F496317

General Info

Members Datasets Scaffolds Average Seq Length
2051 456 2051 180

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100140538|Ga0075430_1001405383
Length 222
Sequence MAKDDETGAAQAKPEKEKAPAAKKGGGKKADAGPAPKYKRETPPRLKLTYDSSVKPTMMKEFNYTSVMEVPRIVKITINMGLGRANQDPKIIDNAVEELKLISGQAPVVCKAKKDIATYKLRKGQKIGVMVTLRRERMWEFLDRLCNIALPRVRDFRGVSPRGFDGRGNYTLGLKDQLLFPEIDYMKVDKARGMNISVITTAKTDQESRKLLQLLGMPFRAS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
117 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
220 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
221 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
222 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
231 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
232 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
233 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
234 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
243 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
244 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
245 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
246 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
247 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
248 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
254 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
255 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
258 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
260 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
261 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
264 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
269 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
270 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
271 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
272 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
274 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
275 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
280 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
281 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
282 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
283 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
284 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
285 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
286 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
287 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
288 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
289 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
290 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
291 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
292 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
293 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
294 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
295 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
296 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
297 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
298 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
299 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
300 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
301 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
315 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
321 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
322 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
323 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
324 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
325 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
326 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
327 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
328 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
329 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
330 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
331 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
334 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
335 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
339 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
340 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
343 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
346 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
347 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
348 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
349 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
350 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
351 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
352 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
353 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
354 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
355 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
356 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
357 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
358 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
359 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
360 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
361 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
362 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
363 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
364 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
365 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
366 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
367 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
368 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
369 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
370 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
371 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
372 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
375 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
376 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
377 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
378 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
379 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
380 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
381 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
382 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
383 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
384 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
400 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
401 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
402 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
403 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
404 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
405 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
406 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
407 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
408 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
409 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
410 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
411 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
412 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
413 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
414 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
415 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
416 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
417 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
418 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
419 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
420 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
421 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
424 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
425 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
426 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
427 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
428 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
429 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
430 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
431 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
432 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
433 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
434 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
435 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
436 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
437 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
438 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
439 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
440 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
441 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
442 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
443 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
444 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
445 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
446 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
447 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
448 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
449 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
456 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 1.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 4.53
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001976 3300001977 Bacteria 3268
2 JGI24745J21846_1002440 3300002073 Bacteria 1901
3 JGI24751J29686_10012861 3300002459 Bacteria 1727
4 JGI25406J46586_10002509 3300003203 Bacteria 8686
5 JGI25406J46586_10005813 3300003203 Bacteria 5709
6 JGI25406J46586_10039381 3300003203 Bacteria 1685
7 Ga0058859_11652582 3300004798 Bacteria 1422
8 Ga0058859_11697584 3300004798 Bacteria 770
9 Ga0058859_11813068 3300004798 Bacteria 3066
10 Ga0058863_11802767 3300004799 Bacteria 3937
11 Ga0058861_11903853 3300004800 Bacteria 3158
12 Ga0058861_12002312 3300004800 Bacteria 1545
13 Ga0058862_12487049 3300004803 Bacteria 2257
14 Ga0058862_12700202 3300004803 Bacteria 3069
15 Ga0065714_10083257 3300005288 Bacteria 2260
16 Ga0065704_10090418 3300005289 Bacteria 2789
17 Ga0065704_10096947 3300005289 Bacteria 2413
18 Ga0065704_10239005 3300005289 Bacteria 1017
19 Ga0065712_10001330 3300005290 Bacteria 7767
20 Ga0065712_10004633 3300005290 Bacteria 3547
21 Ga0065712_10010087 3300005290 Bacteria 2162
22 Ga0065712_10013832 3300005290 Bacteria 1904
23 Ga0065712_10015667 3300005290 Bacteria 2059
24 Ga0065712_10022058 3300005290 Bacteria 1938
25 Ga0065712_10086260 3300005290 Bacteria 2645
26 Ga0065712_10086282 3300005290 Bacteria 2636
27 Ga0065712_10087066 3300005290 Bacteria 2599
28 Ga0065712_10114021 3300005290 Bacteria 1773
29 Ga0065712_10146821 3300005290 Bacteria 1402
30 Ga0065712_10150444 3300005290 Bacteria 1374
31 Ga0065712_10154514 3300005290 Bacteria 1345
32 Ga0065712_10176922 3300005290 Bacteria 1213
33 Ga0065712_10288576 3300005290 Bacteria 882
34 Ga0065712_10483187 3300005290 Bacteria 659
35 Ga0065712_10490958 3300005290 Bacteria 648
36 Ga0065715_10001104 3300005293 Bacteria 7452
37 Ga0065715_10032215 3300005293 Bacteria 1646
38 Ga0065715_10048432 3300005293 Bacteria 1047
39 Ga0065715_10093177 3300005293 Bacteria 4779
40 Ga0065715_10101878 3300005293 Bacteria 3162
41 Ga0065715_10124592 3300005293 Bacteria 2150
42 Ga0065715_10138442 3300005293 Bacteria 1888
43 Ga0065715_10143176 3300005293 Bacteria 1824
44 Ga0065715_10152554 3300005293 Bacteria 1712
45 Ga0065715_10175760 3300005293 Bacteria 1513
46 Ga0065715_10323194 3300005293 Bacteria 998
47 Ga0065715_10615396 3300005293 Bacteria 689
48 Ga0065715_10800436 3300005293 Bacteria 610
49 Ga0065707_10008221 3300005295 Bacteria 3499
50 Ga0065707_10013069 3300005295 Bacteria 1857
51 Ga0065707_10031519 3300005295 Bacteria 1493
52 Ga0065707_10089023 3300005295 Bacteria 4482
53 Ga0065707_10259744 3300005295 Bacteria 1100
54 Ga0065707_10373731 3300005295 Bacteria 886
55 Ga0070658_10015417 3300005327 Bacteria 6115
56 Ga0070658_10042651 3300005327 Bacteria 3665
57 Ga0070658_10436821 3300005327 Bacteria 1127
58 Ga0070676_10007044 3300005328 Bacteria 6019
59 Ga0070676_10048987 3300005328 Bacteria 2471
60 Ga0070676_10055003 3300005328 Bacteria 2348
61 Ga0070676_10141326 3300005328 Bacteria 1533
62 Ga0070683_100000726 3300005329 Bacteria 24102
63 Ga0070683_100263794 3300005329 Bacteria 1638
64 Ga0070683_100358473 3300005329 Bacteria 1389
65 Ga0070690_100009989 3300005330 Bacteria 5510
66 Ga0070690_100022497 3300005330 Bacteria 3856
67 Ga0070690_100028596 3300005330 Bacteria 3453
68 Ga0070690_100030373 3300005330 Bacteria 3357
69 Ga0070690_100080654 3300005330 Bacteria 2128
70 Ga0070690_100291890 3300005330 Bacteria 1166
71 Ga0070690_100292770 3300005330 Bacteria 1165
72 Ga0070690_100494982 3300005330 Bacteria 914
73 Ga0070670_100014012 3300005331 Bacteria 6875
74 Ga0070670_100048150 3300005331 Bacteria 3668
75 Ga0070670_100073134 3300005331 Bacteria 2945
76 Ga0070670_100200994 3300005331 Bacteria 1731
77 Ga0070670_100233025 3300005331 Bacteria 1602
78 Ga0070670_100325326 3300005331 Bacteria 1348
79 Ga0070670_100328550 3300005331 Bacteria 1341
80 Ga0070670_100333402 3300005331 Bacteria 1331
81 Ga0070670_100606716 3300005331 Bacteria 980
82 Ga0070670_100860500 3300005331 Bacteria 820
83 Ga0070670_101281521 3300005331 Bacteria 671
84 Ga0070677_10008644 3300005333 Bacteria 3433
85 Ga0070677_10039428 3300005333 Bacteria 1854
86 Ga0070677_10169573 3300005333 Bacteria 1031
87 Ga0068869_100038779 3300005334 Bacteria 3398
88 Ga0068869_100069288 3300005334 Bacteria 2607
89 Ga0068869_100353204 3300005334 Bacteria 1199
90 Ga0068869_100386929 3300005334 Bacteria 1147
91 Ga0070666_10043493 3300005335 Bacteria 3008
92 Ga0070666_10057819 3300005335 Bacteria 2621
93 Ga0070666_10060248 3300005335 Bacteria 2568
94 Ga0070666_10063054 3300005335 Bacteria 2512
95 Ga0070666_10085832 3300005335 Bacteria 2156
96 Ga0070666_10090128 3300005335 Bacteria 2106
97 Ga0070666_10100165 3300005335 Bacteria 1996
98 Ga0070666_10179183 3300005335 Bacteria 1486
99 Ga0070666_10453953 3300005335 Bacteria 926
100 Ga0070680_100279366 3300005336 Bacteria 1415
101 Ga0070680_100715689 3300005336 Bacteria 862
102 Ga0070682_100202203 3300005337 Bacteria 1402
103 Ga0070682_100302902 3300005337 Bacteria 1174
104 Ga0070682_100307955 3300005337 Bacteria 1165
105 Ga0070682_100482456 3300005337 Bacteria 957
106 Ga0068868_100005009 3300005338 Bacteria 9304
107 Ga0068868_100356176 3300005338 Bacteria 1254
108 Ga0068868_100468354 3300005338 Bacteria 1099
109 Ga0068868_100483574 3300005338 Bacteria 1082
110 Ga0068868_100626199 3300005338 Bacteria 956
111 Ga0068868_101157180 3300005338 Bacteria 714
112 Ga0068868_101267815 3300005338 Bacteria 683
113 Ga0070660_100002987 3300005339 Bacteria 11642
114 Ga0070660_100132985 3300005339 Bacteria 1992
115 Ga0070660_100133779 3300005339 Bacteria 1986
116 Ga0070660_100262357 3300005339 Bacteria 1411
117 Ga0070660_100422000 3300005339 Bacteria 1105
118 Ga0070660_100551215 3300005339 Bacteria 962
119 Ga0070660_100949620 3300005339 Bacteria 726
120 Ga0070689_100018609 3300005340 Bacteria 5120
121 Ga0070689_100022608 3300005340 Bacteria 4697
122 Ga0070689_100084047 3300005340 Bacteria 2501
123 Ga0070689_100086922 3300005340 Bacteria 2459
124 Ga0070689_100121928 3300005340 Bacteria 2083
125 Ga0070689_100176877 3300005340 Bacteria 1731
126 Ga0070689_100279762 3300005340 Bacteria 1384
127 Ga0070689_100324827 3300005340 Bacteria 1286
128 Ga0070689_100764418 3300005340 Bacteria 848
129 Ga0070691_10495163 3300005341 Bacteria 705
130 Ga0070687_100004670 3300005343 Bacteria 5477
131 Ga0070687_100038411 3300005343 Bacteria 2399
132 Ga0070661_100021520 3300005344 Bacteria 4608
133 Ga0070661_100113077 3300005344 Bacteria 2029
134 Ga0070692_10249592 3300005345 Bacteria 1062
135 Ga0070692_10329552 3300005345 Bacteria 942
136 Ga0070668_100026838 3300005347 Bacteria 4372
137 Ga0070668_100045349 3300005347 Bacteria 3373
138 Ga0070668_100081579 3300005347 Bacteria 2536
139 Ga0070668_100144142 3300005347 Bacteria 1922
140 Ga0070668_101009541 3300005347 Bacteria 748
141 Ga0070669_100004188 3300005353 Bacteria 10451
142 Ga0070669_100042463 3300005353 Bacteria 3309
143 Ga0070669_100058143 3300005353 Bacteria 2837
144 Ga0070669_100172802 3300005353 Bacteria 1686
145 Ga0070669_100249215 3300005353 Bacteria 1414
146 Ga0070669_100410662 3300005353 Bacteria 1109
147 Ga0070669_100450671 3300005353 Bacteria 1060
148 Ga0070669_100523023 3300005353 Bacteria 986
149 Ga0070669_101391644 3300005353 Bacteria 609
150 Ga0070675_100000056 3300005354 Bacteria 66985
151 Ga0070675_100004981 3300005354 Bacteria 10137
152 Ga0070675_100007191 3300005354 Bacteria 8578
153 Ga0070675_100014470 3300005354 Bacteria 6222
154 Ga0070675_100047087 3300005354 Bacteria 3533
155 Ga0070675_100059893 3300005354 Bacteria 3142
156 Ga0070675_100166730 3300005354 Bacteria 1897
157 Ga0070675_100294023 3300005354 Bacteria 1430
158 Ga0070675_100306716 3300005354 Bacteria 1400
159 Ga0070675_100380406 3300005354 Bacteria 1256
160 Ga0070675_100389016 3300005354 Bacteria 1242
161 Ga0070675_100631599 3300005354 Bacteria 973
162 Ga0070675_101096753 3300005354 Bacteria 732
163 Ga0070671_100006715 3300005355 Bacteria 9208
164 Ga0070671_100030813 3300005355 Bacteria 4427
165 Ga0070671_100038853 3300005355 Bacteria 3950
166 Ga0070671_100396422 3300005355 Bacteria 1180
167 Ga0070671_100585490 3300005355 Bacteria 964
168 Ga0070674_100012403 3300005356 Bacteria 5234
169 Ga0070674_100015034 3300005356 Bacteria 4823
170 Ga0070674_100017363 3300005356 Bacteria 4525
171 Ga0070674_100058550 3300005356 Bacteria 2679
172 Ga0070674_100107399 3300005356 Bacteria 2043
173 Ga0070674_100240751 3300005356 Bacteria 1416
174 Ga0070674_100291814 3300005356 Bacteria 1297
175 Ga0070674_100353505 3300005356 Bacteria 1187
176 Ga0070674_100619355 3300005356 Bacteria 917
177 Ga0070674_100809547 3300005356 Bacteria 810
178 Ga0070673_100003427 3300005364 Bacteria 9877
179 Ga0070673_100003685 3300005364 Bacteria 9600
180 Ga0070673_100004781 3300005364 Bacteria 8602
181 Ga0070673_100076736 3300005364 Bacteria 2699
182 Ga0070673_100087145 3300005364 Bacteria 2544
183 Ga0070673_100113486 3300005364 Bacteria 2250
184 Ga0070673_100139260 3300005364 Bacteria 2045
185 Ga0070673_100184535 3300005364 Bacteria 1787
186 Ga0070673_100218993 3300005364 Bacteria 1647
187 Ga0070673_100999743 3300005364 Bacteria 779
188 Ga0070688_100003817 3300005365 Bacteria 7811
189 Ga0070688_100109264 3300005365 Bacteria 1836
190 Ga0070688_100144675 3300005365 Bacteria 1618
191 Ga0070688_100240525 3300005365 Bacteria 1284
192 Ga0070688_100279150 3300005365 Bacteria 1199
193 Ga0070688_101059510 3300005365 Bacteria 647
194 Ga0070659_100089158 3300005366 Bacteria 2471
195 Ga0070659_100099878 3300005366 Bacteria 2335
196 Ga0070659_100402441 3300005366 Bacteria 1156
197 Ga0070659_100677164 3300005366 Bacteria 891
198 Ga0070659_100818252 3300005366 Bacteria 811
199 Ga0070667_100021149 3300005367 Bacteria 5405
200 Ga0070667_100429831 3300005367 Bacteria 1205
201 Ga0070709_10126229 3300005434 Bacteria 1741
202 Ga0070709_10354014 3300005434 Bacteria 1086
203 Ga0070713_100038750 3300005436 Bacteria 3864
204 Ga0070701_10002134 3300005438 Bacteria 7524
205 Ga0070701_10010126 3300005438 Bacteria 4157
206 Ga0070701_10037717 3300005438 Bacteria 2442
207 Ga0070701_10071971 3300005438 Bacteria 1850
208 Ga0070705_100000175 3300005440 Bacteria 37567
209 Ga0070705_100016300 3300005440 Bacteria 3860
210 Ga0070705_100046000 3300005440 Bacteria 2514
211 Ga0070705_100072344 3300005440 Bacteria 2088
212 Ga0070705_100117943 3300005440 Bacteria 1708
213 Ga0070705_100422634 3300005440 Bacteria 993
214 Ga0070705_100477989 3300005440 Bacteria 941
215 Ga0070705_100848858 3300005440 Bacteria 730
216 Ga0070705_100905553 3300005440 Bacteria 710
217 Ga0070700_100083063 3300005441 Bacteria 2073
218 Ga0070700_100155953 3300005441 Bacteria 1567
219 Ga0070700_100168624 3300005441 Bacteria 1514
220 Ga0070700_100246816 3300005441 Bacteria 1278
221 Ga0070700_100451229 3300005441 Bacteria 978
222 Ga0070700_100684258 3300005441 Bacteria 813
223 Ga0070700_100744596 3300005441 Bacteria 784
224 Ga0070700_101302678 3300005441 Bacteria 611
225 Ga0070694_100035253 3300005444 Bacteria 3306
226 Ga0070694_100065559 3300005444 Bacteria 2488
227 Ga0070694_100087142 3300005444 Bacteria 2183
228 Ga0070694_100170396 3300005444 Bacteria 1603
229 Ga0070694_100179568 3300005444 Bacteria 1565
