ga0495602_0068416 Ga0495602_0068416_1641_2030 120
125 3300048903 Ga0496100_0008443 Ga0496100_0008443_2950_3312 120
126 3300048904 Ga0496101_0671440 Ga0496101_0671440_268_630 120
127 3300048905 Ga0496102_0495187 Ga0496102_0495187_762_1124 120
128 3300048907 Ga0496104_0007514 Ga0496104_0007514_1263_1625 120
129 3300048908 Ga0496105_0177009 Ga0496105_0177009_1328_1690 120
130 3300048909 Ga0496106_0000634 Ga0496106_0000634_5491_5853 120
131 3300048910 Ga0496107_0009028 Ga0496107_0009028_1860_2222 120
132 3300048911 Ga0496108_0001003 Ga0496108_0001003_17783_18145 120
133 3300048912 Ga0496109_0000166 Ga0496109_0000166_15988_16350 120
134 3300048913 Ga0496110_0012878 Ga0496110_0012878_1738_2100 120
135 3300048914 Ga0496111_0059949 Ga0496111_0059949_944_1306 120
136 3300048915 Ga0496112_0000358 Ga0496112_0000358_6517_6879 120
137 3300048918 Ga0496115_0977835 Ga0496115_0977835_274_636 120
138 3300048928 Ga0496125_0425842 Ga0496125_0425842_342_704 120
139 3300048929 Ga0496126_0080441 Ga0496126_0080441_1147_1509 120
140 3300048929 Ga0496126_0216255 Ga0496126_0216255_179_541 120
141 3300053077 Ga0495601_0310054 Ga0495601_0310054_234_623 120
142 3300053080 Ga0500635_0353477 Ga0500635_0353477_154_516 120
143 3300053094 Ga0500566_0010268 Ga0500566_0010268_3292_3654 120
144 3300053119 Ga0500595_001597 Ga0500595_001597_2533_2895 120
145 3300053136 Ga0500559_0097797 Ga0500559_0097797_531_893 120
146 3300053162 Ga0500638_001878 Ga0500638_001878_936_1298 120
147 3300053162 Ga0500638_361195 Ga0500638_361195_147_509 120
148 3300053177 Ga0500636_0113963 Ga0500636_0113963_303_665 120
149 3300053178 Ga0500637_0000215 Ga0500637_0000215_18367_18729 120
150 3300055283 Ga0500661_003253 Ga0500661_003253_335_697 120
151 3300001979 JGI24740J21852_10002132 JGI24740J21852_100021325 121
152 3300001989 JGI24739J22299_10000994 JGI24739J22299_1000099413 121
153 3300001989 JGI24739J22299_10076384 JGI24739J22299_100763842 121
154 3300001990 JGI24737J22298_10002808 JGI24737J22298_100028088 121
155 3300002067 JGI24735J21928_10027781 JGI24735J21928_100277812 121
156 3300002075 JGI24738J21930_10106588 JGI24738J21930_101065882 121
157 3300002244 JGI24742J22300_10004932 JGI24742J22300_100049322 121
158 3300003215 JGI25153J46596_10001471 JGI25153J46596_100014713 121
159 3300003215 JGI25153J46596_10013115 JGI25153J46596_100131155 121
160 3300003354 JGI25160J50197_1000851 JGI25160J50197_10008514 121
161 3300003354 JGI25160J50197_1064782 JGI25160J50197_10647822 121
162 3300003659 JGI25404J52841_10007296 JGI25404J52841_100072962 121
163 3300003659 JGI25404J52841_10023210 JGI25404J52841_100232101 121
164 3300003759 Ga0055525_1005103 Ga0055525_10051032 121
165 3300003771 Ga0055526_1046137 Ga0055526_10461372 121
166 3300003911 JGI25405J52794_10017671 JGI25405J52794_100176712 121
167 3300005262 Ga0065165_1001015 Ga0065165_100101530 121
168 3300005289 Ga0065704_10263799 Ga0065704_102637992 121
169 3300005293 Ga0065715_10465953 Ga0065715_104659531 121
170 3300005293 Ga0065715_10934983 Ga0065715_109349831 121
171 3300005295 Ga0065707_10381129 Ga0065707_103811292 121
172 3300005327 Ga0070658_10074317 Ga0070658_100743174 121
173 3300005327 Ga0070658_10744815 Ga0070658_107448152 121
174 3300005327 Ga0070658_10750036 Ga0070658_107500362 121
175 3300005327 Ga0070658_11214472 Ga0070658_112144722 121
176 3300005327 Ga0070658_11475700 Ga0070658_114757001 121
177 3300005328 Ga0070676_10051847 Ga0070676_100518473 121
178 3300005328 Ga0070676_10302367 Ga0070676_103023671 121
179 3300005328 Ga0070676_10988659 Ga0070676_109886591 121
180 3300005329 Ga0070683_100041309 Ga0070683_1000413094 121
181 3300005329 Ga0070683_100732893 Ga0070683_1007328932 121
182 3300005329 Ga0070683_100886376 Ga0070683_1008863762 121
183 3300005329 Ga0070683_101408984 Ga0070683_1014089841 121
184 3300005330 Ga0070690_101568449 Ga0070690_1015684491 121
185 3300005331 Ga0070670_100133386 Ga0070670_1001333862 121
186 3300005331 Ga0070670_100410388 Ga0070670_1004103881 121
187 3300005331 Ga0070670_100603834 Ga0070670_1006038342 121
188 3300005334 Ga0068869_100089048 Ga0068869_1000890482 121
189 3300005334 Ga0068869_100272878 Ga0068869_1002728782 121
190 3300005334 Ga0068869_101489202 Ga0068869_1014892022 121
191 3300005335 Ga0070666_10183683 Ga0070666_101836832 121
192 3300005335 Ga0070666_10218472 Ga0070666_102184722 121
193 3300005335 Ga0070666_11079176 Ga0070666_110791761 121
194 3300005336 Ga0070680_100014862 Ga0070680_1000148625 121
195 3300005336 Ga0070680_100056438 Ga0070680_1000564382 121
196 3300005336 Ga0070680_100414086 Ga0070680_1004140862 121
197 3300005336 Ga0070680_100446075 Ga0070680_1004460751 121
198 3300005337 Ga0070682_100049913 Ga0070682_1000499134 121
199 3300005337 Ga0070682_100133688 Ga0070682_1001336883 121
200 3300005337 Ga0070682_100409477 Ga0070682_1004094771 121
201 3300005337 Ga0070682_100451019 Ga0070682_1004510192 121
202 3300005337 Ga0070682_100826514 Ga0070682_1008265142 121
203 3300005338 Ga0068868_100019171 Ga0068868_1000191715 121
204 3300005338 Ga0068868_100128947 Ga0068868_1001289471 121
205 3300005338 Ga0068868_100538342 Ga0068868_1005383422 121
206 3300005338 Ga0068868_100583403 Ga0068868_1005834032 121
207 3300005338 Ga0068868_101043893 Ga0068868_1010438931 121
208 3300005339 Ga0070660_100153390 Ga0070660_1001533902 121
209 3300005339 Ga0070660_100217426 Ga0070660_1002174263 121
210 3300005339 Ga0070660_100298783 Ga0070660_1002987832 121
211 3300005339 Ga0070660_100542726 Ga0070660_1005427262 121
212 3300005339 Ga0070660_100659328 Ga0070660_1006593282 121
213 3300005339 Ga0070660_101071719 Ga0070660_1010717191 121
214 3300005340 Ga0070689_100212105 Ga0070689_1002121052 121
215 3300005340 Ga0070689_100467348 Ga0070689_1004673482 121
216 3300005340 Ga0070689_100802914 Ga0070689_1008029141 121
217 3300005341 Ga0070691_10164287 Ga0070691_101642871 121
218 3300005341 Ga0070691_10272013 Ga0070691_102720132 121
219 3300005341 Ga0070691_10622127 Ga0070691_106221272 121
220 3300005343 Ga0070687_100713929 Ga0070687_1007139292 121
221 3300005344 Ga0070661_100256887 Ga0070661_1002568872 121
222 3300005344 Ga0070661_100410899 Ga0070661_1004108991 121
223 3300005344 Ga0070661_100649012 Ga0070661_1006490121 121
224 3300005344 Ga0070661_100773847 Ga0070661_1007738472 121
225 3300005344 Ga0070661_100778216 Ga0070661_1007782161 121
226 3300005344 Ga0070661_100970048 Ga0070661_1009700482 121
227 3300005344 Ga0070661_101473349 Ga0070661_1014733491 121
228 3300005345 Ga0070692_10325339 Ga0070692_103253391 121
229 3300005347 Ga0070668_100011646 Ga0070668_1000116467 121
230 3300005347 Ga0070668_100093723 Ga0070668_1000937232 121
231 3300005347 Ga0070668_100181892 Ga0070668_1001818922 121
232 3300005347 Ga0070668_100250361 Ga0070668_1002503612 121
233 3300005347 Ga0070668_100440193 Ga0070668_1004401932 121
234 3300005347 Ga0070668_100504853 Ga0070668_1005048532 121
235 3300005347 Ga0070668_100631576 Ga0070668_1006315762 121
236 3300005353 Ga0070669_100358241 Ga0070669_1003582412 121
237 3300005353 Ga0070669_100792759 Ga0070669_1007927592 121
238 3300005353 Ga0070669_101089220 Ga0070669_1010892201 121
239 3300005353 Ga0070669_101128973 Ga0070669_1011289731 121
240 3300005354 Ga0070675_100121009 Ga0070675_1001210092 121
241 3300005354 Ga0070675_101264484 Ga0070675_1012644841 121
242 3300005355 Ga0070671_100200532 Ga0070671_1002005322 121
243 3300005355 Ga0070671_100206291 Ga0070671_1002062912 121
244 3300005355 Ga0070671_100631535 Ga0070671_1006315351 121
245 3300005355 Ga0070671_101214101 Ga0070671_1012141011 121
246 3300005356 Ga0070674_100063873 Ga0070674_1000638734 121
247 3300005356 Ga0070674_100381720 Ga0070674_1003817202 121
248 3300005356 Ga0070674_100811882 Ga0070674_1008118822 121
249 3300005365 Ga0070688_100516122 Ga0070688_1005161222 121
250 3300005365 Ga0070688_100664096 Ga0070688_1006640961 121
251 3300005365 Ga0070688_100799348 Ga0070688_1007993482 121
252 3300005365 Ga0070688_101062568 Ga0070688_1010625682 121
253 3300005366 Ga0070659_100018785 Ga0070659_1000187851 121
254 3300005366 Ga0070659_100153456 Ga0070659_1001534562 121
255 3300005366 Ga0070659_100349826 Ga0070659_1003498261 121
256 3300005366 Ga0070659_100363834 Ga0070659_1003638342 121
257 3300005366 Ga0070659_101369007 Ga0070659_1013690072 121
258 3300005367 Ga0070667_100071421 Ga0070667_1000714212 121
259 3300005367 Ga0070667_100120955 Ga0070667_1001209552 121
260 3300005367 Ga0070667_100155565 Ga0070667_1001555652 121
261 3300005367 Ga0070667_100200543 Ga0070667_1002005433 121
262 3300005367 Ga0070667_101767786 Ga0070667_1017677861 121
263 3300005406 Ga0070703_10357228 Ga0070703_103572282 121
264 3300005434 Ga0070709_10005804 Ga0070709_100058048 121
265 3300005434 Ga0070709_10032349 Ga0070709_100323492 121
266 3300005434 Ga0070709_10070188 Ga0070709_100701882 121
267 3300005434 Ga0070709_10379140 Ga0070709_103791402 121
268 3300005434 Ga0070709_10443497 Ga0070709_104434971 121
269 3300005435 Ga0070714_100008494 Ga0070714_1000084948 121
270 3300005435 Ga0070714_100057152 Ga0070714_1000571524 121
271 3300005435 Ga0070714_100071409 Ga0070714_1000714094 121
272 3300005435 Ga0070714_100088227 Ga0070714_1000882275 121
273 3300005435 Ga0070714_100514544 Ga0070714_1005145442 121
274 3300005435 Ga0070714_100997547 Ga0070714_1009975471 121
275 3300005436 Ga0070713_100011888 Ga0070713_1000118886 121
276 3300005436 Ga0070713_100021271 Ga0070713_1000212716 121
277 3300005436 Ga0070713_100023787 Ga0070713_1000237873 121
278 3300005436 Ga0070713_100063344 Ga0070713_1000633442 121
279 3300005436 Ga0070713_100069263 Ga0070713_1000692634 121
280 3300005436 Ga0070713_100225414 Ga0070713_1002254142 121
281 3300005436 Ga0070713_100569257 Ga0070713_1005692572 121
282 3300005436 Ga0070713_100638903 Ga0070713_1006389032 121
283 3300005437 Ga0070710_10000243 Ga0070710_1000024324 121
284 3300005437 Ga0070710_10645032 Ga0070710_106450322 121
285 3300005438 Ga0070701_10867840 Ga0070701_108678401 121
286 3300005439 Ga0070711_100005828 Ga0070711_1000058286 121
287 3300005439 Ga0070711_100027217 Ga0070711_1000272173 121
288 3300005439 Ga0070711_100579811 Ga0070711_1005798112 121
289 3300005441 Ga0070700_100030349 Ga0070700_1000303492 121
290 3300005441 Ga0070700_100341741 Ga0070700_1003417411 121
291 3300005441 Ga0070700_100451188 Ga0070700_1004511881 121
292 3300005441 Ga0070700_100891242 Ga0070700_1008912422 121
293 3300005441 Ga0070700_101769819 Ga0070700_1017698191 121
294 3300005455 Ga0070663_100015327 Ga0070663_1000153274 121
295 3300005455 Ga0070663_100029415 Ga0070663_1000294153 121
296 3300005455 Ga0070663_100043607 Ga0070663_1000436073 121
297 3300005455 Ga0070663_100053294 Ga0070663_1000532942 121
298 3300005455 Ga0070663_100189348 Ga0070663_1001893483 121
299 3300005455 Ga0070663_100210102 Ga0070663_1002101022 121
300 3300005455 Ga0070663_100295468 Ga0070663_1002954682 121
301 3300005455 Ga0070663_100311829 Ga0070663_1003118292 121
302 3300005455 Ga0070663_100358315 Ga0070663_1003583152 121
303 3300005455 Ga0070663_100630453 Ga0070663_1006304532 121
304 3300005455 Ga0070663_101229843 Ga0070663_1012298431 121
305 3300005456 Ga0070678_100026225 Ga0070678_1000262253 121
306 3300005456 Ga0070678_100131264 Ga0070678_1001312642 121
307 3300005456 Ga0070678_100167776 Ga0070678_1001677762 121
308 3300005456 Ga0070678_100682296 Ga0070678_1006822962 121
309 3300005456 Ga0070678_101755211 Ga0070678_1017552111 121
310 3300005457 Ga0070662_100024830 Ga0070662_1000248303 121
311 3300005457 Ga0070662_100112688 Ga0070662_1001126883 121
312 3300005457 Ga0070662_100700957 Ga0070662_1007009571 121
313 3300005458 Ga0070681_10378766 Ga0070681_103787662 121
314 3300005458 Ga0070681_10867578 Ga0070681_108675782 121
315 3300005458 Ga0070681_11219027 Ga0070681_112190271 121
316 3300005459 Ga0068867_100077824 Ga0068867_1000778243 121
317 3300005459 Ga0068867_100224348 Ga0068867_1002243481 121
318 3300005466 Ga0070685_10048997 Ga0070685_100489973 121
319 3300005466 Ga0070685_10336469 Ga0070685_103364691 121
320 3300005466 Ga0070685_10395641 Ga0070685_103956412 121
321 3300005466 Ga0070685_10905397 Ga0070685_109053972 121
322 3300005471 Ga0070698_100095596 Ga0070698_1000955962 121
323 3300005471 Ga0070698_100181655 Ga0070698_1001816552 121
324 3300005530 Ga0070679_100109221 Ga0070679_1001092213 121
325 3300005530 Ga0070679_100207654 Ga0070679_1002076541 121
326 3300005530 Ga0070679_100373532 Ga0070679_1003735322 121
327 3300005530 Ga0070679_100381825 Ga0070679_1003818252 121
328 3300005530 Ga0070679_100834350 Ga0070679_1008343502 121
329 3300005530 Ga0070679_101300999 Ga0070679_1013009992 121
330 3300005535 Ga0070684_100024360 Ga0070684_1000243607 121
331 3300005535 Ga0070684_100122837 Ga0070684_1001228372 121
332 3300005535 Ga0070684_100325518 Ga0070684_1003255181 121
333 3300005535 Ga0070684_100692431 Ga0070684_1006924312 121
334 3300005536 Ga0070697_100117517 Ga0070697_1001175174 121
335 3300005536 Ga0070697_100821650 Ga0070697_1008216501 121
336 3300005539 Ga0068853_100034208 Ga0068853_1000342084 121
337 3300005539 Ga0068853_100066013 Ga0068853_1000660133 121
338 3300005539 Ga0068853_100111232 Ga0068853_1001112322 121
339 3300005539 Ga0068853_100229348 Ga0068853_1002293482 121
340 3300005539 Ga0068853_100280940 Ga0068853_1002809401 121
341 3300005539 Ga0068853_100311651 Ga0068853_1003116512 121
342 3300005539 Ga0068853_100350062 Ga0068853_1003500622 121
343 3300005539 Ga0068853_100575384 Ga0068853_1005753842 121
344 3300005539 Ga0068853_100642182 Ga0068853_1006421821 121
345 3300005539 Ga0068853_100742973 Ga0068853_1007429732 121
346 3300005539 Ga0068853_100788064 Ga0068853_1007880642 121
347 3300005543 Ga0070672_100240049 Ga0070672_1002400491 121
348 3300005543 Ga0070672_100317559 Ga0070672_1003175592 121
349 3300005543 Ga0070672_100813325 Ga0070672_1008133252 121
350 3300005543 Ga0070672_101012122 Ga0070672_1010121222 121
351 3300005545 Ga0070695_100356290 Ga0070695_1003562902 121
352 3300005545 Ga0070695_100383663 Ga0070695_1003836632 121
353 3300005546 Ga0070696_100661930 Ga0070696_1006619301 121
354 3300005546 Ga0070696_100698724 Ga0070696_1006987242 121
355 3300005546 Ga0070696_100728310 Ga0070696_1007283102 121
356 3300005547 Ga0070693_100131815 Ga0070693_1001318152 121
357 3300005547 Ga0070693_100669274 Ga0070693_1006692742 121
358 3300005547 Ga0070693_100820721 Ga0070693_1008207211 121
359 3300005547 Ga0070693_101457154 Ga0070693_1014571541 121
360 3300005548 Ga0070665_100042843 Ga0070665_1000428435 121
361 3300005548 Ga0070665_100046098 Ga0070665_1000460983 121
362 3300005548 Ga0070665_100114722 Ga0070665_1001147223 121
363 3300005548 Ga0070665_100242487 Ga0070665_1002424872 121
364 3300005548 Ga0070665_100258007 Ga0070665_1002580073 121
365 3300005548 Ga0070665_100564585 Ga0070665_1005645852 121
366 3300005563 Ga0068855_100020255 Ga0068855_1000202554 121
367 3300005563 Ga0068855_100022551 Ga0068855_1000225513 121
368 3300005563 Ga0068855_100083171 Ga0068855_1000831714 121
369 3300005563 Ga0068855_100178644 Ga0068855_1001786442 121
370 3300005563 Ga0068855_100260993 Ga0068855_1002609932 121
371 3300005563 Ga0068855_100270938 Ga0068855_1002709383 121
372 3300005563 Ga0068855_100445512 Ga0068855_1004455122 121