230 Ga0070694_100236819 3300005444 Bacteria 1375
231 Ga0070694_100397193 3300005444 Bacteria 1079
232 Ga0070694_100431780 3300005444 Bacteria 1037
233 Ga0070694_100479385 3300005444 Bacteria 987
234 Ga0070694_101200109 3300005444 Bacteria 636
235 Ga0070663_100014660 3300005455 Bacteria 5036
236 Ga0070663_100016120 3300005455 Bacteria 4841
237 Ga0070663_100176463 3300005455 Bacteria 1655
238 Ga0070663_100340531 3300005455 Bacteria 1211
239 Ga0070663_100789046 3300005455 Bacteria 814
240 Ga0070678_100004485 3300005456 Bacteria 7921
241 Ga0070678_100018711 3300005456 Bacteria 4496
242 Ga0070678_100021999 3300005456 Bacteria 4215
243 Ga0070678_100093315 3300005456 Bacteria 2314
244 Ga0070678_100398239 3300005456 Bacteria 1195
245 Ga0070678_100452352 3300005456 Bacteria 1125
246 Ga0070678_100682865 3300005456 Bacteria 924
247 Ga0070662_100119484 3300005457 Bacteria 2018
248 Ga0070662_100160770 3300005457 Bacteria 1757
249 Ga0070662_100180021 3300005457 Bacteria 1666
250 Ga0070662_100277763 3300005457 Bacteria 1355
251 Ga0070662_100965511 3300005457 Bacteria 729
252 Ga0070681_10006387 3300005458 Bacteria 11462
253 Ga0070681_10019826 3300005458 Bacteria 6735
254 Ga0070681_10317074 3300005458 Bacteria 1468
255 Ga0068867_100006640 3300005459 Bacteria 8180
256 Ga0068867_100007115 3300005459 Bacteria 7904
257 Ga0068867_100035655 3300005459 Bacteria 3609
258 Ga0068867_100043874 3300005459 Bacteria 3274
259 Ga0068867_100140074 3300005459 Bacteria 1890
260 Ga0068867_100152486 3300005459 Bacteria 1816
261 Ga0068867_100200698 3300005459 Bacteria 1596
262 Ga0068867_100236074 3300005459 Bacteria 1480
263 Ga0068867_100272874 3300005459 Bacteria 1384
264 Ga0068867_100410978 3300005459 Bacteria 1144
265 Ga0068867_100416751 3300005459 Bacteria 1137
266 Ga0068867_100847126 3300005459 Bacteria 819
267 Ga0070685_10039495 3300005466 Bacteria 2681
268 Ga0070685_10137020 3300005466 Bacteria 1537
269 Ga0070685_10161503 3300005466 Bacteria 1429
270 Ga0070685_10314335 3300005466 Bacteria 1060
271 Ga0070707_100037632 3300005468 Bacteria 4618
272 Ga0070707_100055271 3300005468 Bacteria 3806
273 Ga0070707_100092768 3300005468 Bacteria 2923
274 Ga0070707_100525239 3300005468 Bacteria 1145
275 Ga0070707_100995231 3300005468 Bacteria 804
276 Ga0070698_100003045 3300005471 Bacteria 18470
277 Ga0070698_100010970 3300005471 Bacteria 9640
278 Ga0070698_100104205 3300005471 Bacteria 2806
279 Ga0070698_100212166 3300005471 Bacteria 1870
280 Ga0070698_100632824 3300005471 Bacteria 1011
281 Ga0070698_100767527 3300005471 Bacteria 907
282 Ga0070698_101074902 3300005471 Bacteria 753
283 Ga0070698_101525887 3300005471 Bacteria 620
284 Ga0070699_100000410 3300005518 Bacteria 41278
285 Ga0070699_100029345 3300005518 Bacteria 4743
286 Ga0070699_100036688 3300005518 Bacteria 4240
287 Ga0070699_100042387 3300005518 Bacteria 3939
288 Ga0070699_100259813 3300005518 Bacteria 1553
289 Ga0070699_100350568 3300005518 Bacteria 1330
290 Ga0070699_100444068 3300005518 Bacteria 1176
291 Ga0070679_100039507 3300005530 Bacteria 4690
292 Ga0070679_100136935 3300005530 Bacteria 2430
293 Ga0070679_100156213 3300005530 Bacteria 2256
294 Ga0070679_100585881 3300005530 Bacteria 1059
295 Ga0070684_100000236 3300005535 Bacteria 38259
296 Ga0070684_100010407 3300005535 Bacteria 7368
297 Ga0070684_100033356 3300005535 Bacteria 4395
298 Ga0070684_100182829 3300005535 Bacteria 1906
299 Ga0070684_100586644 3300005535 Bacteria 1036
300 Ga0070697_100052802 3300005536 Bacteria 3303
301 Ga0070697_101001287 3300005536 Bacteria 743
302 Ga0068853_100653780 3300005539 Bacteria 1001
303 Ga0068853_101318573 3300005539 Bacteria 698
304 Ga0070672_100072531 3300005543 Bacteria 2741
305 Ga0070672_100087900 3300005543 Bacteria 2501
306 Ga0070672_100089719 3300005543 Bacteria 2477
307 Ga0070672_100164673 3300005543 Bacteria 1841
308 Ga0070672_100296948 3300005543 Bacteria 1369
309 Ga0070672_100300275 3300005543 Bacteria 1361
310 Ga0070672_100326621 3300005543 Bacteria 1305
311 Ga0070672_100417882 3300005543 Bacteria 1151
312 Ga0070672_100429670 3300005543 Bacteria 1135
313 Ga0070686_100002243 3300005544 Bacteria 10661
314 Ga0070686_100024325 3300005544 Bacteria 3629
315 Ga0070686_100025770 3300005544 Bacteria 3541
316 Ga0070686_100091793 3300005544 Bacteria 2032
317 Ga0070686_100331513 3300005544 Bacteria 1138
318 Ga0070686_100391372 3300005544 Bacteria 1055
319 Ga0070686_100451177 3300005544 Bacteria 989
320 Ga0070686_100484766 3300005544 Bacteria 957
321 Ga0070695_100026046 3300005545 Bacteria 3615
322 Ga0070695_100026423 3300005545 Bacteria 3591
323 Ga0070695_100036049 3300005545 Bacteria 3111
324 Ga0070695_100057812 3300005545 Bacteria 2506
325 Ga0070695_100092951 3300005545 Bacteria 2018
326 Ga0070695_100151132 3300005545 Bacteria 1621
327 Ga0070695_100177809 3300005545 Bacteria 1506
328 Ga0070695_100188657 3300005545 Bacteria 1466
329 Ga0070695_100189520 3300005545 Bacteria 1462
330 Ga0070695_100523190 3300005545 Bacteria 921
331 Ga0070696_100012605 3300005546 Bacteria 5675
332 Ga0070696_100017137 3300005546 Bacteria 4889
333 Ga0070696_100026481 3300005546 Bacteria 3945
334 Ga0070696_100041141 3300005546 Bacteria 3192
335 Ga0070696_100227938 3300005546 Bacteria 1401
336 Ga0070696_100269265 3300005546 Bacteria 1295
337 Ga0070696_100273812 3300005546 Bacteria 1284
338 Ga0070696_100278315 3300005546 Bacteria 1275
339 Ga0070696_100451269 3300005546 Bacteria 1015
340 Ga0070696_100481187 3300005546 Bacteria 984
341 Ga0070696_100584512 3300005546 Bacteria 899
342 Ga0070693_100467060 3300005547 Bacteria 889
343 Ga0070693_100554615 3300005547 Bacteria 823
344 Ga0070665_100004733 3300005548 Bacteria 14164
345 Ga0070665_100035338 3300005548 Bacteria 5024
346 Ga0070665_100043431 3300005548 Bacteria 4518
347 Ga0070665_100144040 3300005548 Bacteria 2386
348 Ga0070665_100277846 3300005548 Bacteria 1676
349 Ga0070665_101101356 3300005548 Bacteria 806
350 Ga0070665_101545969 3300005548 Bacteria 672
351 Ga0070704_100000751 3300005549 Bacteria 15957
352 Ga0070704_100014117 3300005549 Bacteria 4980
353 Ga0070704_100030754 3300005549 Bacteria 3601
354 Ga0070704_100064034 3300005549 Bacteria 2641
355 Ga0070704_100458103 3300005549 Bacteria 1099
356 Ga0070704_100798777 3300005549 Bacteria 843
357 Ga0070704_101058830 3300005549 Bacteria 735
358 Ga0068855_100066908 3300005563 Bacteria 4188
359 Ga0068855_100126724 3300005563 Bacteria 2919
360 Ga0068855_100356691 3300005563 Bacteria 1610
361 Ga0068855_100560640 3300005563 Bacteria 1236
362 Ga0070664_100001147 3300005564 Bacteria 20989
363 Ga0070664_100006932 3300005564 Bacteria 9130
364 Ga0070664_100007621 3300005564 Bacteria 8741
365 Ga0070664_100010409 3300005564 Bacteria 7543
366 Ga0070664_100014134 3300005564 Bacteria 6512
367 Ga0070664_100040264 3300005564 Bacteria 3939
368 Ga0070664_100156320 3300005564 Bacteria 2015
369 Ga0070664_100245421 3300005564 Bacteria 1608
370 Ga0070664_100270055 3300005564 Bacteria 1532
371 Ga0070664_100305071 3300005564 Bacteria 1439
372 Ga0070664_100355912 3300005564 Bacteria 1333
373 Ga0068857_100071414 3300005577 Bacteria 3092
374 Ga0068857_100215215 3300005577 Bacteria 1754
375 Ga0068857_100217670 3300005577 Bacteria 1744
376 Ga0068857_100371095 3300005577 Bacteria 1327
377 Ga0068857_100722156 3300005577 Bacteria 948
378 Ga0068854_100052991 3300005578 Bacteria 2911
379 Ga0068854_100074177 3300005578 Bacteria 2495
380 Ga0068854_100095480 3300005578 Bacteria 2219
381 Ga0068854_100135180 3300005578 Bacteria 1887
382 Ga0068856_100161829 3300005614 Bacteria 2249
383 Ga0068856_100644651 3300005614 Bacteria 1080
384 Ga0068856_100919255 3300005614 Bacteria 894
385 Ga0070702_100023468 3300005615 Bacteria 3278
386 Ga0070702_100041029 3300005615 Bacteria 2592
387 Ga0070702_100091754 3300005615 Bacteria 1843
388 Ga0070702_100347293 3300005615 Bacteria 1044
389 Ga0068852_100070737 3300005616 Bacteria 3062
390 Ga0068852_100703462 3300005616 Bacteria 1021
391 Ga0068859_100004442 3300005617 Bacteria 14311
392 Ga0068859_100020008 3300005617 Bacteria 6721
393 Ga0068859_100030708 3300005617 Bacteria 5392
394 Ga0068859_100070606 3300005617 Bacteria 3528
395 Ga0068859_100114609 3300005617 Bacteria 2759
396 Ga0068859_100139222 3300005617 Bacteria 2500
397 Ga0068859_100144943 3300005617 Bacteria 2449
398 Ga0068859_100221986 3300005617 Bacteria 1977
399 Ga0068859_100251373 3300005617 Bacteria 1858
400 Ga0068859_100301473 3300005617 Bacteria 1696
401 Ga0068859_100328050 3300005617 Bacteria 1624
402 Ga0068859_100824128 3300005617 Bacteria 1015
403 Ga0068859_100867140 3300005617 Bacteria 988
404 Ga0068859_100960276 3300005617 Bacteria 938
405 Ga0068859_101318485 3300005617 Bacteria 796
406 Ga0068859_101434764 3300005617 Bacteria 761
407 Ga0068864_100022274 3300005618 Bacteria 5312
408 Ga0068864_100027039 3300005618 Bacteria 4840
409 Ga0068864_100054633 3300005618 Bacteria 3447
410 Ga0068864_100075695 3300005618 Bacteria 2940
411 Ga0068864_100091585 3300005618 Bacteria 2683
412 Ga0068864_100218523 3300005618 Bacteria 1757
413 Ga0068864_100297221 3300005618 Bacteria 1511
414 Ga0068864_100493778 3300005618 Bacteria 1177
415 Ga0068864_100680503 3300005618 Bacteria 1004
416 Ga0068864_101217600 3300005618 Bacteria 752
417 Ga0068864_101310622 3300005618 Bacteria 725
418 Ga0068864_101313943 3300005618 Bacteria 724
419 Ga0068866_10016782 3300005718 Bacteria 3280
420 Ga0068866_10071250 3300005718 Bacteria 1837
421 Ga0068866_10107732 3300005718 Bacteria 1549
422 Ga0068866_10354074 3300005718 Bacteria 934
423 Ga0068866_10915524 3300005718 Bacteria 618
424 Ga0068861_100007625 3300005719 Bacteria 7426
425 Ga0068861_100012912 3300005719 Bacteria 5831
426 Ga0068861_100024888 3300005719 Bacteria 4334
427 Ga0068861_100068173 3300005719 Bacteria 2749
428 Ga0068861_100081254 3300005719 Bacteria 2537
429 Ga0068861_100141735 3300005719 Bacteria 1962
430 Ga0068861_100381275 3300005719 Bacteria 1246
431 Ga0068861_100680822 3300005719 Bacteria 953
432 Ga0068861_100828302 3300005719 Bacteria 871
433 Ga0068861_101193116 3300005719 Bacteria 736
434 Ga0068870_10000698 3300005840 Bacteria 12863
435 Ga0068870_10021389 3300005840 Bacteria 3163
436 Ga0068870_10124410 3300005840 Bacteria 1489
437 Ga0068870_10173826 3300005840 Bacteria 1287
438 Ga0068870_10207320 3300005840 Bacteria 1192
439 Ga0068870_10266878 3300005840 Bacteria 1067
440 Ga0068870_10591510 3300005840 Bacteria 753
441 Ga0068863_100026745 3300005841 Bacteria 5501
442 Ga0068863_100147673 3300005841 Bacteria 2249
443 Ga0068863_100189786 3300005841 Bacteria 1975
444 Ga0068863_100206357 3300005841 Bacteria 1891
445 Ga0068863_100333478 3300005841 Bacteria 1475
446 Ga0068863_100439209 3300005841 Bacteria 1280
447 Ga0068863_100692610 3300005841 Bacteria 1012
448 Ga0068863_100753869 3300005841 Bacteria 969
449 Ga0068863_101088148 3300005841 Bacteria 804
450 Ga0068858_100008638 3300005842 Bacteria 9781
451 Ga0068858_100133818 3300005842 Bacteria 2325
452 Ga0068858_100154653 3300005842 Bacteria 2157
453 Ga0068858_100164422 3300005842 Bacteria 2091
454 Ga0068858_100188598 3300005842 Bacteria 1948
455 Ga0068858_100370435 3300005842 Bacteria 1374
456 Ga0068858_100405270 3300005842 Bacteria 1310
457 Ga0068858_100415990 3300005842 Bacteria 1292
458 Ga0068858_100573235 3300005842 Bacteria 1093
459 Ga0068858_100999152 3300005842 Bacteria 820
460 Ga0068858_101120943 3300005842 Bacteria 773
461 Ga0068860_100023512 3300005843 Bacteria 5955
462 Ga0068860_100047798 3300005843 Bacteria 4078
463 Ga0068860_100153384 3300005843 Bacteria 2219
464 Ga0068860_100219173 3300005843 Bacteria 1847
465 Ga0068860_100226609 3300005843 Bacteria 1816
466 Ga0068860_100389123 3300005843 Bacteria 1377
467 Ga0068860_100587914 3300005843 Bacteria 1118
468 Ga0068860_100630748 3300005843 Bacteria 1079
469 Ga0068860_101134067 3300005843 Bacteria 802
470 Ga0068862_100005694 3300005844 Bacteria 10395
471 Ga0068862_100025264 3300005844 Bacteria 4987
472 Ga0068862_100074705 3300005844 Bacteria 2930
473 Ga0068862_100089481 3300005844 Bacteria 2679
474 Ga0068862_100108249 3300005844 Bacteria 2437
475 Ga0068862_100301706 3300005844 Bacteria 1474
476 Ga0068862_100369694 3300005844 Bacteria 1334
477 Ga0068862_100376047 3300005844 Bacteria 1324
478 Ga0068862_101266657 3300005844 Bacteria 738
479 Ga0081455_10015745 3300005937 Bacteria 7324
480 Ga0081455_10127759 3300005937 Bacteria 1992
481 Ga0081455_10294127 3300005937 Bacteria 1168
482 Ga0081538_10157035 3300005981 Bacteria 1018
483 Ga0081539_10000142 3300005985 Bacteria 165444
484 Ga0081539_10000215 3300005985 Bacteria 135054
485 Ga0081539_10008426 3300005985 Bacteria 8994
486 Ga0081539_10039110 3300005985 Bacteria 2803
487 Ga0081539_10050687 3300005985 Bacteria 2347
488 Ga0081539_10257652 3300005985 Bacteria 771
489 Ga0075368_10004958 3300006042 Bacteria 4544
490 Ga0075364_10045079 3300006051 Bacteria 2870
491 Ga0075432_10112970 3300006058 Bacteria 1014
492 Ga0070715_10015342 3300006163 Bacteria 2855
493 Ga0075367_10016089 3300006178 Bacteria 4079
494 Ga0075367_10514831 3300006178 Bacteria 759
495 Ga0075367_10654973 3300006178 Bacteria 668
496 Ga0097621_100025352 3300006237 Bacteria 4638
497 Ga0097621_100050488 3300006237 Bacteria 3383
498 Ga0097621_100061607 3300006237 Bacteria 3077
499 Ga0097621_100077675 3300006237 Bacteria 2757
500 Ga0097621_100082986 3300006237 Bacteria 2670
501 Ga0097621_100084701 3300006237 Bacteria 2643
502 Ga0097621_100112840 3300006237 Bacteria 2299
503 Ga0097621_100147932 3300006237 Bacteria 2013
504 Ga0097621_100767067 3300006237 Bacteria 892
505 Ga0068871_100006055 3300006358 Bacteria 8509
506 Ga0068871_100014366 3300006358 Bacteria 5902
507 Ga0068871_100040321 3300006358 Bacteria 3740
508 Ga0068871_100297441 3300006358 Bacteria 1416
509 Ga0068871_100324463 3300006358 Bacteria 1357
510 Ga0068871_100344647 3300006358 Bacteria 1316
511 Ga0068871_100357249 3300006358 Bacteria 1293
512 Ga0068871_100382477 3300006358 Bacteria 1250
513 Ga0068871_100463373 3300006358 Bacteria 1138
514 Ga0068871_100802891 3300006358 Bacteria 867
515 Ga0068871_101060491 3300006358 Bacteria 757
516 Ga0068871_101071410 3300006358 Bacteria 753
517 Ga0075428_100000009 3300006844 Bacteria 266370
518 Ga0075428_100002605 3300006844 Bacteria 19618
519 Ga0075428_100010879 3300006844 Bacteria 10117
520 Ga0075428_100036785 3300006844 Bacteria 5390
521 Ga0075428_100143196 3300006844 Bacteria 2599
522 Ga0075428_100145232 3300006844 Bacteria 2578
523 Ga0075428_100201957 3300006844 Bacteria 2149
524 Ga0075428_100211646 3300006844 Bacteria 2095
525 Ga0075428_100261696 3300006844 Bacteria 1862
526 Ga0075428_100351385 3300006844 Bacteria 1582
527 Ga0075428_100747326 3300006844 Bacteria 1041
528 Ga0075428_101123476 3300006844 Bacteria 830
529 Ga0075428_101770498 3300006844 Bacteria 644
530 Ga0075430_100003218 3300006846 Bacteria 13675
531 Ga0075430_100004914 3300006846 Bacteria 11243
532 Ga0075430_100010485 3300006846 Bacteria 7846
533 Ga0075430_100074743 3300006846 Bacteria 2841
534 Ga0075430_100111476 3300006846 Bacteria 2281
535 Ga0075430_100136242 3300006846 Bacteria 2046
536 Ga0075430_100140538 3300006846 Bacteria 2011
537 Ga0075430_100174095 3300006846 Bacteria 1791
538 Ga0075430_100187091 3300006846 Bacteria 1722
539 Ga0075431_100003301 3300006847 Bacteria 15626
540 Ga0075431_100009893 3300006847 Bacteria 9575
541 Ga0075431_100077516 3300006847 Bacteria 3430
542 Ga0075431_100094339 3300006847 Bacteria 3088
543 Ga0075431_100101941 3300006847 Bacteria 2962
544 Ga0075431_100112823 3300006847 Bacteria 2805
545 Ga0075431_100119284 3300006847 Bacteria 2722
546 Ga0075431_100256070 3300006847 Bacteria 1777
547 Ga0075431_100552391 3300006847 Bacteria 1139
548 Ga0075431_100567151 3300006847 Bacteria 1121
549 Ga0075433_10007511 3300006852 Bacteria 8653
550 Ga0075433_10022603 3300006852 Bacteria 5281
551 Ga0075433_10024037 3300006852 Bacteria 5138
552 Ga0075433_10027003 3300006852 Bacteria 4866
553 Ga0075433_10030541 3300006852 Bacteria 4598
554 Ga0075433_10034234 3300006852 Bacteria 4361
555 Ga0075433_10034313 3300006852 Bacteria 4357
556 Ga0075433_10148885 3300006852 Bacteria 2082
557 Ga0075433_10166842 3300006852 Bacteria 1959
558 Ga0075433_10172135 3300006852 Bacteria 1927
559 Ga0075433_10204926 3300006852 Bacteria 1753
560 Ga0075433_10226650 3300006852 Bacteria 1660
561 Ga0075433_10622619 3300006852 Bacteria 947
562 Ga0075433_10681390 3300006852 Bacteria 901
563 Ga0075434_100009524 3300006871 Bacteria 9062
564 Ga0075434_100067078 3300006871 Bacteria 3575
565 Ga0075434_100079605 3300006871 Bacteria 3273
566 Ga0075434_100085222 3300006871 Bacteria 3159
567 Ga0075434_100099298 3300006871 Bacteria 2916
568 Ga0075434_100368059 3300006871 Bacteria 1458
569 Ga0075434_100384749 3300006871 Bacteria 1424
570 Ga0075434_100564501 3300006871 Bacteria 1158
571 Ga0075434_101095850 3300006871 Bacteria 810
572 Ga0075429_100037448 3300006880 Bacteria 4222
573 Ga0075429_100071247 3300006880 Bacteria 3026
574 Ga0075429_100080157 3300006880 Bacteria 2846
575 Ga0075429_100123059 3300006880 Bacteria 2268
576 Ga0075429_100389954 3300006880 Bacteria 1219
577 Ga0075429_100456624 3300006880 Bacteria 1119
578 Ga0075429_100520360 3300006880 Bacteria 1042
579 Ga0075429_100807299 3300006880 Bacteria 822
580 Ga0068865_100006729 3300006881 Bacteria 7032
581 Ga0068865_100035649 3300006881 Bacteria 3348
582 Ga0068865_100096969 3300006881 Bacteria 2151
583 Ga0068865_100257624 3300006881 Bacteria 1380
584 Ga0068865_100534094 3300006881 Bacteria 983
585 Ga0068865_100536649 3300006881 Bacteria 980
586 Ga0068865_100663402 3300006881 Bacteria 888
587 Ga0068865_100725481 3300006881 Bacteria 851
588 Ga0068865_100842701 3300006881 Bacteria 794
589 Ga0075436_100018272 3300006914 Bacteria 4802
590 Ga0075436_100032253 3300006914 Bacteria 3610
591 Ga0075436_100038116 3300006914 Bacteria 3318
592 Ga0075436_100089463 3300006914 Bacteria 2139
593 Ga0075436_100146510 3300006914 Bacteria 1661
594 Ga0097620_100004442 3300006931 Bacteria 14311
595 Ga0097620_100020008 3300006931 Bacteria 6721
596 Ga0097620_100030709 3300006931 Bacteria 5392
597 Ga0097620_100070611 3300006931 Bacteria 3528
598 Ga0097620_100114608 3300006931 Bacteria 2759
599 Ga0097620_100125061 3300006931 Bacteria 2640
600 Ga0097620_100139216 3300006931 Bacteria 2500
601 Ga0097620_100144956 3300006931 Bacteria 2449
602 Ga0097620_100221987 3300006931 Bacteria 1977
603 Ga0097620_100251369 3300006931 Bacteria 1858
604 Ga0097620_100301505 3300006931 Bacteria 1696
605 Ga0097620_100328060 3300006931 Bacteria 1624
606 Ga0097620_100470387 3300006931 Bacteria 1353
607 Ga0097620_100824145 3300006931 Bacteria 1015
608 Ga0097620_100867119 3300006931 Bacteria 988
609 Ga0097620_100960380 3300006931 Bacteria 938
610 Ga0097620_101318450 3300006931 Bacteria 796
611 Ga0097620_101434769 3300006931 Bacteria 761
612 Ga0075435_100001542 3300007076 Bacteria 14846
613 Ga0075435_100001694 3300007076 Bacteria 14328
614 Ga0075435_100028991 3300007076 Bacteria 4343
615 Ga0075435_100038141 3300007076 Bacteria 3830
616 Ga0075435_100038256 3300007076 Bacteria 3825
617 Ga0075435_100046915 3300007076 Bacteria 3467
618 Ga0075435_100052049 3300007076 Bacteria 3299
619 Ga0075435_100137102 3300007076 Bacteria 2050
620 Ga0105244_10414552 3300009036 Bacteria 619
621 Ga0105240_10528326 3300009093 Bacteria 1308
622 Ga0105240_11236215 3300009093 Bacteria 790
623 Ga0105240_11511924 3300009093 Bacteria 704
624 Ga0111539_10000010 3300009094 Bacteria 366246
625 Ga0111539_10000566 3300009094 Bacteria 47366
626 Ga0111539_10008096 3300009094 Bacteria 13396
627 Ga0111539_10011587 3300009094 Bacteria 11064
628 Ga0111539_10016960 3300009094 Bacteria 9014
629 Ga0111539_10040307 3300009094 Bacteria 5624
630 Ga0111539_10060191 3300009094 Bacteria 4500
631 Ga0111539_10076195 3300009094 Bacteria 3949
632 Ga0111539_10133455 3300009094 Bacteria 2907
633 Ga0111539_10194685 3300009094 Bacteria 2364
634 Ga0111539_10201988 3300009094 Bacteria 2318
635 Ga0111539_10268052 3300009094 Bacteria 1988
636 Ga0111539_10303828 3300009094 Bacteria 1857
637 Ga0111539_10823829 3300009094 Bacteria 1080
638 Ga0111539_10948777 3300009094 Bacteria 1000
639 Ga0111539_11520662 3300009094 Bacteria 776
640 Ga0111539_11854987 3300009094 Bacteria 699
641 Ga0105245_10035527 3300009098 Bacteria 4423
642 Ga0105245_10062980 3300009098 Bacteria 3348
643 Ga0105245_10092918 3300009098 Bacteria 2779
644 Ga0105245_10150404 3300009098 Bacteria 2201
645 Ga0105245_10166728 3300009098 Bacteria 2094
646 Ga0105245_10292191 3300009098 Bacteria 1597
647 Ga0105245_11292145 3300009098 Bacteria 778