373 3300005563 Ga0068855_100479392 Ga0068855_1004793922 121
374 3300005563 Ga0068855_100666983 Ga0068855_1006669832 121
375 3300005563 Ga0068855_100897426 Ga0068855_1008974262 121
376 3300005564 Ga0070664_100631585 Ga0070664_1006315852 121
377 3300005564 Ga0070664_100725443 Ga0070664_1007254431 121
378 3300005564 Ga0070664_101038474 Ga0070664_1010384742 121
379 3300005577 Ga0068857_100010911 Ga0068857_10001091111 121
380 3300005577 Ga0068857_100068387 Ga0068857_1000683872 121
381 3300005577 Ga0068857_100344130 Ga0068857_1003441302 121
382 3300005578 Ga0068854_100027292 Ga0068854_1000272924 121
383 3300005578 Ga0068854_100347072 Ga0068854_1003470722 121
384 3300005578 Ga0068854_100514421 Ga0068854_1005144211 121
385 3300005578 Ga0068854_100628298 Ga0068854_1006282982 121
386 3300005578 Ga0068854_101028234 Ga0068854_1010282342 121
387 3300005578 Ga0068854_101294716 Ga0068854_1012947162 121
388 3300005614 Ga0068856_100000477 Ga0068856_10000047714 121
389 3300005614 Ga0068856_100013826 Ga0068856_1000138263 121
390 3300005614 Ga0068856_100039721 Ga0068856_1000397214 121
391 3300005614 Ga0068856_100080175 Ga0068856_1000801754 121
392 3300005614 Ga0068856_100107964 Ga0068856_1001079644 121
393 3300005614 Ga0068856_100406820 Ga0068856_1004068203 121
394 3300005614 Ga0068856_100637007 Ga0068856_1006370071 121
395 3300005614 Ga0068856_100991160 Ga0068856_1009911602 121
396 3300005615 Ga0070702_100256280 Ga0070702_1002562801 121
397 3300005615 Ga0070702_100325195 Ga0070702_1003251952 121
398 3300005615 Ga0070702_100887626 Ga0070702_1008876261 121
399 3300005616 Ga0068852_100038691 Ga0068852_1000386913 121
400 3300005616 Ga0068852_100124265 Ga0068852_1001242652 121
401 3300005616 Ga0068852_100262581 Ga0068852_1002625812 121
402 3300005616 Ga0068852_100325906 Ga0068852_1003259062 121
403 3300005616 Ga0068852_100494062 Ga0068852_1004940622 121
404 3300005616 Ga0068852_100646059 Ga0068852_1006460592 121
405 3300005616 Ga0068852_100653058 Ga0068852_1006530582 121
406 3300005616 Ga0068852_100655034 Ga0068852_1006550342 121
407 3300005616 Ga0068852_100850660 Ga0068852_1008506602 121
408 3300005616 Ga0068852_101007822 Ga0068852_1010078222 121
409 3300005616 Ga0068852_101394953 Ga0068852_1013949532 121
410 3300005617 Ga0068859_100191528 Ga0068859_1001915282 121
411 3300005617 Ga0068859_100590058 Ga0068859_1005900583 121
412 3300005617 Ga0068859_102227746 Ga0068859_1022277462 121
413 3300005617 Ga0068859_102241510 Ga0068859_1022415101 121
414 3300005618 Ga0068864_100011654 Ga0068864_1000116542 121
415 3300005618 Ga0068864_100123779 Ga0068864_1001237793 121
416 3300005618 Ga0068864_100578833 Ga0068864_1005788332 121
417 3300005618 Ga0068864_100640193 Ga0068864_1006401932 121
418 3300005618 Ga0068864_100911103 Ga0068864_1009111033 121
419 3300005618 Ga0068864_101146489 Ga0068864_1011464892 121
420 3300005718 Ga0068866_10034581 Ga0068866_100345812 121
421 3300005718 Ga0068866_10110361 Ga0068866_101103612 121
422 3300005718 Ga0068866_10149166 Ga0068866_101491662 121
423 3300005719 Ga0068861_100090532 Ga0068861_1000905322 121
424 3300005834 Ga0068851_10003264 Ga0068851_100032642 121
425 3300005834 Ga0068851_10089268 Ga0068851_100892682 121
426 3300005834 Ga0068851_10302565 Ga0068851_103025652 121
427 3300005834 Ga0068851_11120610 Ga0068851_111206101 121
428 3300005840 Ga0068870_10041783 Ga0068870_100417832 121
429 3300005840 Ga0068870_10388859 Ga0068870_103888592 121
430 3300005841 Ga0068863_100055359 Ga0068863_1000553593 121
431 3300005841 Ga0068863_100278792 Ga0068863_1002787922 121
432 3300005842 Ga0068858_100092104 Ga0068858_1000921044 121
433 3300005842 Ga0068858_100102877 Ga0068858_1001028772 121
434 3300005842 Ga0068858_100178235 Ga0068858_1001782353 121
435 3300005842 Ga0068858_100318188 Ga0068858_1003181883 121
436 3300005842 Ga0068858_100453025 Ga0068858_1004530252 121
437 3300005842 Ga0068858_100469589 Ga0068858_1004695892 121
438 3300005842 Ga0068858_101067021 Ga0068858_1010670212 121
439 3300005842 Ga0068858_101147883 Ga0068858_1011478832 121
440 3300005842 Ga0068858_101286626 Ga0068858_1012866262 121
441 3300005842 Ga0068858_101888172 Ga0068858_1018881722 121
442 3300005843 Ga0068860_100000324 Ga0068860_10000032411 121
443 3300005843 Ga0068860_101039060 Ga0068860_1010390602 121
444 3300005843 Ga0068860_101451241 Ga0068860_1014512411 121
445 3300005843 Ga0068860_102669186 Ga0068860_1026691861 121
446 3300005844 Ga0068862_100222247 Ga0068862_1002222472 121
447 3300005844 Ga0068862_100289941 Ga0068862_1002899412 121
448 3300005844 Ga0068862_100385277 Ga0068862_1003852772 121
449 3300005844 Ga0068862_100494009 Ga0068862_1004940092 121
450 3300005844 Ga0068862_101594539 Ga0068862_1015945392 121
451 3300005937 Ga0081455_10001871 Ga0081455_1000187118 121
452 3300005937 Ga0081455_10011253 Ga0081455_100112536 121
453 3300005937 Ga0081455_10044492 Ga0081455_100444926 121
454 3300005937 Ga0081455_10058158 Ga0081455_100581584 121
455 3300005937 Ga0081455_10142244 Ga0081455_101422442 121
456 3300005937 Ga0081455_10232590 Ga0081455_102325902 121
457 3300005937 Ga0081455_10257213 Ga0081455_102572132 121
458 3300005981 Ga0081538_10022266 Ga0081538_100222665 121
459 3300005981 Ga0081538_10057287 Ga0081538_100572872 121
460 3300005983 Ga0081540_1004943 Ga0081540_100494312 121
461 3300005983 Ga0081540_1007198 Ga0081540_10071983 121
462 3300005983 Ga0081540_1011781 Ga0081540_10117812 121
463 3300005983 Ga0081540_1018982 Ga0081540_10189823 121
464 3300005983 Ga0081540_1021410 Ga0081540_10214104 121
465 3300005983 Ga0081540_1021535 Ga0081540_10215354 121
466 3300005983 Ga0081540_1030775 Ga0081540_10307755 121
467 3300005983 Ga0081540_1036886 Ga0081540_10368863 121
468 3300005983 Ga0081540_1051457 Ga0081540_10514572 121
469 3300005983 Ga0081540_1105076 Ga0081540_11050762 121
470 3300005983 Ga0081540_1136702 Ga0081540_11367021 121
471 3300005983 Ga0081540_1209542 Ga0081540_12095421 121
472 3300005983 Ga0081540_1277682 Ga0081540_12776822 121
473 3300005985 Ga0081539_10035506 Ga0081539_100355063 121
474 3300005985 Ga0081539_10065113 Ga0081539_100651134 121
475 3300006028 Ga0070717_10019455 Ga0070717_100194556 121
476 3300006028 Ga0070717_10139971 Ga0070717_101399712 121
477 3300006028 Ga0070717_10171956 Ga0070717_101719562 121
478 3300006028 Ga0070717_10403918 Ga0070717_104039182 121
479 3300006028 Ga0070717_10608135 Ga0070717_106081352 121
480 3300006028 Ga0070717_11279160 Ga0070717_112791601 121
481 3300006038 Ga0075365_10064317 Ga0075365_100643172 121
482 3300006038 Ga0075365_10104896 Ga0075365_101048963 121
483 3300006038 Ga0075365_10112194 Ga0075365_101121942 121
484 3300006038 Ga0075365_10122601 Ga0075365_101226012 121
485 3300006038 Ga0075365_10356032 Ga0075365_103560322 121
486 3300006038 Ga0075365_10414869 Ga0075365_104148691 121
487 3300006038 Ga0075365_10420766 Ga0075365_104207662 121
488 3300006042 Ga0075368_10030519 Ga0075368_100305192 121
489 3300006042 Ga0075368_10044308 Ga0075368_100443082 121
490 3300006042 Ga0075368_10126084 Ga0075368_101260842 121
491 3300006042 Ga0075368_10265170 Ga0075368_102651702 121
492 3300006048 Ga0075363_100005107 Ga0075363_1000051075 121
493 3300006048 Ga0075363_100216294 Ga0075363_1002162942 121
494 3300006048 Ga0075363_100394420 Ga0075363_1003944202 121
495 3300006051 Ga0075364_10011122 Ga0075364_100111224 121
496 3300006051 Ga0075364_10134993 Ga0075364_101349933 121
497 3300006051 Ga0075364_10366454 Ga0075364_103664542 121
498 3300006163 Ga0070715_10034945 Ga0070715_100349451 121
499 3300006163 Ga0070715_10108458 Ga0070715_101084582 121
500 3300006163 Ga0070715_10205215 Ga0070715_102052152 121
501 3300006163 Ga0070715_10240476 Ga0070715_102404762 121
502 3300006163 Ga0070715_10860550 Ga0070715_108605502 121
503 3300006173 Ga0070716_100259638 Ga0070716_1002596382 121
504 3300006173 Ga0070716_100348798 Ga0070716_1003487982 121
505 3300006173 Ga0070716_100354240 Ga0070716_1003542401 121
506 3300006173 Ga0070716_100704111 Ga0070716_1007041112 121
507 3300006173 Ga0070716_100745606 Ga0070716_1007456061 121
508 3300006175 Ga0070712_100006981 Ga0070712_1000069817 121
509 3300006175 Ga0070712_100464311 Ga0070712_1004643111 121
510 3300006175 Ga0070712_100607825 Ga0070712_1006078252 121
511 3300006175 Ga0070712_100823949 Ga0070712_1008239492 121
512 3300006175 Ga0070712_101176059 Ga0070712_1011760592 121
513 3300006177 Ga0075362_10063047 Ga0075362_100630473 121
514 3300006177 Ga0075362_10066879 Ga0075362_100668793 121
515 3300006177 Ga0075362_10199116 Ga0075362_101991162 121
516 3300006177 Ga0075362_10221059 Ga0075362_102210592 121
517 3300006178 Ga0075367_10016972 Ga0075367_100169722 121
518 3300006178 Ga0075367_10025808 Ga0075367_100258083 121
519 3300006178 Ga0075367_10033657 Ga0075367_100336573 121
520 3300006178 Ga0075367_10127157 Ga0075367_101271572 121
521 3300006178 Ga0075367_10315119 Ga0075367_103151192 121
522 3300006178 Ga0075367_10371339 Ga0075367_103713392 121
523 3300006186 Ga0075369_10036614 Ga0075369_100366141 121
524 3300006186 Ga0075369_10141368 Ga0075369_101413682 121
525 3300006186 Ga0075369_10191499 Ga0075369_101914991 121
526 3300006186 Ga0075369_10192993 Ga0075369_101929932 121
527 3300006186 Ga0075369_10223204 Ga0075369_102232042 121
528 3300006186 Ga0075369_10631888 Ga0075369_106318881 121
529 3300006195 Ga0075366_10009346 Ga0075366_100093466 121
530 3300006195 Ga0075366_10050261 Ga0075366_100502612 121
531 3300006195 Ga0075366_10219622 Ga0075366_102196222 121
532 3300006195 Ga0075366_10264693 Ga0075366_102646932 121
533 3300006195 Ga0075366_10743249 Ga0075366_107432492 121
534 3300006237 Ga0097621_100208844 Ga0097621_1002088442 121
535 3300006237 Ga0097621_101060625 Ga0097621_1010606252 121
536 3300006237 Ga0097621_101173204 Ga0097621_1011732042 121
537 3300006353 Ga0075370_10007146 Ga0075370_100071463 121
538 3300006353 Ga0075370_10044151 Ga0075370_100441514 121
539 3300006353 Ga0075370_10156679 Ga0075370_101566792 121
540 3300006353 Ga0075370_10168882 Ga0075370_101688822 121
541 3300006353 Ga0075370_10187996 Ga0075370_101879962 121
542 3300006358 Ga0068871_100087350 Ga0068871_1000873502 121
543 3300006358 Ga0068871_100113715 Ga0068871_1001137153 121
544 3300006358 Ga0068871_100281937 Ga0068871_1002819372 121
545 3300006358 Ga0068871_100342878 Ga0068871_1003428782 121
546 3300006358 Ga0068871_100417459 Ga0068871_1004174592 121
547 3300006358 Ga0068871_100490168 Ga0068871_1004901682 121
548 3300006844 Ga0075428_100502947 Ga0075428_1005029472 121
549 3300006844 Ga0075428_101930670 Ga0075428_1019306702 121
550 3300006852 Ga0075433_11180134 Ga0075433_111801342 121
551 3300006871 Ga0075434_100378768 Ga0075434_1003787682 121
552 3300006881 Ga0068865_100155130 Ga0068865_1001551302 121
553 3300006881 Ga0068865_100438092 Ga0068865_1004380922 121
554 3300006931 Ga0097620_100191521 Ga0097620_1001915212 121
555 3300006931 Ga0097620_100590056 Ga0097620_1005900563 121
556 3300006931 Ga0097620_102227745 Ga0097620_1022277452 121
557 3300006931 Ga0097620_102241541 Ga0097620_1022415411 121
558 3300007076 Ga0075435_100538266 Ga0075435_1005382662 121
559 3300007265 Ga0099794_10244023 Ga0099794_102440232 121
560 3300007788 Ga0099795_10008505 Ga0099795_100085053 121
561 3300007788 Ga0099795_10182915 Ga0099795_101829152 121
562 3300007788 Ga0099795_10453833 Ga0099795_104538332 121
563 3300007788 Ga0099795_10479768 Ga0099795_104797681 121
564 3300009011 Ga0105251_10344434 Ga0105251_103444342 121
565 3300009092 Ga0105250_10031361 Ga0105250_100313613 121
566 3300009092 Ga0105250_10095732 Ga0105250_100957321 121
567 3300009093 Ga0105240_10031140 Ga0105240_100311402 121
568 3300009093 Ga0105240_10056305 Ga0105240_100563054 121
569 3300009093 Ga0105240_10079684 Ga0105240_100796843 121
570 3300009093 Ga0105240_10089758 Ga0105240_100897582 121
571 3300009093 Ga0105240_10682737 Ga0105240_106827372 121
572 3300009093 Ga0105240_10883722 Ga0105240_108837222 121
573 3300009093 Ga0105240_11597740 Ga0105240_115977402 121
574 3300009093 Ga0105240_12404679 Ga0105240_124046791 121
575 3300009094 Ga0111539_10705764 Ga0111539_107057642 121
576 3300009094 Ga0111539_12484128 Ga0111539_124841281 121
577 3300009098 Ga0105245_10084292 Ga0105245_100842922 121
578 3300009098 Ga0105245_10190442 Ga0105245_101904423 121
579 3300009098 Ga0105245_10232066 Ga0105245_102320663 121
580 3300009098 Ga0105245_10631985 Ga0105245_106319852 121
581 3300009098 Ga0105245_11338970 Ga0105245_113389702 121
582 3300009098 Ga0105245_11986696 Ga0105245_119866961 121
583 3300009098 Ga0105245_12838524 Ga0105245_128385241 121
584 3300009101 Ga0105247_10022626 Ga0105247_100226262 121
585 3300009101 Ga0105247_10062162 Ga0105247_100621622 121
586 3300009101 Ga0105247_10084359 Ga0105247_100843593 121
587 3300009101 Ga0105247_10394424 Ga0105247_103944242 121
588 3300009101 Ga0105247_10512108 Ga0105247_105121082 121
589 3300009101 Ga0105247_10830321 Ga0105247_108303211 121
590 3300009101 Ga0105247_11435355 Ga0105247_114353551 121
591 3300009147 Ga0114129_10060760 Ga0114129_100607602 121
592 3300009147 Ga0114129_11957674 Ga0114129_119576741 121
593 3300009147 Ga0114129_12387997 Ga0114129_123879971 121
594 3300009148 Ga0105243_10033198 Ga0105243_100331982 121
595 3300009148 Ga0105243_10047590 Ga0105243_100475905 121
596 3300009148 Ga0105243_10267254 Ga0105243_102672542 121
597 3300009148 Ga0105243_10740835 Ga0105243_107408352 121
598 3300009148 Ga0105243_10959550 Ga0105243_109595502 121
599 3300009148 Ga0105243_11339161 Ga0105243_113391612 121
600 3300009148 Ga0105243_11573580 Ga0105243_115735801 121
601 3300009148 Ga0105243_11759420 Ga0105243_117594202 121
602 3300009174 Ga0105241_10001008 Ga0105241_1000100816 121
603 3300009174 Ga0105241_10177980 Ga0105241_101779802 121
604 3300009174 Ga0105241_10330050 Ga0105241_103300502 121
605 3300009174 Ga0105241_11087885 Ga0105241_110878852 121
606 3300009174 Ga0105241_12551952 Ga0105241_125519522 121
607 3300009176 Ga0105242_10258033 Ga0105242_102580332 121
608 3300009176 Ga0105242_10379507 Ga0105242_103795072 121
609 3300009176 Ga0105242_10382084 Ga0105242_103820842 121
610 3300009176 Ga0105242_10479372 Ga0105242_104793722 121
611 3300009176 Ga0105242_10991146 Ga0105242_109911462 121
612 3300009176 Ga0105242_11065824 Ga0105242_110658242 121
613 3300009176 Ga0105242_12853617 Ga0105242_128536172 121
614 3300009177 Ga0105248_10248781 Ga0105248_102487812 121
615 3300009177 Ga0105248_10780762 Ga0105248_107807622 121
616 3300009177 Ga0105248_11102413 Ga0105248_111024132 121
617 3300009177 Ga0105248_11324917 Ga0105248_113249172 121
618 3300009177 Ga0105248_12059058 Ga0105248_120590582 121
619 3300009545 Ga0105237_10029563 Ga0105237_100295633 121
620 3300009545 Ga0105237_10130582 Ga0105237_101305823 121
621 3300009545 Ga0105237_10144948 Ga0105237_101449484 121
622 3300009545 Ga0105237_10157999 Ga0105237_101579992 121
623 3300009545 Ga0105237_10165660 Ga0105237_101656602 121
624 3300009545 Ga0105237_10165660 Ga0105237_101656603 121
625 3300009545 Ga0105237_10325017 Ga0105237_103250173 121
626 3300009545 Ga0105237_10690455 Ga0105237_106904551 121
627 3300009545 Ga0105237_10935486 Ga0105237_109354862 121
628 3300009551 Ga0105238_10017548 Ga0105238_100175483 121
629 3300009551 Ga0105238_10057485 Ga0105238_100574853 121
630 3300009551 Ga0105238_10202290 Ga0105238_102022902 121
631 3300009551 Ga0105238_10415043 Ga0105238_104150432 121
632 3300009551 Ga0105238_10731011 Ga0105238_107310111 121
633 3300009551 Ga0105238_10802331 Ga0105238_108023312 121
634 3300009551 Ga0105238_10862861 Ga0105238_108628611 121
635 3300009551 Ga0105238_11103637 Ga0105238_111036372 121
636 3300009551 Ga0105238_11121340 Ga0105238_111213402 121
637 3300009551 Ga0105238_11343932 Ga0105238_113439322 121
638 3300009551 Ga0105238_11694793 Ga0105238_116947932 121
639 3300009553 Ga0105249_10820056 Ga0105249_108200561 121
640 3300009553 Ga0105249_12022726 Ga0105249_120227261 121
641 3300010159 Ga0099796_10292597 Ga0099796_102925971 121
642 3300010375 Ga0105239_10034795 Ga0105239_100347955 121
643 3300010375 Ga0105239_10075959 Ga0105239_100759594 121
644 3300010375 Ga0105239_10301160 Ga0105239_103011602 121
645 3300010375 Ga0105239_10659771 Ga0105239_106597712 121
646 3300010375 Ga0105239_10860455 Ga0105239_108604552 121
647 3300010375 Ga0105239_11697881 Ga0105239_116978811 121
648 3300010375 Ga0105239_11746962 Ga0105239_117469622 121
649 3300010375 Ga0105239_11997844 Ga0105239_119978442 121
650 3300011119 Ga0105246_10089242 Ga0105246_100892422 121
651 3300011119 Ga0105246_10091525 Ga0105246_100915253 121
652 3300011119 Ga0105246_10139088 Ga0105246_101390881 121
653 3300011119 Ga0105246_10288112 Ga0105246_102881122 121
654 3300011119 Ga0105246_10550313 Ga0105246_105503131 121
655 3300011119 Ga0105246_10713775 Ga0105246_107137752 121
656 3300011119 Ga0105246_11100399 Ga0105246_111003992 121
657 3300011119 Ga0105246_11865446 Ga0105246_118654461 121
658 3300012488 Ga0157343_1019807 Ga0157343_10198072 121
659 3300012495 Ga0157323_1026230 Ga0157323_10262301 121
660 3300012507 Ga0157342_1047910 Ga0157342_10479101 121
661 3300013100 Ga0157373_10089798 Ga0157373_100897982 121
662 3300013100 Ga0157373_10895513 Ga0157373_108955132 121
663 3300013104 Ga0157370_10083446 Ga0157370_100834461 121
664 3300013104 Ga0157370_10389912 Ga0157370_103899122 121
665 3300013104 Ga0157370_10562320 Ga0157370_105623202 121
666 3300013104 Ga0157370_11300671 Ga0157370_113006712 121
667 3300013104 Ga0157370_11366596 Ga0157370_113665962 121
668 3300013104 Ga0157370_12064887 Ga0157370_120648871 121
669 3300013105 Ga0157369_10007048 Ga0157369_100070483 121
670 3300013105 Ga0157369_10036963 Ga0157369_100369634 121
671 3300013105 Ga0157369_11354013 Ga0157369_113540131 121
672 3300013105 Ga0157369_11443341 Ga0157369_114433412 121
673 3300013105 Ga0157369_12393463 Ga0157369_123934631 121
674 3300013296 Ga0157374_10003779 Ga0157374_1000377912 121
675 3300013296 Ga0157374_10083182 Ga0157374_100831822 121
676 3300013296 Ga0157374_10505077 Ga0157374_105050772 121
677 3300013296 Ga0157374_11131641 Ga0157374_111316411 121
678 3300013296 Ga0157374_11203608 Ga0157374_112036082 121
679 3300013296 Ga0157374_11893913 Ga0157374_118939132 121
680 3300013296 Ga0157374_12857768 Ga0157374_128577682 121
681 3300013297 Ga0157378_10016187 Ga0157378_100161877 121
682 3300013297 Ga0157378_10309950 Ga0157378_103099502 121
683 3300013297 Ga0157378_10745313 Ga0157378_107453132 121
684 3300013297 Ga0157378_11040510 Ga0157378_110405101 121
685 3300013297 Ga0157378_12023634 Ga0157378_120236342 121
686 3300013297 Ga0157378_12263818 Ga0157378_122638182 121
687 3300013306 Ga0163162_10027469 Ga0163162_100274697 121
688 3300013306 Ga0163162_10108608 Ga0163162_101086084 121
689 3300013306 Ga0163162_10656923 Ga0163162_106569232 121
690 3300013306 Ga0163162_10680266 Ga0163162_106802661 121
691 3300013306 Ga0163162_10947424 Ga0163162_109474242 121
692 3300013306 Ga0163162_11530191 Ga0163162_115301912 121
693 3300013306 Ga0163162_11636737 Ga0163162_116367371 121
694 3300013306 Ga0163162_11994090 Ga0163162_119940901 121
695 3300013306 Ga0163162_12451168 Ga0163162_124511682 121
696 3300013307 Ga0157372_10307105 Ga0157372_103071053 121
697 3300013307 Ga0157372_10324395 Ga0157372_103243953 121
698 3300013307 Ga0157372_10730602 Ga0157372_107306022 121
699 3300013307 Ga0157372_10890254 Ga0157372_108902542 121
700 3300013307 Ga0157372_12113724 Ga0157372_121137242 121
701 3300013307 Ga0157372_12438341 Ga0157372_124383412 121
702 3300013307 Ga0157372_12904047 Ga0157372_129040471 121
703 3300013308 Ga0157375_10064609 Ga0157375_100646095 121
704 3300013308 Ga0157375_10202740 Ga0157375_102027403 121
705 3300013308 Ga0157375_10661934 Ga0157375_106619343 121
706 3300013308 Ga0157375_11357165 Ga0157375_113571652 121
707 3300013308 Ga0157375_11614111 Ga0157375_116141111 121
708 3300014325 Ga0163163_10126601 Ga0163163_101266013 121
709 3300014325 Ga0163163_10282022 Ga0163163_102820222 121
710 3300014325 Ga0163163_10336532 Ga0163163_103365323 121
711 3300014325 Ga0163163_10402076 Ga0163163_104020762 121
712 3300014325 Ga0163163_10883660 Ga0163163_108836602 121
713 3300014325 Ga0163163_10973155 Ga0163163_109731552 121
714 3300014325 Ga0163163_12283982 Ga0163163_122839822 121
715 3300014326 Ga0157380_10178437 Ga0157380_101784373 121
716 3300014326 Ga0157380_10551069 Ga0157380_105510692 121
717 3300014326 Ga0157380_10813846 Ga0157380_108138462 121
718 3300014326 Ga0157380_12345519 Ga0157380_123455191 121
719 3300014745 Ga0157377_10081774 Ga0157377_100817742 121
720 3300014745 Ga0157377_10545896 Ga0157377_105458962 121
721 3300014745 Ga0157377_11010053 Ga0157377_110100532 121
722 3300014968 Ga0157379_10138920 Ga0157379_101389203 121
723 3300014968 Ga0157379_10145562 Ga0157379_101455623 121
724 3300014968 Ga0157379_10152708 Ga0157379_101527084 121
725 3300014968 Ga0157379_10157951 Ga0157379_101579512 121
726 3300014968 Ga0157379_10489103 Ga0157379_104891032 121
727 3300014968 Ga0157379_10779432 Ga0157379_107794321 121
728 3300014968 Ga0157379_11435948 Ga0157379_114359482 121
729 3300014968 Ga0157379_11601079 Ga0157379_116010792 121
730 3300014969 Ga0157376_10075336 Ga0157376_100753363 121
731 3300014969 Ga0157376_10125927 Ga0157376_101259273 121
732 3300014969 Ga0157376_10127844 Ga0157376_101278443 121
733 3300014969 Ga0157376_10602861 Ga0157376_106028612 121
734 3300017792 Ga0163161_10221975 Ga0163161_102219752 121
735 3300017792 Ga0163161_10702580 Ga0163161_107025802 121
736 3300021361 Ga0213872_10025966 Ga0213872_100259662 121
737 3300021377 Ga0213874_10045896 Ga0213874_100458962 121
738 3300021384 Ga0213876_10007688 Ga0213876_100076886 121
739 3300021384 Ga0213876_10053186 Ga0213876_100531862 121
740 3300021441 Ga0213871_10038295 Ga0213871_100382952 121
741 3300025230 Ga0209563_101314 Ga0209563_1013141 121
742 3300025253 Ga0209677_103699 Ga0209677_1036995 121
743 3300025254 Ga0209148_1005097 Ga0209148_10050972 121
744 3300025261 Ga0209233_1005247 Ga0209233_10052472 121
745 3300025261 Ga0209233_1019917 Ga0209233_10199172 121
746 3300025261 Ga0209233_1025956 Ga0209233_10259562 121
747 3300025272 Ga0209455_1003980 Ga0209455_10039802 121
748 3300025272 Ga0209455_1043663 Ga0209455_10436632 121
749 3300025295 Ga0209564_1021737 Ga0209564_10217372 121
750 3300025297 Ga0209758_1000720 Ga0209758_100072014 121
751 3300025297 Ga0209758_1001990 Ga0209758_100199012 121
752 3300025297 Ga0209758_1011741 Ga0209758_10117412 121
753 3300025297 Ga0209758_1029293 Ga0209758_10292933 121
754 3300025297 Ga0209758_1036588 Ga0209758_10365881 121
755 3300025299 Ga0209256_1034656 Ga0209256_10346562 121
756 3300025302 Ga0207426_1000480 Ga0207426_100048051 121
757 3300025302 Ga0207426_1001491 Ga0207426_10014914 121
758 3300025304 Ga0209257_1060263 Ga0209257_10602632 121
759 3300025315 Ga0207697_10091260 Ga0207697_100912603 121
760 3300025315 Ga0207697_10142192 Ga0207697_101421922 121
761 3300025321 Ga0207656_10002484 Ga0207656_100024844 121
762 3300025321 Ga0207656_10133247 Ga0207656_101332471 121
763 3300025893 Ga0207682_10093465 Ga0207682_100934653 121
764 3300025898 Ga0207692_10003656 Ga0207692_100036566 121
765 3300025898 Ga0207692_10005126 Ga0207692_100051265 121
766 3300025898 Ga0207692_10097241 Ga0207692_100972413 121
767 3300025898 Ga0207692_10616603 Ga0207692_106166032 121
768 3300025898 Ga0207692_10692408 Ga0207692_106924082 121
769 3300025899 Ga0207642_10291908 Ga0207642_102919082 121
770 3300025899 Ga0207642_10371953 Ga0207642_103719532 121
771 3300025900 Ga0207710_10053419 Ga0207710_100534193 121
772 3300025900 Ga0207710_10131847 Ga0207710_101318472 121
773 3300025900 Ga0207710_10205416 Ga0207710_102054162 121
774 3300025900 Ga0207710_10239728 Ga0207710_102397282 121
775 3300025900 Ga0207710_10257554 Ga0207710_102575542 121
776 3300025900 Ga0207710_10350614 Ga0207710_103506141 121
777 3300025900 Ga0207710_10785235 Ga0207710_107852351 121
778 3300025901 Ga0207688_10056128 Ga0207688_100561283 121
779 3300025901 Ga0207688_10289825 Ga0207688_102898252 121
780 3300025903 Ga0207680_10277414 Ga0207680_102774141 121
781 3300025903 Ga0207680_10376179 Ga0207680_103761792 121
782 3300025903 Ga0207680_10681953 Ga0207680_106819532 121
783 3300025903 Ga0207680_10722871 Ga0207680_107228712 121
784 3300025903 Ga0207680_10968046 Ga0207680_109680462 121
785 3300025904 Ga0207647_10004039 Ga0207647_100040396 121
786 3300025904 Ga0207647_10032878 Ga0207647_100328782 121
787 3300025904 Ga0207647_10049888 Ga0207647_100498882 121
788 3300025904 Ga0207647_10215640 Ga0207647_102156402 121
789 3300025904 Ga0207647_10274464 Ga0207647_102744642 121
790 3300025905 Ga0207685_10017678 Ga0207685_100176783 121
791 3300025905 Ga0207685_10095425 Ga0207685_100954252 121
792 3300025905 Ga0207685_10645472 Ga0207685_106454722 121
793 3300025906 Ga0207699_10000577 Ga0207699_100005776 121
794 3300025906 Ga0207699_10006106 Ga0207699_100061066 121
795 3300025906 Ga0207699_10024585 Ga0207699_100245853 121
796 3300025906 Ga0207699_10049055 Ga0207699_100490554 121
797 3300025906 Ga0207699_10256086 Ga0207699_102560862 121
798 3300025907 Ga0207645_10049857 Ga0207645_100498573 121
799 3300025907 Ga0207645_10349657 Ga0207645_103496572 121
800 3300025907 Ga0207645_10495702 Ga0207645_104957022 121
801 3300025907 Ga0207645_10746389 Ga0207645_107463892 121
802 3300025908 Ga0207643_10088442 Ga0207643_100884423 121
803 3300025908 Ga0207643_10133525 Ga0207643_101335252 121
804 3300025908 Ga0207643_10557229 Ga0207643_105572292 121
805 3300025909 Ga0207705_10316793 Ga0207705_103167931 121
806 3300025909 Ga0207705_10463695 Ga0207705_104636952 121
807 3300025909 Ga0207705_10763177 Ga0207705_107631772 121
808 3300025909 Ga0207705_11142941 Ga0207705_111429411 121
809 3300025911 Ga0207654_10004108 Ga0207654_100041083 121
810 3300025911 Ga0207654_10027201 Ga0207654_100272014 121
811 3300025911 Ga0207654_10074355 Ga0207654_100743553 121
812 3300025911 Ga0207654_10599922 Ga0207654_105999222 121
813 3300025912 Ga0207707_10010530 Ga0207707_100105302 121
814 3300025912 Ga0207707_10172110 Ga0207707_101721101 121
815 3300025912 Ga0207707_10490729 Ga0207707_104907292 121
816 3300025913 Ga0207695_10001596 Ga0207695_1000159616 121
817 3300025913 Ga0207695_10040729 Ga0207695_100407294 121
818 3300025913 Ga0207695_10047940 Ga0207695_100479402 121
819 3300025913 Ga0207695_10227471 Ga0207695_102274712 121
820 3300025913 Ga0207695_10247058 Ga0207695_102470582 121
821 3300025913 Ga0207695_10357126 Ga0207695_103571262 121
822 3300025913 Ga0207695_10440425 Ga0207695_104404252 121
823 3300025913 Ga0207695_10851535 Ga0207695_108515352 121
824 3300025913 Ga0207695_10858845 Ga0207695_108588451 121
825 3300025914 Ga0207671_10040116 Ga0207671_100401165 121
826 3300025914 Ga0207671_10085407 Ga0207671_100854071 121
827 3300025914 Ga0207671_10165399 Ga0207671_101653992 121
828 3300025914 Ga0207671_10177214 Ga0207671_101772142 121
829 3300025914 Ga0207671_10208932 Ga0207671_102089322 121
830 3300025914 Ga0207671_10255363 Ga0207671_102553631 121
831 3300025914 Ga0207671_10328512 Ga0207671_103285122 121
832 3300025914 Ga0207671_10660665 Ga0207671_106606652 121
833 3300025914 Ga0207671_10678654 Ga0207671_106786542 121
834 3300025915 Ga0207693_10003944 Ga0207693_100039442 121
835 3300025915 Ga0207693_10013523 Ga0207693_100135231 121
836 3300025915 Ga0207693_10056474 Ga0207693_100564742 121
837 3300025915 Ga0207693_10121734 Ga0207693_101217342 121
838 3300025915 Ga0207693_10778654 Ga0207693_107786541 121
839 3300025916 Ga0207663_10008914 Ga0207663_100089145 121
840 3300025916 Ga0207663_10140855 Ga0207663_101408551 121
841 3300025916 Ga0207663_10432396 Ga0207663_104323962 121
842 3300025917 Ga0207660_10034726 Ga0207660_100347265 121
843 3300025917 Ga0207660_10093335 Ga0207660_100933351 121
844 3300025917 Ga0207660_10153677 Ga0207660_101536773 121
845 3300025917 Ga0207660_10426359 Ga0207660_104263592 121
846 3300025918 Ga0207662_10187498 Ga0207662_101874982 121
847 3300025918 Ga0207662_10323419 Ga0207662_103234192 121
848 3300025919 Ga0207657_10019344 Ga0207657_100193447 121
849 3300025919 Ga0207657_10100066 Ga0207657_101000663 121
850 3300025919 Ga0207657_10162330 Ga0207657_101623303 121
851 3300025919 Ga0207657_10299838 Ga0207657_102998382 121
852 3300025920 Ga0207649_10361912 Ga0207649_103619122 121
853 3300025920 Ga0207649_10844819 Ga0207649_108448192 121
854 3300025920 Ga0207649_10847576 Ga0207649_108475761 121
855 3300025920 Ga0207649_11467170 Ga0207649_114671701 121
856 3300025921 Ga0207652_10163094 Ga0207652_101630943 121
857 3300025921 Ga0207652_10191743 Ga0207652_101917433 121
858 3300025921 Ga0207652_11898822 Ga0207652_118988221 121
859 3300025923 Ga0207681_11028637 Ga0207681_110286372 121
860 3300025923 Ga0207681_11626970 Ga0207681_116269701 121
861 3300025924 Ga0207694_10000757 Ga0207694_1000075717 121
862 3300025924 Ga0207694_10043771 Ga0207694_100437713 121
863 3300025924 Ga0207694_10310706 Ga0207694_103107062 121
864 3300025924 Ga0207694_10320856 Ga0207694_103208562 121
865 3300025924 Ga0207694_10467364 Ga0207694_104673642 121
866 3300025924 Ga0207694_10722773 Ga0207694_107227732 121
867 3300025924 Ga0207694_10795393 Ga0207694_107953932 121
868 3300025924 Ga0207694_11109796 Ga0207694_111097961 121
869 3300025925 Ga0207650_10144680 Ga0207650_101446803 121
870 3300025925 Ga0207650_10177638 Ga0207650_101776382 121
871 3300025927 Ga0207687_10055560 Ga0207687_100555602 121
872 3300025927 Ga0207687_10329319 Ga0207687_103293192 121
873 3300025927 Ga0207687_10379318 Ga0207687_103793182 121
874 3300025928 Ga0207700_10013608 Ga0207700_100136083 121
875 3300025928 Ga0207700_10061229 Ga0207700_100612293 121
876 3300025928 Ga0207700_10134443 Ga0207700_101344433 121
877 3300025928 Ga0207700_10157297 Ga0207700_101572972 121
878 3300025928 Ga0207700_10185956 Ga0207700_101859563 121
879 3300025928 Ga0207700_10797414 Ga0207700_107974142 121
880 3300025928 Ga0207700_11410433 Ga0207700_114104331 121
881 3300025929 Ga0207664_10006915 Ga0207664_100069155 121
882 3300025929 Ga0207664_10036913 Ga0207664_100369135 121
883 3300025929 Ga0207664_10255823 Ga0207664_102558233 121
884 3300025929 Ga0207664_11052701 Ga0207664_110527011 121
885 3300025929 Ga0207664_11088878 Ga0207664_110888782 121
886 3300025931 Ga0207644_10158148 Ga0207644_101581482 121
887 3300025931 Ga0207644_10161469 Ga0207644_101614693 121
888 3300025931 Ga0207644_10172994 Ga0207644_101729942 121
889 3300025931 Ga0207644_10193212 Ga0207644_101932123 121
890 3300025931 Ga0207644_10990870 Ga0207644_109908701 121