648 Ga0105247_10004209 3300009101 Bacteria 9230
649 Ga0105247_10231557 3300009101 Bacteria 1255
650 Ga0114129_10008264 3300009147 Bacteria 14846
651 Ga0114129_10021566 3300009147 Bacteria 9144
652 Ga0114129_10049690 3300009147 Bacteria 5892
653 Ga0114129_10065603 3300009147 Bacteria 5067
654 Ga0114129_10089267 3300009147 Bacteria 4273
655 Ga0114129_10101848 3300009147 Bacteria 3972
656 Ga0114129_10117140 3300009147 Bacteria 3671
657 Ga0114129_10149769 3300009147 Bacteria 3194
658 Ga0114129_10150439 3300009147 Bacteria 3186
659 Ga0114129_10285718 3300009147 Bacteria 2203
660 Ga0114129_10305373 3300009147 Bacteria 2120
661 Ga0114129_10401686 3300009147 Bacteria 1806
662 Ga0114129_10435231 3300009147 Bacteria 1723
663 Ga0114129_10553706 3300009147 Bacteria 1495
664 Ga0114129_10877884 3300009147 Bacteria 1138
665 Ga0114129_11242540 3300009147 Bacteria 926
666 Ga0105243_10063021 3300009148 Bacteria 2970
667 Ga0105243_10332838 3300009148 Bacteria 1388
668 Ga0105243_10430421 3300009148 Bacteria 1233
669 Ga0105241_10179916 3300009174 Bacteria 1753
670 Ga0105241_10600700 3300009174 Bacteria 994
671 Ga0105242_10013585 3300009176 Bacteria 6299
672 Ga0105242_10035616 3300009176 Bacteria 3991
673 Ga0105242_10082948 3300009176 Bacteria 2683
674 Ga0105242_10098861 3300009176 Bacteria 2469
675 Ga0105242_10149845 3300009176 Bacteria 2033
676 Ga0105242_10479055 3300009176 Bacteria 1179
677 Ga0105242_12135091 3300009176 Bacteria 604
678 Ga0105248_10013460 3300009177 Bacteria 9007
679 Ga0105248_10026461 3300009177 Bacteria 6454
680 Ga0105248_10045879 3300009177 Bacteria 4899
681 Ga0105248_10053076 3300009177 Bacteria 4548
682 Ga0105248_10085885 3300009177 Bacteria 3540
683 Ga0105248_10120187 3300009177 Bacteria 2964
684 Ga0105248_10124833 3300009177 Bacteria 2904
685 Ga0105248_10173329 3300009177 Bacteria 2432
686 Ga0105248_10201886 3300009177 Bacteria 2240
687 Ga0105248_10260433 3300009177 Bacteria 1952
688 Ga0105248_10279546 3300009177 Bacteria 1879
689 Ga0105248_10359936 3300009177 Bacteria 1638
690 Ga0105248_10449852 3300009177 Bacteria 1451
691 Ga0105248_10474563 3300009177 Bacteria 1410
692 Ga0105248_10556864 3300009177 Bacteria 1294
693 Ga0105248_10867938 3300009177 Bacteria 1019
694 Ga0105248_10895762 3300009177 Bacteria 1002
695 Ga0105248_11795542 3300009177 Bacteria 695
696 Ga0105248_11898612 3300009177 Bacteria 676
697 Ga0105237_11910315 3300009545 Bacteria 602
698 Ga0105238_10116693 3300009551 Bacteria 2649
699 Ga0105249_10000649 3300009553 Bacteria 31693
700 Ga0105249_10019022 3300009553 Bacteria 6126
701 Ga0105249_10051449 3300009553 Bacteria 3758
702 Ga0105249_10305085 3300009553 Bacteria 1598
703 Ga0105249_10333159 3300009553 Bacteria 1532
704 Ga0105249_10367556 3300009553 Bacteria 1461
705 Ga0105249_10784612 3300009553 Bacteria 1016
706 Ga0105249_11130991 3300009553 Bacteria 853
707 Ga0105249_11240176 3300009553 Bacteria 817
708 Ga0105249_11337966 3300009553 Bacteria 788
709 Ga0105249_12160650 3300009553 Bacteria 629
710 Ga0105246_10091603 3300011119 Bacteria 2192
711 Ga0105246_10158766 3300011119 Bacteria 1720
712 Ga0157339_1032538 3300012505 Bacteria 617
713 Ga0157324_1037476 3300012506 Bacteria 579
714 Ga0157370_10456700 3300013104 Bacteria 1174
715 Ga0157369_10106177 3300013105 Bacteria 2989
716 Ga0157369_10738345 3300013105 Bacteria 1013
717 Ga0157369_11073610 3300013105 Bacteria 823
718 Ga0157374_10027622 3300013296 Bacteria 5123
719 Ga0157374_10056738 3300013296 Bacteria 3657
720 Ga0157374_10262520 3300013296 Bacteria 1701
721 Ga0157374_10275164 3300013296 Bacteria 1661
722 Ga0157374_10707805 3300013296 Bacteria 1020
723 Ga0157378_10112704 3300013297 Bacteria 2495
724 Ga0157378_10140804 3300013297 Bacteria 2240
725 Ga0157378_10319377 3300013297 Bacteria 1508
726 Ga0157378_10470570 3300013297 Bacteria 1250
727 Ga0157378_11063452 3300013297 Bacteria 845
728 Ga0157378_11250723 3300013297 Bacteria 783
729 Ga0157378_11616807 3300013297 Bacteria 694
730 Ga0163162_10007697 3300013306 Bacteria 10494
731 Ga0163162_10039352 3300013306 Bacteria 4724
732 Ga0163162_10058002 3300013306 Bacteria 3900
733 Ga0163162_10251528 3300013306 Bacteria 1899
734 Ga0163162_11049397 3300013306 Bacteria 922
735 Ga0157372_10122637 3300013307 Bacteria 2987
736 Ga0157375_10044727 3300013308 Bacteria 4305
737 Ga0157375_10051620 3300013308 Bacteria 4039
738 Ga0157375_10128252 3300013308 Bacteria 2654
739 Ga0157375_10157788 3300013308 Bacteria 2409
740 Ga0157375_10248451 3300013308 Bacteria 1939
741 Ga0157375_10413346 3300013308 Bacteria 1515
742 Ga0157375_10414280 3300013308 Bacteria 1514
743 Ga0157375_10419905 3300013308 Bacteria 1503
744 Ga0157375_10477866 3300013308 Bacteria 1411
745 Ga0157375_10518254 3300013308 Bacteria 1356
746 Ga0157375_10707953 3300013308 Bacteria 1160
747 Ga0157375_11208422 3300013308 Bacteria 887
748 Ga0163163_10029752 3300014325 Bacteria 5256
749 Ga0163163_10061505 3300014325 Bacteria 3721
750 Ga0163163_10069167 3300014325 Bacteria 3515
751 Ga0163163_10094023 3300014325 Bacteria 3015
752 Ga0163163_10109105 3300014325 Bacteria 2795
753 Ga0163163_10189376 3300014325 Bacteria 2106
754 Ga0163163_10238029 3300014325 Bacteria 1870
755 Ga0163163_10303648 3300014325 Bacteria 1649
756 Ga0163163_10412474 3300014325 Bacteria 1409
757 Ga0163163_10430349 3300014325 Bacteria 1379
758 Ga0163163_10540550 3300014325 Bacteria 1228
759 Ga0163163_11244746 3300014325 Bacteria 807
760 Ga0163163_11443648 3300014325 Bacteria 750
761 Ga0163163_12144912 3300014325 Bacteria 618
762 Ga0157380_10007827 3300014326 Bacteria 7605
763 Ga0157380_10018558 3300014326 Bacteria 5164
764 Ga0157380_10053387 3300014326 Bacteria 3204
765 Ga0157380_10235303 3300014326 Bacteria 1648
766 Ga0157380_10286770 3300014326 Bacteria 1509
767 Ga0157380_10410508 3300014326 Bacteria 1288
768 Ga0157380_10417710 3300014326 Bacteria 1278
769 Ga0157380_10519229 3300014326 Bacteria 1161
770 Ga0157380_11202048 3300014326 Bacteria 802
771 Ga0157380_11668312 3300014326 Bacteria 694
772 Ga0157377_10021314 3300014745 Bacteria 3407
773 Ga0157377_10056165 3300014745 Bacteria 2235
774 Ga0157377_10059780 3300014745 Bacteria 2174
775 Ga0157377_10085823 3300014745 Bacteria 1849
776 Ga0157377_10295746 3300014745 Bacteria 1067
777 Ga0157377_10491345 3300014745 Bacteria 856
778 Ga0157377_10571822 3300014745 Bacteria 802
779 Ga0157379_10011639 3300014968 Bacteria 7682
780 Ga0157379_10012114 3300014968 Bacteria 7532
781 Ga0157379_10063370 3300014968 Bacteria 3306
782 Ga0157379_10072684 3300014968 Bacteria 3077
783 Ga0157379_10205528 3300014968 Bacteria 1781
784 Ga0157379_10404505 3300014968 Bacteria 1255
785 Ga0157379_10528095 3300014968 Bacteria 1096
786 Ga0157379_10581554 3300014968 Bacteria 1044
787 Ga0157376_10126830 3300014969 Bacteria 2271
788 Ga0157376_10184980 3300014969 Bacteria 1907
789 Ga0157376_10190729 3300014969 Bacteria 1879
790 Ga0157376_10255157 3300014969 Bacteria 1640
791 Ga0157376_10451872 3300014969 Bacteria 1253
792 Ga0157376_10509173 3300014969 Bacteria 1184
793 Ga0157376_10586178 3300014969 Bacteria 1108
794 Ga0157376_11278801 3300014969 Bacteria 763
795 Ga0182007_10107856 3300015262 Bacteria 925
796 Ga0182005_1040807 3300015265 Bacteria 1262
797 Ga0163161_10028845 3300017792 Bacteria 3943
798 Ga0163161_10859964 3300017792 Bacteria 766
799 Ga0197907_10552970 3300020069 Bacteria 1366
800 Ga0206356_10214271 3300020070 Bacteria 783
801 Ga0206356_10505801 3300020070 Bacteria 721
802 Ga0206356_10687278 3300020070 Bacteria 2962
803 Ga0206349_1035609 3300020075 Bacteria 1764
804 Ga0206355_1058195 3300020076 Bacteria 2119
805 Ga0206351_10341298 3300020077 Bacteria 2840
806 Ga0206352_11179373 3300020078 Bacteria 3285
807 Ga0206350_10061890 3300020080 Bacteria 1222
808 Ga0206350_11146903 3300020080 Bacteria 2788
809 Ga0206354_10436132 3300020081 Bacteria 3605
810 Ga0206353_10446860 3300020082 Bacteria 1821
811 Ga0207666_1019558 3300025271 Bacteria 989
812 Ga0207697_10002633 3300025315 Bacteria 9219
813 Ga0207697_10007629 3300025315 Bacteria 4804
814 Ga0207697_10022506 3300025315 Bacteria 2582
815 Ga0207697_10022773 3300025315 Bacteria 2566
816 Ga0207697_10048447 3300025315 Bacteria 1753
817 Ga0207697_10103789 3300025315 Bacteria 1213
818 Ga0207697_10133784 3300025315 Bacteria 1072
819 Ga0207656_10251929 3300025321 Bacteria 865
820 Ga0207653_10102303 3300025885 Bacteria 1014
821 Ga0207682_10059317 3300025893 Bacteria 1599
822 Ga0207682_10068988 3300025893 Bacteria 1495
823 Ga0207682_10123061 3300025893 Bacteria 1152
824 Ga0207692_10503348 3300025898 Bacteria 769
825 Ga0207642_10027730 3300025899 Bacteria 2321
826 Ga0207642_10086812 3300025899 Bacteria 1535
827 Ga0207642_10226439 3300025899 Bacteria 1048
828 Ga0207710_10013317 3300025900 Bacteria 3464
829 Ga0207688_10000138 3300025901 Bacteria 30845
830 Ga0207688_10084458 3300025901 Bacteria 1817
831 Ga0207688_10182102 3300025901 Bacteria 1253
832 Ga0207688_10190243 3300025901 Bacteria 1227
833 Ga0207688_10205732 3300025901 Bacteria 1181
834 Ga0207688_10320672 3300025901 Bacteria 951
835 Ga0207680_10060506 3300025903 Bacteria 2305
836 Ga0207680_10066906 3300025903 Bacteria 2211
837 Ga0207680_10075280 3300025903 Bacteria 2105
838 Ga0207680_10154195 3300025903 Bacteria 1534
839 Ga0207680_10190064 3300025903 Bacteria 1393
840 Ga0207680_10193407 3300025903 Bacteria 1382
841 Ga0207680_10295624 3300025903 Bacteria 1128
842 Ga0207680_10984339 3300025903 Bacteria 604
843 Ga0207685_10025352 3300025905 Bacteria 2046
844 Ga0207699_10014062 3300025906 Bacteria 4113
845 Ga0207699_11007994 3300025906 Bacteria 616
846 Ga0207645_10006334 3300025907 Bacteria 8508
847 Ga0207645_10025953 3300025907 Bacteria 3789
848 Ga0207645_10088367 3300025907 Bacteria 1992
849 Ga0207645_10107375 3300025907 Bacteria 1805
850 Ga0207645_10292073 3300025907 Bacteria 1084
851 Ga0207645_10338034 3300025907 Bacteria 1006
852 Ga0207645_10415433 3300025907 Bacteria 906
853 Ga0207643_10000779 3300025908 Bacteria 19421
854 Ga0207643_10037074 3300025908 Bacteria 2735
855 Ga0207643_10059113 3300025908 Bacteria 2187
856 Ga0207643_10101161 3300025908 Bacteria 1690
857 Ga0207643_10134193 3300025908 Bacteria 1475
858 Ga0207643_10152236 3300025908 Bacteria 1387
859 Ga0207643_10231269 3300025908 Bacteria 1134
860 Ga0207643_10272951 3300025908 Bacteria 1047
861 Ga0207643_10515030 3300025908 Bacteria 766
862 Ga0207705_10108310 3300025909 Bacteria 2051
863 Ga0207705_10158610 3300025909 Bacteria 1698
864 Ga0207684_10186623 3300025910 Bacteria 1788
865 Ga0207684_10252087 3300025910 Bacteria 1523
866 Ga0207707_10027601 3300025912 Bacteria 4963
867 Ga0207707_10161809 3300025912 Bacteria 1957
868 Ga0207707_10465226 3300025912 Bacteria 1081
869 Ga0207707_10710848 3300025912 Bacteria 843
870 Ga0207695_10097911 3300025913 Bacteria 2933
871 Ga0207695_11370852 3300025913 Bacteria 587
872 Ga0207660_10105617 3300025917 Bacteria 2111
873 Ga0207660_10186256 3300025917 Bacteria 1614
874 Ga0207660_10216564 3300025917 Bacteria 1501
875 Ga0207660_10254834 3300025917 Bacteria 1386
876 Ga0207662_10009410 3300025918 Bacteria 5376
877 Ga0207662_10034165 3300025918 Bacteria 2968
878 Ga0207662_10077779 3300025918 Bacteria 2018
879 Ga0207662_10096347 3300025918 Bacteria 1828
880 Ga0207662_10096484 3300025918 Bacteria 1826
881 Ga0207662_10160366 3300025918 Bacteria 1436
882 Ga0207662_10349672 3300025918 Bacteria 992
883 Ga0207657_10013143 3300025919 Bacteria 8130
884 Ga0207657_10033272 3300025919 Bacteria 4649
885 Ga0207657_10124277 3300025919 Bacteria 2120
886 Ga0207657_10484905 3300025919 Bacteria 969
887 Ga0207649_10028632 3300025920 Bacteria 3281
888 Ga0207649_10065329 3300025920 Bacteria 2303
889 Ga0207649_10235962 3300025920 Bacteria 1310
890 Ga0207652_10041098 3300025921 Bacteria 3929
891 Ga0207652_10100995 3300025921 Bacteria 2547
892 Ga0207652_10270189 3300025921 Bacteria 1534
893 Ga0207646_10036909 3300025922 Bacteria 4409
894 Ga0207646_10039242 3300025922 Bacteria 4262
895 Ga0207646_10162614 3300025922 Bacteria 2015
896 Ga0207646_10241995 3300025922 Bacteria 1630
897 Ga0207646_10265943 3300025922 Bacteria 1550
898 Ga0207646_10813445 3300025922 Bacteria 832
899 Ga0207646_10993522 3300025922 Bacteria 742
900 Ga0207681_10017709 3300025923 Bacteria 4477
901 Ga0207681_10076294 3300025923 Bacteria 2353
902 Ga0207681_10102273 3300025923 Bacteria 2069
903 Ga0207681_10103828 3300025923 Bacteria 2055
904 Ga0207681_10108677 3300025923 Bacteria 2013
905 Ga0207681_10111776 3300025923 Bacteria 1988
906 Ga0207681_10160752 3300025923 Bacteria 1693
907 Ga0207681_10181371 3300025923 Bacteria 1604
908 Ga0207681_10222321 3300025923 Bacteria 1461
909 Ga0207681_10314348 3300025923 Bacteria 1243
910 Ga0207681_10444855 3300025923 Bacteria 1053
911 Ga0207681_10616653 3300025923 Bacteria 898
912 Ga0207681_10652555 3300025923 Bacteria 872
913 Ga0207694_10459900 3300025924 Bacteria 1063
914 Ga0207650_10010669 3300025925 Bacteria 6310
915 Ga0207650_10042178 3300025925 Bacteria 3347
916 Ga0207650_10172001 3300025925 Bacteria 1722
917 Ga0207650_10174194 3300025925 Bacteria 1712
918 Ga0207650_10198170 3300025925 Bacteria 1607
919 Ga0207650_10247045 3300025925 Bacteria 1444
920 Ga0207650_10380106 3300025925 Bacteria 1166
921 Ga0207650_10531602 3300025925 Bacteria 985
922 Ga0207650_11111996 3300025925 Bacteria 672
923 Ga0207650_11411028 3300025925 Bacteria 592
924 Ga0207659_10001199 3300025926 Bacteria 15459
925 Ga0207659_10003579 3300025926 Bacteria 9354
926 Ga0207659_10029153 3300025926 Bacteria 3758
927 Ga0207659_10054621 3300025926 Bacteria 2853
928 Ga0207659_10062434 3300025926 Bacteria 2689
929 Ga0207659_10071205 3300025926 Bacteria 2538
930 Ga0207659_10079888 3300025926 Bacteria 2414
931 Ga0207659_10209680 3300025926 Bacteria 1561
932 Ga0207659_10223278 3300025926 Bacteria 1516
933 Ga0207659_10484368 3300025926 Bacteria 1045
934 Ga0207659_10556102 3300025926 Bacteria 976
935 Ga0207687_10015584 3300025927 Bacteria 4986
936 Ga0207687_10067367 3300025927 Bacteria 2547
937 Ga0207687_10103158 3300025927 Bacteria 2103
938 Ga0207687_10340427 3300025927 Bacteria 1219
939 Ga0207687_10365975 3300025927 Bacteria 1178
940 Ga0207687_10566897 3300025927 Bacteria 954
941 Ga0207687_11000483 3300025927 Bacteria 717
942 Ga0207700_10070594 3300025928 Bacteria 2686
943 Ga0207644_10007454 3300025931 Bacteria 7134
944 Ga0207644_10049107 3300025931 Bacteria 3019
945 Ga0207644_10053903 3300025931 Bacteria 2895
946 Ga0207644_10079042 3300025931 Bacteria 2426
947 Ga0207644_10251870 3300025931 Bacteria 1409
948 Ga0207644_10298861 3300025931 Bacteria 1297
949 Ga0207644_10976349 3300025931 Bacteria 711
950 Ga0207644_11195848 3300025931 Bacteria 639
951 Ga0207690_10078070 3300025932 Bacteria 2303
952 Ga0207690_10256121 3300025932 Bacteria 1354
953 Ga0207690_10549855 3300025932 Bacteria 938
954 Ga0207706_10003002 3300025933 Bacteria 16261
955 Ga0207706_10047200 3300025933 Bacteria 3811
956 Ga0207706_10061033 3300025933 Bacteria 3320
957 Ga0207706_10105816 3300025933 Bacteria 2475
958 Ga0207706_10107334 3300025933 Bacteria 2457
959 Ga0207706_10173569 3300025933 Bacteria 1894
960 Ga0207706_10258380 3300025933 Bacteria 1521
961 Ga0207706_10286367 3300025933 Bacteria 1437
962 Ga0207706_10371838 3300025933 Bacteria 1241
963 Ga0207706_10719440 3300025933 Bacteria 852
964 Ga0207686_10011631 3300025934 Bacteria 4826
965 Ga0207686_10013361 3300025934 Bacteria 4541
966 Ga0207686_10068725 3300025934 Bacteria 2270
967 Ga0207686_10087260 3300025934 Bacteria 2051
968 Ga0207686_10111839 3300025934 Bacteria 1843
969 Ga0207686_10250509 3300025934 Bacteria 1294
970 Ga0207686_10340524 3300025934 Bacteria 1126
971 Ga0207709_10007222 3300025935 Bacteria 6197
972 Ga0207709_10024672 3300025935 Bacteria 3436
973 Ga0207709_10412233 3300025935 Bacteria 1036
974 Ga0207709_10884141 3300025935 Bacteria 725
975 Ga0207709_10927221 3300025935 Bacteria 709
976 Ga0207670_10050869 3300025936 Bacteria 2779
977 Ga0207670_10068187 3300025936 Bacteria 2450
978 Ga0207670_10086695 3300025936 Bacteria 2204
979 Ga0207670_10097398 3300025936 Bacteria 2094
980 Ga0207670_10133057 3300025936 Bacteria 1825
981 Ga0207670_10210368 3300025936 Bacteria 1483
982 Ga0207670_10216609 3300025936 Bacteria 1463
983 Ga0207670_10234615 3300025936 Bacteria 1410
984 Ga0207670_10237257 3300025936 Bacteria 1403
985 Ga0207670_10242392 3300025936 Bacteria 1389
986 Ga0207670_10826796 3300025936 Bacteria 773
987 Ga0207669_10007924 3300025937 Bacteria 4953
988 Ga0207669_10047024 3300025937 Bacteria 2553
989 Ga0207669_10052960 3300025937 Bacteria 2441
990 Ga0207669_10107365 3300025937 Bacteria 1862
991 Ga0207669_10257031 3300025937 Bacteria 1304
992 Ga0207669_10287152 3300025937 Bacteria 1244
993 Ga0207669_10370024 3300025937 Bacteria 1113
994 Ga0207669_10521918 3300025937 Bacteria 954
995 Ga0207669_10675009 3300025937 Bacteria 847
996 Ga0207704_10001666 3300025938 Bacteria 9966
997 Ga0207704_10005828 3300025938 Bacteria 5701
998 Ga0207704_10025041 3300025938 Bacteria 3249
999 Ga0207704_10028528 3300025938 Bacteria 3098
1000 Ga0207704_10068220 3300025938 Bacteria 2241
1001 Ga0207704_10091254 3300025938 Bacteria 2002
1002 Ga0207704_10250405 3300025938 Bacteria 1329
1003 Ga0207704_10539838 3300025938 Bacteria 946
1004 Ga0207704_10666006 3300025938 Bacteria 859
1005 Ga0207704_10850642 3300025938 Bacteria 764
1006 Ga0207691_10008380 3300025940 Bacteria 9933
1007 Ga0207691_10012406 3300025940 Bacteria 8169
1008 Ga0207691_10017406 3300025940 Bacteria 6817
1009 Ga0207691_10018907 3300025940 Bacteria 6526
1010 Ga0207691_10046195 3300025940 Bacteria 4004
1011 Ga0207691_10053434 3300025940 Bacteria 3688
1012 Ga0207691_10070802 3300025940 Bacteria 3149
1013 Ga0207691_10100700 3300025940 Bacteria 2579
1014 Ga0207691_10543533 3300025940 Bacteria 985
1015 Ga0207711_10026433 3300025941 Bacteria 4870
1016 Ga0207711_10042393 3300025941 Bacteria 3878
1017 Ga0207711_10050382 3300025941 Bacteria 3564
1018 Ga0207711_10050802 3300025941 Bacteria 3550
1019 Ga0207711_10115511 3300025941 Bacteria 2392
1020 Ga0207711_10142830 3300025941 Bacteria 2155
1021 Ga0207711_10159325 3300025941 Bacteria 2041
1022 Ga0207711_10159462 3300025941 Bacteria 2041
1023 Ga0207711_10262952 3300025941 Bacteria 1586
1024 Ga0207711_10398014 3300025941 Bacteria 1279
1025 Ga0207711_10595796 3300025941 Bacteria 1031
1026 Ga0207689_10003297 3300025942 Bacteria 14779
1027 Ga0207689_10007360 3300025942 Bacteria 9653
1028 Ga0207689_10034411 3300025942 Bacteria 4209
1029 Ga0207689_10038286 3300025942 Bacteria 3973
1030 Ga0207689_10086089 3300025942 Bacteria 2583
1031 Ga0207689_10106986 3300025942 Bacteria 2298
1032 Ga0207689_10328007 3300025942 Bacteria 1271
1033 Ga0207689_10775043 3300025942 Bacteria 809
1034 Ga0207661_10071900 3300025944 Bacteria 2829
1035 Ga0207661_10090383 3300025944 Bacteria 2549
1036 Ga0207661_10134307 3300025944 Bacteria 2124
1037 Ga0207661_10355104 3300025944 Bacteria 1323
1038 Ga0207661_10455152 3300025944 Bacteria 1166
1039 Ga0207679_10001422 3300025945 Bacteria 15054
1040 Ga0207679_10005490 3300025945 Bacteria 7947
1041 Ga0207679_10027564 3300025945 Bacteria 3930
1042 Ga0207679_10073634 3300025945 Bacteria 2585
1043 Ga0207679_10142613 3300025945 Bacteria 1939
1044 Ga0207679_11088644 3300025945 Bacteria 733
1045 Ga0207679_11216838 3300025945 Bacteria 691
1046 Ga0207667_10017864 3300025949 Bacteria 7972
1047 Ga0207667_10142701 3300025949 Bacteria 2466
1048 Ga0207667_10271090 3300025949 Bacteria 1735
1049 Ga0207651_10010012 3300025960 Bacteria 5227
1050 Ga0207651_10030950 3300025960 Bacteria 3415
1051 Ga0207651_10046695 3300025960 Bacteria 2914
1052 Ga0207651_10050040 3300025960 Bacteria 2835
1053 Ga0207651_10068872 3300025960 Bacteria 2496
1054 Ga0207651_10159576 3300025960 Bacteria 1766
1055 Ga0207651_10355698 3300025960 Bacteria 1234
1056 Ga0207651_10361305 3300025960 Bacteria 1225
1057 Ga0207651_10390878 3300025960 Bacteria 1181
1058 Ga0207651_10742557 3300025960 Bacteria 867
1059 Ga0207651_10778775 3300025960 Bacteria 847
1060 Ga0207712_10080357 3300025961 Bacteria 2371
1061 Ga0207712_10095501 3300025961 Bacteria 2198
1062 Ga0207712_10393022 3300025961 Bacteria 1163
1063 Ga0207712_10404199 3300025961 Bacteria 1148
1064 Ga0207712_10470471 3300025961 Bacteria 1069
1065 Ga0207712_10518014 3300025961 Bacteria 1022
1066 Ga0207712_10545672 3300025961 Bacteria 996
1067 Ga0207712_11083200 3300025961 Bacteria 713
1068 Ga0207668_10020156 3300025972 Bacteria 4231
1069 Ga0207668_10056063 3300025972 Bacteria 2743
1070 Ga0207668_10113909 3300025972 Bacteria 2034
1071 Ga0207668_10175342 3300025972 Bacteria 1686