891 3300025932 Ga0207690_10016718 Ga0207690_100167185 121
892 3300025932 Ga0207690_10194786 Ga0207690_101947862 121
893 3300025932 Ga0207690_10195520 Ga0207690_101955202 121
894 3300025932 Ga0207690_10408447 Ga0207690_104084472 121
895 3300025932 Ga0207690_10446977 Ga0207690_104469772 121
896 3300025932 Ga0207690_11318982 Ga0207690_113189822 121
897 3300025933 Ga0207706_10065152 Ga0207706_100651524 121
898 3300025933 Ga0207706_10094764 Ga0207706_100947642 121
899 3300025934 Ga0207686_10116429 Ga0207686_101164291 121
900 3300025934 Ga0207686_10242173 Ga0207686_102421732 121
901 3300025935 Ga0207709_10128777 Ga0207709_101287772 121
902 3300025935 Ga0207709_10129066 Ga0207709_101290662 121
903 3300025935 Ga0207709_10631956 Ga0207709_106319562 121
904 3300025935 Ga0207709_10648985 Ga0207709_106489852 121
905 3300025935 Ga0207709_11019103 Ga0207709_110191032 121
906 3300025935 Ga0207709_11123684 Ga0207709_111236842 121
907 3300025936 Ga0207670_10391031 Ga0207670_103910312 121
908 3300025936 Ga0207670_10410095 Ga0207670_104100952 121
909 3300025936 Ga0207670_10917357 Ga0207670_109173572 121
910 3300025937 Ga0207669_10409929 Ga0207669_104099292 121
911 3300025937 Ga0207669_10757109 Ga0207669_107571092 121
912 3300025937 Ga0207669_11523894 Ga0207669_115238941 121
913 3300025938 Ga0207704_10021550 Ga0207704_100215503 121
914 3300025938 Ga0207704_10104069 Ga0207704_101040694 121
915 3300025939 Ga0207665_10004132 Ga0207665_100041329 121
916 3300025939 Ga0207665_10079009 Ga0207665_100790092 121
917 3300025939 Ga0207665_10103423 Ga0207665_101034232 121
918 3300025939 Ga0207665_10281226 Ga0207665_102812261 121
919 3300025939 Ga0207665_10395574 Ga0207665_103955742 121
920 3300025939 Ga0207665_10443501 Ga0207665_104435011 121
921 3300025939 Ga0207665_11304768 Ga0207665_113047682 121
922 3300025939 Ga0207665_11549067 Ga0207665_115490671 121
923 3300025939 Ga0207665_11575215 Ga0207665_115752152 121
924 3300025940 Ga0207691_10154001 Ga0207691_101540012 121
925 3300025940 Ga0207691_10189182 Ga0207691_101891822 121
926 3300025940 Ga0207691_10409365 Ga0207691_104093652 121
927 3300025940 Ga0207691_11077790 Ga0207691_110777902 121
928 3300025941 Ga0207711_10033638 Ga0207711_100336385 121
929 3300025941 Ga0207711_10046779 Ga0207711_100467793 121
930 3300025941 Ga0207711_10877974 Ga0207711_108779742 121
931 3300025941 Ga0207711_11936629 Ga0207711_119366292 121
932 3300025942 Ga0207689_10098724 Ga0207689_100987243 121
933 3300025942 Ga0207689_10111351 Ga0207689_101113513 121
934 3300025942 Ga0207689_10139060 Ga0207689_101390601 121
935 3300025942 Ga0207689_10162827 Ga0207689_101628273 121
936 3300025944 Ga0207661_10014836 Ga0207661_100148368 121
937 3300025944 Ga0207661_10084573 Ga0207661_100845734 121
938 3300025944 Ga0207661_10615211 Ga0207661_106152112 121
939 3300025944 Ga0207661_11215494 Ga0207661_112154942 121
940 3300025945 Ga0207679_10025455 Ga0207679_100254552 121
941 3300025945 Ga0207679_11076271 Ga0207679_110762712 121
942 3300025945 Ga0207679_11372118 Ga0207679_113721181 121
943 3300025945 Ga0207679_11560646 Ga0207679_115606462 121
944 3300025949 Ga0207667_10061306 Ga0207667_100613065 121
945 3300025949 Ga0207667_10109742 Ga0207667_101097422 121
946 3300025949 Ga0207667_10158436 Ga0207667_101584362 121
947 3300025949 Ga0207667_10349468 Ga0207667_103494683 121
948 3300025949 Ga0207667_10527895 Ga0207667_105278952 121
949 3300025949 Ga0207667_10609513 Ga0207667_106095132 121
950 3300025949 Ga0207667_10852217 Ga0207667_108522172 121
951 3300025949 Ga0207667_10904720 Ga0207667_109047202 121
952 3300025949 Ga0207667_11887961 Ga0207667_118879612 121
953 3300025949 Ga0207667_12148003 Ga0207667_121480032 121
954 3300025960 Ga0207651_11449804 Ga0207651_114498041 121
955 3300025961 Ga0207712_10546545 Ga0207712_105465452 121
956 3300025961 Ga0207712_10893510 Ga0207712_108935102 121
957 3300025972 Ga0207668_10206410 Ga0207668_102064102 121
958 3300025972 Ga0207668_10413199 Ga0207668_104131991 121
959 3300025972 Ga0207668_10451147 Ga0207668_104511472 121
960 3300025972 Ga0207668_10606382 Ga0207668_106063822 121
961 3300025972 Ga0207668_10948413 Ga0207668_109484131 121
962 3300025972 Ga0207668_10986140 Ga0207668_109861402 121
963 3300025972 Ga0207668_11439104 Ga0207668_114391042 121
964 3300025981 Ga0207640_10045297 Ga0207640_100452974 121
965 3300025981 Ga0207640_10143338 Ga0207640_101433382 121
966 3300025981 Ga0207640_10427295 Ga0207640_104272951 121
967 3300025981 Ga0207640_10671751 Ga0207640_106717512 121
968 3300025981 Ga0207640_10814277 Ga0207640_108142772 121
969 3300025981 Ga0207640_11852295 Ga0207640_118522952 121
970 3300025986 Ga0207658_10104015 Ga0207658_101040153 121
971 3300025986 Ga0207658_10404716 Ga0207658_104047161 121
972 3300025986 Ga0207658_10969121 Ga0207658_109691212 121
973 3300025986 Ga0207658_11077773 Ga0207658_110777731 121
974 3300026023 Ga0207677_10029898 Ga0207677_100298985 121
975 3300026023 Ga0207677_10711426 Ga0207677_107114262 121
976 3300026023 Ga0207677_10827032 Ga0207677_108270321 121
977 3300026023 Ga0207677_10833613 Ga0207677_108336132 121
978 3300026035 Ga0207703_10065585 Ga0207703_100655855 121
979 3300026035 Ga0207703_10275413 Ga0207703_102754131 121
980 3300026035 Ga0207703_11325748 Ga0207703_113257482 121
981 3300026035 Ga0207703_11343439 Ga0207703_113434392 121
982 3300026041 Ga0207639_10012898 Ga0207639_100128983 121
983 3300026041 Ga0207639_10014848 Ga0207639_100148483 121
984 3300026041 Ga0207639_10019630 Ga0207639_100196306 121
985 3300026041 Ga0207639_10088539 Ga0207639_100885394 121
986 3300026041 Ga0207639_10161946 Ga0207639_101619461 121
987 3300026041 Ga0207639_10262757 Ga0207639_102627573 121
988 3300026041 Ga0207639_10410399 Ga0207639_104103992 121
989 3300026041 Ga0207639_10542047 Ga0207639_105420472 121
990 3300026041 Ga0207639_10579343 Ga0207639_105793432 121
991 3300026041 Ga0207639_10786438 Ga0207639_107864381 121
992 3300026041 Ga0207639_10794264 Ga0207639_107942642 121
993 3300026067 Ga0207678_10003302 Ga0207678_1000330215 121
994 3300026067 Ga0207678_10023203 Ga0207678_100232033 121
995 3300026067 Ga0207678_10027731 Ga0207678_100277314 121
996 3300026067 Ga0207678_10056727 Ga0207678_100567273 121
997 3300026067 Ga0207678_10066796 Ga0207678_100667962 121
998 3300026067 Ga0207678_10170951 Ga0207678_101709512 121
999 3300026067 Ga0207678_10195056 Ga0207678_101950562 121
1000 3300026067 Ga0207678_10217097 Ga0207678_102170973 121
1001 3300026067 Ga0207678_10234204 Ga0207678_102342042 121
1002 3300026067 Ga0207678_10279137 Ga0207678_102791372 121
1003 3300026067 Ga0207678_10314833 Ga0207678_103148332 121
1004 3300026067 Ga0207678_10429183 Ga0207678_104291832 121
1005 3300026067 Ga0207678_10768904 Ga0207678_107689042 121
1006 3300026067 Ga0207678_11002467 Ga0207678_110024671 121
1007 3300026075 Ga0207708_10035518 Ga0207708_100355185 121
1008 3300026075 Ga0207708_11502925 Ga0207708_115029251 121
1009 3300026078 Ga0207702_10000003 Ga0207702_10000003329 121
1010 3300026078 Ga0207702_10000744 Ga0207702_100007448 121
1011 3300026078 Ga0207702_10046859 Ga0207702_100468594 121
1012 3300026078 Ga0207702_10189788 Ga0207702_101897883 121
1013 3300026078 Ga0207702_10197412 Ga0207702_101974122 121
1014 3300026078 Ga0207702_10205988 Ga0207702_102059883 121
1015 3300026078 Ga0207702_10298895 Ga0207702_102988952 121
1016 3300026078 Ga0207702_10375964 Ga0207702_103759642 121
1017 3300026078 Ga0207702_10915567 Ga0207702_109155672 121
1018 3300026078 Ga0207702_11090074 Ga0207702_110900741 121
1019 3300026078 Ga0207702_11187701 Ga0207702_111877012 121
1020 3300026088 Ga0207641_11939477 Ga0207641_119394772 121
1021 3300026089 Ga0207648_10088869 Ga0207648_100888695 121
1022 3300026089 Ga0207648_10164443 Ga0207648_101644432 121
1023 3300026089 Ga0207648_10465653 Ga0207648_104656532 121
1024 3300026089 Ga0207648_11122052 Ga0207648_111220522 121
1025 3300026089 Ga0207648_11281186 Ga0207648_112811861 121
1026 3300026095 Ga0207676_10075837 Ga0207676_100758372 121
1027 3300026095 Ga0207676_10142072 Ga0207676_101420723 121
1028 3300026095 Ga0207676_10328372 Ga0207676_103283723 121
1029 3300026095 Ga0207676_10385509 Ga0207676_103855092 121
1030 3300026095 Ga0207676_10958672 Ga0207676_109586722 121
1031 3300026095 Ga0207676_11108167 Ga0207676_111081672 121
1032 3300026116 Ga0207674_10017516 Ga0207674_1001751611 121
1033 3300026116 Ga0207674_10052521 Ga0207674_100525214 121
1034 3300026116 Ga0207674_10088541 Ga0207674_100885413 121
1035 3300026116 Ga0207674_10133243 Ga0207674_101332433 121
1036 3300026116 Ga0207674_10256684 Ga0207674_102566843 121
1037 3300026116 Ga0207674_10704318 Ga0207674_107043182 121
1038 3300026118 Ga0207675_100103863 Ga0207675_1001038633 121
1039 3300026118 Ga0207675_100137467 Ga0207675_1001374673 121
1040 3300026118 Ga0207675_100616218 Ga0207675_1006162181 121
1041 3300026118 Ga0207675_101113730 Ga0207675_1011137302 121
1042 3300026121 Ga0207683_10065026 Ga0207683_100650262 121
1043 3300026121 Ga0207683_10075863 Ga0207683_100758633 121
1044 3300026121 Ga0207683_10168997 Ga0207683_101689972 121
1045 3300026121 Ga0207683_10294328 Ga0207683_102943282 121
1046 3300026121 Ga0207683_10738654 Ga0207683_107386542 121
1047 3300026121 Ga0207683_10872335 Ga0207683_108723352 121
1048 3300026142 Ga0207698_10008823 Ga0207698_100088234 121
1049 3300026142 Ga0207698_10027211 Ga0207698_100272114 121
1050 3300026142 Ga0207698_10168842 Ga0207698_101688422 121
1051 3300026142 Ga0207698_10194058 Ga0207698_101940582 121
1052 3300026142 Ga0207698_10341317 Ga0207698_103413173 121
1053 3300026142 Ga0207698_10361341 Ga0207698_103613412 121
1054 3300026142 Ga0207698_10414102 Ga0207698_104141022 121
1055 3300026142 Ga0207698_10548985 Ga0207698_105489852 121
1056 3300026142 Ga0207698_10620213 Ga0207698_106202132 121
1057 3300026142 Ga0207698_10678941 Ga0207698_106789412 121
1058 3300026142 Ga0207698_10727393 Ga0207698_107273931 121
1059 3300026142 Ga0207698_12654412 Ga0207698_126544122 121
1060 3300026142 Ga0207698_12659955 Ga0207698_126599551 121
1061 3300026142 Ga0207698_12757283 Ga0207698_127572831 121
1062 3300027296 Ga0209389_1000009 Ga0209389_100000967 121
1063 3300027361 Ga0209489_100050 Ga0209489_10005058 121
1064 3300027363 Ga0209700_100016 Ga0209700_100016166 121
1065 3300027512 Ga0209179_1002915 Ga0209179_10029151 121
1066 3300027671 Ga0209588_1069753 Ga0209588_10697532 121
1067 3300027866 Ga0209813_10080942 Ga0209813_100809422 121
1068 3300027866 Ga0209813_10268132 Ga0209813_102681322 121
1069 3300027866 Ga0209813_10309226 Ga0209813_103092261 121
1070 3300028379 Ga0268266_10002325 Ga0268266_100023252 121
1071 3300028379 Ga0268266_10010017 Ga0268266_100100174 121
1072 3300028379 Ga0268266_10030342 Ga0268266_100303425 121
1073 3300028379 Ga0268266_10079541 Ga0268266_100795412 121
1074 3300028379 Ga0268266_10108109 Ga0268266_101081094 121
1075 3300028379 Ga0268266_10163306 Ga0268266_101633062 121
1076 3300028379 Ga0268266_10345523 Ga0268266_103455232 121
1077 3300028379 Ga0268266_10482117 Ga0268266_104821172 121
1078 3300028379 Ga0268266_11169379 Ga0268266_111693792 121
1079 3300028379 Ga0268266_11360192 Ga0268266_113601922 121
1080 3300028380 Ga0268265_10067985 Ga0268265_100679853 121
1081 3300028380 Ga0268265_10149717 Ga0268265_101497172 121
1082 3300028380 Ga0268265_10259271 Ga0268265_102592712 121
1083 3300028380 Ga0268265_10823154 Ga0268265_108231542 121
1084 3300028380 Ga0268265_11595115 Ga0268265_115951151 121
1085 3300028380 Ga0268265_11604686 Ga0268265_116046861 121
1086 3300028381 Ga0268264_10000038 Ga0268264_10000038312 121
1087 3300028381 Ga0268264_10044034 Ga0268264_100440342 121
1088 3300028381 Ga0268264_11692090 Ga0268264_116920901 121
1089 3300028786 Ga0307517_10000512 Ga0307517_100005127 121
1090 3300028786 Ga0307517_10140807 Ga0307517_101408073 121
1091 3300028786 Ga0307517_10321581 Ga0307517_103215812 121
1092 3300028794 Ga0307515_10022025 Ga0307515_1002202511 121
1093 3300028794 Ga0307515_10382332 Ga0307515_103823322 121
1094 3300030521 Ga0307511_10117777 Ga0307511_101177773 121
1095 3300030521 Ga0307511_10215090 Ga0307511_102150902 121
1096 3300031235 Ga0265330_10003886 Ga0265330_100038867 121
1097 3300031238 Ga0265332_10034474 Ga0265332_100344742 121
1098 3300031238 Ga0265332_10103572 Ga0265332_101035721 121
1099 3300031239 Ga0265328_10037456 Ga0265328_100374562 121
1100 3300031247 Ga0265340_10005741 Ga0265340_100057416 121
1101 3300031247 Ga0265340_10419736 Ga0265340_104197362 121
1102 3300031249 Ga0265339_10024640 Ga0265339_100246403 121
1103 3300031249 Ga0265339_10513904 Ga0265339_105139041 121
1104 3300031250 Ga0265331_10188624 Ga0265331_101886242 121
1105 3300031250 Ga0265331_10397380 Ga0265331_103973802 121
1106 3300031456 Ga0307513_10236595 Ga0307513_102365952 121
1107 3300031456 Ga0307513_10320835 Ga0307513_103208352 121
1108 3300031456 Ga0307513_10417631 Ga0307513_104176312 121
1109 3300031507 Ga0307509_10261922 Ga0307509_102619222 121
1110 3300031507 Ga0307509_10589968 Ga0307509_105899681 121
1111 3300031507 Ga0307509_10602254 Ga0307509_106022542 121
1112 3300031548 Ga0307408_100075146 Ga0307408_1000751465 121
1113 3300031548 Ga0307408_102321925 Ga0307408_1023219252 121
1114 3300031616 Ga0307508_10000008 Ga0307508_10000008106 121
1115 3300031616 Ga0307508_10043701 Ga0307508_100437012 121
1116 3300031616 Ga0307508_10088541 Ga0307508_100885413 121
1117 3300031616 Ga0307508_10206983 Ga0307508_102069832 121
1118 3300031616 Ga0307508_10314525 Ga0307508_103145252 121
1119 3300031711 Ga0265314_10001759 Ga0265314_1000175915 121
1120 3300031712 Ga0265342_10097288 Ga0265342_100972881 121
1121 3300031712 Ga0265342_10120667 Ga0265342_101206672 121
1122 3300031730 Ga0307516_10066581 Ga0307516_100665813 121
1123 3300031730 Ga0307516_10099474 Ga0307516_100994743 121
1124 3300031730 Ga0307516_10113504 Ga0307516_101135042 121
1125 3300031730 Ga0307516_10167947 Ga0307516_101679472 121
1126 3300031730 Ga0307516_10185470 Ga0307516_101854702 121
1127 3300031730 Ga0307516_10214139 Ga0307516_102141392 121
1128 3300031730 Ga0307516_10445570 Ga0307516_104455702 121
1129 3300031730 Ga0307516_10455428 Ga0307516_104554282 121
1130 3300031730 Ga0307516_10808780 Ga0307516_108087801 121
1131 3300031731 Ga0307405_10108479 Ga0307405_101084792 121
1132 3300031731 Ga0307405_10790815 Ga0307405_107908151 121
1133 3300031824 Ga0307413_11174437 Ga0307413_111744372 121
1134 3300031824 Ga0307413_12159251 Ga0307413_121592511 121
1135 3300031838 Ga0307518_10270366 Ga0307518_102703662 121
1136 3300031852 Ga0307410_10407593 Ga0307410_104075932 121
1137 3300031903 Ga0307407_10455455 Ga0307407_104554551 121
1138 3300031911 Ga0307412_10803011 Ga0307412_108030111 121
1139 3300031995 Ga0307409_100260726 Ga0307409_1002607262 121
1140 3300031995 Ga0307409_100591857 Ga0307409_1005918572 121
1141 3300032002 Ga0307416_100668121 Ga0307416_1006681212 121
1142 3300032002 Ga0307416_100935474 Ga0307416_1009354742 121
1143 3300032002 Ga0307416_101334917 Ga0307416_1013349172 121
1144 3300032002 Ga0307416_103797766 Ga0307416_1037977661 121
1145 3300032004 Ga0307414_10372720 Ga0307414_103727202 121
1146 3300032005 Ga0307411_10281482 Ga0307411_102814822 121
1147 3300032005 Ga0307411_10405790 Ga0307411_104057901 121
1148 3300032126 Ga0307415_100146142 Ga0307415_1001461422 121
1149 3300032126 Ga0307415_100256944 Ga0307415_1002569441 121
1150 3300032126 Ga0307415_100542146 Ga0307415_1005421462 121
1151 3300032126 Ga0307415_100704490 Ga0307415_1007044902 121
1152 3300032126 Ga0307415_102561490 Ga0307415_1025614901 121
1153 3300033180 Ga0307510_10009742 Ga0307510_100097424 121
1154 3300033180 Ga0307510_10050764 Ga0307510_100507643 121
1155 3300033180 Ga0307510_10275419 Ga0307510_102754191 121
1156 3300033442 Ga0315911_1000004 Ga0315911_1000004366 121
1157 3300034816 Ga0373930_0023681 Ga0373930_0023681_423_788 121
1158 3300034957 Ga0373938_0009634 Ga0373938_0009634_534_899 121
1159 3300035083 Ga0373926_0170234 Ga0373926_0170234_73_438 121
1160 3300035083 Ga0373926_0179436 Ga0373926_0179436_162_527 121
1161 3300035084 Ga0373928_0030900 Ga0373928_0030900_601_966 121
1162 3300035090 Ga0373949_0068913 Ga0373949_0068913_380_745 121
1163 3300035092 Ga0373952_0186611 Ga0373952_0186611_78_443 121
1164 3300035111 Ga0373923_0024351 Ga0373923_0024351_929_1294 121
1165 3300035111 Ga0373923_0065895 Ga0373923_0065895_224_589 121
1166 3300035112 Ga0373932_0043651 Ga0373932_0043651_457_822 121
1167 3300035114 Ga0373939_0067628 Ga0373939_0067628_521_886 121
1168 3300035114 Ga0373939_0172438 Ga0373939_0172438_159_524 121
1169 3300035115 Ga0373941_0062019 Ga0373941_0062019_222_587 121
1170 3300035116 Ga0373945_0106342 Ga0373945_0106342_638_1003 121
1171 3300035116 Ga0373945_0336143 Ga0373945_0336143_55_420 121
1172 3300035116 Ga0373945_0473287 Ga0373945_0473287_174_539 121
1173 3300035117 Ga0373953_0008522 Ga0373953_0008522_2295_2660 121
1174 3300035118 Ga0373954_0188554 Ga0373954_0188554_214_579 121
1175 3300035121 Ga0373960_0153340 Ga0373960_0153340_327_692 121
1176 3300035170 Ga0373943_0003068 Ga0373943_0003068_938_1303 121
1177 3300035170 Ga0373943_0247281 Ga0373943_0247281_355_720 121
1178 3300035170 Ga0373943_0358814 Ga0373943_0358814_254_619 121
1179 3300035170 Ga0373943_0374906 Ga0373943_0374906_170_535 121
1180 3300035170 Ga0373943_0456947 Ga0373943_0456947_78_443 121
1181 3300035171 Ga0373946_0029683 Ga0373946_0029683_1114_1479 121
1182 3300035171 Ga0373946_0052697 Ga0373946_0052697_621_986 121
1183 3300035172 Ga0373955_0030906 Ga0373955_0030906_560_925 121
1184 3300035241 Ga0373961_0009070 Ga0373961_0009070_1741_2106 121
1185 3300035410 Ga0373924_0094211 Ga0373924_0094211_835_1200 121
1186 3300035691 Ga0373931_0003601 Ga0373931_0003601_141_506 121
1187 3300035691 Ga0373931_0083348 Ga0373931_0083348_594_959 121
1188 3300035691 Ga0373931_0328557 Ga0373931_0328557_360_725 121
1189 3300035692 Ga0373935_0001766 Ga0373935_0001766_506_871 121
1190 3300035692 Ga0373935_1021568 Ga0373935_1021568_85_450 121
1191 3300035695 Ga0373927_0000346 Ga0373927_0000346_17184_17549 121
1192 3300035695 Ga0373927_0003142 Ga0373927_0003142_5149_5514 121
1193 3300035695 Ga0373927_0018992 Ga0373927_0018992_2077_2442 121
1194 3300035695 Ga0373927_0021985 Ga0373927_0021985_2954_3319 121
1195 3300035695 Ga0373927_0028798 Ga0373927_0028798_413_778 121
1196 3300035695 Ga0373927_0046710 Ga0373927_0046710_71_436 121
1197 3300035695 Ga0373927_0073207 Ga0373927_0073207_421_786 121
1198 3300035695 Ga0373927_0231107 Ga0373927_0231107_716_1081 121
1199 3300035695 Ga0373927_0252436 Ga0373927_0252436_372_737 121
1200 3300035695 Ga0373927_0408378 Ga0373927_0408378_101_475 121
1201 3300035724 Ga0373933_0004420 Ga0373933_0004420_5099_5464 121
1202 3300035724 Ga0373933_0024198 Ga0373933_0024198_1790_2155 121
1203 3300035724 Ga0373933_0362937 Ga0373933_0362937_346_711 121
1204 3300035724 Ga0373933_1167544 Ga0373933_1167544_106_471 121
1205 3300035725 Ga0373947_0001267 Ga0373947_0001267_9392_9757 121
1206 3300035725 Ga0373947_0036794 Ga0373947_0036794_1292_1657 121
1207 3300035725 Ga0373947_0066104 Ga0373947_0066104_107_472 121
1208 3300035725 Ga0373947_0138555 Ga0373947_0138555_641_1006 121
1209 3300036401 Ga0373937_0023839 Ga0373937_0023839_3694_4059 121
1210 3300036401 Ga0373937_0038979 Ga0373937_0038979_2421_2786 121
1211 3300036401 Ga0373937_1364881 Ga0373937_1364881_197_562 121
1212 3300037068 Ga0373925_0001404 Ga0373925_0001404_6422_6787 121
1213 3300037068 Ga0373925_0017538 Ga0373925_0017538_3902_4267 121
1214 3300037068 Ga0373925_0030842 Ga0373925_0030842_2225_2590 121
1215 3300037068 Ga0373925_0098512 Ga0373925_0098512_639_1004 121
1216 3300037068 Ga0373925_0435487 Ga0373925_0435487_149_514 121
1217 3300037068 Ga0373925_0879586 Ga0373925_0879586_200_565 121
1218 3300037068 Ga0373925_1015961 Ga0373925_1015961_50_415 121
1219 3300037068 Ga0373925_1741326 Ga0373925_1741326_113_478 121
1220 3300037312 Ga0395899_0069735 Ga0395899_0069735_489_854 121
1221 3300037312 Ga0395899_0562304 Ga0395899_0562304_327_692 121
1222 3300037418 Ga0395900_0000134 Ga0395900_0000134_81555_81920 121
1223 3300037418 Ga0395900_0044996 Ga0395900_0044996_143_508 121
1224 3300037418 Ga0395900_0122865 Ga0395900_0122865_985_1350 121
1225 3300037418 Ga0395900_0439665 Ga0395900_0439665_534_899 121
1226 3300037418 Ga0395900_1256167 Ga0395900_1256167_215_580 121
1227 3300037418 Ga0395900_1346056 Ga0395900_1346056_38_403 121
1228 3300037466 Ga0395898_0006221 Ga0395898_0006221_2074_2439 121
1229 3300037466 Ga0395898_0037354 Ga0395898_0037354_4421_4786 121
1230 3300037466 Ga0395898_0428621 Ga0395898_0428621_680_1054 121
1231 3300037466 Ga0395898_1097266 Ga0395898_1097266_54_419 121
1232 3300037471 Ga0395905_0074148 Ga0395905_0074148_2106_2471 121
1233 3300037471 Ga0395905_0252906 Ga0395905_0252906_581_946 121
1234 3300037471 Ga0395905_0478329 Ga0395905_0478329_658_1023 121
1235 3300037471 Ga0395905_0529899 Ga0395905_0529899_605_970 121
1236 3300037471 Ga0395905_1861925 Ga0395905_1861925_42_407 121
1237 3300038443 Ga0395901_0084968 Ga0395901_0084968_2826_3191 121
1238 3300038443 Ga0395901_0128573 Ga0395901_0128573_2152_2517 121
1239 3300038443 Ga0395901_0367001 Ga0395901_0367001_248_613 121
1240 3300038443 Ga0395901_0856042 Ga0395901_0856042_406_771 121
1241 3300039437 Ga0436365_0124625 Ga0436365_0124625_496_861 121
1242 3300039437 Ga0436365_0507971 Ga0436365_0507971_2042_2407 121
1243 3300039437 Ga0436365_0788813 Ga0436365_0788813_4598_4963 121
1244 3300039437 Ga0436365_1710304 Ga0436365_1710304_888_1253 121
1245 3300039438 Ga0436360_0137740 Ga0436360_0137740_287_652 121
1246 3300039438 Ga0436360_0165980 Ga0436360_0165980_376_741 121
1247 3300039447 Ga0436361_0448890 Ga0436361_0448890_268_642 121
1248 3300039447 Ga0436361_0566914 Ga0436361_0566914_175_540 121
1249 3300039447 Ga0436361_1070161 Ga0436361_1070161_748_1113 121
1250 3300039450 Ga0436363_0361191 Ga0436363_0361191_209_574 121
1251 3300039450 Ga0436363_0535409 Ga0436363_0535409_506_871 121
1252 3300039450 Ga0436363_0636413 Ga0436363_0636413_68_433 121
1253 3300039450 Ga0436363_0668617 Ga0436363_0668617_69_434 121
1254 3300039450 Ga0436363_1471097 Ga0436363_1471097_5186_5551 121
1255 3300039453 Ga0436362_0429757 Ga0436362_0429757_2881_3246 121
1256 3300041413 Ga0439465_0047696 Ga0439465_0047696_704_1069 121
1257 3300041413 Ga0439465_0085144 Ga0439465_0085144_356_721 121
1258 3300041443 Ga0451789_0634394 Ga0451789_0634394_515_880 121
1259 3300041452 Ga0451793_0652808 Ga0451793_0652808_1043_1408 121
1260 3300041452 Ga0451793_1091092 Ga0451793_1091092_74_439 121
1261 3300041453 Ga0451797_0395902 Ga0451797_0395902_52_417 121
1262 3300041456 Ga0451795_0707023 Ga0451795_0707023_79_444 121
1263 3300041458 Ga0451798_0489730 Ga0451798_0489730_142_507 121
1264 3300041458 Ga0451798_0737230 Ga0451798_0737230_213_578 121
1265 3300041458 Ga0451798_1101150 Ga0451798_1101150_321_686 121
1266 3300041459 Ga0451800_1437687 Ga0451800_1437687_536_901 121
1267 3300041460 Ga0451802_1523859 Ga0451802_1523859_42_407 121
1268 3300041463 Ga0451804_0724896 Ga0451804_0724896_183_548 121
1269 3300041486 Ga0451807_1402442 Ga0451807_1402442_36_401 121
1270 3300041486 Ga0451807_2336714 Ga0451807_2336714_970_1335 121
1271 3300041491 Ga0451833_0925663 Ga0451833_0925663_226_591 121
1272 3300041501 Ga0451845_0841671 Ga0451845_0841671_62_427 121
1273 3300041503 Ga0451847_0122684 Ga0451847_0122684_71_436 121
1274 3300041507 Ga0451851_0480271 Ga0451851_0480271_421_786 121
1275 3300041509 Ga0451843_1105407 Ga0451843_1105407_38_403 121
1276 3300041511 Ga0451855_0889375 Ga0451855_0889375_615_980 121
1277 3300041512 Ga0451853_1195350 Ga0451853_1195350_1826_2191 121
1278 3300042142 Ga0450905_015473 Ga0450905_015473_700_1065 121
1279 3300044656 Ga0466969_0422981 Ga0466969_0422981_110_475 121
1280 3300044683 Ga0466965_0020828 Ga0466965_0020828_193_558 121
1281 3300044684 Ga0466966_0005030 Ga0466966_0005030_3373_3738 121
1282 3300044693 Ga0466961_0000060 Ga0466961_0000060_51655_52020 121
1283 3300044694 Ga0466963_0052710 Ga0466963_0052710_542_907 121
1284 3300044694 Ga0466963_0605779 Ga0466963_0605779_123_488 121
1285 3300044694 Ga0466963_1254748 Ga0466963_1254748_73_438 121
1286 3300044706 Ga0466964_0148605 Ga0466964_0148605_273_638 121
1287 3300044842 Ga0466957_0038885 Ga0466957_0038885_842_1207 121
1288 3300045049 Ga0466959_0001866 Ga0466959_0001866_715_1080 121
1289 3300045049 Ga0466959_0027870 Ga0466959_0027870_2042_2407 121
1290 3300045836 Ga0466958_0310852 Ga0466958_0310852_39_404 121
1291 3300045976 Ga0466967_0042613 Ga0466967_0042613_2964_3329 121
1292 3300045976 Ga0466967_0440312 Ga0466967_0440312_895_1260 121
1293 3300045976 Ga0466967_0571107 Ga0466967_0571107_104_469 121
1294 3300046452 Ga0495617_110013 Ga0495617_110013_250_615 121
1295 3300046453 Ga0495627_043963 Ga0495627_043963_836_1201 121
1296 3300046454 Ga0495592_0006304 Ga0495592_0006304_5586_5951 121
1297 3300046454 Ga0495592_0063692 Ga0495592_0063692_726_1091 121
1298 3300046455 Ga0495603_0000092 Ga0495603_0000092_10720_11085 121
1299 3300046455 Ga0495603_0002928 Ga0495603_0002928_6070_6435 121
1300 3300046455 Ga0495603_0031557 Ga0495603_0031557_1651_2016 121
1301 3300046455 Ga0495603_0035014 Ga0495603_0035014_2047_2412 121
1302 3300046455 Ga0495603_0063024 Ga0495603_0063024_32_397 121
1303 3300046455 Ga0495603_0205860 Ga0495603_0205860_455_820 121
1304 3300046455 Ga0495603_0323113 Ga0495603_0323113_369_743 121
1305 3300046455 Ga0495603_0618801 Ga0495603_0618801_203_568 121
1306 3300046455 Ga0495603_0667937 Ga0495603_0667937_49_414 121
1307 3300046457 Ga0495590_0078639 Ga0495590_0078639_392_766 121
1308 3300046457 Ga0495590_0129365 Ga0495590_0129365_387_752 121
1309 3300046457 Ga0495590_0265856 Ga0495590_0265856_86_451 121
1310 3300046458 Ga0495591_093915 Ga0495591_093915_280_645 121
1311 3300046459 Ga0495629_0000181 Ga0495629_0000181_37604_37969 121
1312 3300046459 Ga0495629_0026471 Ga0495629_0026471_3271_3645 121
1313 3300046459 Ga0495629_0096249 Ga0495629_0096249_1135_1500 121
1314 3300046459 Ga0495629_0329397 Ga0495629_0329397_175_540 121
1315 3300046459 Ga0495629_0504118 Ga0495629_0504118_367_732 121
1316 3300046460 Ga0495638_0009594 Ga0495638_0009594_727_1092 121
1317 3300046460 Ga0495638_0122532 Ga0495638_0122532_906_1271 121
1318 3300046460 Ga0495638_0356008 Ga0495638_0356008_285_650 121
1319 3300046460 Ga0495638_0572123 Ga0495638_0572123_21_386 121
1320 3300046461 Ga0495641_0001499 Ga0495641_0001499_8440_8805 121
1321 3300046461 Ga0495641_0250807 Ga0495641_0250807_63_428 121
1322 3300046461 Ga0495641_0309271 Ga0495641_0309271_156_521 121
1323 3300046462 Ga0495651_0034560 Ga0495651_0034560_1463_1837 121
1324 3300046463 Ga0495653_0031775 Ga0495653_0031775_3593_3967 121
1325 3300046463 Ga0495653_0143164 Ga0495653_0143164_1238_1603 121
1326 3300046463 Ga0495653_0337590 Ga0495653_0337590_393_767 121
1327 3300046471 Ga0495650_0078066 Ga0495650_0078066_610_975 121
1328 3300046471 Ga0495650_0115316 Ga0495650_0115316_143_508 121
1329 3300046472 Ga0495580_0001467 Ga0495580_0001467_1472_1837 121
1330 3300046472 Ga0495580_0063846 Ga0495580_0063846_295_660 121
1331 3300046472 Ga0495580_0334737 Ga0495580_0334737_464_829 121
1332 3300046473 Ga0495582_0000039 Ga0495582_0000039_34555_34920 121
1333 3300046473 Ga0495582_0433269 Ga0495582_0433269_131_496 121
1334 3300046474 Ga0495605_0176195 Ga0495605_0176195_480_845 121
1335 3300046475 Ga0495639_0000489 Ga0495639_0000489_12917_13282 121
1336 3300046475 Ga0495639_0031876 Ga0495639_0031876_618_983 121
1337 3300046475 Ga0495639_0049551 Ga0495639_0049551_1133_1498 121
1338 3300046475 Ga0495639_0316490 Ga0495639_0316490_100_465 121
1339 3300046476 Ga0495662_0000343 Ga0495662_0000343_12311_12676 121
1340 3300046476 Ga0495662_0221448 Ga0495662_0221448_326_691 121
1341 3300046477 Ga0495664_0002664 Ga0495664_0002664_3886_4251 121
1342 3300046477 Ga0495664_0007350 Ga0495664_0007350_216_581 121
1343 3300046477 Ga0495664_0107854 Ga0495664_0107854_70_444 121
1344 3300046477 Ga0495664_0183729 Ga0495664_0183729_150_515 121
1345 3300046477 Ga0495664_0402126 Ga0495664_0402126_139_504 121
1346 3300046477 Ga0495664_0537935 Ga0495664_0537935_45_410 121
1347 3300046491 Ga0495584_0130199 Ga0495584_0130199_141_506 121
1348 3300046491 Ga0495584_0512257 Ga0495584_0512257_172_537 121
1349 3300046491 Ga0495584_0642228 Ga0495584_0642228_122_487 121
1350 3300046492 Ga0495585_0091525 Ga0495585_0091525_1076_1441 121
1351 3300046492 Ga0495585_0165821 Ga0495585_0165821_611_976 121
1352 3300046492 Ga0495585_0315699 Ga0495585_0315699_314_679 121
1353 3300046492 Ga0495585_0390440 Ga0495585_0390440_78_443 121
1354 3300046499 Ga0495594_0000619 Ga0495594_0000619_8060_8425 121
1355 3300046499 Ga0495594_0038266 Ga0495594_0038266_1866_2231 121
1356 3300046499 Ga0495594_0118635 Ga0495594_0118635_304_669 121
1357 3300046499 Ga0495594_0189332 Ga0495594_0189332_211_576 121
1358 3300046499 Ga0495594_0303961 Ga0495594_0303961_125_490 121
1359 3300046500 Ga0495596_0068936 Ga0495596_0068936_733_1098 121
1360 3300046501 Ga0495607_0113657 Ga0495607_0113657_487_852 121
1361 3300046501 Ga0495607_0260255 Ga0495607_0260255_26_391 121
1362 3300046506 Ga0495583_0132290 Ga0495583_0132290_314_688 121
1363 3300046506 Ga0495583_0144248 Ga0495583_0144248_541_906 121
1364 3300046506 Ga0495583_0325018 Ga0495583_0325018_105_470 121
1365 3300046507 Ga0495606_0233103 Ga0495606_0233103_301_666 121
1366 3300046507 Ga0495606_0268487 Ga0495606_0268487_11_376 121
1367 3300046507 Ga0495606_0298171 Ga0495606_0298171_152_526 121
1368 3300046511 Ga0495608_0111928 Ga0495608_0111928_810_1184 121
1369 3300046511 Ga0495608_0264021 Ga0495608_0264021_130_504 121
1370 3300046512 Ga0495610_0043579 Ga0495610_0043579_97_462 121
1371 3300046512 Ga0495610_0121716 Ga0495610_0121716_487_852 121
1372 3300046513 Ga0495616_0092338 Ga0495616_0092338_964_1329 121
1373 3300046513 Ga0495616_0159820 Ga0495616_0159820_171_536 121
1374 3300046513 Ga0495616_0235628 Ga0495616_0235628_17_382 121
1375 3300046514 Ga0495618_0038467 Ga0495618_0038467_2351_2716 121
1376 3300046515 Ga0495620_0057718 Ga0495620_0057718_863_1228 121
1377 3300046515 Ga0495620_0082866 Ga0495620_0082866_183_548 121
1378 3300046516 Ga0495628_0073295 Ga0495628_0073295_1911_2276 121
1379 3300046516 Ga0495628_0212146 Ga0495628_0212146_912_1277 121
1380 3300046516 Ga0495628_0217572 Ga0495628_0217572_359_724 121
1381 3300046516 Ga0495628_0433109 Ga0495628_0433109_367_732 121
1382 3300046516 Ga0495628_0527982 Ga0495628_0527982_297_671 121