1072 Ga0207668_10307462 3300025972 Bacteria 1311
1073 Ga0207668_10325044 3300025972 Bacteria 1278
1074 Ga0207668_10711130 3300025972 Bacteria 884
1075 Ga0207640_10044089 3300025981 Bacteria 2855
1076 Ga0207640_10088384 3300025981 Bacteria 2139
1077 Ga0207640_10233267 3300025981 Bacteria 1417
1078 Ga0207640_10814752 3300025981 Bacteria 810
1079 Ga0207640_11121504 3300025981 Bacteria 697
1080 Ga0207640_11419956 3300025981 Bacteria 622
1081 Ga0207640_11711666 3300025981 Bacteria 568
1082 Ga0207658_10065901 3300025986 Bacteria 2722
1083 Ga0207658_10202397 3300025986 Bacteria 1658
1084 Ga0207658_10259922 3300025986 Bacteria 1479
1085 Ga0207658_10281351 3300025986 Bacteria 1426
1086 Ga0207658_10296291 3300025986 Bacteria 1392
1087 Ga0207658_10613732 3300025986 Bacteria 978
1088 Ga0207677_10044957 3300026023 Bacteria 2946
1089 Ga0207677_10084348 3300026023 Bacteria 2290
1090 Ga0207677_10088689 3300026023 Bacteria 2243
1091 Ga0207677_10278463 3300026023 Bacteria 1372
1092 Ga0207677_10327234 3300026023 Bacteria 1276
1093 Ga0207677_10507972 3300026023 Bacteria 1043
1094 Ga0207677_10589455 3300026023 Bacteria 974
1095 Ga0207677_10777951 3300026023 Bacteria 855
1096 Ga0207703_10032004 3300026035 Bacteria 4160
1097 Ga0207703_10033254 3300026035 Bacteria 4086
1098 Ga0207703_10070384 3300026035 Bacteria 2887
1099 Ga0207703_10076318 3300026035 Bacteria 2779
1100 Ga0207703_10084790 3300026035 Bacteria 2650
1101 Ga0207703_10114306 3300026035 Bacteria 2308
1102 Ga0207703_10347095 3300026035 Bacteria 1365
1103 Ga0207703_10453150 3300026035 Bacteria 1199
1104 Ga0207703_10535929 3300026035 Bacteria 1103
1105 Ga0207639_10214899 3300026041 Bacteria 1657
1106 Ga0207639_10306084 3300026041 Bacteria 1406
1107 Ga0207639_10414445 3300026041 Bacteria 1216
1108 Ga0207678_10065410 3300026067 Bacteria 3122
1109 Ga0207678_10078447 3300026067 Bacteria 2828
1110 Ga0207678_10113825 3300026067 Bacteria 2308
1111 Ga0207708_10025274 3300026075 Bacteria 4492
1112 Ga0207708_10087134 3300026075 Bacteria 2404
1113 Ga0207708_10115929 3300026075 Bacteria 2084
1114 Ga0207708_10121037 3300026075 Bacteria 2039
1115 Ga0207708_10124112 3300026075 Bacteria 2014
1116 Ga0207708_10154806 3300026075 Bacteria 1807
1117 Ga0207708_10349089 3300026075 Bacteria 1213
1118 Ga0207708_10550301 3300026075 Bacteria 973
1119 Ga0207708_10774544 3300026075 Bacteria 825
1120 Ga0207708_11243810 3300026075 Bacteria 651
1121 Ga0207702_10300635 3300026078 Bacteria 1523
1122 Ga0207641_10055386 3300026088 Bacteria 3367
1123 Ga0207641_10087096 3300026088 Bacteria 2724
1124 Ga0207641_10099999 3300026088 Bacteria 2553
1125 Ga0207641_10132999 3300026088 Bacteria 2236
1126 Ga0207641_10149478 3300026088 Bacteria 2114
1127 Ga0207641_10252335 3300026088 Bacteria 1648
1128 Ga0207641_10282235 3300026088 Bacteria 1562
1129 Ga0207641_10766745 3300026088 Bacteria 953
1130 Ga0207641_10949210 3300026088 Bacteria 855
1131 Ga0207641_11075589 3300026088 Bacteria 802
1132 Ga0207641_11155664 3300026088 Bacteria 773
1133 Ga0207648_10001325 3300026089 Bacteria 27526
1134 Ga0207648_10013253 3300026089 Bacteria 7680
1135 Ga0207648_10016724 3300026089 Bacteria 6693
1136 Ga0207648_10074761 3300026089 Bacteria 2953
1137 Ga0207648_10090323 3300026089 Bacteria 2676
1138 Ga0207648_10134253 3300026089 Bacteria 2179
1139 Ga0207648_10165633 3300026089 Bacteria 1953
1140 Ga0207648_10179905 3300026089 Bacteria 1871
1141 Ga0207648_10323852 3300026089 Bacteria 1385
1142 Ga0207648_10381942 3300026089 Bacteria 1274
1143 Ga0207648_10470729 3300026089 Bacteria 1146
1144 Ga0207648_11024330 3300026089 Bacteria 773
1145 Ga0207676_10028142 3300026095 Bacteria 4195
1146 Ga0207676_10103375 3300026095 Bacteria 2367
1147 Ga0207676_10175694 3300026095 Bacteria 1870
1148 Ga0207676_10234105 3300026095 Bacteria 1644
1149 Ga0207676_10243707 3300026095 Bacteria 1614
1150 Ga0207676_10246645 3300026095 Bacteria 1605
1151 Ga0207676_10386099 3300026095 Bacteria 1305
1152 Ga0207676_10512550 3300026095 Bacteria 1141
1153 Ga0207676_10742833 3300026095 Bacteria 954
1154 Ga0207676_10989453 3300026095 Bacteria 828
1155 Ga0207676_11106469 3300026095 Bacteria 783
1156 Ga0207676_11504823 3300026095 Bacteria 670
1157 Ga0207674_10204292 3300026116 Bacteria 1925
1158 Ga0207674_10308751 3300026116 Bacteria 1531
1159 Ga0207674_10631029 3300026116 Bacteria 1035
1160 Ga0207674_10990988 3300026116 Bacteria 809
1161 Ga0207674_11088242 3300026116 Bacteria 769
1162 Ga0207675_100014045 3300026118 Bacteria 7468
1163 Ga0207675_100022725 3300026118 Bacteria 5835
1164 Ga0207675_100038967 3300026118 Bacteria 4435
1165 Ga0207675_100052806 3300026118 Bacteria 3792
1166 Ga0207675_100094597 3300026118 Bacteria 2811
1167 Ga0207675_100099958 3300026118 Bacteria 2732
1168 Ga0207675_100190984 3300026118 Bacteria 1964
1169 Ga0207675_100282097 3300026118 Bacteria 1614
1170 Ga0207675_100327098 3300026118 Bacteria 1498
1171 Ga0207675_100367127 3300026118 Bacteria 1413
1172 Ga0207683_10054170 3300026121 Bacteria 3517
1173 Ga0207683_10054620 3300026121 Bacteria 3502
1174 Ga0207683_10109399 3300026121 Bacteria 2473
1175 Ga0207683_10143122 3300026121 Bacteria 2155
1176 Ga0207683_10253977 3300026121 Bacteria 1605
1177 Ga0207683_10294147 3300026121 Bacteria 1485
1178 Ga0207683_10324309 3300026121 Bacteria 1411
1179 Ga0207683_10411318 3300026121 Bacteria 1245
1180 Ga0207683_10659178 3300026121 Bacteria 970
1181 Ga0207683_10755321 3300026121 Bacteria 902
1182 Ga0207683_10796366 3300026121 Bacteria 877
1183 Ga0207683_10898286 3300026121 Bacteria 823
1184 Ga0207683_11015433 3300026121 Bacteria 770
1185 Ga0207698_10093502 3300026142 Bacteria 2469
1186 Ga0207698_10165914 3300026142 Bacteria 1938
1187 Ga0207698_10328937 3300026142 Bacteria 1435
1188 Ga0207698_11050855 3300026142 Bacteria 826
1189 Ga0209984_1006288 3300027424 Bacteria 1453
1190 Ga0209999_1021187 3300027543 Bacteria 1193
1191 Ga0209983_1003671 3300027665 Bacteria 3254
1192 Ga0209983_1076551 3300027665 Bacteria 748
1193 Ga0209971_1008254 3300027682 Bacteria 2469
1194 Ga0209971_1049431 3300027682 Bacteria 1016
1195 Ga0209971_1105826 3300027682 Bacteria 690
1196 Ga0209971_1106524 3300027682 Bacteria 687
1197 Ga0209971_1109884 3300027682 Bacteria 676
1198 Ga0209998_10050364 3300027717 Bacteria 963
1199 Ga0209813_10042156 3300027866 Bacteria 1394
1200 Ga0209974_10012249 3300027876 Bacteria 2870
1201 Ga0209974_10036907 3300027876 Bacteria 1623
1202 Ga0209974_10113882 3300027876 Bacteria 954
1203 Ga0209974_10180128 3300027876 Bacteria 774
1204 Ga0207428_10000034 3300027907 Bacteria 231306
1205 Ga0207428_10001541 3300027907 Bacteria 24114
1206 Ga0207428_10002655 3300027907 Bacteria 17812
1207 Ga0207428_10003291 3300027907 Bacteria 15710
1208 Ga0207428_10041247 3300027907 Bacteria 3738
1209 Ga0207428_10047323 3300027907 Bacteria 3454
1210 Ga0207428_10061497 3300027907 Bacteria 2973
1211 Ga0207428_10102792 3300027907 Bacteria 2206
1212 Ga0207428_10110710 3300027907 Bacteria 2114
1213 Ga0207428_10126076 3300027907 Bacteria 1961
1214 Ga0207428_10134350 3300027907 Bacteria 1892
1215 Ga0207428_10152809 3300027907 Bacteria 1756
1216 Ga0207428_10185122 3300027907 Bacteria 1572
1217 Ga0207428_10249344 3300027907 Bacteria 1324
1218 Ga0207428_10311694 3300027907 Bacteria 1163
1219 Ga0268266_10005896 3300028379 Bacteria 11335
1220 Ga0268266_10034166 3300028379 Bacteria 4324
1221 Ga0268266_10045638 3300028379 Bacteria 3749
1222 Ga0268266_10054819 3300028379 Bacteria 3426
1223 Ga0268266_10083997 3300028379 Bacteria 2780
1224 Ga0268266_10162259 3300028379 Bacteria 2023
1225 Ga0268266_10414854 3300028379 Bacteria 1275
1226 Ga0268266_10480140 3300028379 Bacteria 1185
1227 Ga0268265_10000103 3300028380 Bacteria 106177
1228 Ga0268265_10005520 3300028380 Bacteria 8630
1229 Ga0268265_10040884 3300028380 Bacteria 3426
1230 Ga0268265_10050150 3300028380 Bacteria 3143
1231 Ga0268265_10060408 3300028380 Bacteria 2904
1232 Ga0268265_10079157 3300028380 Bacteria 2587
1233 Ga0268265_10252038 3300028380 Bacteria 1564
1234 Ga0268265_10256100 3300028380 Bacteria 1553
1235 Ga0268265_10308043 3300028380 Bacteria 1429
1236 Ga0268265_10493540 3300028380 Bacteria 1152
1237 Ga0268265_10567553 3300028380 Bacteria 1080
1238 Ga0268265_11033187 3300028380 Bacteria 813
1239 Ga0268264_10010645 3300028381 Bacteria 7600
1240 Ga0268264_10027905 3300028381 Bacteria 4615
1241 Ga0268264_10056447 3300028381 Bacteria 3283
1242 Ga0268264_10106377 3300028381 Bacteria 2449
1243 Ga0268264_10156694 3300028381 Bacteria 2047
1244 Ga0268264_10222150 3300028381 Bacteria 1739
1245 Ga0268264_10484587 3300028381 Bacteria 1203
1246 Ga0268264_10701517 3300028381 Bacteria 1005
1247 Ga0268264_11037134 3300028381 Bacteria 827
1248 Ga0268264_11595850 3300028381 Bacteria 663
1249 Ga0265326_10065209 3300028558 Bacteria 1030
1250 Ga0265338_10113495 3300028800 Bacteria 2176
1251 Ga0265324_10011911 3300029957 Bacteria 3301
1252 Ga0265330_10037126 3300031235 Bacteria 2170
1253 Ga0265332_10010141 3300031238 Bacteria 4194
1254 Ga0265332_10085113 3300031238 Bacteria 1340
1255 Ga0265328_10154609 3300031239 Bacteria 863
1256 Ga0265320_10012074 3300031240 Bacteria 5050
1257 Ga0265320_10186182 3300031240 Bacteria 930
1258 Ga0265329_10008336 3300031242 Bacteria 3938
1259 Ga0265340_10020784 3300031247 Bacteria 3369
1260 Ga0265331_10038287 3300031250 Bacteria 2344
1261 Ga0265316_10025425 3300031344 Bacteria 4940
1262 Ga0265316_10132996 3300031344 Bacteria 1872
1263 Ga0307513_10669904 3300031456 Bacteria 744
1264 Ga0307509_10427512 3300031507 Bacteria 1024
1265 Ga0307408_100038013 3300031548 Bacteria 3394
1266 Ga0307408_100057488 3300031548 Bacteria 2824
1267 Ga0307408_100081795 3300031548 Bacteria 2415
1268 Ga0307408_100204003 3300031548 Bacteria 1602
1269 Ga0307408_100225649 3300031548 Bacteria 1531
1270 Ga0307408_100530685 3300031548 Bacteria 1035
1271 Ga0307408_100680889 3300031548 Bacteria 922
1272 Ga0307408_100755938 3300031548 Bacteria 878
1273 Ga0265314_10005858 3300031711 Bacteria 11002
1274 Ga0265314_10007579 3300031711 Bacteria 9400
1275 Ga0265342_10081550 3300031712 Bacteria 1867
1276 Ga0316576_10244689 3300031727 Bacteria 1347
1277 Ga0307405_10003705 3300031731 Bacteria 7092
1278 Ga0307405_10016138 3300031731 Bacteria 4065
1279 Ga0307405_10030751 3300031731 Bacteria 3152
1280 Ga0307405_10138224 3300031731 Bacteria 1694
1281 Ga0307405_10297854 3300031731 Bacteria 1222
1282 Ga0307405_10674016 3300031731 Bacteria 853
1283 Ga0307413_10030050 3300031824 Bacteria 3048
1284 Ga0307413_10077755 3300031824 Bacteria 2114
1285 Ga0307413_10113611 3300031824 Bacteria 1818
1286 Ga0307413_10223029 3300031824 Bacteria 1378
1287 Ga0307413_10678229 3300031824 Bacteria 853
1288 Ga0307413_11333368 3300031824 Bacteria 629
1289 Ga0307410_10006003 3300031852 Bacteria 6507
1290 Ga0307410_10017954 3300031852 Bacteria 4262
1291 Ga0307410_10047643 3300031852 Bacteria 2866
1292 Ga0307410_10221253 3300031852 Bacteria 1456
1293 Ga0307410_10234760 3300031852 Bacteria 1418
1294 Ga0307410_10499257 3300031852 Bacteria 1001
1295 Ga0307406_10006390 3300031901 Bacteria 6502
1296 Ga0307406_10234504 3300031901 Bacteria 1372
1297 Ga0307406_10306001 3300031901 Bacteria 1223
1298 Ga0307406_11180440 3300031901 Bacteria 664
1299 Ga0307407_10002685 3300031903 Bacteria 7052
1300 Ga0307407_10045517 3300031903 Bacteria 2480
1301 Ga0307407_10050963 3300031903 Bacteria 2371
1302 Ga0307407_10091366 3300031903 Bacteria 1866
1303 Ga0307407_10156691 3300031903 Bacteria 1486
1304 Ga0307407_10325266 3300031903 Unclassified 1080
1305 Ga0307407_10411656 3300031903 Bacteria 972
1306 Ga0307407_10420175 3300031903 Bacteria 963
1307 Ga0307412_10010747 3300031911 Bacteria 5280
1308 Ga0307412_10107881 3300031911 Bacteria 1983
1309 Ga0307412_10126226 3300031911 Bacteria 1851
1310 Ga0307412_10152701 3300031911 Bacteria 1706
1311 Ga0307412_10267132 3300031911 Bacteria 1337
1312 Ga0307412_10301772 3300031911 Bacteria 1266
1313 Ga0307412_10350372 3300031911 Bacteria 1185
1314 Ga0307412_10442676 3300031911 Bacteria 1068
1315 Ga0307412_10452487 3300031911 Bacteria 1058
1316 Ga0307412_10681319 3300031911 Bacteria 880
1317 Ga0307409_100020053 3300031995 Bacteria 4546
1318 Ga0307409_100087327 3300031995 Bacteria 2541
1319 Ga0307409_100107444 3300031995 Bacteria 2331
1320 Ga0307409_100112567 3300031995 Bacteria 2285
1321 Ga0307409_100127380 3300031995 Bacteria 2168
1322 Ga0307409_100772663 3300031995 Bacteria 966
1323 Ga0307409_100854042 3300031995 Bacteria 921
1324 Ga0307409_101158764 3300031995 Bacteria 795
1325 Ga0307409_101759026 3300031995 Bacteria 649
1326 Ga0307416_100003624 3300032002 Bacteria 9121
1327 Ga0307416_100045169 3300032002 Bacteria 3467
1328 Ga0307416_100048189 3300032002 Bacteria 3378
1329 Ga0307416_100056176 3300032002 Bacteria 3175
1330 Ga0307416_100079895 3300032002 Bacteria 2758
1331 Ga0307416_100089739 3300032002 Bacteria 2633
1332 Ga0307416_100101244 3300032002 Bacteria 2508
1333 Ga0307416_100117449 3300032002 Bacteria 2361
1334 Ga0307416_100943827 3300032002 Bacteria 964
1335 Ga0307416_102059606 3300032002 Bacteria 673
1336 Ga0307416_102140929 3300032002 Bacteria 661
1337 Ga0307414_10142455 3300032004 Bacteria 1879
1338 Ga0307414_10152732 3300032004 Bacteria 1824
1339 Ga0307414_10197495 3300032004 Bacteria 1633
1340 Ga0307414_10316215 3300032004 Bacteria 1327
1341 Ga0307414_10450865 3300032004 Bacteria 1128
1342 Ga0307414_11334422 3300032004 Bacteria 666
1343 Ga0307411_10000416 3300032005 Bacteria 14543
1344 Ga0307411_10016125 3300032005 Bacteria 4223
1345 Ga0307411_10055467 3300032005 Bacteria 2607
1346 Ga0307411_10106711 3300032005 Bacteria 1994
1347 Ga0307411_10110820 3300032005 Bacteria 1963
1348 Ga0307411_10130074 3300032005 Bacteria 1838
1349 Ga0307411_10246351 3300032005 Bacteria 1402
1350 Ga0307411_10300832 3300032005 Bacteria 1286
1351 Ga0307411_10607368 3300032005 Bacteria 941
1352 Ga0307411_10652573 3300032005 Bacteria 911
1353 Ga0307415_100000625 3300032126 Bacteria 15495
1354 Ga0307415_100106352 3300032126 Bacteria 2071
1355 Ga0307415_100441434 3300032126 Bacteria 1122
1356 Ga0307415_101121615 3300032126 Bacteria 737
1357 Ga0373948_0116479 3300034817 Bacteria 642
1358 Ga0373950_0005290 3300034818 Bacteria 1923
1359 Ga0373958_0000045 3300034819 Bacteria 12165
1360 Ga0373959_0001151 3300034820 Bacteria 4278
1361 Ga0373938_0000418 3300034957 Bacteria 6847
1362 Ga0373938_0026047 3300034957 Bacteria 1221
1363 Ga0373938_0166466 3300034957 Bacteria 595
1364 Ga0373928_0001212 3300035084 Bacteria 5090
1365 Ga0373928_0015408 3300035084 Bacteria 1556
1366 Ga0373929_0000116 3300035085 Bacteria 13311
1367 Ga0373934_0034771 3300035086 Bacteria 1981
1368 Ga0373934_0065468 3300035086 Bacteria 1451
1369 Ga0373940_0000084 3300035088 Bacteria 11367
1370 Ga0373944_0303872 3300035089 Bacteria 599
1371 Ga0373949_0000597 3300035090 Bacteria 11806
1372 Ga0373949_0038576 3300035090 Bacteria 1166
1373 Ga0373951_0001673 3300035091 Bacteria 5805
1374 Ga0373952_0001387 3300035092 Bacteria 4428
1375 Ga0373923_0271448 3300035111 Bacteria 798
1376 Ga0373923_0320815 3300035111 Bacteria 736
1377 Ga0373932_0006095 3300035112 Bacteria 2845
1378 Ga0373932_0037176 3300035112 Bacteria 1386
1379 Ga0373932_0176427 3300035112 Bacteria 747
1380 Ga0373936_0085973 3300035113 Bacteria 1313
1381 Ga0373939_0001888 3300035114 Bacteria 5012
1382 Ga0373941_0000161 3300035115 Bacteria 12224
1383 Ga0373941_0168810 3300035115 Bacteria 814
1384 Ga0373953_0067476 3300035117 Bacteria 1472
1385 Ga0373953_0098621 3300035117 Bacteria 1228
1386 Ga0373956_0183744 3300035119 Bacteria 989
1387 Ga0373957_0071947 3300035120 Bacteria 1354
1388 Ga0373960_0001448 3300035121 Bacteria 5252
1389 Ga0373943_0022741 3300035170 Bacteria 2909
1390 Ga0373946_0062792 3300035171 Bacteria 1585
1391 Ga0373946_0074104 3300035171 Bacteria 1477
1392 Ga0373946_0160914 3300035171 Bacteria 1054
1393 Ga0373946_0567824 3300035171 Bacteria 586
1394 Ga0373955_0491747 3300035172 Bacteria 749
1395 Ga0373942_0001420 3300035207 Bacteria 6171
1396 Ga0373942_0142636 3300035207 Bacteria 764
1397 Ga0373961_0001591 3300035241 Bacteria 6457
1398 Ga0373961_0150062 3300035241 Bacteria 793
1399 Ga0373962_0000245 3300035242 Bacteria 11519
1400 Ga0373931_0002441 3300035691 Bacteria 8234
1401 Ga0373931_0084404 3300035691 Bacteria 1759
1402 Ga0373931_0085636 3300035691 Bacteria 1747
1403 Ga0373931_0167215 3300035691 Bacteria 1293
1404 Ga0373935_0164739 3300035692 Bacteria 1513
1405 Ga0373927_0139946 3300035695 Bacteria 1583
1406 Ga0373933_0596789 3300035724 Bacteria 725
1407 Ga0373947_0034097 3300035725 Bacteria 3010
1408 Ga0373947_0206717 3300035725 Bacteria 1286
1409 Ga0373947_0380536 3300035725 Bacteria 950
1410 Ga0373947_0535016 3300035725 Bacteria 797
1411 Ga0373937_0055667 3300036401 Bacteria 3632
1412 Ga0373937_0068497 3300036401 Bacteria 3272
1413 Ga0373937_0156528 3300036401 Bacteria 2136
1414 Ga0373937_0749077 3300036401 Bacteria 924
1415 Ga0373937_0985887 3300036401 Bacteria 791
1416 Ga0373937_1083223 3300036401 Bacteria 750
1417 Ga0373925_0035123 3300037068 Bacteria 3698
1418 Ga0373925_0185734 3300037068 Bacteria 1648
1419 Ga0373925_0320151 3300037068 Bacteria 1255
1420 Ga0373925_1290745 3300037068 Bacteria 599
1421 Ga0436365_0036290 3300039437 Bacteria 1612
1422 Ga0436365_0581991 3300039437 Bacteria 1447
1423 Ga0439439_0034189 3300041406 Bacteria 1303
1424 Ga0439439_0038937 3300041406 Bacteria 1228
1425 Ga0439453_0004336 3300041408 Bacteria 2105
1426 Ga0451855_0468162 3300041511 Bacteria 764
1427 Ga0439431_0028869 3300041997 Bacteria 1368
1428 Ga0439441_009987 3300042001 Bacteria 1583
1429 Ga0439441_052477 3300042001 Bacteria 843
1430 Ga0439443_038709 3300042003 Bacteria 809
1431 Ga0439450_001122 3300042008 Bacteria 3796
1432 Ga0439450_067497 3300042008 Bacteria 873
1433 Ga0439455_0110887 3300042012 Bacteria 763
1434 Ga0439457_031767 3300042014 Bacteria 1171
1435 Ga0439462_0078638 3300042015 Bacteria 900
1436 Ga0439462_0126319 3300042015 Bacteria 713
1437 Ga0450913_009550 3300042117 Bacteria 764
1438 Ga0450920_022971 3300042122 Bacteria 1209
1439 Ga0450892_030457 3300042130 Bacteria 565
1440 Ga0450896_016030 3300042133 Bacteria 1075
1441 Ga0450896_037581 3300042133 Bacteria 747
1442 Ga0450896_043641 3300042133 Bacteria 703
1443 Ga0439434_0028691 3300042435 Bacteria 1686
1444 Ga0439434_0146090 3300042435 Bacteria 781
1445 Ga0439434_0166329 3300042435 Bacteria 735
1446 Ga0439435_0027034 3300042436 Bacteria 1532
1447 Ga0439435_0150939 3300042436 Bacteria 745
1448 Ga0439464_0002679 3300042439 Bacteria 4416
1449 Ga0439464_0028831 3300042439 Bacteria 1548
1450 Ga0439464_0029074 3300042439 Bacteria 1543
1451 Ga0439460_0054239 3300042461 Bacteria 1209
1452 Ga0450916_000502 3300042530 Bacteria 3425
1453 Ga0450916_019009 3300042530 Bacteria 929
1454 Ga0451577_0011517 3300042876 Bacteria 8358
1455 Ga0451577_0284963 3300042876 Bacteria 1497
1456 Ga0451577_0286314 3300042876 Bacteria 1493
1457 Ga0451577_0375642 3300042876 Bacteria 1290
1458 Ga0466965_0146653 3300044683 Bacteria 1232
1459 Ga0453684_0026145 3300044712 Bacteria 8445
1460 Ga0453684_0287763 3300044712 Bacteria 1872
1461 Ga0453684_0685249 3300044712 Bacteria 1115
1462 Ga0466957_0659541 3300044842 Bacteria 736
1463 Ga0466959_0074856 3300045049 Bacteria 2448
1464 Ga0451576_0018296 3300045051 Bacteria 7684
1465 Ga0451576_0049051 3300045051 Bacteria 4431
1466 Ga0451576_0055541 3300045051 Bacteria 4142
1467 Ga0451576_0084364 3300045051 Bacteria 3304
1468 Ga0451576_0176092 3300045051 Bacteria 2233
1469 Ga0451576_0596282 3300045051 Bacteria 1161
1470 Ga0466967_0057235 3300045976 Bacteria 3441
1471 Ga0495592_0313574 3300046454 Bacteria 1016
1472 Ga0495603_0011963 3300046455 Bacteria 5252
1473 Ga0495603_0073260 3300046455 Bacteria 2012
1474 Ga0495603_0142169 3300046455 Bacteria 1396
1475 Ga0495603_0178189 3300046455 Bacteria 1230
1476 Ga0495603_0195150 3300046455 Bacteria 1170
1477 Ga0495590_0101823 3300046457 Bacteria 1021
1478 Ga0495629_0005673 3300046459 Bacteria 9321
1479 Ga0495629_0032718 3300046459 Bacteria 3681
1480 Ga0495629_0247911 3300046459 Bacteria 1226
1481 Ga0495629_0323121 3300046459 Bacteria 1055
1482 Ga0495629_0431206 3300046459 Bacteria 894
1483 Ga0495641_0038066 3300046461 Bacteria 2249
1484 Ga0495651_0083661 3300046462 Bacteria 2406
1485 Ga0495651_0416830 3300046462 Bacteria 874
1486 Ga0495653_0154914 3300046463 Bacteria 1597
1487 Ga0495580_0160420 3300046472 Bacteria 1556
1488 Ga0495580_0735816 3300046472 Bacteria 643
1489 Ga0495582_0084059 3300046473 Bacteria 1769
1490 Ga0495582_0210918 3300046473 Bacteria 1110
1491 Ga0495582_0308473 3300046473 Bacteria 910