1383 3300046517 Ga0495630_0001653 Ga0495630_0001653_10118_10483 121
1384 3300046517 Ga0495630_0015746 Ga0495630_0015746_5097_5462 121
1385 3300046517 Ga0495630_0509395 Ga0495630_0509395_81_446 121
1386 3300046518 Ga0495631_0053389 Ga0495631_0053389_666_1031 121
1387 3300046518 Ga0495631_0121277 Ga0495631_0121277_559_924 121
1388 3300046518 Ga0495631_0438174 Ga0495631_0438174_97_462 121
1389 3300046518 Ga0495631_0512031 Ga0495631_0512031_112_477 121
1390 3300046520 Ga0495637_0073275 Ga0495637_0073275_957_1322 121
1391 3300046522 Ga0495643_0032803 Ga0495643_0032803_1612_1977 121
1392 3300046522 Ga0495643_0225144 Ga0495643_0225144_13_378 121
1393 3300046522 Ga0495643_0394406 Ga0495643_0394406_181_546 121
1394 3300046523 Ga0495644_0029123 Ga0495644_0029123_545_910 121
1395 3300046523 Ga0495644_0167214 Ga0495644_0167214_408_773 121
1396 3300046523 Ga0495644_0343599 Ga0495644_0343599_93_458 121
1397 3300046524 Ga0495648_0002556 Ga0495648_0002556_10752_11117 121
1398 3300046524 Ga0495648_0004859 Ga0495648_0004859_10954_11319 121
1399 3300046524 Ga0495648_0088987 Ga0495648_0088987_636_1010 121
1400 3300046524 Ga0495648_0098432 Ga0495648_0098432_628_993 121
1401 3300046524 Ga0495648_0125201 Ga0495648_0125201_723_1088 121
1402 3300046524 Ga0495648_0156134 Ga0495648_0156134_457_822 121
1403 3300046525 Ga0495663_0099294 Ga0495663_0099294_207_572 121
1404 3300046525 Ga0495663_0300246 Ga0495663_0300246_104_469 121
1405 3300046526 Ga0495666_0003729 Ga0495666_0003729_1785_2150 121
1406 3300046526 Ga0495666_0053055 Ga0495666_0053055_435_800 121
1407 3300046526 Ga0495666_0107369 Ga0495666_0107369_525_890 121
1408 3300046528 Ga0495642_0279935 Ga0495642_0279935_75_440 121
1409 3300046528 Ga0495642_0412792 Ga0495642_0412792_43_408 121
1410 3300046529 Ga0495652_0074129 Ga0495652_0074129_308_682 121
1411 3300046529 Ga0495652_0138411 Ga0495652_0138411_41_406 121
1412 3300046529 Ga0495652_0192655 Ga0495652_0192655_1023_1388 121
1413 3300046529 Ga0495652_0586571 Ga0495652_0586571_301_666 121
1414 3300046530 Ga0495654_0070152 Ga0495654_0070152_1191_1556 121
1415 3300046530 Ga0495654_0303895 Ga0495654_0303895_19_384 121
1416 3300046531 Ga0495665_0000079 Ga0495665_0000079_23795_24160 121
1417 3300046531 Ga0495665_0194356 Ga0495665_0194356_615_980 121
1418 3300046531 Ga0495665_0500693 Ga0495665_0500693_170_544 121
1419 3300046533 Ga0495640_0003085 Ga0495640_0003085_10107_10472 121
1420 3300046533 Ga0495640_0009778 Ga0495640_0009778_3443_3808 121
1421 3300046533 Ga0495640_0101698 Ga0495640_0101698_351_725 121
1422 3300046533 Ga0495640_0230633 Ga0495640_0230633_688_1062 121
1423 3300046533 Ga0495640_0257977 Ga0495640_0257977_41_406 121
1424 3300046535 Ga0495586_0356199 Ga0495586_0356199_54_419 121
1425 3300046536 Ga0495587_0095791 Ga0495587_0095791_432_797 121
1426 3300046537 Ga0495598_0024134 Ga0495598_0024134_379_744 121
1427 3300046537 Ga0495598_0261654 Ga0495598_0261654_208_573 121
1428 3300046538 Ga0495609_0241387 Ga0495609_0241387_86_451 121
1429 3300046538 Ga0495609_0278685 Ga0495609_0278685_277_642 121
1430 3300046539 Ga0495621_0015968 Ga0495621_0015968_1942_2307 121
1431 3300046539 Ga0495621_0245217 Ga0495621_0245217_342_707 121
1432 3300046542 Ga0495597_0024560 Ga0495597_0024560_698_1063 121
1433 3300046543 Ga0495645_0026869 Ga0495645_0026869_347_721 121
1434 3300046543 Ga0495645_0145598 Ga0495645_0145598_684_1049 121
1435 3300046543 Ga0495645_0191461 Ga0495645_0191461_695_1060 121
1436 3300046557 Ga0495622_0000987 Ga0495622_0000987_306_671 121
1437 3300046557 Ga0495622_0042359 Ga0495622_0042359_1159_1533 121
1438 3300046557 Ga0495622_0054930 Ga0495622_0054930_793_1158 121
1439 3300046557 Ga0495622_0096896 Ga0495622_0096896_854_1219 121
1440 3300046557 Ga0495622_0136598 Ga0495622_0136598_457_822 121
1441 3300046557 Ga0495622_0234591 Ga0495622_0234591_251_616 121
1442 3300046558 Ga0495633_0067968 Ga0495633_0067968_562_927 121
1443 3300046558 Ga0495633_0167832 Ga0495633_0167832_162_527 121
1444 3300046559 Ga0495667_0006293 Ga0495667_0006293_1957_2322 121
1445 3300046559 Ga0495667_0056782 Ga0495667_0056782_1485_1859 121
1446 3300046559 Ga0495667_0167941 Ga0495667_0167941_545_910 121
1447 3300046615 Ga0495656_0220575 Ga0495656_0220575_308_673 121
1448 3300046615 Ga0495656_0643083 Ga0495656_0643083_41_406 121
1449 3300046616 Ga0495668_0009486 Ga0495668_0009486_214_579 121
1450 3300046616 Ga0495668_0290774 Ga0495668_0290774_195_560 121
1451 3300046616 Ga0495668_0335735 Ga0495668_0335735_191_556 121
1452 3300046616 Ga0495668_0675600 Ga0495668_0675600_113_478 121
1453 3300046642 Ga0495634_0004026 Ga0495634_0004026_8188_8553 121
1454 3300046642 Ga0495634_0089976 Ga0495634_0089976_1112_1477 121
1455 3300046642 Ga0495634_0122922 Ga0495634_0122922_347_721 121
1456 3300046642 Ga0495634_0184954 Ga0495634_0184954_465_839 121
1457 3300046648 Ga0495611_0058626 Ga0495611_0058626_196_561 121
1458 3300046648 Ga0495611_0063062 Ga0495611_0063062_1200_1565 121
1459 3300046648 Ga0495611_0591444 Ga0495611_0591444_90_455 121
1460 3300046660 Ga0495625_0117994 Ga0495625_0117994_1425_1790 121
1461 3300046660 Ga0495625_0133759 Ga0495625_0133759_630_995 121
1462 3300046660 Ga0495625_0163761 Ga0495625_0163761_528_896 121
1463 3300046660 Ga0495625_0301434 Ga0495625_0301434_644_1009 121
1464 3300046660 Ga0495625_0337774 Ga0495625_0337774_291_656 121
1465 3300046660 Ga0495625_0695992 Ga0495625_0695992_161_526 121
1466 3300046663 Ga0495635_0004998 Ga0495635_0004998_6777_7151 121
1467 3300046663 Ga0495635_0006922 Ga0495635_0006922_1174_1539 121
1468 3300046663 Ga0495635_0020339 Ga0495635_0020339_981_1346 121
1469 3300046663 Ga0495635_0834212 Ga0495635_0834212_129_494 121
1470 3300046664 Ga0495659_0031542 Ga0495659_0031542_485_850 121
1471 3300046664 Ga0495659_0133826 Ga0495659_0133826_571_936 121
1472 3300046665 Ga0495661_0352845 Ga0495661_0352845_25_390 121
1473 3300046665 Ga0495661_0597316 Ga0495661_0597316_77_442 121
1474 3300046674 Ga0495588_0008456 Ga0495588_0008456_411_776 121
1475 3300046674 Ga0495588_0071953 Ga0495588_0071953_430_795 121
1476 3300046674 Ga0495588_0106193 Ga0495588_0106193_313_678 121
1477 3300046674 Ga0495588_0156932 Ga0495588_0156932_391_756 121
1478 3300046674 Ga0495588_0199666 Ga0495588_0199666_215_589 121
1479 3300046674 Ga0495588_0267486 Ga0495588_0267486_182_547 121
1480 3300046674 Ga0495588_0272901 Ga0495588_0272901_406_771 121
1481 3300046674 Ga0495588_0715067 Ga0495588_0715067_128_493 121
1482 3300046675 Ga0495657_0042155 Ga0495657_0042155_79_453 121
1483 3300046675 Ga0495657_0047199 Ga0495657_0047199_1915_2289 121
1484 3300046678 Ga0495599_0012657 Ga0495599_0012657_430_795 121
1485 3300046678 Ga0495599_0061226 Ga0495599_0061226_884_1258 121
1486 3300046680 Ga0495646_0038525 Ga0495646_0038525_1628_1993 121
1487 3300046680 Ga0495646_0120188 Ga0495646_0120188_592_966 121
1488 3300046681 Ga0495647_0000562 Ga0495647_0000562_4729_5094 121
1489 3300046681 Ga0495647_0114159 Ga0495647_0114159_679_1044 121
1490 3300046681 Ga0495647_0551393 Ga0495647_0551393_64_429 121
1491 3300046683 Ga0495658_0000733 Ga0495658_0000733_2566_2931 121
1492 3300046683 Ga0495658_0018540 Ga0495658_0018540_2323_2688 121
1493 3300046683 Ga0495658_0483337 Ga0495658_0483337_295_669 121
1494 3300046684 Ga0495669_0012302 Ga0495669_0012302_3101_3466 121
1495 3300046684 Ga0495669_0041442 Ga0495669_0041442_1617_1982 121
1496 3300046684 Ga0495669_0053561 Ga0495669_0053561_643_1008 121
1497 3300046684 Ga0495669_0081198 Ga0495669_0081198_1040_1405 121
1498 3300046684 Ga0495669_0277938 Ga0495669_0277938_235_600 121
1499 3300046689 Ga0495613_0000543 Ga0495613_0000543_15684_16049 121
1500 3300046689 Ga0495613_0014301 Ga0495613_0014301_3772_4146 121
1501 3300046689 Ga0495613_0121804 Ga0495613_0121804_742_1107 121
1502 3300046689 Ga0495613_0159879 Ga0495613_0159879_1015_1380 121
1503 3300046689 Ga0495613_0289013 Ga0495613_0289013_307_681 121
1504 3300046690 Ga0495624_0006648 Ga0495624_0006648_6293_6658 121
1505 3300046690 Ga0495624_0039648 Ga0495624_0039648_2482_2847 121
1506 3300046690 Ga0495624_0056351 Ga0495624_0056351_975_1349 121
1507 3300046690 Ga0495624_0215206 Ga0495624_0215206_442_807 121
1508 3300046691 Ga0495670_0085783 Ga0495670_0085783_1069_1434 121
1509 3300046691 Ga0495670_0536036 Ga0495670_0536036_83_448 121
1510 3300046691 Ga0495670_0763446 Ga0495670_0763446_34_399 121
1511 3300046692 Ga0495671_0112377 Ga0495671_0112377_47_412 121
1512 3300046694 Ga0495649_0109123 Ga0495649_0109123_261_626 121
1513 3300046694 Ga0495649_0160422 Ga0495649_0160422_752_1117 121
1514 3300046694 Ga0495649_0331197 Ga0495649_0331197_283_648 121
1515 3300046694 Ga0495649_0409246 Ga0495649_0409246_33_398 121
1516 3300046794 Ga0495589_0129158 Ga0495589_0129158_580_945 121
1517 3300046794 Ga0495589_0194737 Ga0495589_0194737_578_943 121
1518 3300046794 Ga0495589_0446771 Ga0495589_0446771_214_579 121
1519 3300046794 Ga0495589_0557142 Ga0495589_0557142_41_406 121
1520 3300046809 Ga0495600_0104073 Ga0495600_0104073_678_1052 121
1521 3300046809 Ga0495600_0564172 Ga0495600_0564172_193_567 121
1522 3300046810 Ga0495660_0358492 Ga0495660_0358492_89_454 121
1523 3300047315 Ga0495581_0000024 Ga0495581_0000024_5661_6026 121
1524 3300047315 Ga0495581_0101334 Ga0495581_0101334_581_955 121
1525 3300047315 Ga0495581_0239724 Ga0495581_0239724_435_800 121
1526 3300047317 Ga0495604_0017775 Ga0495604_0017775_1274_1648 121
1527 3300047317 Ga0495604_0051100 Ga0495604_0051100_1199_1573 121
1528 3300047317 Ga0495604_0129697 Ga0495604_0129697_1151_1516 121
1529 3300047317 Ga0495604_0141596 Ga0495604_0141596_678_1043 121
1530 3300047317 Ga0495604_0886737 Ga0495604_0886737_87_452 121
1531 3300047319 Ga0495674_0001161 Ga0495674_0001161_23738_24103 121
1532 3300047319 Ga0495674_0091080 Ga0495674_0091080_1650_2024 121
1533 3300047319 Ga0495674_0120872 Ga0495674_0120872_1797_2162 121
1534 3300047319 Ga0495674_0197545 Ga0495674_0197545_1223_1588 121
1535 3300047319 Ga0495674_0349990 Ga0495674_0349990_108_473 121
1536 3300047319 Ga0495674_0660428 Ga0495674_0660428_349_714 121
1537 3300047320 Ga0495672_0017804 Ga0495672_0017804_2043_2408 121
1538 3300047320 Ga0495672_0051366 Ga0495672_0051366_353_718 121
1539 3300047320 Ga0495672_0097550 Ga0495672_0097550_523_888 121
1540 3300047321 Ga0495676_0040839 Ga0495676_0040839_1517_1882 121
1541 3300047321 Ga0495676_0154833 Ga0495676_0154833_339_713 121
1542 3300047322 Ga0495680_0008182 Ga0495680_0008182_4822_5196 121
1543 3300047322 Ga0495680_0373738 Ga0495680_0373738_56_421 121
1544 3300047322 Ga0495680_1010063 Ga0495680_1010063_149_514 121
1545 3300047323 Ga0495683_0123351 Ga0495683_0123351_355_720 121
1546 3300047323 Ga0495683_0197350 Ga0495683_0197350_266_631 121
1547 3300047443 Ga0495687_018321 Ga0495687_018321_736_1101 121
1548 3300047444 Ga0495675_0058711 Ga0495675_0058711_1859_2233 121
1549 3300047444 Ga0495675_0061217 Ga0495675_0061217_1712_2077 121
1550 3300047445 Ga0495677_0044541 Ga0495677_0044541_892_1257 121
1551 3300047447 Ga0495685_153467 Ga0495685_153467_210_575 121
1552 3300047469 Ga0495673_0020913 Ga0495673_0020913_2471_2836 121
1553 3300047469 Ga0495673_0037380 Ga0495673_0037380_1454_1819 121
1554 3300047469 Ga0495673_0048974 Ga0495673_0048974_174_539 121
1555 3300047469 Ga0495673_0062519 Ga0495673_0062519_494_859 121
1556 3300047469 Ga0495673_0083166 Ga0495673_0083166_362_727 121
1557 3300047469 Ga0495673_0090752 Ga0495673_0090752_546_911 121
1558 3300047470 Ga0495681_0068429 Ga0495681_0068429_17_382 121
1559 3300047471 Ga0495684_0009222 Ga0495684_0009222_3021_3386 121
1560 3300047471 Ga0495684_0025703 Ga0495684_0025703_1720_2085 121
1561 3300047471 Ga0495684_0123972 Ga0495684_0123972_1457_1831 121
1562 3300047472 Ga0495686_0065312 Ga0495686_0065312_1714_2079 121
1563 3300047472 Ga0495686_0216738 Ga0495686_0216738_423_788 121
1564 3300047673 Ga0495593_0000019 Ga0495593_0000019_60550_60915 121
1565 3300047673 Ga0495593_0023313 Ga0495593_0023313_2198_2572 121
1566 3300047673 Ga0495593_0078136 Ga0495593_0078136_1147_1512 121
1567 3300047673 Ga0495593_0415239 Ga0495593_0415239_228_593 121
1568 3300048088 Ga0495602_0042945 Ga0495602_0042945_2693_3067 121
1569 3300048088 Ga0495602_0346218 Ga0495602_0346218_102_467 121
1570 3300048088 Ga0495602_0346446 Ga0495602_0346446_614_988 121
1571 3300048089 Ga0495614_0003524 Ga0495614_0003524_1579_1944 121
1572 3300048089 Ga0495614_0140469 Ga0495614_0140469_442_807 121
1573 3300048089 Ga0495614_0490888 Ga0495614_0490888_82_447 121
1574 3300048090 Ga0495615_0259734 Ga0495615_0259734_62_427 121
1575 3300048903 Ga0496100_0020444 Ga0496100_0020444_1602_1967 121
1576 3300048903 Ga0496100_0029450 Ga0496100_0029450_1176_1541 121
1577 3300048903 Ga0496100_0159747 Ga0496100_0159747_241_606 121
1578 3300048903 Ga0496100_0325012 Ga0496100_0325012_463_828 121
1579 3300048903 Ga0496100_0373230 Ga0496100_0373230_700_1065 121
1580 3300048903 Ga0496100_0375138 Ga0496100_0375138_314_679 121
1581 3300048903 Ga0496100_0825864 Ga0496100_0825864_85_450 121
1582 3300048904 Ga0496101_0004532 Ga0496101_0004532_2192_2557 121
1583 3300048904 Ga0496101_0010276 Ga0496101_0010276_3207_3572 121
1584 3300048904 Ga0496101_0075808 Ga0496101_0075808_623_997 121
1585 3300048904 Ga0496101_0199933 Ga0496101_0199933_463_828 121
1586 3300048904 Ga0496101_0481795 Ga0496101_0481795_80_445 121
1587 3300048904 Ga0496101_0548328 Ga0496101_0548328_448_813 121
1588 3300048904 Ga0496101_0568716 Ga0496101_0568716_43_408 121
1589 3300048904 Ga0496101_0573018 Ga0496101_0573018_473_838 121
1590 3300048905 Ga0496102_0009611 Ga0496102_0009611_4980_5345 121
1591 3300048905 Ga0496102_0089830 Ga0496102_0089830_1838_2203 121
1592 3300048905 Ga0496102_0129157 Ga0496102_0129157_1739_2104 121
1593 3300048905 Ga0496102_0208546 Ga0496102_0208546_811_1176 121
1594 3300048905 Ga0496102_0272046 Ga0496102_0272046_169_534 121
1595 3300048905 Ga0496102_0323965 Ga0496102_0323965_464_829 121
1596 3300048905 Ga0496102_0341741 Ga0496102_0341741_691_1056 121
1597 3300048905 Ga0496102_0380041 Ga0496102_0380041_334_699 121
1598 3300048905 Ga0496102_0418036 Ga0496102_0418036_780_1145 121
1599 3300048905 Ga0496102_0666739 Ga0496102_0666739_100_465 121
1600 3300048905 Ga0496102_0710004 Ga0496102_0710004_510_875 121
1601 3300048905 Ga0496102_1034212 Ga0496102_1034212_213_578 121
1602 3300048905 Ga0496102_1193922 Ga0496102_1193922_118_483 121
1603 3300048905 Ga0496102_1216807 Ga0496102_1216807_90_455 121
1604 3300048905 Ga0496102_1699500 Ga0496102_1699500_133_498 121
1605 3300048906 Ga0496103_0021349 Ga0496103_0021349_1762_2127 121
1606 3300048906 Ga0496103_0157563 Ga0496103_0157563_512_877 121
1607 3300048906 Ga0496103_0165810 Ga0496103_0165810_670_1035 121
1608 3300048906 Ga0496103_0285776 Ga0496103_0285776_73_438 121
1609 3300048907 Ga0496104_0009587 Ga0496104_0009587_6365_6730 121
1610 3300048907 Ga0496104_0014513 Ga0496104_0014513_2594_2959 121
1611 3300048907 Ga0496104_0014678 Ga0496104_0014678_197_562 121
1612 3300048907 Ga0496104_0021951 Ga0496104_0021951_2558_2923 121
1613 3300048907 Ga0496104_0091129 Ga0496104_0091129_1492_1866 121
1614 3300048907 Ga0496104_0321942 Ga0496104_0321942_722_1087 121
1615 3300048907 Ga0496104_0439668 Ga0496104_0439668_635_1000 121
1616 3300048907 Ga0496104_1192104 Ga0496104_1192104_159_539 121