1492 Ga0495639_0030139 3300046475 Bacteria 2411
1493 Ga0495639_0159747 3300046475 Bacteria 1090
1494 Ga0495639_0220820 3300046475 Bacteria 932
1495 Ga0495664_0214431 3300046477 Bacteria 1166
1496 Ga0495584_0484325 3300046491 Bacteria 630
1497 Ga0495585_0131680 3300046492 Bacteria 1316
1498 Ga0495594_0009792 3300046499 Bacteria 4962
1499 Ga0495594_0013061 3300046499 Bacteria 4331
1500 Ga0495594_0044838 3300046499 Bacteria 2426
1501 Ga0495594_0153882 3300046499 Bacteria 1306
1502 Ga0495596_0048137 3300046500 Bacteria 1672
1503 Ga0495608_0235194 3300046511 Bacteria 1146
1504 Ga0495628_0076916 3300046516 Bacteria 2597
1505 Ga0495628_0226237 3300046516 Bacteria 1403
1506 Ga0495630_0195846 3300046517 Bacteria 1542
1507 Ga0495630_0473089 3300046517 Bacteria 961
1508 Ga0495644_0196354 3300046523 Bacteria 777
1509 Ga0495663_0083941 3300046525 Bacteria 1029
1510 Ga0495663_0154142 3300046525 Bacteria 785
1511 Ga0495642_0004633 3300046528 Bacteria 5329
1512 Ga0495642_0261654 3300046528 Bacteria 757
1513 Ga0495665_0150034 3300046531 Bacteria 1217
1514 Ga0495640_0030475 3300046533 Bacteria 3862
1515 Ga0495640_0056439 3300046533 Bacteria 2683
1516 Ga0495586_0110189 3300046535 Bacteria 1532
1517 Ga0495586_0202366 3300046535 Bacteria 1126
1518 Ga0495587_0366704 3300046536 Bacteria 802
1519 Ga0495598_0004409 3300046537 Bacteria 3045
1520 Ga0495598_0012857 3300046537 Bacteria 2065
1521 Ga0495598_0054140 3300046537 Bacteria 1217
1522 Ga0495609_0019662 3300046538 Bacteria 3122
1523 Ga0495609_0023705 3300046538 Bacteria 2819
1524 Ga0495621_0013237 3300046539 Bacteria 2588
1525 Ga0495621_0018299 3300046539 Bacteria 2274
1526 Ga0495621_0034876 3300046539 Bacteria 1740
1527 Ga0495621_0045294 3300046539 Bacteria 1558
1528 Ga0495621_0045398 3300046539 Bacteria 1556
1529 Ga0495621_0106156 3300046539 Bacteria 1073
1530 Ga0495621_0125550 3300046539 Bacteria 995
1531 Ga0495621_0367758 3300046539 Bacteria 606
1532 Ga0495645_0004427 3300046543 Bacteria 9593
1533 Ga0495645_0146884 3300046543 Bacteria 1642
1534 Ga0495645_0242401 3300046543 Bacteria 1202
1535 Ga0495633_0081374 3300046558 Bacteria 1507
1536 Ga0495656_0013358 3300046615 Bacteria 3054
1537 Ga0495656_0104798 3300046615 Bacteria 1314
1538 Ga0495656_0105318 3300046615 Bacteria 1311
1539 Ga0495656_0211187 3300046615 Bacteria 967
1540 Ga0495668_0201813 3300046616 Bacteria 1089
1541 Ga0495634_0132458 3300046642 Bacteria 1588
1542 Ga0495634_0453174 3300046642 Bacteria 757
1543 Ga0495611_0202351 3300046648 Bacteria 926
1544 Ga0495635_0293510 3300046663 Bacteria 1091
1545 Ga0495659_0009558 3300046664 Bacteria 3098
1546 Ga0495659_0011236 3300046664 Bacteria 2884
1547 Ga0495659_0013370 3300046664 Bacteria 2673
1548 Ga0495659_0013901 3300046664 Bacteria 2627
1549 Ga0495659_0038786 3300046664 Bacteria 1693
1550 Ga0495659_0045980 3300046664 Bacteria 1575
1551 Ga0495659_0072239 3300046664 Bacteria 1294
1552 Ga0495659_0189963 3300046664 Bacteria 839
1553 Ga0495588_0004710 3300046674 Bacteria 6030
1554 Ga0495657_0179033 3300046675 Bacteria 1302
1555 Ga0495599_0476460 3300046678 Bacteria 737
1556 Ga0495646_0162193 3300046680 Bacteria 1237
1557 Ga0495647_0067201 3300046681 Bacteria 1427
1558 Ga0495647_0168281 3300046681 Bacteria 948
1559 Ga0495658_0115758 3300046683 Bacteria 1616
1560 Ga0495658_0169867 3300046683 Bacteria 1349
1561 Ga0495658_0398530 3300046683 Bacteria 877
1562 Ga0495669_0259747 3300046684 Bacteria 834
1563 Ga0495613_0056428 3300046689 Bacteria 2884
1564 Ga0495624_0356946 3300046690 Bacteria 879
1565 Ga0495670_0265060 3300046691 Bacteria 917
1566 Ga0495670_0343500 3300046691 Bacteria 803
1567 Ga0495600_0158681 3300046809 Bacteria 1463
1568 Ga0495600_0503675 3300046809 Bacteria 744
1569 Ga0495581_0286146 3300047315 Bacteria 963
1570 Ga0495604_0223051 3300047317 Bacteria 1297
1571 Ga0495636_0002384 3300047318 Bacteria 7217
1572 Ga0495636_0207950 3300047318 Bacteria 895
1573 Ga0495636_0392301 3300047318 Bacteria 660
1574 Ga0495674_0225933 3300047319 Bacteria 1546
1575 Ga0495674_0344427 3300047319 Bacteria 1211
1576 Ga0495674_0364505 3300047319 Bacteria 1171
1577 Ga0495674_0513669 3300047319 Bacteria 957
1578 Ga0495672_0088102 3300047320 Bacteria 1712
1579 Ga0495676_0264865 3300047321 Bacteria 1168
1580 Ga0495680_0069116 3300047322 Bacteria 2696
1581 Ga0495675_0232880 3300047444 Bacteria 1111
1582 Ga0495684_0762795 3300047471 Bacteria 635
1583 Ga0495593_0316955 3300047673 Bacteria 780
1584 Ga0495615_0172109 3300048090 Bacteria 656
1585 Ga0496100_0004796 3300048903 Bacteria 7222
1586 Ga0496100_0366146 3300048903 Bacteria 1092
1587 Ga0496100_0382037 3300048903 Bacteria 1070
1588 Ga0496100_0687195 3300048903 Bacteria 798
1589 Ga0496101_0000396 3300048904 Bacteria 28444
1590 Ga0496101_0029477 3300048904 Bacteria 3838
1591 Ga0496101_0181057 3300048904 Bacteria 1623
1592 Ga0496101_0215176 3300048904 Bacteria 1490
1593 Ga0496101_0402930 3300048904 Bacteria 1077
1594 Ga0496101_0410402 3300048904 Bacteria 1067
1595 Ga0496101_0425109 3300048904 Bacteria 1047
1596 Ga0496102_0002334 3300048905 Bacteria 16195
1597 Ga0496102_0164766 3300048905 Bacteria 2086
1598 Ga0496102_0219233 3300048905 Bacteria 1793
1599 Ga0496102_0234216 3300048905 Bacteria 1731
1600 Ga0496102_0246276 3300048905 Bacteria 1685
1601 Ga0496102_0727657 3300048905 Bacteria 915
1602 Ga0496102_1101616 3300048905 Bacteria 714
1603 Ga0496103_0289329 3300048906 Bacteria 1054
1604 Ga0496103_0366714 3300048906 Bacteria 926
1605 Ga0496104_0002699 3300048907 Bacteria 15275
1606 Ga0496104_0014503 3300048907 Bacteria 7118
1607 Ga0496104_0015461 3300048907 Bacteria 6911
1608 Ga0496104_0021813 3300048907 Bacteria 5883
1609 Ga0496104_0083357 3300048907 Bacteria 3049
1610 Ga0496104_0169675 3300048907 Bacteria 2092
1611 Ga0496104_0379989 3300048907 Bacteria 1325
1612 Ga0496104_0720055 3300048907 Bacteria 905
1613 Ga0496105_0089711 3300048908 Bacteria 2540
1614 Ga0496105_0105843 3300048908 Bacteria 2322
1615 Ga0496105_0162182 3300048908 Bacteria 1835
1616 Ga0496105_0212809 3300048908 Bacteria 1575
1617 Ga0496106_0019828 3300048909 Bacteria 4986
1618 Ga0496106_0058558 3300048909 Bacteria 2917
1619 Ga0496106_0264255 3300048909 Bacteria 1377
1620 Ga0496106_0447819 3300048909 Bacteria 1037
1621 Ga0496106_0465220 3300048909 Bacteria 1016
1622 Ga0496107_0031098 3300048910 Bacteria 3807
1623 Ga0496107_0330833 3300048910 Bacteria 1134
1624 Ga0496107_0380450 3300048910 Bacteria 1050
1625 Ga0496107_0474855 3300048910 Bacteria 928
1626 Ga0496107_0605056 3300048910 Bacteria 810
1627 Ga0496108_0011060 3300048911 Bacteria 7328
1628 Ga0496108_0039080 3300048911 Bacteria 3955
1629 Ga0496108_0137002 3300048911 Bacteria 2107
1630 Ga0496108_0375295 3300048911 Bacteria 1242
1631 Ga0496108_0432665 3300048911 Bacteria 1149
1632 Ga0496108_0501720 3300048911 Bacteria 1060
1633 Ga0496109_0001514 3300048912 Bacteria 19323
1634 Ga0496109_0159807 3300048912 Bacteria 2111
1635 Ga0496109_0184229 3300048912 Bacteria 1962
1636 Ga0496109_0360754 3300048912 Bacteria 1373
1637 Ga0496109_0423303 3300048912 Bacteria 1258
1638 Ga0496109_0826534 3300048912 Bacteria 864
1639 Ga0496109_0922402 3300048912 Bacteria 811
1640 Ga0496109_1165469 3300048912 Bacteria 707
1641 Ga0496110_0015263 3300048913 Bacteria 6388
1642 Ga0496110_0152762 3300048913 Bacteria 2091
1643 Ga0496110_0241917 3300048913 Bacteria 1642
1644 Ga0496110_0594849 3300048913 Bacteria 1004
1645 Ga0496110_1215116 3300048913 Bacteria 663
1646 Ga0496111_0027389 3300048914 Bacteria 4032
1647 Ga0496111_0331344 3300048914 Bacteria 1127
1648 Ga0496111_0607052 3300048914 Bacteria 801
1649 Ga0496112_0002153 3300048915 Bacteria 15650
1650 Ga0496112_0046122 3300048915 Bacteria 4273
1651 Ga0496112_0055326 3300048915 Bacteria 3901
1652 Ga0496112_0069136 3300048915 Bacteria 3488
1653 Ga0496112_0165394 3300048915 Bacteria 2178
1654 Ga0496112_0172476 3300048915 Bacteria 2128
1655 Ga0496112_0196906 3300048915 Bacteria 1975
1656 Ga0496112_0222947 3300048915 Bacteria 1841
1657 Ga0496112_0460455 3300048915 Bacteria 1209
1658 Ga0496112_0557841 3300048915 Bacteria 1079
1659 Ga0496112_0629340 3300048915 Bacteria 1004
1660 Ga0496113_0006726 3300048916 Bacteria 7324
1661 Ga0496113_0045212 3300048916 Bacteria 3265
1662 Ga0496113_0185984 3300048916 Bacteria 1648
1663 Ga0496113_0371949 3300048916 Bacteria 1147
1664 Ga0496113_0513036 3300048916 Bacteria 962
1665 Ga0496113_0541207 3300048916 Bacteria 934
1666 Ga0496114_0000246 3300048917 Bacteria 39480
1667 Ga0496114_0013645 3300048917 Bacteria 6514
1668 Ga0496114_0063145 3300048917 Bacteria 3101
1669 Ga0496114_0152111 3300048917 Bacteria 2008
1670 Ga0496114_0206262 3300048917 Bacteria 1723
1671 Ga0496114_0231201 3300048917 Bacteria 1624
1672 Ga0496114_0256738 3300048917 Bacteria 1538
1673 Ga0496114_0316093 3300048917 Bacteria 1380
1674 Ga0496114_0438645 3300048917 Bacteria 1157
1675 Ga0496114_0480816 3300048917 Bacteria 1099
1676 Ga0496115_0031358 3300048918 Bacteria 4189
1677 Ga0496115_0203505 3300048918 Bacteria 1635
1678 Ga0501291_023051 3300049514 Bacteria 1004
1679 Ga0501292_076083 3300049515 Bacteria 632
1680 Ga0501293_029053 3300049516 Bacteria 583
1681 Ga0501296_013170 3300049519 Bacteria 1005
1682 Ga0501299_009069 3300049522 Bacteria 1632
1683 Ga0501031_0043373 3300049568 Bacteria 2935
1684 Ga0501031_0073573 3300049568 Bacteria 2225
1685 Ga0501031_0267930 3300049568 Bacteria 1109
1686 Ga0501031_0288261 3300049568 Bacteria 1065
1687 Ga0501031_0337596 3300049568 Bacteria 976
1688 Ga0501031_0643177 3300049568 Bacteria 682
1689 Ga0501032_0054572 3300049569 Bacteria 2689
1690 Ga0501032_0067399 3300049569 Bacteria 2390
1691 Ga0501032_0148425 3300049569 Bacteria 1542
1692 Ga0501032_0292881 3300049569 Bacteria 1053
1693 Ga0501033_0010156 3300049570 Bacteria 7228
1694 Ga0501033_0017769 3300049570 Bacteria 5370
1695 Ga0501033_0249266 3300049570 Bacteria 1259
1696 Ga0501033_0328211 3300049570 Bacteria 1074
1697 Ga0501034_0013252 3300049571 Bacteria 8494
1698 Ga0501034_0026702 3300049571 Bacteria 5875
1699 Ga0501034_0031932 3300049571 Bacteria 5349
1700 Ga0501034_0035468 3300049571 Bacteria 5056
1701 Ga0501034_0098192 3300049571 Bacteria 2924
1702 Ga0501034_0123450 3300049571 Bacteria 2575
1703 Ga0501034_0181183 3300049571 Bacteria 2071
1704 Ga0501034_0307864 3300049571 Bacteria 1519
1705 Ga0501034_0523445 3300049571 Bacteria 1097
1706 Ga0501034_0544910 3300049571 Bacteria 1070
1707 Ga0501036_0011660 3300049572 Bacteria 7284
1708 Ga0501036_0030598 3300049572 Bacteria 4546
1709 Ga0501036_0057133 3300049572 Bacteria 3305
1710 Ga0501036_0089808 3300049572 Bacteria 2596
1711 Ga0501036_0215663 3300049572 Bacteria 1612
1712 Ga0501036_0294508 3300049572 Bacteria 1357
1713 Ga0501036_0383121 3300049572 Bacteria 1173
1714 Ga0501037_0035865 3300049573 Bacteria 3654
1715 Ga0501037_0369197 3300049573 Bacteria 987
1716 Ga0501038_0060881 3300049574 Bacteria 3229
1717 Ga0501038_0100507 3300049574 Bacteria 2409
1718 Ga0501038_0390261 3300049574 Bacteria 1079
1719 Ga0501039_0039586 3300049575 Bacteria 3640
1720 Ga0501039_0123895 3300049575 Bacteria 2026
1721 Ga0501039_0140837 3300049575 Bacteria 1895
1722 Ga0501039_0151380 3300049575 Bacteria 1822
1723 Ga0501039_0912668 3300049575 Bacteria 683
1724 Ga0501040_0221528 3300049576 Bacteria 1346
1725 Ga0501040_0252242 3300049576 Bacteria 1259
1726 Ga0501041_0035058 3300049577 Bacteria 3040
1727 Ga0501041_0061920 3300049577 Bacteria 2291
1728 Ga0501041_0168357 3300049577 Bacteria 1371
1729 Ga0501041_0231293 3300049577 Bacteria 1161
1730 Ga0501041_0267909 3300049577 Bacteria 1074
1731 Ga0501041_0325199 3300049577 Bacteria 970
1732 Ga0501041_0336126 3300049577 Bacteria 954
1733 Ga0501041_0669749 3300049577 Bacteria 663
1734 Ga0501041_0746652 3300049577 Bacteria 627
1735 Ga0501042_0009478 3300049578 Bacteria 6489
1736 Ga0501042_0050664 3300049578 Bacteria 2961
1737 Ga0501042_0121338 3300049578 Bacteria 1882
1738 Ga0501042_0173184 3300049578 Bacteria 1557
1739 Ga0501042_0187599 3300049578 Bacteria 1492
1740 Ga0501042_0271926 3300049578 Bacteria 1223
1741 Ga0501042_0480827 3300049578 Bacteria 901
1742 Ga0501042_0762196 3300049578 Bacteria 704
1743 Ga0501043_0034818 3300049579 Bacteria 3960
1744 Ga0501043_0070968 3300049579 Bacteria 2736
1745 Ga0501043_0126335 3300049579 Bacteria 2005
1746 Ga0501043_0160054 3300049579 Bacteria 1759
1747 Ga0501046_0022396 3300049580 Bacteria 5204
1748 Ga0501046_0030233 3300049580 Bacteria 4397
1749 Ga0501046_0147309 3300049580 Bacteria 1777
1750 Ga0501047_0007192 3300049581 Bacteria 10461
1751 Ga0501047_0008209 3300049581 Bacteria 9860
1752 Ga0501047_0025664 3300049581 Bacteria 5666
1753 Ga0501047_0032236 3300049581 Bacteria 5057
1754 Ga0501047_0033605 3300049581 Bacteria 4950
1755 Ga0501047_0053218 3300049581 Bacteria 3913
1756 Ga0501047_0061080 3300049581 Bacteria 3636
1757 Ga0501047_0092564 3300049581 Bacteria 2901
1758 Ga0501048_0027688 3300049582 Bacteria 4116
1759 Ga0501048_0050069 3300049582 Bacteria 2975
1760 Ga0501048_0054176 3300049582 Bacteria 2849
1761 Ga0501048_0065073 3300049582 Bacteria 2578
1762 Ga0501048_0123213 3300049582 Bacteria 1832
1763 Ga0501048_0165784 3300049582 Bacteria 1564
1764 Ga0501048_0197312 3300049582 Bacteria 1426
1765 Ga0501048_0228115 3300049582 Bacteria 1321
1766 Ga0501048_0967210 3300049582 Bacteria 612
1767 Ga0501067_0015088 3300049583 Bacteria 4275
1768 Ga0501067_0049579 3300049583 Bacteria 2326
1769 Ga0501067_0322947 3300049583 Bacteria 859
1770 Ga0501068_0008979 3300049584 Bacteria 5577
1771 Ga0501068_0019337 3300049584 Bacteria 3953
1772 Ga0501068_0030055 3300049584 Bacteria 3220
1773 Ga0501068_0155925 3300049584 Bacteria 1437
1774 Ga0501068_0216169 3300049584 Bacteria 1218
1775 Ga0501068_0341021 3300049584 Bacteria 962
1776 Ga0501068_0412514 3300049584 Bacteria 871
1777 Ga0501069_0001595 3300049585 Bacteria 11218
1778 Ga0501069_0031141 3300049585 Bacteria 2932
1779 Ga0501069_0184857 3300049585 Bacteria 1205
1780 Ga0501069_0299174 3300049585 Bacteria 943
1781 Ga0501070_0012118 3300049586 Bacteria 7277
1782 Ga0501070_0014951 3300049586 Bacteria 6529
1783 Ga0501070_0171737 3300049586 Bacteria 1785
1784 Ga0501070_0189507 3300049586 Bacteria 1691
1785 Ga0501071_0002536 3300049587 Bacteria 11118
1786 Ga0501071_0338803 3300049587 Bacteria 1143
1787 Ga0501071_0349023 3300049587 Bacteria 1126
1788 Ga0501071_0388828 3300049587 Bacteria 1064
1789 Ga0501071_0443512 3300049587 Bacteria 993
1790 Ga0501071_0469731 3300049587 Bacteria 964
1791 Ga0501071_0547828 3300049587 Bacteria 888
1792 Ga0501072_0012080 3300049588 Bacteria 6597
1793 Ga0501072_0013067 3300049588 Bacteria 6354
1794 Ga0501072_0095139 3300049588 Bacteria 2367
1795 Ga0501072_0101866 3300049588 Bacteria 2282
1796 Ga0501072_0102741 3300049588 Bacteria 2272
1797 Ga0501072_0424619 3300049588 Bacteria 1054
1798 Ga0501073_0004894 3300049589 Bacteria 10051
1799 Ga0501073_0052788 3300049589 Bacteria 2846
1800 Ga0501073_0091800 3300049589 Bacteria 2110
1801 Ga0501073_0131275 3300049589 Bacteria 1736
1802 Ga0501073_0248770 3300049589 Bacteria 1227
1803 Ga0501073_0333679 3300049589 Bacteria 1047
1804 Ga0501073_0355491 3300049589 Bacteria 1011
1805 Ga0501073_0661020 3300049589 Bacteria 721
1806 Ga0501074_0005968 3300049590 Bacteria 8787
1807 Ga0501074_0111424 3300049590 Bacteria 1958
1808 Ga0501074_0190566 3300049590 Bacteria 1462
1809 Ga0501074_0284823 3300049590 Bacteria 1174
1810 Ga0501075_0044834 3300049591 Bacteria 3318
1811 Ga0501075_0082026 3300049591 Bacteria 2442
1812 Ga0501075_0095949 3300049591 Bacteria 2250
1813 Ga0501075_0119064 3300049591 Bacteria 2008
1814 Ga0501075_0171793 3300049591 Bacteria 1654
1815 Ga0501075_0287430 3300049591 Bacteria 1253
1816 Ga0501075_0359146 3300049591 Bacteria 1110
1817 Ga0501075_0674481 3300049591 Bacteria 788
1818 Ga0501076_0022347 3300049592 Bacteria 4862
1819 Ga0501076_0099638 3300049592 Bacteria 2341
1820 Ga0501076_0102721 3300049592 Bacteria 2305
1821 Ga0501076_0111850 3300049592 Bacteria 2208
1822 Ga0501076_0114579 3300049592 Bacteria 2182
1823 Ga0501076_0129675 3300049592 Bacteria 2045
1824 Ga0501076_0628777 3300049592 Bacteria 886
1825 Ga0501077_0054477 3300049593 Bacteria 2540
1826 Ga0501202_035075 3300049652 Bacteria 1063
1827 Ga0501209_040504 3300049656 Bacteria 1230
1828 Ga0501216_044425 3300049660 Bacteria 858
1829 Ga0501217_051587 3300049661 Bacteria 1077
1830 Ga0501235_031096 3300049669 Bacteria 1205
1831 Ga0501249_146244 3300049679 Bacteria 592
1832 Ga0501225_0085627 3300049705 Bacteria 909
1833 Ga0501225_0174579 3300049705 Bacteria 668
1834 Ga0501079_0018519 3300049741 Bacteria 5320
1835 Ga0501079_0021349 3300049741 Bacteria 4952
1836 Ga0501079_0038135 3300049741 Bacteria 3706
1837 Ga0501079_0068731 3300049741 Bacteria 2734
1838 Ga0501079_0072836 3300049741 Bacteria 2655
1839 Ga0501079_0147420 3300049741 Bacteria 1834
1840 Ga0501079_0188310 3300049741 Bacteria 1610
1841 Ga0501079_0228349 3300049741 Bacteria 1454
1842 Ga0501079_0268723 3300049741 Bacteria 1333
1843 Ga0501079_0356038 3300049741 Bacteria 1147
1844 Ga0501079_0452924 3300049741 Bacteria 1008
1845 Ga0501080_0049182 3300049742 Bacteria 3924
1846 Ga0501080_0052652 3300049742 Bacteria 3789
1847 Ga0501080_0057688 3300049742 Bacteria 3615
1848 Ga0501080_0075641 3300049742 Bacteria 3132
1849 Ga0501080_0086218 3300049742 Bacteria 2917
1850 Ga0501080_0088731 3300049742 Bacteria 2872
1851 Ga0501080_0181947 3300049742 Bacteria 1933
1852 Ga0501080_0243581 3300049742 Bacteria 1640
1853 Ga0501080_0254913 3300049742 Bacteria 1600
1854 Ga0501080_0258166 3300049742 Bacteria 1588
1855 Ga0501080_0682871 3300049742 Bacteria 907
1856 Ga0501081_0020963 3300049743 Bacteria 4361
1857 Ga0501081_0048503 3300049743 Bacteria 2923
1858 Ga0501081_0086874 3300049743 Bacteria 2196
1859 Ga0501081_0307755 3300049743 Bacteria 1163
1860 Ga0501081_0444570 3300049743 Bacteria 963
1861 Ga0501081_0483710 3300049743 Bacteria 922
1862 Ga0501081_0489325 3300049743 Bacteria 916
1863 Ga0501081_0497693 3300049743 Bacteria 908
1864 Ga0501081_0805258 3300049743 Bacteria 707
1865 Ga0501083_0018519 3300049744 Bacteria 4852
1866 Ga0501083_0032228 3300049744 Bacteria 3595
1867 Ga0501083_0081846 3300049744 Bacteria 2140
1868 Ga0501083_0082866 3300049744 Bacteria 2124
1869 Ga0501083_0190089 3300049744 Bacteria 1340
1870 Ga0501083_0277863 3300049744 Bacteria 1089
1871 Ga0501083_0813819 3300049744 Bacteria 608
1872 Ga0501035_0031573 3300049822 Bacteria 4823
1873 Ga0501035_0125804 3300049822 Bacteria 2237
1874 Ga0501035_0209539 3300049822 Bacteria 1668
1875 Ga0501035_0957258 3300049822 Bacteria 675
1876 Ga0501044_0003452 3300049823 Bacteria 17800
1877 Ga0501044_0075438 3300049823 Bacteria 3423
1878 Ga0501044_0557394 3300049823 Bacteria 1042
1879 Ga0501044_0666082 3300049823 Bacteria 928
1880 Ga0501045_0031277 3300049824 Bacteria 3855
1881 Ga0501045_0051561 3300049824 Bacteria 3003
1882 Ga0501045_0207264 3300049824 Bacteria 1460
1883 Ga0501045_0253934 3300049824 Bacteria 1309
1884 Ga0501045_0336872 3300049824 Bacteria 1123
1885 nmdc:mga00v17_14500_c1 3300050491 Bacteria 4401
1886 nmdc:mga06z11_18170_c1 3300050494 Bacteria 3207
1887 nmdc:mga04h51_32128_c1 3300050495 Bacteria 1663
1888 nmdc:mga05p37_11036_c1 3300050507 Bacteria 10734
1889 nmdc:mga05p37_1269119_c1 3300050507 Bacteria 754
1890 nmdc:mga05p37_1346306_c1 3300050507 Bacteria 724
1891 nmdc:mga05p37_1426373_c1 3300050507 Bacteria 695
1892 nmdc:mga05p37_154199_c1 3300050507 Bacteria 2808
1893 nmdc:mga05p37_158310_c1 3300050507 Bacteria 2767
1894 nmdc:mga05p37_17386_c1 3300050507 Bacteria 8676
1895 nmdc:mga05p37_18820_c1 3300050507 Bacteria 8346
1896 nmdc:mga05p37_192822_c1 3300050507 Bacteria 2473
1897 nmdc:mga05p37_199866_c1 3300050507 Bacteria 2422
1898 nmdc:mga05p37_2249_c1 3300050507 Bacteria 22479
1899 nmdc:mga05p37_250653_c1 3300050507 Bacteria 2124
1900 nmdc:mga05p37_252783_c1 3300050507 Bacteria 2113
1901 nmdc:mga05p37_324604_c1 3300050507 Bacteria 1821
1902 nmdc:mga05p37_442_c2 3300050507 Bacteria 3896
1903 nmdc:mga05p37_4833_c1 3300050507 Bacteria 15759
1904 nmdc:mga05p37_529385_c1 3300050507 Bacteria 1346
1905 nmdc:mga05p37_551470_c1 3300050507 Bacteria 1312
1906 nmdc:mga05p37_555890_c1 3300050507 Bacteria 1305
1907 nmdc:mga05p37_57020_c1 3300050507 Bacteria 4811
1908 nmdc:mga05p37_58588_c1 3300050507 Bacteria 4743
1909 nmdc:mga05p37_595_c1 3300050507 Bacteria 25325
1910 nmdc:mga05p37_742081_c1 3300050507 Bacteria 1084
1911 nmdc:mga05p37_808529_c1 3300050507 Bacteria 1024
1912 nmdc:mga05p37_811014_c1 3300050507 Bacteria 1022
1913 nmdc:mga05p37_838889_c1 3300050507 Bacteria 1000
1914 nmdc:mga05p37_84446_c1 3300050507 Bacteria 3912
1915 nmdc:mga09592_120146_c1 3300050508 Bacteria 2257
1916 nmdc:mga09592_26926_c1 3300050508 Bacteria 4767
1917 nmdc:mga09592_302004_c1 3300050508 Bacteria 1388
1918 nmdc:mga09592_339628_c1 3300050508 Bacteria 1300
1919 nmdc:mga09592_430610_c1 3300050508 Bacteria 1139
1920 nmdc:mga09592_481847_c1 3300050508 Bacteria 1069
1921 nmdc:mga09592_97790_c1 3300050508 Bacteria 2512
1922 nmdc:mga0qj67_15565_c1 3300050509 Bacteria 4645
1923 nmdc:mga0qj67_165452_c1 3300050509 Bacteria 1795
1924 nmdc:mga0qj67_22250_c1 3300050509 Bacteria 4869
1925 nmdc:mga0qj67_224752_c1 3300050509 Bacteria 1524
1926 nmdc:mga0qj67_2372_c1 3300050509 Bacteria 13411
1927 nmdc:mga0qj67_325247_c1 3300050509 Bacteria 1245
1928 nmdc:mga0qj67_4157_c1 3300050509 Bacteria 10490
1929 nmdc:mga0qj67_564347_c1 3300050509 Bacteria 912
1930 nmdc:mga0qj67_665977_c1 3300050509 Bacteria 830
1931 nmdc:mga0qj67_731210_c1 3300050509 Bacteria 786
1932 nmdc:mga06r32_193106_c1 3300050510 Bacteria 2023
1933 nmdc:mga06r32_274980_c1 3300050510 Bacteria 1672
1934 nmdc:mga06r32_418267_c1 3300050510 Bacteria 1322
1935 nmdc:mga06r32_460045_c1 3300050510 Bacteria 1251
1936 nmdc:mga06r32_550438_c1 3300050510 Bacteria 1128
1937 nmdc:mga06r32_712509_c1 3300050510 Bacteria 969
1938 nmdc:mga06r32_79535_c1 3300050510 Bacteria 3189
1939 nmdc:mga06r32_85956_c1 3300050510 Bacteria 3067
1940 nmdc:mga06r32_9166_c1 3300050510 Bacteria 8919
1941 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
1942 nmdc:mga08y16_13623_c1 3300050511 Bacteria 8559
1943 nmdc:mga08y16_155_c1 3300050511 Bacteria 31746
1944 nmdc:mga08y16_16207_c1 3300050511 Bacteria 7835
1945 nmdc:mga08y16_165837_c1 3300050511 Bacteria 2295
1946 nmdc:mga08y16_202_c1 3300050511 Bacteria 53486
1947 nmdc:mga08y16_20665_c1 3300050511 Bacteria 6949
1948 nmdc:mga08y16_242231_c2 3300050511 Bacteria 1157
1949 nmdc:mga08y16_358929_c1 3300050511 Bacteria 1496
1950 nmdc:mga08y16_373375_c1 3300050511 Bacteria 1084
1951 nmdc:mga08y16_420500_c1 3300050511 Bacteria 1366
1952 nmdc:mga08y16_59755_c1 3300050511 Bacteria 3982
1953 nmdc:mga08y16_69932_c1 3300050511 Bacteria 3659
1954 nmdc:mga08y16_707160_c1 3300050511 Bacteria 1007
1955 nmdc:mga08y16_83813_c1 3300050511 Bacteria 3323
1956 nmdc:mga0n895_1039503_c1 3300050512 Bacteria 799
1957 nmdc:mga0n895_1194231_c1 3300050512 Bacteria 735
1958 nmdc:mga0n895_1295565_c1 3300050512 Bacteria 700
1959 nmdc:mga0n895_159380_c1 3300050512 Bacteria 2288
1960 nmdc:mga0n895_17757_c1 3300050512 Bacteria 6566
1961 nmdc:mga0n895_21313_c1 3300050512 Bacteria 6056
1962 nmdc:mga0n895_24421_c1 3300050512 Bacteria 5697
1963 nmdc:mga0n895_29459_c1 3300050512 Bacteria 5237
1964 nmdc:mga0n895_36985_c1 3300050512 Bacteria 4719
1965 nmdc:mga0n895_440066_c1 3300050512 Bacteria 1317
1966 nmdc:mga0n895_7101_c1 3300050512 Bacteria 9574
1967 nmdc:mga0n895_83582_c1 3300050512 Bacteria 3185
1968 nmdc:mga0n895_90701_c1 3300050512 Bacteria 3058
1969 nmdc:mga0n895_987225_c1 3300050512 Bacteria 824
1970 nmdc:mga0rr50_130334_c1 3300050513 Bacteria 2013
1971 nmdc:mga0rr50_1773_c1 3300050513 Bacteria 11923
1972 nmdc:mga0rr50_185897_c1 3300050513 Bacteria 1701
1973 nmdc:mga0rr50_1983_c1 3300050513 Bacteria 11375
1974 nmdc:mga0rr50_261472_c1 3300050513 Bacteria 1440
1975 nmdc:mga0rr50_287992_c1 3300050513 Bacteria 1372
1976 nmdc:mga0rr50_32050_c1 3300050513 Bacteria 3740
1977 nmdc:mga0rr50_37105_c1 3300050513 Bacteria 3515
1978 nmdc:mga0rr50_373_c1 3300050513 Bacteria 24506
1979 nmdc:mga0rr50_404836_c1 3300050513 Bacteria 1153
1980 nmdc:mga0rr50_43434_c1 3300050513 Bacteria 3290
1981 nmdc:mga0rr50_440346_c1 3300050513 Bacteria 1104
1982 nmdc:mga0rr50_8258_c1 3300050513 Bacteria 6472
1983 nmdc:mga08x19_10007_c1 3300050514 Bacteria 5684
1984 nmdc:mga08x19_124254_c1 3300050514 Bacteria 1732
1985 nmdc:mga08x19_228724_c1 3300050514 Bacteria 1280
1986 nmdc:mga08x19_30264_c1 3300050514 Bacteria 3400
1987 nmdc:mga08x19_78601_c1 3300050514 Bacteria 2162
1988 nmdc:mga08x19_95027_c1 3300050514 Bacteria 1972
1989 nmdc:mga0a205_10220_c1 3300050515 Bacteria 8622
1990 nmdc:mga0a205_14317_c1 3300050515 Bacteria 7396
1991 nmdc:mga0a205_164147_c1 3300050515 Bacteria 2117
1992 nmdc:mga0a205_177662_c1 3300050515 Bacteria 2024
1993 nmdc:mga0a205_183676_c1 3300050515 Bacteria 1985
1994 nmdc:mga0a205_2239_c1 3300050515 Bacteria 17045
1995 nmdc:mga0a205_3001_c1 3300050515 Bacteria 14958
1996 nmdc:mga0a205_301479_c1 3300050515 Bacteria 1475
1997 nmdc:mga0a205_3048_c1 3300050515 Bacteria 14858
1998 nmdc:mga0a205_334780_c1 3300050515 Bacteria 1383
1999 nmdc:mga0a205_45628_c1 3300050515 Bacteria 4226
2000 nmdc:mga0a205_6655_c1 3300050515 Bacteria 10458
2001 nmdc:mga0a205_69911_c1 3300050515 Bacteria 3390
2002 nmdc:mga0a205_7364_c1 3300050515 Bacteria 9967
2003 nmdc:mga0a205_7753_c2 3300050515 Bacteria 5583
2004 Ga0495601_0139220 3300053077 Bacteria 1582
2005 Ga0495595_0091960 3300053084 Bacteria 1456
2006 Ga0495595_0096054 3300053084 Bacteria 1426
2007 Ga0495619_0056922 3300053085 Bacteria 2593
2008 Ga0495619_0090666 3300053085 Bacteria 2069
2009 Ga0495619_0188061 3300053085 Bacteria 1429
2010 Ga0500555_000474 3300053103 Bacteria 16656
2011 Ga0500592_001961 3300053116 Bacteria 3308
2012 Ga0500658_0086584 3300053134 Bacteria 1348
2013 Ga0500616_0000173 3300053153 Bacteria 107646
2014 Ga0500645_002162 3300053730 Bacteria 9009
2015 Ga0501084_0029531 3300054114 Bacteria 4586
2016 Ga0501084_0033473 3300054114 Bacteria 4299
2017 Ga0501084_0035989 3300054114 Bacteria 4137
2018 Ga0501084_0139356 3300054114 Bacteria 2042
2019 Ga0501084_0282971 3300054114 Bacteria 1400
2020 Ga0501084_0287940 3300054114 Bacteria 1387
2021 Ga0501084_0801611 3300054114 Bacteria 793
2022 Ga0590071_000004 3300059421 Bacteria 63957
2023 Ga0590074_000940 3300059423 Bacteria 4567
2024 Ga0590075_000034 3300059424 Bacteria 36053
2025 Ga0590075_037092 3300059424 Bacteria 1242
2026 Ga0590075_110101 3300059424 Bacteria 719
2027 Ga0590077_000015 3300059426 Bacteria 38773
2028 Ga0587084_035846 3300059477 Bacteria 821
2029 Ga0587083_0106660 3300059505 Bacteria 706
2030 Ga0587091_010024 3300059511 Bacteria 1441
2031 Ga0587128_004306 3300059630 Bacteria 1642
2032 Ga0587067_008021 3300059640 Bacteria 1530
2033 Ga0587114_024982 3300059655 Bacteria 873
2034 Ga0501082_0030758 3300060353 Bacteria 4627
2035 Ga0501082_0042145 3300060353 Bacteria 3935
2036 Ga0501082_0067692 3300060353 Bacteria 3076
2037 Ga0501082_0071934 3300060353 Bacteria 2978
2038 Ga0501082_0082568 3300060353 Bacteria 2773
2039 Ga0501082_0126266 3300060353 Bacteria 2219
2040 Ga0501082_0132322 3300060353 Bacteria 2164
2041 Ga0501082_0229652 3300060353 Bacteria 1615
2042 Ga0501082_0421528 3300060353 Bacteria 1165
2043 Ga0501082_0516312 3300060353 Bacteria 1044
2044 Ga0501082_0617786 3300060353 Bacteria 948
2045 Ga0530510_0153816 3300061734 Bacteria 1699
2046 Ga0530510_0167544 3300061734 Bacteria 1627
2047 Ga0530510_0186296 3300061734 Bacteria 1540
2048 Ga0530510_0188385 3300061734 Bacteria 1531
2049 Ga0530510_0212203 3300061734 Bacteria 1438
2050 Ga0530510_0911693 3300061734 Bacteria 672
2051 Ga0530510_1014446 3300061734 Bacteria 635

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_1269119_c1 nmdc:mga05p37_1269119_c1_75_644 142
2 3300025885 Ga0207653_10102303 Ga0207653_101023031 163
3 3300002459 JGI24751J29686_10012861 JGI24751J29686_100128612 179
4 3300004800 Ga0058861_11903853 Ga0058861_119038536 179
5 3300004803 Ga0058862_12487049 Ga0058862_124870493 179
6 3300005290 Ga0065712_10010087 Ga0065712_100100872 179
7 3300005293 Ga0065715_10138442 Ga0065715_101384424 179
8 3300005327 Ga0070658_10436821 Ga0070658_104368211 179
9 3300005329 Ga0070683_100358473 Ga0070683_1003584733 179
10 3300005330 Ga0070690_100292770 Ga0070690_1002927703 179
11 3300005331 Ga0070670_100860500 Ga0070670_1008605002 179
12 3300005339 Ga0070660_100132985 Ga0070660_1001329854 179
13 3300005339 Ga0070660_100133779 Ga0070660_1001337795 179
14 3300005340 Ga0070689_100279762 Ga0070689_1002797623 179
15 3300005365 Ga0070688_101059510 Ga0070688_1010595101 179
16 3300005434 Ga0070709_10126229 Ga0070709_101262292 179
17 3300005456 Ga0070678_100021999 Ga0070678_1000219996 179
18 3300005458 Ga0070681_10019826 Ga0070681_100198261 179
19 3300005530 Ga0070679_100136935 Ga0070679_1001369354 179
20 3300005535 Ga0070684_100182829 Ga0070684_1001828293 179
21 3300005544 Ga0070686_100331513 Ga0070686_1003315133 179
22 3300005547 Ga0070693_100554615 Ga0070693_1005546151 179
23 3300005549 Ga0070704_100798777 Ga0070704_1007987771 179
24 3300005617 Ga0068859_100020008 Ga0068859_10002000810 179
25 3300005618 Ga0068864_100022274 Ga0068864_1000222747 179
26 3300005841 Ga0068863_100439209 Ga0068863_1004392093 179
27 3300005843 Ga0068860_100630748 Ga0068860_1006307482 179
28 3300006871 Ga0075434_100564501 Ga0075434_1005645012 179
29 3300006931 Ga0097620_100020008 Ga0097620_10002000810 179
30 3300009174 Ga0105241_10600700 Ga0105241_106007002 179
31 3300009177 Ga0105248_10173329 Ga0105248_101733293 179
32 3300009553 Ga0105249_11130991 Ga0105249_111309912 179
33 3300013105 Ga0157369_10738345 Ga0157369_107383452 179
34 3300014325 Ga0163163_10069167 Ga0163163_100691674 179
35 3300014326 Ga0157380_10286770 Ga0157380_102867702 179
36 3300025906 Ga0207699_11007994 Ga0207699_110079941 179
37 3300025912 Ga0207707_10027601 Ga0207707_100276013 179
38 3300025919 Ga0207657_10033272 Ga0207657_100332724 179
39 3300025919 Ga0207657_10124277 Ga0207657_101242772 179
40 3300025921 Ga0207652_10100995 Ga0207652_101009954 179
41 3300025925 Ga0207650_10247045 Ga0207650_102470452 179
42 3300026041 Ga0207639_10414445 Ga0207639_104144452 179
43 3300026095 Ga0207676_10103375 Ga0207676_101033754 179
44 3300026142 Ga0207698_10093502 Ga0207698_100935024 179
45 3300028379 Ga0268266_10414854 Ga0268266_104148542 179
46 3300028381 Ga0268264_10222150 Ga0268264_102221502 179
47 3300031995 Ga0307409_100772663 Ga0307409_1007726632 179
48 3300032005 Ga0307411_10652573 Ga0307411_106525731 179
49 3300034957 Ga0373938_0166466 Ga0373938_0166466_16_555 179
50 3300035086 Ga0373934_0034771 Ga0373934_0034771_26_565 179
51 3300035111 Ga0373923_0320815 Ga0373923_0320815_110_649 179
52 3300035113 Ga0373936_0085973 Ga0373936_0085973_323_862 179
53 3300035120 Ga0373957_0071947 Ga0373957_0071947_658_1197 179
54 3300035171 Ga0373946_0567824 Ga0373946_0567824_29_568 179
55 3300035172 Ga0373955_0491747 Ga0373955_0491747_31_570 179
56 3300035692 Ga0373935_0164739 Ga0373935_0164739_852_1391 179
57 3300035695 Ga0373927_0139946 Ga0373927_0139946_80_619 179
58 3300036401 Ga0373937_0749077 Ga0373937_0749077_239_778 179
59 3300037068 Ga0373925_1290745 Ga0373925_1290745_43_585 179
60 3300042876 Ga0451577_0375642 Ga0451577_0375642_126_665 179
61 3300045051 Ga0451576_0176092 Ga0451576_0176092_1528_2070 179
62 3300046455 Ga0495603_0142169 Ga0495603_0142169_786_1325 179
63 3300046473 Ga0495582_0210918 Ga0495582_0210918_96_635 179
64 3300046516 Ga0495628_0076916 Ga0495628_0076916_1358_1897 179
65 3300046535 Ga0495586_0110189 Ga0495586_0110189_113_652 179
66 3300046642 Ga0495634_0453174 Ga0495634_0453174_112_651 179
67 3300046678 Ga0495599_0476460 Ga0495599_0476460_151_690 179
68 3300046684 Ga0495669_0259747 Ga0495669_0259747_116_655 179
69 3300047317 Ga0495604_0223051 Ga0495604_0223051_39_578 179
70 3300047471 Ga0495684_0762795 Ga0495684_0762795_79_618 179
71 3300048090 Ga0495615_0172109 Ga0495615_0172109_64_603 179
72 3300048904 Ga0496101_0215176 Ga0496101_0215176_40_579 179
73 3300048904 Ga0496101_0410402 Ga0496101_0410402_61_600 179
74 3300048905 Ga0496102_0727657 Ga0496102_0727657_36_575 179
75 3300048907 Ga0496104_0014503 Ga0496104_0014503_1741_2280 179
76 3300048908 Ga0496105_0162182 Ga0496105_0162182_705_1244 179
77 3300048912 Ga0496109_0423303 Ga0496109_0423303_495_1034 179
78 3300048914 Ga0496111_0331344 Ga0496111_0331344_398_937 179
79 3300048915 Ga0496112_0055326 Ga0496112_0055326_3162_3701 179
80 3300048916 Ga0496113_0513036 Ga0496113_0513036_218_757 179
81 3300049568 Ga0501031_0337596 Ga0501031_0337596_319_858 179
82 3300049571 Ga0501034_0013252 Ga0501034_0013252_6301_6840 179
83 3300049571 Ga0501034_0026702 Ga0501034_0026702_3807_4346 179
84 3300049571 Ga0501034_0523445 Ga0501034_0523445_548_1087 179
85 3300049579 Ga0501043_0070968 Ga0501043_0070968_623_1162 179
86 3300049581 Ga0501047_0025664 Ga0501047_0025664_4423_4962 179
87 3300049589 Ga0501073_0333679 Ga0501073_0333679_275_814 179
88 3300049742 Ga0501080_0052652 Ga0501080_0052652_302_841 179
89 3300049823 Ga0501044_0003452 Ga0501044_0003452_3784_4323 179
90 3300050512 nmdc:mga0n895_90701_c1 nmdc:mga0n895_90701_c1_331_870 179
91 3300053085 Ga0495619_0090666 Ga0495619_0090666_195_734 179
92 3300001977 JGI24746J21847_1001976 JGI24746J21847_10019762 180
93 3300002073 JGI24745J21846_1002440 JGI24745J21846_10024404 180
94 3300003203 JGI25406J46586_10002509 JGI25406J46586_100025099 180
95 3300003203 JGI25406J46586_10005813 JGI25406J46586_100058139 180
96 3300003203 JGI25406J46586_10039381 JGI25406J46586_100393811 180
97 3300004798 Ga0058859_11652582 Ga0058859_116525823 180
98 3300004798 Ga0058859_11697584 Ga0058859_116975842 180
99 3300004798 Ga0058859_11813068 Ga0058859_118130687 180
100 3300004799 Ga0058863_11802767 Ga0058863_118027678 180
101 3300004800 Ga0058861_12002312 Ga0058861_120023122 180
102 3300004803 Ga0058862_12700202 Ga0058862_127002026 180
103 3300005288 Ga0065714_10083257 Ga0065714_100832576 180
104 3300005289 Ga0065704_10090418 Ga0065704_100904182 180
105 3300005289 Ga0065704_10096947 Ga0065704_100969472 180
106 3300005289 Ga0065704_10239005 Ga0065704_102390051 180
107 3300005290 Ga0065712_10001330 Ga0065712_1000133011 180
108 3300005290 Ga0065712_10004633 Ga0065712_100046334 180
109 3300005290 Ga0065712_10013832 Ga0065712_100138323 180
110 3300005290 Ga0065712_10015667 Ga0065712_100156673 180
111 3300005290 Ga0065712_10022058 Ga0065712_100220583 180
112 3300005290 Ga0065712_10086260 Ga0065712_100862605 180
113 3300005290 Ga0065712_10086282 Ga0065712_100862825 180
114 3300005290 Ga0065712_10087066 Ga0065712_100870661 180
115 3300005290 Ga0065712_10114021 Ga0065712_101140214 180
116 3300005290 Ga0065712_10146821 Ga0065712_101468214 180
117 3300005290 Ga0065712_10150444 Ga0065712_101504443 180
118 3300005290 Ga0065712_10154514 Ga0065712_101545142 180
119 3300005290 Ga0065712_10176922 Ga0065712_101769222 180
120 3300005290 Ga0065712_10288576 Ga0065712_102885762 180
121 3300005290 Ga0065712_10483187 Ga0065712_104831871 180
122 3300005290 Ga0065712_10490958 Ga0065712_104909581 180
123 3300005293 Ga0065715_10001104 Ga0065715_100011046 180
124 3300005293 Ga0065715_10032215 Ga0065715_100322153 180
125 3300005293 Ga0065715_10048432 Ga0065715_100484321 180
126 3300005293 Ga0065715_10093177 Ga0065715_100931772 180
127 3300005293 Ga0065715_10101878 Ga0065715_101018788 180
128 3300005293 Ga0065715_10124592 Ga0065715_101245923 180
129 3300005293 Ga0065715_10143176 Ga0065715_101431761 180
130 3300005293 Ga0065715_10152554 Ga0065715_101525543 180
131 3300005293 Ga0065715_10175760 Ga0065715_101757602 180
132 3300005293 Ga0065715_10323194 Ga0065715_103231941 180
133 3300005293 Ga0065715_10615396 Ga0065715_106153961 180
134 3300005293 Ga0065715_10800436 Ga0065715_108004361 180
135 3300005295 Ga0065707_10008221 Ga0065707_100082218 180
136 3300005295 Ga0065707_10013069 Ga0065707_100130694 180
137 3300005295 Ga0065707_10031519 Ga0065707_100315193 180
138 3300005295 Ga0065707_10089023 Ga0065707_100890234 180
139 3300005295 Ga0065707_10259744 Ga0065707_102597441 180
140 3300005295 Ga0065707_10373731 Ga0065707_103737311 180
141 3300005327 Ga0070658_10015417 Ga0070658_1001541710 180
142 3300005327 Ga0070658_10042651 Ga0070658_100426518 180
143 3300005328 Ga0070676_10007044 Ga0070676_100070442 180
144 3300005328 Ga0070676_10048987 Ga0070676_100489874 180
145 3300005328 Ga0070676_10055003 Ga0070676_100550033 180
146 3300005328 Ga0070676_10141326 Ga0070676_101413264 180
147 3300005329 Ga0070683_100000726 Ga0070683_10000072621 180
148 3300005329 Ga0070683_100263794 Ga0070683_1002637942 180
149 3300005330 Ga0070690_100009989 Ga0070690_10000998910 180
150 3300005330 Ga0070690_100022497 Ga0070690_1000224976 180
151 3300005330 Ga0070690_100028596 Ga0070690_1000285967 180
152 3300005330 Ga0070690_100030373 Ga0070690_1000303734 180
153 3300005330 Ga0070690_100080654 Ga0070690_1000806544 180
154 3300005330 Ga0070690_100291890 Ga0070690_1002918902 180
155 3300005330 Ga0070690_100494982 Ga0070690_1004949822 180
156 3300005331 Ga0070670_100014012 Ga0070670_10001401211 180
157 3300005331 Ga0070670_100048150 Ga0070670_1000481503 180
158 3300005331 Ga0070670_100073134 Ga0070670_1000731343 180
159 3300005331 Ga0070670_100200994 Ga0070670_1002009945 180
160 3300005331 Ga0070670_100233025 Ga0070670_1002330253 180
161 3300005331 Ga0070670_100325326 Ga0070670_1003253262 180
162 3300005331 Ga0070670_100328550 Ga0070670_1003285502 180
163 3300005331 Ga0070670_100333402 Ga0070670_1003334023 180
164 3300005331 Ga0070670_100606716 Ga0070670_1006067162 180
165 3300005331 Ga0070670_101281521 Ga0070670_1012815211 180
166 3300005333 Ga0070677_10008644 Ga0070677_100086444 180
167 3300005333 Ga0070677_10039428 Ga0070677_100394284 180
168 3300005333 Ga0070677_10169573 Ga0070677_101695733 180
169 3300005334 Ga0068869_100038779 Ga0068869_1000387794 180
170 3300005334 Ga0068869_100069288 Ga0068869_1000692883 180
171 3300005334 Ga0068869_100353204 Ga0068869_1003532042 180
172 3300005334 Ga0068869_100386929 Ga0068869_1003869291 180
173 3300005335 Ga0070666_10043493 Ga0070666_100434936 180
174 3300005335 Ga0070666_10057819 Ga0070666_100578193 180
175 3300005335 Ga0070666_10060248 Ga0070666_100602485 180
176 3300005335 Ga0070666_10063054 Ga0070666_100630542 180
177 3300005335 Ga0070666_10085832 Ga0070666_100858324 180
178 3300005335 Ga0070666_10090128 Ga0070666_100901285 180
179 3300005335 Ga0070666_10100165 Ga0070666_101001651 180
180 3300005335 Ga0070666_10179183 Ga0070666_101791833 180
181 3300005335 Ga0070666_10453953 Ga0070666_104539532 180
182 3300005336 Ga0070680_100279366 Ga0070680_1002793663 180
183 3300005336 Ga0070680_100715689 Ga0070680_1007156892 180
184 3300005337 Ga0070682_100202203 Ga0070682_1002022033 180
185 3300005337 Ga0070682_100302902 Ga0070682_1003029022 180
186 3300005337 Ga0070682_100307955 Ga0070682_1003079552 180
187 3300005337 Ga0070682_100482456 Ga0070682_1004824562 180
188 3300005338 Ga0068868_100005009 Ga0068868_10000500913 180
189 3300005338 Ga0068868_100356176 Ga0068868_1003561761 180
190 3300005338 Ga0068868_100468354 Ga0068868_1004683543 180
191 3300005338 Ga0068868_100483574 Ga0068868_1004835742 180
192 3300005338 Ga0068868_100626199 Ga0068868_1006261992 180
193 3300005338 Ga0068868_101157180 Ga0068868_1011571801 180
194 3300005338 Ga0068868_101267815 Ga0068868_1012678151 180
195 3300005339 Ga0070660_100002987 Ga0070660_10000298715 180
196 3300005339 Ga0070660_100262357 Ga0070660_1002623571 180
197 3300005339 Ga0070660_100422000 Ga0070660_1004220001 180
198 3300005339 Ga0070660_100551215 Ga0070660_1005512151 180
199 3300005339 Ga0070660_100949620 Ga0070660_1009496202 180
200 3300005340 Ga0070689_100018609 Ga0070689_1000186093 180
201 3300005340 Ga0070689_100022608 Ga0070689_1000226084 180
202 3300005340 Ga0070689_100084047 Ga0070689_1000840476 180
203 3300005340 Ga0070689_100086922 Ga0070689_1000869224 180
204 3300005340 Ga0070689_100121928 Ga0070689_1001219284 180
205 3300005340 Ga0070689_100176877 Ga0070689_1001768773 180
206 3300005340 Ga0070689_100324827 Ga0070689_1003248272 180
207 3300005340 Ga0070689_100764418 Ga0070689_1007644181 180
208 3300005341 Ga0070691_10495163 Ga0070691_104951631 180
209 3300005343 Ga0070687_100004670 Ga0070687_10000467010 180
210 3300005343 Ga0070687_100038411 Ga0070687_1000384113 180
211 3300005344 Ga0070661_100021520 Ga0070661_1000215208 180
212 3300005344 Ga0070661_100113077 Ga0070661_1001130772 180
213 3300005345 Ga0070692_10249592 Ga0070692_102495921 180
214 3300005345 Ga0070692_10329552 Ga0070692_103295523 180
215 3300005347 Ga0070668_100026838 Ga0070668_1000268385 180
216 3300005347 Ga0070668_100045349 Ga0070668_1000453495 180
217 3300005347 Ga0070668_100081579 Ga0070668_1000815792 180
218 3300005347 Ga0070668_100144142 Ga0070668_1001441423 180
219 3300005347 Ga0070668_101009541 Ga0070668_1010095412 180
220 3300005353 Ga0070669_100004188 Ga0070669_1000041889 180
221 3300005353 Ga0070669_100042463 Ga0070669_1000424634 180
222 3300005353 Ga0070669_100058143 Ga0070669_1000581433 180