1617 3300048908 Ga0496105_0002708 Ga0496105_0002708_10519_10884 121
1618 3300048908 Ga0496105_0013076 Ga0496105_0013076_2839_3213 121
1619 3300048908 Ga0496105_0032830 Ga0496105_0032830_3314_3679 121
1620 3300048908 Ga0496105_0220271 Ga0496105_0220271_420_785 121
1621 3300048908 Ga0496105_0537766 Ga0496105_0537766_481_846 121
1622 3300048908 Ga0496105_1077999 Ga0496105_1077999_45_410 121
1623 3300048909 Ga0496106_0003207 Ga0496106_0003207_2442_2807 121
1624 3300048909 Ga0496106_0006039 Ga0496106_0006039_4326_4691 121
1625 3300048909 Ga0496106_0018657 Ga0496106_0018657_1693_2058 121
1626 3300048909 Ga0496106_0029256 Ga0496106_0029256_2936_3301 121
1627 3300048909 Ga0496106_0145610 Ga0496106_0145610_151_516 121
1628 3300048909 Ga0496106_0356026 Ga0496106_0356026_317_682 121
1629 3300048909 Ga0496106_0413195 Ga0496106_0413195_31_396 121
1630 3300048909 Ga0496106_0642329 Ga0496106_0642329_366_731 121
1631 3300048910 Ga0496107_0002095 Ga0496107_0002095_6841_7206 121
1632 3300048910 Ga0496107_0008466 Ga0496107_0008466_5084_5449 121
1633 3300048910 Ga0496107_0253852 Ga0496107_0253852_639_1004 121
1634 3300048910 Ga0496107_0365932 Ga0496107_0365932_486_851 121
1635 3300048910 Ga0496107_0373784 Ga0496107_0373784_86_451 121
1636 3300048910 Ga0496107_0658926 Ga0496107_0658926_242_607 121
1637 3300048911 Ga0496108_0110277 Ga0496108_0110277_1819_2184 121
1638 3300048911 Ga0496108_0134259 Ga0496108_0134259_1753_2118 121
1639 3300048911 Ga0496108_0256534 Ga0496108_0256534_43_408 121
1640 3300048911 Ga0496108_0404982 Ga0496108_0404982_655_1020 121
1641 3300048911 Ga0496108_0925492 Ga0496108_0925492_371_736 121
1642 3300048911 Ga0496108_1360054 Ga0496108_1360054_71_451 121
1643 3300048911 Ga0496108_1604092 Ga0496108_1604092_109_474 121
1644 3300048912 Ga0496109_0036779 Ga0496109_0036779_2248_2613 121
1645 3300048912 Ga0496109_0046847 Ga0496109_0046847_1471_1851 121
1646 3300048912 Ga0496109_0072226 Ga0496109_0072226_1561_1926 121
1647 3300048912 Ga0496109_0312146 Ga0496109_0312146_1076_1441 121
1648 3300048912 Ga0496109_0434667 Ga0496109_0434667_743_1108 121
1649 3300048913 Ga0496110_0049864 Ga0496110_0049864_2711_3076 121
1650 3300048913 Ga0496110_0104638 Ga0496110_0104638_1733_2098 121
1651 3300048913 Ga0496110_0186693 Ga0496110_0186693_103_468 121
1652 3300048913 Ga0496110_0326335 Ga0496110_0326335_642_1007 121
1653 3300048913 Ga0496110_0886357 Ga0496110_0886357_42_407 121
1654 3300048914 Ga0496111_0007619 Ga0496111_0007619_4507_4872 121
1655 3300048914 Ga0496111_0094947 Ga0496111_0094947_1118_1483 121
1656 3300048914 Ga0496111_0169739 Ga0496111_0169739_430_795 121
1657 3300048914 Ga0496111_0304276 Ga0496111_0304276_393_758 121
1658 3300048914 Ga0496111_0380164 Ga0496111_0380164_256_621 121
1659 3300048915 Ga0496112_0000142 Ga0496112_0000142_25131_25496 121
1660 3300048915 Ga0496112_0006785 Ga0496112_0006785_4236_4601 121
1661 3300048915 Ga0496112_0009986 Ga0496112_0009986_6743_7108 121
1662 3300048915 Ga0496112_0048503 Ga0496112_0048503_1523_1888 121
1663 3300048915 Ga0496112_0126707 Ga0496112_0126707_669_1034 121
1664 3300048915 Ga0496112_0139196 Ga0496112_0139196_603_968 121
1665 3300048915 Ga0496112_0511953 Ga0496112_0511953_729_1094 121
1666 3300048915 Ga0496112_0917188 Ga0496112_0917188_394_759 121
1667 3300048915 Ga0496112_0950595 Ga0496112_0950595_393_758 121
1668 3300048916 Ga0496113_0004839 Ga0496113_0004839_1818_2183 121
1669 3300048916 Ga0496113_0017042 Ga0496113_0017042_2606_2971 121
1670 3300048916 Ga0496113_0108009 Ga0496113_0108009_240_605 121
1671 3300048916 Ga0496113_0290303 Ga0496113_0290303_490_855 121
1672 3300048916 Ga0496113_0321488 Ga0496113_0321488_837_1202 121
1673 3300048916 Ga0496113_0673665 Ga0496113_0673665_278_652 121
1674 3300048917 Ga0496114_0029897 Ga0496114_0029897_2864_3229 121
1675 3300048917 Ga0496114_0085730 Ga0496114_0085730_1915_2280 121
1676 3300048917 Ga0496114_0142918 Ga0496114_0142918_374_739 121
1677 3300048917 Ga0496114_0226811 Ga0496114_0226811_790_1155 121
1678 3300048917 Ga0496114_0323900 Ga0496114_0323900_31_396 121
1679 3300048917 Ga0496114_0438542 Ga0496114_0438542_41_406 121
1680 3300048917 Ga0496114_1370654 Ga0496114_1370654_193_567 121
1681 3300048918 Ga0496115_0008444 Ga0496115_0008444_7065_7430 121
1682 3300048918 Ga0496115_0017339 Ga0496115_0017339_1179_1544 121
1683 3300048918 Ga0496115_0034316 Ga0496115_0034316_1344_1709 121
1684 3300048918 Ga0496115_0124043 Ga0496115_0124043_638_1003 121
1685 3300048918 Ga0496115_0241782 Ga0496115_0241782_663_1028 121
1686 3300048918 Ga0496115_0463012 Ga0496115_0463012_328_693 121
1687 3300048918 Ga0496115_0469357 Ga0496115_0469357_248_622 121
1688 3300048918 Ga0496115_1074825 Ga0496115_1074825_195_560 121
1689 3300048919 Ga0496116_0049903 Ga0496116_0049903_641_1006 121
1690 3300048919 Ga0496116_0117670 Ga0496116_0117670_811_1182 121
1691 3300048919 Ga0496116_0223207 Ga0496116_0223207_71_436 121
1692 3300048919 Ga0496116_0439558 Ga0496116_0439558_60_425 121
1693 3300048920 Ga0496117_0019227 Ga0496117_0019227_4999_5364 121
1694 3300048920 Ga0496117_0064198 Ga0496117_0064198_1680_2051 121
1695 3300048920 Ga0496117_0132591 Ga0496117_0132591_520_885 121
1696 3300048920 Ga0496117_0169117 Ga0496117_0169117_589_954 121
1697 3300048920 Ga0496117_0220670 Ga0496117_0220670_642_1007 121
1698 3300048920 Ga0496117_0239331 Ga0496117_0239331_129_494 121
1699 3300048920 Ga0496117_0339337 Ga0496117_0339337_84_449 121
1700 3300048921 Ga0496118_0008409 Ga0496118_0008409_2420_2785 121
1701 3300048921 Ga0496118_0052322 Ga0496118_0052322_1970_2335 121
1702 3300048921 Ga0496118_0070455 Ga0496118_0070455_1279_1650 121
1703 3300048921 Ga0496118_0112306 Ga0496118_0112306_138_503 121
1704 3300048921 Ga0496118_0182500 Ga0496118_0182500_358_732 121
1705 3300048921 Ga0496118_0409147 Ga0496118_0409147_233_598 121
1706 3300048921 Ga0496118_0559443 Ga0496118_0559443_122_487 121
1707 3300048922 Ga0496119_0044246 Ga0496119_0044246_1924_2298 121
1708 3300048922 Ga0496119_0078320 Ga0496119_0078320_890_1255 121
1709 3300048923 Ga0496120_0007337 Ga0496120_0007337_1167_1541 121
1710 3300048923 Ga0496120_0078523 Ga0496120_0078523_908_1273 121
1711 3300048923 Ga0496120_0102455 Ga0496120_0102455_446_817 121
1712 3300048924 Ga0496121_0000221 Ga0496121_0000221_30098_30472 121
1713 3300048924 Ga0496121_0000365 Ga0496121_0000365_49547_49912 121
1714 3300048924 Ga0496121_0001293 Ga0496121_0001293_2417_2782 121
1715 3300048924 Ga0496121_0005804 Ga0496121_0005804_12717_13082 121
1716 3300048924 Ga0496121_0005812 Ga0496121_0005812_14006_14371 121
1717 3300048924 Ga0496121_0052411 Ga0496121_0052411_2382_2747 121
1718 3300048924 Ga0496121_0127644 Ga0496121_0127644_238_603 121
1719 3300048924 Ga0496121_0168558 Ga0496121_0168558_337_702 121
1720 3300048924 Ga0496121_0259923 Ga0496121_0259923_189_554 121
1721 3300048924 Ga0496121_0310485 Ga0496121_0310485_18_392 121
1722 3300048924 Ga0496121_0344754 Ga0496121_0344754_492_857 121
1723 3300048924 Ga0496121_0464329 Ga0496121_0464329_407_772 121
1724 3300048924 Ga0496121_0750172 Ga0496121_0750172_115_480 121
1725 3300048924 Ga0496121_0813933 Ga0496121_0813933_64_429 121
1726 3300048925 Ga0496122_0019295 Ga0496122_0019295_1533_1898 121
1727 3300048925 Ga0496122_0125363 Ga0496122_0125363_584_949 121
1728 3300048925 Ga0496122_0170955 Ga0496122_0170955_138_503 121
1729 3300048926 Ga0496123_0050852 Ga0496123_0050852_371_736 121
1730 3300048927 Ga0496124_0002671 Ga0496124_0002671_1070_1435 121
1731 3300048927 Ga0496124_0085140 Ga0496124_0085140_913_1278 121
1732 3300048927 Ga0496124_0310015 Ga0496124_0310015_460_825 121
1733 3300048928 Ga0496125_0018856 Ga0496125_0018856_4721_5086 121
1734 3300048928 Ga0496125_0019036 Ga0496125_0019036_136_501 121
1735 3300048928 Ga0496125_0056031 Ga0496125_0056031_109_474 121
1736 3300048928 Ga0496125_0061650 Ga0496125_0061650_2605_2970 121
1737 3300048928 Ga0496125_0198508 Ga0496125_0198508_56_421 121
1738 3300048929 Ga0496126_0001612 Ga0496126_0001612_2126_2491 121
1739 3300048929 Ga0496126_0009177 Ga0496126_0009177_8699_9064 121
1740 3300048929 Ga0496126_0023193 Ga0496126_0023193_3481_3846 121
1741 3300048929 Ga0496126_0054516 Ga0496126_0054516_2404_2769 121
1742 3300048929 Ga0496126_0074388 Ga0496126_0074388_833_1198 121
1743 3300048929 Ga0496126_0078076 Ga0496126_0078076_2127_2498 121
1744 3300048929 Ga0496126_0080901 Ga0496126_0080901_1473_1847 121
1745 3300048929 Ga0496126_0093679 Ga0496126_0093679_1786_2151 121
1746 3300048929 Ga0496126_0100547 Ga0496126_0100547_1757_2122 121
1747 3300048929 Ga0496126_0135659 Ga0496126_0135659_1193_1558 121
1748 3300048929 Ga0496126_0179139 Ga0496126_0179139_681_1046 121
1749 3300048929 Ga0496126_0318897 Ga0496126_0318897_239_604 121
1750 3300048929 Ga0496126_0357452 Ga0496126_0357452_665_1039 121
1751 3300048929 Ga0496126_0384848 Ga0496126_0384848_707_1072 121
1752 3300048929 Ga0496126_0398787 Ga0496126_0398787_592_957 121
1753 3300048929 Ga0496126_0570780 Ga0496126_0570780_55_420 121
1754 3300048929 Ga0496126_0587538 Ga0496126_0587538_306_671 121
1755 3300048929 Ga0496126_1119713 Ga0496126_1119713_147_512 121
1756 3300049459 Ga0495678_042737 Ga0495678_042737_1276_1641 121
1757 3300049460 Ga0495682_0099152 Ga0495682_0099152_563_928 121
1758 3300049460 Ga0495682_0227744 Ga0495682_0227744_228_593 121
1759 3300049460 Ga0495682_0266300 Ga0495682_0266300_154_528 121
1760 3300049460 Ga0495682_0281499 Ga0495682_0281499_190_555 121
1761 3300049568 Ga0501031_0198369 Ga0501031_0198369_693_1058 121
1762 3300049568 Ga0501031_0201817 Ga0501031_0201817_683_1048 121
1763 3300049568 Ga0501031_0269712 Ga0501031_0269712_474_839 121
1764 3300049569 Ga0501032_0014139 Ga0501032_0014139_3175_3540 121
1765 3300049569 Ga0501032_0072883 Ga0501032_0072883_1229_1594 121
1766 3300049569 Ga0501032_0120880 Ga0501032_0120880_582_947 121
1767 3300049570 Ga0501033_0018372 Ga0501033_0018372_1120_1485 121
1768 3300049570 Ga0501033_0072403 Ga0501033_0072403_1204_1569 121
1769 3300049570 Ga0501033_0089241 Ga0501033_0089241_1624_1989 121
1770 3300049570 Ga0501033_0198215 Ga0501033_0198215_220_585 121
1771 3300049570 Ga0501033_0325495 Ga0501033_0325495_466_831 121
1772 3300049570 Ga0501033_0456047 Ga0501033_0456047_234_599 121
1773 3300049571 Ga0501034_0029876 Ga0501034_0029876_1701_2066 121
1774 3300049571 Ga0501034_0051508 Ga0501034_0051508_2261_2626 121
1775 3300049571 Ga0501034_0076670 Ga0501034_0076670_1045_1410 121
1776 3300049571 Ga0501034_0127654 Ga0501034_0127654_942_1307 121
1777 3300049571 Ga0501034_0130450 Ga0501034_0130450_1565_1930 121
1778 3300049571 Ga0501034_0187640 Ga0501034_0187640_1438_1803 121
1779 3300049571 Ga0501034_0286335 Ga0501034_0286335_915_1283 121
1780 3300049572 Ga0501036_0130240 Ga0501036_0130240_756_1121 121
1781 3300049572 Ga0501036_0150317 Ga0501036_0150317_1024_1389 121
1782 3300049572 Ga0501036_0158697 Ga0501036_0158697_617_982 121
1783 3300049572 Ga0501036_0338565 Ga0501036_0338565_379_744 121
1784 3300049572 Ga0501036_0404601 Ga0501036_0404601_761_1126 121
1785 3300049573 Ga0501037_0024204 Ga0501037_0024204_3972_4337 121
1786 3300049573 Ga0501037_0099222 Ga0501037_0099222_1133_1498 121
1787 3300049573 Ga0501037_0212826 Ga0501037_0212826_122_487 121
1788 3300049573 Ga0501037_0401235 Ga0501037_0401235_124_489 121
1789 3300049573 Ga0501037_0573889 Ga0501037_0573889_213_578 121
1790 3300049573 Ga0501037_1048488 Ga0501037_1048488_145_510 121
1791 3300049574 Ga0501038_0164206 Ga0501038_0164206_1284_1649 121
1792 3300049574 Ga0501038_0284266 Ga0501038_0284266_237_602 121
1793 3300049574 Ga0501038_0464710 Ga0501038_0464710_24_389 121
1794 3300049574 Ga0501038_0583103 Ga0501038_0583103_72_437 121
1795 3300049575 Ga0501039_0075802 Ga0501039_0075802_1315_1680 121
1796 3300049575 Ga0501039_0143126 Ga0501039_0143126_244_609 121
1797 3300049575 Ga0501039_0260038 Ga0501039_0260038_731_1096 121
1798 3300049576 Ga0501040_0021329 Ga0501040_0021329_18_383 121
1799 3300049577 Ga0501041_0194479 Ga0501041_0194479_176_541 121
1800 3300049578 Ga0501042_0231619 Ga0501042_0231619_506_871 121
1801 3300049578 Ga0501042_0312633 Ga0501042_0312633_49_414 121
1802 3300049579 Ga0501043_0018518 Ga0501043_0018518_2714_3079 121
1803 3300049579 Ga0501043_0018792 Ga0501043_0018792_4793_5158 121
1804 3300049579 Ga0501043_0341172 Ga0501043_0341172_213_578 121
1805 3300049579 Ga0501043_0363216 Ga0501043_0363216_104_469 121
1806 3300049580 Ga0501046_0036035 Ga0501046_0036035_1419_1784 121
1807 3300049580 Ga0501046_0108943 Ga0501046_0108943_1283_1648 121
1808 3300049580 Ga0501046_0233471 Ga0501046_0233471_828_1196 121
1809 3300049581 Ga0501047_0008451 Ga0501047_0008451_8678_9043 121
1810 3300049581 Ga0501047_0124677 Ga0501047_0124677_1178_1543 121
1811 3300049581 Ga0501047_0481812 Ga0501047_0481812_186_551 121
1812 3300049581 Ga0501047_1324072 Ga0501047_1324072_154_519 121
1813 3300049582 Ga0501048_0028074 Ga0501048_0028074_2225_2590 121
1814 3300049583 Ga0501067_0021403 Ga0501067_0021403_1717_2082 121
1815 3300049583 Ga0501067_0046127 Ga0501067_0046127_1638_2003 121
1816 3300049583 Ga0501067_0584534 Ga0501067_0584534_58_423 121
1817 3300049584 Ga0501068_0025230 Ga0501068_0025230_3013_3378 121
1818 3300049584 Ga0501068_0324512 Ga0501068_0324512_161_526 121
1819 3300049585 Ga0501069_0022072 Ga0501069_0022072_2338_2703 121
1820 3300049585 Ga0501069_0456452 Ga0501069_0456452_286_651 121
1821 3300049585 Ga0501069_0596458 Ga0501069_0596458_85_450 121
1822 3300049585 Ga0501069_0871642 Ga0501069_0871642_59_424 121
1823 3300049586 Ga0501070_0125601 Ga0501070_0125601_561_926 121
1824 3300049586 Ga0501070_0164843 Ga0501070_0164843_579_944 121
1825 3300049586 Ga0501070_0271587 Ga0501070_0271587_379_744 121
1826 3300049586 Ga0501070_0478767 Ga0501070_0478767_502_867 121
1827 3300049586 Ga0501070_0973018 Ga0501070_0973018_18_383 121
1828 3300049586 Ga0501070_1215909 Ga0501070_1215909_86_451 121
1829 3300049586 Ga0501070_1335692 Ga0501070_1335692_121_486 121
1830 3300049587 Ga0501071_0041872 Ga0501071_0041872_1110_1475 121
1831 3300049587 Ga0501071_0224990 Ga0501071_0224990_96_461 121
1832 3300049588 Ga0501072_0008410 Ga0501072_0008410_3484_3849 121
1833 3300049589 Ga0501073_0045956 Ga0501073_0045956_837_1202 121
1834 3300049589 Ga0501073_0097002 Ga0501073_0097002_961_1326 121
1835 3300049589 Ga0501073_0145857 Ga0501073_0145857_200_565 121
1836 3300049590 Ga0501074_0659113 Ga0501074_0659113_241_606 121
1837 3300049592 Ga0501076_0220427 Ga0501076_0220427_220_585 121
1838 3300049593 Ga0501077_0046293 Ga0501077_0046293_1092_1457 121
1839 3300049741 Ga0501079_0073394 Ga0501079_0073394_870_1235 121
1840 3300049741 Ga0501079_0704273 Ga0501079_0704273_396_761 121
1841 3300049742 Ga0501080_0030857 Ga0501080_0030857_969_1334 121
1842 3300049742 Ga0501080_0147179 Ga0501080_0147179_104_469 121
1843 3300049742 Ga0501080_0154727 Ga0501080_0154727_875_1240 121
1844 3300049742 Ga0501080_0604375 Ga0501080_0604375_587_952 121
1845 3300049743 Ga0501081_0062666 Ga0501081_0062666_1090_1455 121
1846 3300049743 Ga0501081_0330659 Ga0501081_0330659_235_600 121
1847 3300049822 Ga0501035_0051610 Ga0501035_0051610_2493_2858 121
1848 3300049822 Ga0501035_0056002 Ga0501035_0056002_1103_1468 121
1849 3300049822 Ga0501035_0072618 Ga0501035_0072618_1033_1401 121
1850 3300049822 Ga0501035_0193170 Ga0501035_0193170_591_956 121
1851 3300049823 Ga0501044_0008204 Ga0501044_0008204_7181_7546 121
1852 3300049823 Ga0501044_0009213 Ga0501044_0009213_399_764 121
1853 3300049823 Ga0501044_0043044 Ga0501044_0043044_2398_2763 121
1854 3300049823 Ga0501044_0160361 Ga0501044_0160361_816_1181 121
1855 3300049823 Ga0501044_0435537 Ga0501044_0435537_257_622 121
1856 3300049824 Ga0501045_0020077 Ga0501045_0020077_3544_3909 121
1857 3300049824 Ga0501045_0135403 Ga0501045_0135403_572_937 121
1858 3300050489 nmdc:mga03683_167172_c1 nmdc:mga03683_167172_c1_218_583 121
1859 3300050489 nmdc:mga03683_269600_c1 nmdc:mga03683_269600_c1_70_435 121
1860 3300050489 nmdc:mga03683_270889_c1 nmdc:mga03683_270889_c1_228_593 121
1861 3300050489 nmdc:mga03683_359252_c1 nmdc:mga03683_359252_c1_15_380 121
1862 3300050489 nmdc:mga03683_534536_c1 nmdc:mga03683_534536_c1_164_529 121
1863 3300050489 nmdc:mga03683_581804_c1 nmdc:mga03683_581804_c1_164_529 121
1864 3300050490 nmdc:mga03n38_1841_c1 nmdc:mga03n38_1841_c1_4620_4985 121
1865 3300050490 nmdc:mga03n38_21432_c1 nmdc:mga03n38_21432_c1_655_1020 121
1866 3300050490 nmdc:mga03n38_53405_c1 nmdc:mga03n38_53405_c1_318_683 121
1867 3300050490 nmdc:mga03n38_66814_c1 nmdc:mga03n38_66814_c1_854_1219 121
1868 3300050491 nmdc:mga00v17_134798_c1 nmdc:mga00v17_134798_c1_1120_1485 121
1869 3300050491 nmdc:mga00v17_162975_c1 nmdc:mga00v17_162975_c1_937_1302 121
1870 3300050491 nmdc:mga00v17_403989_c1 nmdc:mga00v17_403989_c1_481_846 121
1871 3300050491 nmdc:mga00v17_58269_c1 nmdc:mga00v17_58269_c1_1854_2219 121
1872 3300050492 nmdc:mga0yw44_108567_c1 nmdc:mga0yw44_108567_c1_755_1120 121
1873 3300050492 nmdc:mga0yw44_115170_c1 nmdc:mga0yw44_115170_c1_1205_1570 121
1874 3300050492 nmdc:mga0yw44_1218032_c1 nmdc:mga0yw44_1218032_c1_29_460 121
1875 3300050492 nmdc:mga0yw44_355487_c1 nmdc:mga0yw44_355487_c1_209_574 121
1876 3300050492 nmdc:mga0yw44_612951_c1 nmdc:mga0yw44_612951_c1_22_387 121
1877 3300050492 nmdc:mga0yw44_626702_c1 nmdc:mga0yw44_626702_c1_62_427 121
1878 3300050492 nmdc:mga0yw44_64077_c1 nmdc:mga0yw44_64077_c1_1230_1595 121
1879 3300050492 nmdc:mga0yw44_721487_c1 nmdc:mga0yw44_721487_c1_76_441 121
1880 3300050492 nmdc:mga0yw44_731195_c1 nmdc:mga0yw44_731195_c1_262_627 121
1881 3300050492 nmdc:mga0yw44_80485_c1 nmdc:mga0yw44_80485_c1_480_845 121
1882 3300050493 nmdc:mga0k408_116939_c1 nmdc:mga0k408_116939_c1_1077_1442 121
1883 3300050493 nmdc:mga0k408_176479_c1 nmdc:mga0k408_176479_c1_869_1234 121
1884 3300050493 nmdc:mga0k408_281867_c1 nmdc:mga0k408_281867_c1_312_677 121
1885 3300050493 nmdc:mga0k408_299560_c1 nmdc:mga0k408_299560_c1_233_598 121
1886 3300050493 nmdc:mga0k408_85015_c1 nmdc:mga0k408_85015_c1_89_454 121
1887 3300050494 nmdc:mga06z11_12290_c1 nmdc:mga06z11_12290_c1_1571_1936 121
1888 3300050494 nmdc:mga06z11_171882_c1 nmdc:mga06z11_171882_c1_450_815 121
1889 3300050494 nmdc:mga06z11_173619_c1 nmdc:mga06z11_173619_c1_13_378 121
1890 3300050494 nmdc:mga06z11_28342_c1 nmdc:mga06z11_28342_c1_1213_1578 121
1891 3300050494 nmdc:mga06z11_357025_c1 nmdc:mga06z11_357025_c1_158_523 121
1892 3300050494 nmdc:mga06z11_389790_c1 nmdc:mga06z11_389790_c1_144_509 121
1893 3300050494 nmdc:mga06z11_416901_c1 nmdc:mga06z11_416901_c1_30_395 121
1894 3300050494 nmdc:mga06z11_45947_c1 nmdc:mga06z11_45947_c1_902_1267 121
1895 3300050494 nmdc:mga06z11_525265_c1 nmdc:mga06z11_525265_c1_136_501 121
1896 3300050495 nmdc:mga04h51_179964_c1 nmdc:mga04h51_179964_c1_209_574 121
1897 3300050495 nmdc:mga04h51_205924_c1 nmdc:mga04h51_205924_c1_370_735 121
1898 3300050495 nmdc:mga04h51_242357_c1 nmdc:mga04h51_242357_c1_225_590 121
1899 3300050495 nmdc:mga04h51_84180_c1 nmdc:mga04h51_84180_c1_92_457 121
1900 3300050496 nmdc:mga07m45_114066_c1 nmdc:mga07m45_114066_c1_990_1355 121
1901 3300050496 nmdc:mga07m45_158126_c1 nmdc:mga07m45_158126_c1_634_999 121
1902 3300050496 nmdc:mga07m45_19367_c1 nmdc:mga07m45_19367_c1_2094_2459 121
1903 3300050496 nmdc:mga07m45_297378_c1 nmdc:mga07m45_297378_c1_227_601 121
1904 3300050496 nmdc:mga07m45_55283_c1 nmdc:mga07m45_55283_c1_311_676 121
1905 3300050496 nmdc:mga07m45_599194_c1 nmdc:mga07m45_599194_c1_240_605 121
1906 3300050496 nmdc:mga07m45_66972_c1 nmdc:mga07m45_66972_c1_802_1167 121
1907 3300050496 nmdc:mga07m45_763100_c1 nmdc:mga07m45_763100_c1_137_502 121
1908 3300050496 nmdc:mga07m45_7723_c1 nmdc:mga07m45_7723_c1_2807_3172 121
1909 3300050507 nmdc:mga05p37_145109_c1 nmdc:mga05p37_145109_c1_851_1216 121
1910 3300050507 nmdc:mga05p37_2092563_c1 nmdc:mga05p37_2092563_c1_154_519 121
1911 3300050508 nmdc:mga09592_679646_c1 nmdc:mga09592_679646_c1_392_757 121
1912 3300050509 nmdc:mga0qj67_187067_c1 nmdc:mga0qj67_187067_c1_29_394 121
1913 3300050511 nmdc:mga08y16_821765_c1 nmdc:mga08y16_821765_c1_289_654 121
1914 3300050512 nmdc:mga0n895_431346_c1 nmdc:mga0n895_431346_c1_486_851 121
1915 3300050513 nmdc:mga0rr50_94735_c1 nmdc:mga0rr50_94735_c1_298_663 121
1916 3300050515 nmdc:mga0a205_157818_c1 nmdc:mga0a205_157818_c1_1656_2021 121
1917 3300050516 nmdc:mga0sz30_13149_c1 nmdc:mga0sz30_13149_c1_556_921 121
1918 3300050516 nmdc:mga0sz30_145628_c1 nmdc:mga0sz30_145628_c1_57_422 121
1919 3300050516 nmdc:mga0sz30_21231_c2 nmdc:mga0sz30_21231_c2_413_778 121
1920 3300050516 nmdc:mga0sz30_215343_c1 nmdc:mga0sz30_215343_c1_100_465 121
1921 3300050516 nmdc:mga0sz30_226095_c1 nmdc:mga0sz30_226095_c1_134_499 121
1922 3300050516 nmdc:mga0sz30_82852_c1 nmdc:mga0sz30_82852_c1_915_1280 121
1923 3300053077 Ga0495601_0112862 Ga0495601_0112862_594_959 121
1924 3300053077 Ga0495601_0222298 Ga0495601_0222298_488_853 121
1925 3300053077 Ga0495601_0243806 Ga0495601_0243806_413_778 121
1926 3300053078 Ga0495612_0013700 Ga0495612_0013700_1790_2155 121
1927 3300053078 Ga0495612_0109903 Ga0495612_0109903_641_1006 121
1928 3300053079 Ga0500610_0303834 Ga0500610_0303834_92_457 121
1929 3300053079 Ga0500610_0428140 Ga0500610_0428140_41_406 121
1930 3300053080 Ga0500635_0001213 Ga0500635_0001213_1649_2014 121
1931 3300053080 Ga0500635_0284343 Ga0500635_0284343_20_385 121
1932 3300053083 Ga0495655_0044181 Ga0495655_0044181_36_410 121
1933 3300053083 Ga0495655_0189143 Ga0495655_0189143_197_562 121
1934 3300053084 Ga0495595_0143395 Ga0495595_0143395_50_415 121
1935 3300053085 Ga0495619_0211036 Ga0495619_0211036_57_431 121
1936 3300053085 Ga0495619_0552000 Ga0495619_0552000_155_529 121
1937 3300053086 Ga0500578_0081194 Ga0500578_0081194_1186_1551 121
1938 3300053086 Ga0500578_0108041 Ga0500578_0108041_528_893 121
1939 3300053086 Ga0500578_0382313 Ga0500578_0382313_52_417 121
1940 3300053087 Ga0500643_000042 Ga0500643_000042_51850_52215 121
1941 3300053087 Ga0500643_224451 Ga0500643_224451_89_454 121
1942 3300053088 Ga0500644_0045629 Ga0500644_0045629_701_1066 121
1943 3300053092 Ga0500583_0046184 Ga0500583_0046184_863_1228 121
1944 3300053092 Ga0500583_0125348 Ga0500583_0125348_685_1050 121
1945 3300053093 Ga0500651_0000628 Ga0500651_0000628_16105_16470 121
1946 3300053093 Ga0500651_0153849 Ga0500651_0153849_606_971 121
1947 3300053094 Ga0500566_0026880 Ga0500566_0026880_2867_3232 121
1948 3300053094 Ga0500566_0428635 Ga0500566_0428635_191_556 121
1949 3300053094 Ga0500566_0532268 Ga0500566_0532268_11_376 121
1950 3300053096 Ga0500641_0010282 Ga0500641_0010282_2560_2925 121
1951 3300053096 Ga0500641_0044466 Ga0500641_0044466_24_389 121
1952 3300053096 Ga0500641_0059365 Ga0500641_0059365_532_897 121
1953 3300053096 Ga0500641_0067877 Ga0500641_0067877_159_524 121
1954 3300053097 Ga0500648_036088 Ga0500648_036088_2222_2587 121
1955 3300053098 Ga0500650_0323244 Ga0500650_0323244_80_445 121
1956 3300053099 Ga0500654_164771 Ga0500654_164771_163_528 121
1957 3300053102 Ga0500554_045258 Ga0500554_045258_289_654 121
1958 3300053103 Ga0500555_000735 Ga0500555_000735_1003_1368 121
1959 3300053103 Ga0500555_019657 Ga0500555_019657_292_657 121
1960 3300053104 Ga0500556_0004619 Ga0500556_0004619_2293_2658 121
1961 3300053106 Ga0500558_070584 Ga0500558_070584_1032_1397 121
1962 3300053108 Ga0500562_031716 Ga0500562_031716_289_654 121
1963 3300053109 Ga0500569_019439 Ga0500569_019439_628_993 121
1964 3300053109 Ga0500569_141199 Ga0500569_141199_276_641 121
1965 3300053116 Ga0500592_037057 Ga0500592_037057_377_742 121
1966 3300053118 Ga0500594_0075582 Ga0500594_0075582_460_825 121
1967 3300053119 Ga0500595_003957 Ga0500595_003957_6264_6629 121
1968 3300053119 Ga0500595_009190 Ga0500595_009190_2535_2906 121
1969 3300053119 Ga0500595_034703 Ga0500595_034703_588_953 121
1970 3300053119 Ga0500595_035518 Ga0500595_035518_121_486 121
1971 3300053119 Ga0500595_035816 Ga0500595_035816_776_1141 121
1972 3300053119 Ga0500595_151313 Ga0500595_151313_177_548 121
1973 3300053124 Ga0500617_136715 Ga0500617_136715_301_666 121
1974 3300053130 Ga0500642_0022271 Ga0500642_0022271_390_755 121
1975 3300053130 Ga0500642_0105216 Ga0500642_0105216_721_1086 121
1976 3300053130 Ga0500642_0184531 Ga0500642_0184531_586_951 121
1977 3300053130 Ga0500642_0342224 Ga0500642_0342224_116_481 121
1978 3300053130 Ga0500642_0379414 Ga0500642_0379414_188_553 121
1979 3300053134 Ga0500658_0037343 Ga0500658_0037343_804_1169 121
1980 3300053134 Ga0500658_0157707 Ga0500658_0157707_262_627 121
1981 3300053136 Ga0500559_0031655 Ga0500559_0031655_1012_1377 121
1982 3300053136 Ga0500559_0148736 Ga0500559_0148736_541_915 121
1983 3300053137 Ga0500561_0009191 Ga0500561_0009191_257_622 121
1984 3300053139 Ga0500568_0003788 Ga0500568_0003788_7693_8058 121
1985 3300053139 Ga0500568_0056943 Ga0500568_0056943_803_1168 121
1986 3300053139 Ga0500568_0127282 Ga0500568_0127282_105_470 121
1987 3300053139 Ga0500568_0209033 Ga0500568_0209033_22_387 121
1988 3300053140 Ga0500573_0025465 Ga0500573_0025465_2238_2603 121
1989 3300053141 Ga0500574_219006 Ga0500574_219006_85_450 121
1990 3300053142 Ga0500577_0000545 Ga0500577_0000545_8423_8788 121
1991 3300053144 Ga0500585_067408 Ga0500585_067408_121_486 121
1992 3300053146 Ga0500588_0102452 Ga0500588_0102452_501_866 121
1993 3300053147 Ga0500589_106325 Ga0500589_106325_645_1010 121
1994 3300053147 Ga0500589_158557 Ga0500589_158557_506_871 121
1995 3300053147 Ga0500589_251655 Ga0500589_251655_212_577 121
1996 3300053148 Ga0500590_261082 Ga0500590_261082_31_405 121
1997 3300053150 Ga0500603_000400 Ga0500603_000400_1003_1368 121
1998 3300053150 Ga0500603_050379 Ga0500603_050379_512_877 121
1999 3300053150 Ga0500603_099696 Ga0500603_099696_152_517 121
2000 3300053151 Ga0500604_0016250 Ga0500604_0016250_1039_1404 121
2001 3300053153 Ga0500616_0000048 Ga0500616_0000048_92588_92959 121
2002 3300053156 Ga0500622_0012774 Ga0500622_0012774_2969_3334 121
2003 3300053156 Ga0500622_0412359 Ga0500622_0412359_58_423 121
2004 3300053158 Ga0500627_0247775 Ga0500627_0247775_309_674 121
2005 3300053160 Ga0500633_0065795 Ga0500633_0065795_879_1244 121
2006 3300053161 Ga0500634_0036445 Ga0500634_0036445_34_399 121
2007 3300053161 Ga0500634_0237939 Ga0500634_0237939_125_490 121
2008 3300053162 Ga0500638_107729 Ga0500638_107729_665_1030 121
2009 3300053162 Ga0500638_213645 Ga0500638_213645_177_542 121
2010 3300053162 Ga0500638_233150 Ga0500638_233150_280_645 121
2011 3300053163 Ga0500639_089484 Ga0500639_089484_708_1073 121
2012 3300053177 Ga0500636_0139657 Ga0500636_0139657_112_477 121
2013 3300053177 Ga0500636_0423344 Ga0500636_0423344_19_384 121
2014 3300053178 Ga0500637_0001951 Ga0500637_0001951_7894_8259 121
2015 3300053178 Ga0500637_0171763 Ga0500637_0171763_231_605 121
2016 3300053178 Ga0500637_0355367 Ga0500637_0355367_182_547 121
2017 3300053727 Ga0500611_081987 Ga0500611_081987_253_618 121
2018 3300053727 Ga0500611_200808 Ga0500611_200808_89_454 121
2019 3300053730 Ga0500645_042505 Ga0500645_042505_267_632 121
2020 3300053730 Ga0500645_104554 Ga0500645_104554_245_610 121
2021 3300053730 Ga0500645_109345 Ga0500645_109345_61_426 121
2022 3300053731 Ga0500609_004989 Ga0500609_004989_1363_1728 121
2023 3300053731 Ga0500609_014421 Ga0500609_014421_650_1015 121
2024 3300053732 Ga0500656_008183 Ga0500656_008183_657_1022 121
2025 3300053735 Ga0500596_017117 Ga0500596_017117_434_799 121
2026 3300053735 Ga0500596_021342 Ga0500596_021342_474_848 121
2027 3300053736 Ga0500599_006905 Ga0500599_006905_825_1190 121
2028 3300053737 Ga0500601_000682 Ga0500601_000682_1946_2311 121
2029 3300054114 Ga0501084_0013841 Ga0501084_0013841_2664_3029 121
2030 3300054114 Ga0501084_0512371 Ga0501084_0512371_160_525 121
2031 3300055283 Ga0500661_006979 Ga0500661_006979_741_1106 121
2032 3300060353 Ga0501082_0154093 Ga0501082_0154093_1468_1833 121
2033 3300061719 Ga0466962_0633959 Ga0466962_0633959_78_443 121
2034 iso_pu_bacteria 2824653114 2824658968 121
2035 iso_pu_bacteria 2824661429 2824668479 121
2036 iso_pu_bacteria 2879099564 2879105327 121
2037 iso_pu_bacteria 2885409591 2885410119 121
2038 iso_pu_bacteria 2932784394 2932789449 121
2039 iso_pu_bacteria 2932809354 2932816498 121
2040 iso_pu_bacteria 2932818245 2932827381 121
2041 iso_pu_bacteria 2935638405 2935643995 121
2042 iso_pu_bacteria 2935665750 2935669090 121
2043 iso_pu_bacteria 2935675223 2935683352 121
2044 iso_pu_bacteria 2935703347 2935708835 121
2045 iso_pu_bacteria 2935760218 2935767473 121
2046 iso_pu_bacteria 2935801545 2935805806 121
2047 iso_pu_bacteria 2935810662 2935815636 121
2048 iso_pu_bacteria 2935827899 2935833247 121
2049 iso_pu_bacteria 2935992306 2935998172 121
2050 iso_pu_bacteria 2936037263 2936040874 121
2051 iso_pu_bacteria 2941538514 2941544724 121
2052 iso_pu_bacteria 8056673599 8056675916 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

119

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8303 2 118
4ntm-assembly1.cif.gz_A qued soaked with sepiapterin (selenomethionine substituted protein) 0.8229 2 118
2oba-assembly1.cif.gz_D pseudomonas aeruginosa 6-pyruvoyl tetrahydrobiopterin synthase 0.8226 2 119
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8087 2 118
2dtt-assembly2.cif.gz_E crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8081 2 118
ID Description Score Start End Superfamily
af_C8YR32_1924_2056_2.60.60.20 Mainly Beta;Sandwich;Lipoxygenase-1;PLAT/LH2 domain 0.854 100 118 2.60.60.20
af_C8YR32_407_533_2.60.60.20 Mainly Beta;Sandwich;Lipoxygenase-1;PLAT/LH2 domain 0.8501 98 118 2.60.60.20
af_Q9VJS0_1349_1463_2.60.60.20 Mainly Beta;Sandwich;Lipoxygenase-1;PLAT/LH2 domain 0.8257 96 116 2.60.60.20
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8173 1 118 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.817 2 119 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A522A5E9-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.8847 2 119 GO:0008616
GO:0046872
GO:0070497
AF-A0A5E4V7J0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.8832 2 121 GO:0046872
GO:0070497
AF-A0A3D5RP83-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.8814 2 119 GO:0008616
GO:0046872
GO:0070497
AF-A0A2S6RR08-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.8801 2 119 GO:0008616
GO:0046872
GO:0070497
AF-A0A4R1MVI0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.88 2 120 GO:0046872
GO:0070497

Feature Viewer

pLDDT pTM Quality
89.96 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map