223 3300005353 Ga0070669_100172802 Ga0070669_1001728023 180
224 3300005353 Ga0070669_100249215 Ga0070669_1002492152 180
225 3300005353 Ga0070669_100410662 Ga0070669_1004106623 180
226 3300005353 Ga0070669_100450671 Ga0070669_1004506712 180
227 3300005353 Ga0070669_100523023 Ga0070669_1005230232 180
228 3300005353 Ga0070669_101391644 Ga0070669_1013916441 180
229 3300005354 Ga0070675_100000056 Ga0070675_10000005623 180
230 3300005354 Ga0070675_100004981 Ga0070675_1000049817 180
231 3300005354 Ga0070675_100007191 Ga0070675_1000071919 180
232 3300005354 Ga0070675_100014470 Ga0070675_1000144708 180
233 3300005354 Ga0070675_100047087 Ga0070675_1000470878 180
234 3300005354 Ga0070675_100059893 Ga0070675_1000598933 180
235 3300005354 Ga0070675_100166730 Ga0070675_1001667301 180
236 3300005354 Ga0070675_100294023 Ga0070675_1002940233 180
237 3300005354 Ga0070675_100306716 Ga0070675_1003067164 180
238 3300005354 Ga0070675_100380406 Ga0070675_1003804063 180
239 3300005354 Ga0070675_100389016 Ga0070675_1003890161 180
240 3300005354 Ga0070675_100631599 Ga0070675_1006315992 180
241 3300005354 Ga0070675_101096753 Ga0070675_1010967531 180
242 3300005355 Ga0070671_100006715 Ga0070671_1000067154 180
243 3300005355 Ga0070671_100030813 Ga0070671_1000308139 180
244 3300005355 Ga0070671_100038853 Ga0070671_1000388536 180
245 3300005355 Ga0070671_100396422 Ga0070671_1003964223 180
246 3300005355 Ga0070671_100585490 Ga0070671_1005854902 180
247 3300005356 Ga0070674_100012403 Ga0070674_1000124033 180
248 3300005356 Ga0070674_100015034 Ga0070674_1000150347 180
249 3300005356 Ga0070674_100017363 Ga0070674_1000173632 180
250 3300005356 Ga0070674_100058550 Ga0070674_1000585503 180
251 3300005356 Ga0070674_100107399 Ga0070674_1001073993 180
252 3300005356 Ga0070674_100240751 Ga0070674_1002407513 180
253 3300005356 Ga0070674_100291814 Ga0070674_1002918142 180
254 3300005356 Ga0070674_100353505 Ga0070674_1003535052 180
255 3300005356 Ga0070674_100619355 Ga0070674_1006193551 180
256 3300005356 Ga0070674_100809547 Ga0070674_1008095472 180
257 3300005364 Ga0070673_100003427 Ga0070673_10000342713 180
258 3300005364 Ga0070673_100003685 Ga0070673_10000368510 180
259 3300005364 Ga0070673_100004781 Ga0070673_1000047816 180
260 3300005364 Ga0070673_100076736 Ga0070673_1000767366 180
261 3300005364 Ga0070673_100087145 Ga0070673_1000871452 180
262 3300005364 Ga0070673_100113486 Ga0070673_1001134862 180
263 3300005364 Ga0070673_100139260 Ga0070673_1001392604 180
264 3300005364 Ga0070673_100184535 Ga0070673_1001845354 180
265 3300005364 Ga0070673_100218993 Ga0070673_1002189932 180
266 3300005364 Ga0070673_100999743 Ga0070673_1009997431 180
267 3300005365 Ga0070688_100003817 Ga0070688_1000038174 180
268 3300005365 Ga0070688_100109264 Ga0070688_1001092643 180
269 3300005365 Ga0070688_100144675 Ga0070688_1001446752 180
270 3300005365 Ga0070688_100240525 Ga0070688_1002405253 180
271 3300005365 Ga0070688_100279150 Ga0070688_1002791503 180
272 3300005366 Ga0070659_100089158 Ga0070659_1000891585 180
273 3300005366 Ga0070659_100099878 Ga0070659_1000998782 180
274 3300005366 Ga0070659_100402441 Ga0070659_1004024411 180
275 3300005366 Ga0070659_100677164 Ga0070659_1006771642 180
276 3300005366 Ga0070659_100818252 Ga0070659_1008182521 180
277 3300005367 Ga0070667_100021149 Ga0070667_1000211499 180
278 3300005367 Ga0070667_100429831 Ga0070667_1004298312 180
279 3300005434 Ga0070709_10354014 Ga0070709_103540142 180
280 3300005436 Ga0070713_100038750 Ga0070713_1000387505 180
281 3300005438 Ga0070701_10002134 Ga0070701_100021346 180
282 3300005438 Ga0070701_10010126 Ga0070701_100101262 180
283 3300005438 Ga0070701_10037717 Ga0070701_100377175 180
284 3300005438 Ga0070701_10071971 Ga0070701_100719714 180
285 3300005440 Ga0070705_100000175 Ga0070705_1000001753 180
286 3300005440 Ga0070705_100016300 Ga0070705_1000163006 180
287 3300005440 Ga0070705_100046000 Ga0070705_1000460005 180
288 3300005440 Ga0070705_100072344 Ga0070705_1000723443 180
289 3300005440 Ga0070705_100117943 Ga0070705_1001179432 180
290 3300005440 Ga0070705_100422634 Ga0070705_1004226342 180
291 3300005440 Ga0070705_100477989 Ga0070705_1004779892 180
292 3300005440 Ga0070705_100848858 Ga0070705_1008488581 180
293 3300005440 Ga0070705_100905553 Ga0070705_1009055531 180
294 3300005441 Ga0070700_100083063 Ga0070700_1000830634 180
295 3300005441 Ga0070700_100155953 Ga0070700_1001559533 180
296 3300005441 Ga0070700_100168624 Ga0070700_1001686244 180
297 3300005441 Ga0070700_100246816 Ga0070700_1002468161 180
298 3300005441 Ga0070700_100451229 Ga0070700_1004512292 180
299 3300005441 Ga0070700_100684258 Ga0070700_1006842582 180
300 3300005441 Ga0070700_100744596 Ga0070700_1007445961 180
301 3300005441 Ga0070700_101302678 Ga0070700_1013026781 180
302 3300005444 Ga0070694_100035253 Ga0070694_1000352534 180
303 3300005444 Ga0070694_100065559 Ga0070694_1000655593 180
304 3300005444 Ga0070694_100087142 Ga0070694_1000871426 180
305 3300005444 Ga0070694_100170396 Ga0070694_1001703964 180
306 3300005444 Ga0070694_100179568 Ga0070694_1001795683 180
307 3300005444 Ga0070694_100236819 Ga0070694_1002368192 180
308 3300005444 Ga0070694_100397193 Ga0070694_1003971933 180
309 3300005444 Ga0070694_100431780 Ga0070694_1004317802 180
310 3300005444 Ga0070694_100479385 Ga0070694_1004793851 180
311 3300005444 Ga0070694_101200109 Ga0070694_1012001091 180
312 3300005455 Ga0070663_100014660 Ga0070663_10001466010 180
313 3300005455 Ga0070663_100016120 Ga0070663_1000161207 180
314 3300005455 Ga0070663_100176463 Ga0070663_1001764632 180
315 3300005455 Ga0070663_100340531 Ga0070663_1003405311 180
316 3300005455 Ga0070663_100789046 Ga0070663_1007890461 180
317 3300005456 Ga0070678_100004485 Ga0070678_1000044854 180
318 3300005456 Ga0070678_100018711 Ga0070678_1000187112 180
319 3300005456 Ga0070678_100093315 Ga0070678_1000933153 180
320 3300005456 Ga0070678_100398239 Ga0070678_1003982392 180
321 3300005456 Ga0070678_100452352 Ga0070678_1004523521 180
322 3300005456 Ga0070678_100682865 Ga0070678_1006828651 180
323 3300005457 Ga0070662_100119484 Ga0070662_1001194844 180
324 3300005457 Ga0070662_100160770 Ga0070662_1001607702 180
325 3300005457 Ga0070662_100180021 Ga0070662_1001800211 180
326 3300005457 Ga0070662_100277763 Ga0070662_1002777632 180
327 3300005457 Ga0070662_100965511 Ga0070662_1009655111 180
328 3300005458 Ga0070681_10006387 Ga0070681_1000638719 180
329 3300005458 Ga0070681_10317074 Ga0070681_103170741 180
330 3300005459 Ga0068867_100006640 Ga0068867_1000066403 180
331 3300005459 Ga0068867_100007115 Ga0068867_10000711515 180
332 3300005459 Ga0068867_100035655 Ga0068867_1000356553 180
333 3300005459 Ga0068867_100043874 Ga0068867_1000438746 180
334 3300005459 Ga0068867_100140074 Ga0068867_1001400742 180
335 3300005459 Ga0068867_100152486 Ga0068867_1001524863 180
336 3300005459 Ga0068867_100200698 Ga0068867_1002006983 180
337 3300005459 Ga0068867_100236074 Ga0068867_1002360743 180
338 3300005459 Ga0068867_100272874 Ga0068867_1002728742 180
339 3300005459 Ga0068867_100410978 Ga0068867_1004109783 180
340 3300005459 Ga0068867_100416751 Ga0068867_1004167512 180
341 3300005459 Ga0068867_100847126 Ga0068867_1008471262 180
342 3300005466 Ga0070685_10039495 Ga0070685_100394955 180
343 3300005466 Ga0070685_10137020 Ga0070685_101370202 180
344 3300005466 Ga0070685_10161503 Ga0070685_101615033 180
345 3300005466 Ga0070685_10314335 Ga0070685_103143352 180
346 3300005468 Ga0070707_100037632 Ga0070707_1000376327 180
347 3300005468 Ga0070707_100055271 Ga0070707_1000552713 180
348 3300005468 Ga0070707_100092768 Ga0070707_1000927686 180
349 3300005468 Ga0070707_100525239 Ga0070707_1005252392 180
350 3300005468 Ga0070707_100995231 Ga0070707_1009952312 180
351 3300005471 Ga0070698_100003045 Ga0070698_10000304515 180
352 3300005471 Ga0070698_100010970 Ga0070698_10001097013 180
353 3300005471 Ga0070698_100104205 Ga0070698_1001042057 180
354 3300005471 Ga0070698_100212166 Ga0070698_1002121664 180
355 3300005471 Ga0070698_100632824 Ga0070698_1006328241 180
356 3300005471 Ga0070698_100767527 Ga0070698_1007675272 180
357 3300005471 Ga0070698_101074902 Ga0070698_1010749022 180
358 3300005471 Ga0070698_101525887 Ga0070698_1015258871 180
359 3300005518 Ga0070699_100000410 Ga0070699_10000041034 180
360 3300005518 Ga0070699_100029345 Ga0070699_10002934510 180
361 3300005518 Ga0070699_100036688 Ga0070699_1000366889 180
362 3300005518 Ga0070699_100042387 Ga0070699_1000423876 180
363 3300005518 Ga0070699_100259813 Ga0070699_1002598133 180
364 3300005518 Ga0070699_100350568 Ga0070699_1003505683 180
365 3300005518 Ga0070699_100444068 Ga0070699_1004440683 180
366 3300005530 Ga0070679_100039507 Ga0070679_1000395076 180
367 3300005530 Ga0070679_100156213 Ga0070679_1001562132 180
368 3300005530 Ga0070679_100585881 Ga0070679_1005858812 180
369 3300005535 Ga0070684_100000236 Ga0070684_1000002369 180
370 3300005535 Ga0070684_100010407 Ga0070684_1000104079 180
371 3300005535 Ga0070684_100033356 Ga0070684_1000333567 180
372 3300005535 Ga0070684_100586644 Ga0070684_1005866441 180
373 3300005536 Ga0070697_100052802 Ga0070697_1000528026 180
374 3300005536 Ga0070697_101001287 Ga0070697_1010012871 180
375 3300005539 Ga0068853_100653780 Ga0068853_1006537801 180
376 3300005539 Ga0068853_101318573 Ga0068853_1013185731 180
377 3300005543 Ga0070672_100072531 Ga0070672_1000725317 180
378 3300005543 Ga0070672_100087900 Ga0070672_1000879002 180
379 3300005543 Ga0070672_100089719 Ga0070672_1000897192 180
380 3300005543 Ga0070672_100164673 Ga0070672_1001646734 180
381 3300005543 Ga0070672_100296948 Ga0070672_1002969482 180
382 3300005543 Ga0070672_100300275 Ga0070672_1003002752 180
383 3300005543 Ga0070672_100326621 Ga0070672_1003266213 180
384 3300005543 Ga0070672_100417882 Ga0070672_1004178823 180
385 3300005543 Ga0070672_100429670 Ga0070672_1004296702 180
386 3300005544 Ga0070686_100002243 Ga0070686_10000224311 180
387 3300005544 Ga0070686_100024325 Ga0070686_1000243258 180
388 3300005544 Ga0070686_100025770 Ga0070686_1000257707 180
389 3300005544 Ga0070686_100091793 Ga0070686_1000917934 180
390 3300005544 Ga0070686_100391372 Ga0070686_1003913722 180
391 3300005544 Ga0070686_100451177 Ga0070686_1004511772 180
392 3300005544 Ga0070686_100484766 Ga0070686_1004847662 180
393 3300005545 Ga0070695_100026046 Ga0070695_1000260462 180
394 3300005545 Ga0070695_100026423 Ga0070695_1000264234 180
395 3300005545 Ga0070695_100036049 Ga0070695_1000360493 180
396 3300005545 Ga0070695_100057812 Ga0070695_1000578122 180
397 3300005545 Ga0070695_100092951 Ga0070695_1000929513 180
398 3300005545 Ga0070695_100151132 Ga0070695_1001511323 180
399 3300005545 Ga0070695_100177809 Ga0070695_1001778092 180
400 3300005545 Ga0070695_100188657 Ga0070695_1001886573 180
401 3300005545 Ga0070695_100189520 Ga0070695_1001895202 180
402 3300005545 Ga0070695_100523190 Ga0070695_1005231902 180
403 3300005546 Ga0070696_100012605 Ga0070696_1000126059 180
404 3300005546 Ga0070696_100017137 Ga0070696_1000171379 180
405 3300005546 Ga0070696_100026481 Ga0070696_1000264814 180
406 3300005546 Ga0070696_100041141 Ga0070696_1000411413 180
407 3300005546 Ga0070696_100227938 Ga0070696_1002279383 180
408 3300005546 Ga0070696_100269265 Ga0070696_1002692651 180
409 3300005546 Ga0070696_100273812 Ga0070696_1002738123 180
410 3300005546 Ga0070696_100278315 Ga0070696_1002783152 180
411 3300005546 Ga0070696_100451269 Ga0070696_1004512693 180
412 3300005546 Ga0070696_100481187 Ga0070696_1004811871 180
413 3300005546 Ga0070696_100584512 Ga0070696_1005845121 180
414 3300005547 Ga0070693_100467060 Ga0070693_1004670602 180
415 3300005548 Ga0070665_100004733 Ga0070665_10000473316 180
416 3300005548 Ga0070665_100035338 Ga0070665_1000353384 180
417 3300005548 Ga0070665_100043431 Ga0070665_1000434317 180
418 3300005548 Ga0070665_100144040 Ga0070665_1001440402 180
419 3300005548 Ga0070665_100277846 Ga0070665_1002778462 180
420 3300005548 Ga0070665_101101356 Ga0070665_1011013562 180
421 3300005548 Ga0070665_101545969 Ga0070665_1015459692 180
422 3300005549 Ga0070704_100000751 Ga0070704_10000075119 180
423 3300005549 Ga0070704_100014117 Ga0070704_10001411710 180
424 3300005549 Ga0070704_100030754 Ga0070704_1000307544 180
425 3300005549 Ga0070704_100064034 Ga0070704_1000640341 180
426 3300005549 Ga0070704_100458103 Ga0070704_1004581032 180
427 3300005549 Ga0070704_101058830 Ga0070704_1010588301 180
428 3300005563 Ga0068855_100066908 Ga0068855_1000669087 180
429 3300005563 Ga0068855_100126724 Ga0068855_1001267242 180
430 3300005563 Ga0068855_100356691 Ga0068855_1003566913 180
431 3300005563 Ga0068855_100560640 Ga0068855_1005606402 180
432 3300005564 Ga0070664_100001147 Ga0070664_1000011474 180
433 3300005564 Ga0070664_100006932 Ga0070664_1000069329 180
434 3300005564 Ga0070664_100007621 Ga0070664_10000762111 180
435 3300005564 Ga0070664_100010409 Ga0070664_10001040911 180
436 3300005564 Ga0070664_100014134 Ga0070664_10001413410 180
437 3300005564 Ga0070664_100040264 Ga0070664_1000402644 180
438 3300005564 Ga0070664_100156320 Ga0070664_1001563204 180
439 3300005564 Ga0070664_100245421 Ga0070664_1002454213 180
440 3300005564 Ga0070664_100270055 Ga0070664_1002700554 180
441 3300005564 Ga0070664_100305071 Ga0070664_1003050713 180
442 3300005564 Ga0070664_100355912 Ga0070664_1003559122 180
443 3300005577 Ga0068857_100071414 Ga0068857_1000714144 180
444 3300005577 Ga0068857_100215215 Ga0068857_1002152154 180
445 3300005577 Ga0068857_100217670 Ga0068857_1002176701 180
446 3300005577 Ga0068857_100371095 Ga0068857_1003710953 180
447 3300005577 Ga0068857_100722156 Ga0068857_1007221562 180
448 3300005578 Ga0068854_100052991 Ga0068854_1000529917 180
449 3300005578 Ga0068854_100074177 Ga0068854_1000741776 180
450 3300005578 Ga0068854_100095480 Ga0068854_1000954804 180
451 3300005578 Ga0068854_100135180 Ga0068854_1001351804 180
452 3300005614 Ga0068856_100161829 Ga0068856_1001618292 180
453 3300005614 Ga0068856_100644651 Ga0068856_1006446512 180
454 3300005614 Ga0068856_100919255 Ga0068856_1009192552 180
455 3300005615 Ga0070702_100023468 Ga0070702_1000234686 180
456 3300005615 Ga0070702_100041029 Ga0070702_1000410295 180
457 3300005615 Ga0070702_100091754 Ga0070702_1000917543 180
458 3300005615 Ga0070702_100347293 Ga0070702_1003472932 180
459 3300005616 Ga0068852_100070737 Ga0068852_1000707374 180
460 3300005616 Ga0068852_100703462 Ga0068852_1007034622 180
461 3300005617 Ga0068859_100004442 Ga0068859_10000444214 180
462 3300005617 Ga0068859_100030708 Ga0068859_1000307084 180
463 3300005617 Ga0068859_100070606 Ga0068859_1000706068 180
464 3300005617 Ga0068859_100114609 Ga0068859_1001146092 180
465 3300005617 Ga0068859_100139222 Ga0068859_1001392221 180
466 3300005617 Ga0068859_100144943 Ga0068859_1001449431 180
467 3300005617 Ga0068859_100221986 Ga0068859_1002219861 180
468 3300005617 Ga0068859_100251373 Ga0068859_1002513734 180
469 3300005617 Ga0068859_100301473 Ga0068859_1003014733 180
470 3300005617 Ga0068859_100328050 Ga0068859_1003280502 180
471 3300005617 Ga0068859_100824128 Ga0068859_1008241281 180
472 3300005617 Ga0068859_100867140 Ga0068859_1008671403 180
473 3300005617 Ga0068859_100960276 Ga0068859_1009602763 180
474 3300005617 Ga0068859_101318485 Ga0068859_1013184851 180
475 3300005617 Ga0068859_101434764 Ga0068859_1014347641 180
476 3300005618 Ga0068864_100027039 Ga0068864_1000270399 180
477 3300005618 Ga0068864_100054633 Ga0068864_1000546334 180
478 3300005618 Ga0068864_100075695 Ga0068864_1000756952 180
479 3300005618 Ga0068864_100091585 Ga0068864_1000915855 180
480 3300005618 Ga0068864_100218523 Ga0068864_1002185233 180
481 3300005618 Ga0068864_100297221 Ga0068864_1002972213 180
482 3300005618 Ga0068864_100493778 Ga0068864_1004937782 180
483 3300005618 Ga0068864_100680503 Ga0068864_1006805032 180
484 3300005618 Ga0068864_101217600 Ga0068864_1012176001 180
485 3300005618 Ga0068864_101310622 Ga0068864_1013106222 180
486 3300005618 Ga0068864_101313943 Ga0068864_1013139432 180
487 3300005718 Ga0068866_10016782 Ga0068866_100167827 180
488 3300005718 Ga0068866_10071250 Ga0068866_100712504 180
489 3300005718 Ga0068866_10107732 Ga0068866_101077321 180
490 3300005718 Ga0068866_10354074 Ga0068866_103540742 180
491 3300005718 Ga0068866_10915524 Ga0068866_109155241 180
492 3300005719 Ga0068861_100007625 Ga0068861_10000762515 180
493 3300005719 Ga0068861_100012912 Ga0068861_10001291210 180
494 3300005719 Ga0068861_100024888 Ga0068861_1000248883 180
495 3300005719 Ga0068861_100068173 Ga0068861_1000681737 180
496 3300005719 Ga0068861_100081254 Ga0068861_1000812543 180
497 3300005719 Ga0068861_100141735 Ga0068861_1001417355 180
498 3300005719 Ga0068861_100381275 Ga0068861_1003812752 180
499 3300005719 Ga0068861_100680822 Ga0068861_1006808221 180
500 3300005719 Ga0068861_100828302 Ga0068861_1008283021 180
501 3300005719 Ga0068861_101193116 Ga0068861_1011931162 180
502 3300005840 Ga0068870_10000698 Ga0068870_1000069810 180
503 3300005840 Ga0068870_10021389 Ga0068870_100213894 180
504 3300005840 Ga0068870_10124410 Ga0068870_101244103 180
505 3300005840 Ga0068870_10173826 Ga0068870_101738261 180
506 3300005840 Ga0068870_10207320 Ga0068870_102073202 180
507 3300005840 Ga0068870_10266878 Ga0068870_102668782 180
508 3300005840 Ga0068870_10591510 Ga0068870_105915101 180
509 3300005841 Ga0068863_100026745 Ga0068863_1000267458 180
510 3300005841 Ga0068863_100147673 Ga0068863_1001476732 180
511 3300005841 Ga0068863_100189786 Ga0068863_1001897866 180
512 3300005841 Ga0068863_100206357 Ga0068863_1002063574 180
513 3300005841 Ga0068863_100333478 Ga0068863_1003334783 180
514 3300005841 Ga0068863_100692610 Ga0068863_1006926101 180
515 3300005841 Ga0068863_100753869 Ga0068863_1007538691 180
516 3300005841 Ga0068863_101088148 Ga0068863_1010881482 180
517 3300005842 Ga0068858_100008638 Ga0068858_1000086389 180
518 3300005842 Ga0068858_100133818 Ga0068858_1001338183 180
519 3300005842 Ga0068858_100154653 Ga0068858_1001546533 180
520 3300005842 Ga0068858_100164422 Ga0068858_1001644226 180
521 3300005842 Ga0068858_100188598 Ga0068858_1001885983 180
522 3300005842 Ga0068858_100370435 Ga0068858_1003704351 180
523 3300005842 Ga0068858_100405270 Ga0068858_1004052702 180
524 3300005842 Ga0068858_100415990 Ga0068858_1004159901 180
525 3300005842 Ga0068858_100573235 Ga0068858_1005732353 180
526 3300005842 Ga0068858_100999152 Ga0068858_1009991522 180
527 3300005842 Ga0068858_101120943 Ga0068858_1011209432 180
528 3300005843 Ga0068860_100023512 Ga0068860_1000235128 180
529 3300005843 Ga0068860_100047798 Ga0068860_1000477986 180
530 3300005843 Ga0068860_100153384 Ga0068860_1001533841 180
531 3300005843 Ga0068860_100219173 Ga0068860_1002191732 180
532 3300005843 Ga0068860_100226609 Ga0068860_1002266092 180
533 3300005843 Ga0068860_100389123 Ga0068860_1003891232 180
534 3300005843 Ga0068860_100587914 Ga0068860_1005879142 180
535 3300005843 Ga0068860_101134067 Ga0068860_1011340672 180
536 3300005844 Ga0068862_100005694 Ga0068862_1000056949 180
537 3300005844 Ga0068862_100025264 Ga0068862_1000252644 180
538 3300005844 Ga0068862_100074705 Ga0068862_1000747053 180
539 3300005844 Ga0068862_100089481 Ga0068862_1000894816 180
540 3300005844 Ga0068862_100108249 Ga0068862_1001082495 180
541 3300005844 Ga0068862_100301706 Ga0068862_1003017063 180
542 3300005844 Ga0068862_100369694 Ga0068862_1003696943 180
543 3300005844 Ga0068862_100376047 Ga0068862_1003760471 180
544 3300005844 Ga0068862_101266657 Ga0068862_1012666571 180
545 3300005937 Ga0081455_10015745 Ga0081455_1001574510 180
546 3300005937 Ga0081455_10127759 Ga0081455_101277593 180
547 3300005937 Ga0081455_10294127 Ga0081455_102941272 180
548 3300005981 Ga0081538_10157035 Ga0081538_101570352 180
549 3300005985 Ga0081539_10000142 Ga0081539_1000014295 180
550 3300005985 Ga0081539_10000215 Ga0081539_10000215142 180
551 3300005985 Ga0081539_10008426 Ga0081539_1000842614 180
552 3300005985 Ga0081539_10039110 Ga0081539_100391104 180
553 3300005985 Ga0081539_10050687 Ga0081539_100506871 180
554 3300005985 Ga0081539_10257652 Ga0081539_102576521 180
555 3300006042 Ga0075368_10004958 Ga0075368_100049588 180
556 3300006051 Ga0075364_10045079 Ga0075364_100450796 180
557 3300006058 Ga0075432_10112970 Ga0075432_101129702 180
558 3300006163 Ga0070715_10015342 Ga0070715_100153424 180
559 3300006178 Ga0075367_10016089 Ga0075367_1001608910 180
560 3300006178 Ga0075367_10514831 Ga0075367_105148311 180
561 3300006178 Ga0075367_10654973 Ga0075367_106549731 180
562 3300006237 Ga0097621_100025352 Ga0097621_1000253523 180
563 3300006237 Ga0097621_100050488 Ga0097621_1000504887 180
564 3300006237 Ga0097621_100061607 Ga0097621_1000616073 180
565 3300006237 Ga0097621_100077675 Ga0097621_1000776753 180
566 3300006237 Ga0097621_100082986 Ga0097621_1000829866 180
567 3300006237 Ga0097621_100084701 Ga0097621_1000847016 180
568 3300006237 Ga0097621_100112840 Ga0097621_1001128404 180
569 3300006237 Ga0097621_100147932 Ga0097621_1001479324 180
570 3300006237 Ga0097621_100767067 Ga0097621_1007670672 180
571 3300006358 Ga0068871_100006055 Ga0068871_10000605514 180
572 3300006358 Ga0068871_100014366 Ga0068871_1000143667 180
573 3300006358 Ga0068871_100040321 Ga0068871_1000403213 180
574 3300006358 Ga0068871_100297441 Ga0068871_1002974413 180
575 3300006358 Ga0068871_100324463 Ga0068871_1003244632 180
576 3300006358 Ga0068871_100344647 Ga0068871_1003446472 180
577 3300006358 Ga0068871_100357249 Ga0068871_1003572492 180
578 3300006358 Ga0068871_100382477 Ga0068871_1003824772 180
579 3300006358 Ga0068871_100463373 Ga0068871_1004633732 180
580 3300006358 Ga0068871_100802891 Ga0068871_1008028912 180
581 3300006358 Ga0068871_101060491 Ga0068871_1010604912 180
582 3300006358 Ga0068871_101071410 Ga0068871_1010714102 180
583 3300006844 Ga0075428_100000009 Ga0075428_100000009198 180
584 3300006844 Ga0075428_100002605 Ga0075428_10000260510 180
585 3300006844 Ga0075428_100010879 Ga0075428_10001087915 180
586 3300006844 Ga0075428_100036785 Ga0075428_1000367855 180
587 3300006844 Ga0075428_100143196 Ga0075428_1001431966 180
588 3300006844 Ga0075428_100145232 Ga0075428_1001452326 180
589 3300006844 Ga0075428_100201957 Ga0075428_1002019574 180
590 3300006844 Ga0075428_100211646 Ga0075428_1002116463 180
591 3300006844 Ga0075428_100261696 Ga0075428_1002616963 180
592 3300006844 Ga0075428_100351385 Ga0075428_1003513854 180
593 3300006844 Ga0075428_100747326 Ga0075428_1007473261 180
594 3300006844 Ga0075428_101123476 Ga0075428_1011234761 180
595 3300006844 Ga0075428_101770498 Ga0075428_1017704981 180
596 3300006846 Ga0075430_100003218 Ga0075430_10000321821 180
597 3300006846 Ga0075430_100004914 Ga0075430_10000491410 180
598 3300006846 Ga0075430_100010485 Ga0075430_10001048516 180
599 3300006846 Ga0075430_100074743 Ga0075430_1000747435 180
600 3300006846 Ga0075430_100111476 Ga0075430_1001114763 180
601 3300006846 Ga0075430_100136242 Ga0075430_1001362422 180
602 3300006846 Ga0075430_100140538 Ga0075430_1001405383 180
603 3300006846 Ga0075430_100174095 Ga0075430_1001740952 180
604 3300006846 Ga0075430_100187091 Ga0075430_1001870913 180
605 3300006847 Ga0075431_100003301 Ga0075431_1000033016 180
606 3300006847 Ga0075431_100009893 Ga0075431_10000989310 180
607 3300006847 Ga0075431_100077516 Ga0075431_1000775167 180
608 3300006847 Ga0075431_100094339 Ga0075431_1000943393 180
609 3300006847 Ga0075431_100101941 Ga0075431_1001019412 180
610 3300006847 Ga0075431_100112823 Ga0075431_1001128236 180
611 3300006847 Ga0075431_100119284 Ga0075431_1001192845 180
612 3300006847 Ga0075431_100256070 Ga0075431_1002560704 180
613 3300006847 Ga0075431_100552391 Ga0075431_1005523912 180
614 3300006847 Ga0075431_100567151 Ga0075431_1005671512 180
615 3300006852 Ga0075433_10007511 Ga0075433_100075118 180
616 3300006852 Ga0075433_10022603 Ga0075433_100226036 180
617 3300006852 Ga0075433_10024037 Ga0075433_100240375 180
618 3300006852 Ga0075433_10027003 Ga0075433_100270036 180
619 3300006852 Ga0075433_10030541 Ga0075433_100305418 180
620 3300006852 Ga0075433_10034234 Ga0075433_100342349 180
621 3300006852 Ga0075433_10034313 Ga0075433_100343139 180
622 3300006852 Ga0075433_10148885 Ga0075433_101488853 180
623 3300006852 Ga0075433_10166842 Ga0075433_101668423 180
624 3300006852 Ga0075433_10172135 Ga0075433_101721353 180
625 3300006852 Ga0075433_10204926 Ga0075433_102049263 180
626 3300006852 Ga0075433_10226650 Ga0075433_102266502 180
627 3300006852 Ga0075433_10622619 Ga0075433_106226192 180
628 3300006852 Ga0075433_10681390 Ga0075433_106813902 180
629 3300006871 Ga0075434_100009524 Ga0075434_10000952415 180
630 3300006871 Ga0075434_100067078 Ga0075434_1000670787 180
631 3300006871 Ga0075434_100079605 Ga0075434_1000796054 180
632 3300006871 Ga0075434_100085222 Ga0075434_1000852226 180
633 3300006871 Ga0075434_100099298 Ga0075434_1000992982 180
634 3300006871 Ga0075434_100368059 Ga0075434_1003680593 180
635 3300006871 Ga0075434_100384749 Ga0075434_1003847492 180
636 3300006871 Ga0075434_101095850 Ga0075434_1010958502 180
637 3300006880 Ga0075429_100037448 Ga0075429_1000374483 180
638 3300006880 Ga0075429_100071247 Ga0075429_1000712474 180
639 3300006880 Ga0075429_100080157 Ga0075429_1000801574 180
640 3300006880 Ga0075429_100123059 Ga0075429_1001230595 180
641 3300006880 Ga0075429_100389954 Ga0075429_1003899543 180
642 3300006880 Ga0075429_100456624 Ga0075429_1004566242 180
643 3300006880 Ga0075429_100520360 Ga0075429_1005203602 180
644 3300006880 Ga0075429_100807299 Ga0075429_1008072992 180
645 3300006881 Ga0068865_100006729 Ga0068865_10000672910 180
646 3300006881 Ga0068865_100035649 Ga0068865_1000356497 180
647 3300006881 Ga0068865_100096969 Ga0068865_1000969694 180
648 3300006881 Ga0068865_100257624 Ga0068865_1002576242 180
649 3300006881 Ga0068865_100534094 Ga0068865_1005340942 180
650 3300006881 Ga0068865_100536649 Ga0068865_1005366493 180
651 3300006881 Ga0068865_100663402 Ga0068865_1006634021 180
652 3300006881 Ga0068865_100725481 Ga0068865_1007254812 180
653 3300006881 Ga0068865_100842701 Ga0068865_1008427011 180
654 3300006914 Ga0075436_100018272 Ga0075436_1000182726 180
655 3300006914 Ga0075436_100032253 Ga0075436_1000322536 180
656 3300006914 Ga0075436_100038116 Ga0075436_1000381166 180
657 3300006914 Ga0075436_100089463 Ga0075436_1000894635 180
658 3300006914 Ga0075436_100146510 Ga0075436_1001465103 180
659 3300006931 Ga0097620_100004442 Ga0097620_10000444214 180
660 3300006931 Ga0097620_100030709 Ga0097620_1000307094 180
661 3300006931 Ga0097620_100070611 Ga0097620_1000706118 180
662 3300006931 Ga0097620_100114608 Ga0097620_1001146085 180
663 3300006931 Ga0097620_100125061 Ga0097620_1001250615 180
664 3300006931 Ga0097620_100139216 Ga0097620_1001392161 180
665 3300006931 Ga0097620_100144956 Ga0097620_1001449561 180
666 3300006931 Ga0097620_100221987 Ga0097620_1002219875 180
667 3300006931 Ga0097620_100251369 Ga0097620_1002513694 180
668 3300006931 Ga0097620_100301505 Ga0097620_1003015053 180
669 3300006931 Ga0097620_100328060 Ga0097620_1003280602 180
670 3300006931 Ga0097620_100470387 Ga0097620_1004703873 180
671 3300006931 Ga0097620_100824145 Ga0097620_1008241451 180
672 3300006931 Ga0097620_100867119 Ga0097620_1008671191 180
673 3300006931 Ga0097620_100960380 Ga0097620_1009603803 180
674 3300006931 Ga0097620_101318450 Ga0097620_1013184502 180
675 3300006931 Ga0097620_101434769 Ga0097620_1014347692 180
676 3300007076 Ga0075435_100001542 Ga0075435_10000154220 180
677 3300007076 Ga0075435_100001694 Ga0075435_10000169414 180
678 3300007076 Ga0075435_100028991 Ga0075435_1000289913 180
679 3300007076 Ga0075435_100038141 Ga0075435_1000381413 180
680 3300007076 Ga0075435_100038256 Ga0075435_1000382569 180
681 3300007076 Ga0075435_100046915 Ga0075435_1000469153 180
682 3300007076 Ga0075435_100052049 Ga0075435_1000520492 180
683 3300007076 Ga0075435_100137102 Ga0075435_1001371023 180
684 3300009036 Ga0105244_10414552 Ga0105244_104145521 180
685 3300009093 Ga0105240_10528326 Ga0105240_105283262 180
686 3300009093 Ga0105240_11236215 Ga0105240_112362152 180
687 3300009093 Ga0105240_11511924 Ga0105240_115119241 180
688 3300009094 Ga0111539_10000010 Ga0111539_1000001040 180
689 3300009094 Ga0111539_10000566 Ga0111539_100005667 180
690 3300009094 Ga0111539_10008096 Ga0111539_100080966 180
691 3300009094 Ga0111539_10011587 Ga0111539_1001158715 180
692 3300009094 Ga0111539_10016960 Ga0111539_1001696014 180
693 3300009094 Ga0111539_10040307 Ga0111539_1004030712 180
694 3300009094 Ga0111539_10060191 Ga0111539_100601917 180
695 3300009094 Ga0111539_10076195 Ga0111539_100761957 180
696 3300009094 Ga0111539_10133455 Ga0111539_101334555 180
697 3300009094 Ga0111539_10194685 Ga0111539_101946852 180
698 3300009094 Ga0111539_10201988 Ga0111539_102019886 180
699 3300009094 Ga0111539_10268052 Ga0111539_102680523 180
700 3300009094 Ga0111539_10303828 Ga0111539_103038283 180
701 3300009094 Ga0111539_10823829 Ga0111539_108238293 180
702 3300009094 Ga0111539_10948777 Ga0111539_109487773 180
703 3300009094 Ga0111539_11520662 Ga0111539_115206622 180
704 3300009094 Ga0111539_11854987 Ga0111539_118549872 180
705 3300009098 Ga0105245_10035527 Ga0105245_100355276 180
706 3300009098 Ga0105245_10062980 Ga0105245_100629806 180
707 3300009098 Ga0105245_10092918 Ga0105245_100929186 180
708 3300009098 Ga0105245_10150404 Ga0105245_101504043 180
709 3300009098 Ga0105245_10166728 Ga0105245_101667285 180
710 3300009098 Ga0105245_10292191 Ga0105245_102921913 180
711 3300009098 Ga0105245_11292145 Ga0105245_112921452 180
712 3300009101 Ga0105247_10004209 Ga0105247_1000420911 180
713 3300009101 Ga0105247_10231557 Ga0105247_102315572 180
714 3300009147 Ga0114129_10008264 Ga0114129_100082647 180
715 3300009147 Ga0114129_10021566 Ga0114129_100215662 180
716 3300009147 Ga0114129_10049690 Ga0114129_100496906 180
717 3300009147 Ga0114129_10065603 Ga0114129_100656034 180
718 3300009147 Ga0114129_10089267 Ga0114129_100892673 180
719 3300009147 Ga0114129_10101848 Ga0114129_101018483 180
720 3300009147 Ga0114129_10117140 Ga0114129_101171401 180
721 3300009147 Ga0114129_10149769 Ga0114129_101497697 180
722 3300009147 Ga0114129_10150439 Ga0114129_101504393 180
723 3300009147 Ga0114129_10285718 Ga0114129_102857184 180
724 3300009147 Ga0114129_10305373 Ga0114129_103053733 180
725 3300009147 Ga0114129_10401686 Ga0114129_104016862 180
726 3300009147 Ga0114129_10435231 Ga0114129_104352312 180
727 3300009147 Ga0114129_10553706 Ga0114129_105537062 180
728 3300009147 Ga0114129_10877884 Ga0114129_108778842 180
729 3300009147 Ga0114129_11242540 Ga0114129_112425402 180
730 3300009148 Ga0105243_10063021 Ga0105243_100630216 180
731 3300009148 Ga0105243_10332838 Ga0105243_103328383 180
732 3300009148 Ga0105243_10430421 Ga0105243_104304212 180
733 3300009174 Ga0105241_10179916 Ga0105241_101799162 180
734 3300009176 Ga0105242_10013585 Ga0105242_100135858 180
735 3300009176 Ga0105242_10035616 Ga0105242_100356163 180
736 3300009176 Ga0105242_10082948 Ga0105242_100829483 180
737 3300009176 Ga0105242_10098861 Ga0105242_100988612 180
738 3300009176 Ga0105242_10149845 Ga0105242_101498456 180
739 3300009176 Ga0105242_10479055 Ga0105242_104790551 180
740 3300009176 Ga0105242_12135091 Ga0105242_121350911 180
741 3300009177 Ga0105248_10013460 Ga0105248_1001346015 180
742 3300009177 Ga0105248_10026461 Ga0105248_100264619 180
743 3300009177 Ga0105248_10045879 Ga0105248_1004587910 180
744 3300009177 Ga0105248_10053076 Ga0105248_100530769 180
745 3300009177 Ga0105248_10085885 Ga0105248_100858857 180
746 3300009177 Ga0105248_10120187 Ga0105248_101201875 180
747 3300009177 Ga0105248_10124833 Ga0105248_101248337 180
748 3300009177 Ga0105248_10201886 Ga0105248_102018864 180
749 3300009177 Ga0105248_10260433 Ga0105248_102604333 180
750 3300009177 Ga0105248_10279546 Ga0105248_102795461 180
751 3300009177 Ga0105248_10359936 Ga0105248_103599363 180
752 3300009177 Ga0105248_10449852 Ga0105248_104498524 180
753 3300009177 Ga0105248_10474563 Ga0105248_104745632 180
754 3300009177 Ga0105248_10556864 Ga0105248_105568642 180
755 3300009177 Ga0105248_10867938 Ga0105248_108679382 180
756 3300009177 Ga0105248_10895762 Ga0105248_108957621 180
757 3300009177 Ga0105248_11795542 Ga0105248_117955422 180
758 3300009177 Ga0105248_11898612 Ga0105248_118986121 180
759 3300009545 Ga0105237_11910315 Ga0105237_119103151 180
760 3300009551 Ga0105238_10116693 Ga0105238_101166932 180
761 3300009553 Ga0105249_10000649 Ga0105249_1000064930 180
762 3300009553 Ga0105249_10019022 Ga0105249_1001902210 180
763 3300009553 Ga0105249_10051449 Ga0105249_100514496 180
764 3300009553 Ga0105249_10305085 Ga0105249_103050852 180
765 3300009553 Ga0105249_10333159 Ga0105249_103331592 180
766 3300009553 Ga0105249_10367556 Ga0105249_103675562 180
767 3300009553 Ga0105249_10784612 Ga0105249_107846122 180
768 3300009553 Ga0105249_11240176 Ga0105249_112401762 180
769 3300009553 Ga0105249_11337966 Ga0105249_113379662 180
770 3300009553 Ga0105249_12160650 Ga0105249_121606501 180
771 3300011119 Ga0105246_10091603 Ga0105246_100916035 180
772 3300011119 Ga0105246_10158766 Ga0105246_101587664 180
773 3300012505 Ga0157339_1032538 Ga0157339_10325381 180
774 3300012506 Ga0157324_1037476 Ga0157324_10374761 180
775 3300013104 Ga0157370_10456700 Ga0157370_104567003 180
776 3300013105 Ga0157369_10106177 Ga0157369_101061776 180
777 3300013105 Ga0157369_11073610 Ga0157369_110736102 180
778 3300013296 Ga0157374_10027622 Ga0157374_100276221 180
779 3300013296 Ga0157374_10056738 Ga0157374_100567386 180
780 3300013296 Ga0157374_10262520 Ga0157374_102625203 180
781 3300013296 Ga0157374_10275164 Ga0157374_102751643 180
782 3300013296 Ga0157374_10707805 Ga0157374_107078052 180
783 3300013297 Ga0157378_10112704 Ga0157378_101127046 180
784 3300013297 Ga0157378_10140804 Ga0157378_101408044 180
785 3300013297 Ga0157378_10319377 Ga0157378_103193772 180
786 3300013297 Ga0157378_10470570 Ga0157378_104705701 180
787 3300013297 Ga0157378_11063452 Ga0157378_110634522 180
788 3300013297 Ga0157378_11250723 Ga0157378_112507231 180
789 3300013297 Ga0157378_11616807 Ga0157378_116168071 180
790 3300013306 Ga0163162_10007697 Ga0163162_1000769715 180
791 3300013306 Ga0163162_10039352 Ga0163162_100393523 180
792 3300013306 Ga0163162_10058002 Ga0163162_100580023 180
793 3300013306 Ga0163162_10251528 Ga0163162_102515284 180
794 3300013306 Ga0163162_11049397 Ga0163162_110493972 180
795 3300013307 Ga0157372_10122637 Ga0157372_101226375 180
796 3300013308 Ga0157375_10044727 Ga0157375_100447277 180
797 3300013308 Ga0157375_10051620 Ga0157375_100516207 180
798 3300013308 Ga0157375_10128252 Ga0157375_101282523 180
799 3300013308 Ga0157375_10157788 Ga0157375_101577885 180
800 3300013308 Ga0157375_10248451 Ga0157375_102484513 180
801 3300013308 Ga0157375_10413346 Ga0157375_104133464 180
802 3300013308 Ga0157375_10414280 Ga0157375_104142802 180
803 3300013308 Ga0157375_10419905 Ga0157375_104199054 180
804 3300013308 Ga0157375_10477866 Ga0157375_104778662 180
805 3300013308 Ga0157375_10518254 Ga0157375_105182544 180
806 3300013308 Ga0157375_10707953 Ga0157375_107079532 180
807 3300013308 Ga0157375_11208422 Ga0157375_112084221 180
808 3300014325 Ga0163163_10029752 Ga0163163_100297529 180
809 3300014325 Ga0163163_10061505 Ga0163163_100615055 180
810 3300014325 Ga0163163_10094023 Ga0163163_100940236 180
811 3300014325 Ga0163163_10109105 Ga0163163_101091053 180
812 3300014325 Ga0163163_10189376 Ga0163163_101893763 180
813 3300014325 Ga0163163_10238029 Ga0163163_102380294 180
814 3300014325 Ga0163163_10303648 Ga0163163_103036483 180
815 3300014325 Ga0163163_10412474 Ga0163163_104124743 180
816 3300014325 Ga0163163_10430349 Ga0163163_104303491 180
817 3300014325 Ga0163163_10540550 Ga0163163_105405503 180
818 3300014325 Ga0163163_11244746 Ga0163163_112447461 180
819 3300014325 Ga0163163_11443648 Ga0163163_114436481 180
820 3300014325 Ga0163163_12144912 Ga0163163_121449121 180
821 3300014326 Ga0157380_10007827 Ga0157380_100078272 180
822 3300014326 Ga0157380_10018558 Ga0157380_100185584 180
823 3300014326 Ga0157380_10053387 Ga0157380_100533873 180
824 3300014326 Ga0157380_10235303 Ga0157380_102353033 180
825 3300014326 Ga0157380_10410508 Ga0157380_104105083 180
826 3300014326 Ga0157380_10417710 Ga0157380_104177102 180
827 3300014326 Ga0157380_10519229 Ga0157380_105192293 180
828 3300014326 Ga0157380_11202048 Ga0157380_112020481 180
829 3300014326 Ga0157380_11668312 Ga0157380_116683121 180
830 3300014745 Ga0157377_10021314 Ga0157377_100213146 180
831 3300014745 Ga0157377_10056165 Ga0157377_100561653 180
832 3300014745 Ga0157377_10059780 Ga0157377_100597802 180
833 3300014745 Ga0157377_10085823 Ga0157377_100858233 180
834 3300014745 Ga0157377_10295746 Ga0157377_102957462 180
835 3300014745 Ga0157377_10491345 Ga0157377_104913452 180
836 3300014745 Ga0157377_10571822 Ga0157377_105718222 180
837 3300014968 Ga0157379_10011639 Ga0157379_1001163911 180
838 3300014968 Ga0157379_10012114 Ga0157379_1001211413 180
839 3300014968 Ga0157379_10063370 Ga0157379_100633708 180
840 3300014968 Ga0157379_10072684 Ga0157379_100726842 180
841 3300014968 Ga0157379_10205528 Ga0157379_102055283 180
842 3300014968 Ga0157379_10404505 Ga0157379_104045053 180
843 3300014968 Ga0157379_10528095 Ga0157379_105280951 180
844 3300014968 Ga0157379_10581554 Ga0157379_105815542 180
845 3300014969 Ga0157376_10126830 Ga0157376_101268304 180
846 3300014969 Ga0157376_10184980 Ga0157376_101849804 180
847 3300014969 Ga0157376_10190729 Ga0157376_101907294 180
848 3300014969 Ga0157376_10255157 Ga0157376_102551573 180
849 3300014969 Ga0157376_10451872 Ga0157376_104518723 180
850 3300014969 Ga0157376_10509173 Ga0157376_105091732 180
851 3300014969 Ga0157376_10586178 Ga0157376_105861783 180
852 3300014969 Ga0157376_11278801 Ga0157376_112788012 180
853 3300015262 Ga0182007_10107856 Ga0182007_101078562 180
854 3300015265 Ga0182005_1040807 Ga0182005_10408072 180
855 3300017792 Ga0163161_10028845 Ga0163161_100288458 180
856 3300017792 Ga0163161_10859964 Ga0163161_108599641 180
857 3300020069 Ga0197907_10552970 Ga0197907_105529702 180
858 3300020070 Ga0206356_10214271 Ga0206356_102142712 180
859 3300020070 Ga0206356_10505801 Ga0206356_105058012 180
860 3300020070 Ga0206356_10687278 Ga0206356_106872784 180
861 3300020075 Ga0206349_1035609 Ga0206349_10356092 180
862 3300020076 Ga0206355_1058195 Ga0206355_10581952 180
863 3300020077 Ga0206351_10341298 Ga0206351_103412983 180
864 3300020078 Ga0206352_11179373 Ga0206352_111793736 180
865 3300020080 Ga0206350_10061890 Ga0206350_100618903 180
866 3300020080 Ga0206350_11146903 Ga0206350_111469033 180
867 3300020081 Ga0206354_10436132 Ga0206354_104361323 180
868 3300020082 Ga0206353_10446860 Ga0206353_104468603 180
869 3300025271 Ga0207666_1019558 Ga0207666_10195582 180
870 3300025315 Ga0207697_10002633 Ga0207697_100026339 180
871 3300025315 Ga0207697_10007629 Ga0207697_100076296 180
872 3300025315 Ga0207697_10022506 Ga0207697_100225062 180
873 3300025315 Ga0207697_10022773 Ga0207697_100227733 180
874 3300025315 Ga0207697_10048447 Ga0207697_100484474 180
875 3300025315 Ga0207697_10103789 Ga0207697_101037893 180
876 3300025315 Ga0207697_10133784 Ga0207697_101337843 180
877 3300025321 Ga0207656_10251929 Ga0207656_102519292 180
878 3300025893 Ga0207682_10059317 Ga0207682_100593173 180
879 3300025893 Ga0207682_10068988 Ga0207682_100689883 180
880 3300025893 Ga0207682_10123061 Ga0207682_101230613 180
881 3300025898 Ga0207692_10503348 Ga0207692_105033482 180
882 3300025899 Ga0207642_10027730 Ga0207642_100277302 180
883 3300025899 Ga0207642_10086812 Ga0207642_100868124 180
884 3300025899 Ga0207642_10226439 Ga0207642_102264393 180
885 3300025900 Ga0207710_10013317 Ga0207710_100133173 180
886 3300025901 Ga0207688_10000138 Ga0207688_100001382 180
887 3300025901 Ga0207688_10084458 Ga0207688_100844583 180
888 3300025901 Ga0207688_10182102 Ga0207688_101821023 180
889 3300025901 Ga0207688_10190243 Ga0207688_101902432 180
890 3300025901 Ga0207688_10205732 Ga0207688_102057322 180
891 3300025901 Ga0207688_10320672 Ga0207688_103206722 180
892 3300025903 Ga0207680_10060506 Ga0207680_100605062 180
893 3300025903 Ga0207680_10066906 Ga0207680_100669063 180
894 3300025903 Ga0207680_10075280 Ga0207680_100752801 180
895 3300025903 Ga0207680_10154195 Ga0207680_101541953 180
896 3300025903 Ga0207680_10190064 Ga0207680_101900643 180
897 3300025903 Ga0207680_10193407 Ga0207680_101934073 180
898 3300025903 Ga0207680_10295624 Ga0207680_102956242 180
899 3300025903 Ga0207680_10984339 Ga0207680_109843391 180
900 3300025905 Ga0207685_10025352 Ga0207685_100253524 180
901 3300025906 Ga0207699_10014062 Ga0207699_100140628 180
902 3300025907 Ga0207645_10006334 Ga0207645_100063349 180
903 3300025907 Ga0207645_10025953 Ga0207645_100259536 180
904 3300025907 Ga0207645_10088367 Ga0207645_100883674 180
905 3300025907 Ga0207645_10107375 Ga0207645_101073754 180
906 3300025907 Ga0207645_10292073 Ga0207645_102920732 180
907 3300025907 Ga0207645_10338034 Ga0207645_103380342 180
908 3300025907 Ga0207645_10415433 Ga0207645_104154331 180
909 3300025908 Ga0207643_10000779 Ga0207643_1000077919 180
910 3300025908 Ga0207643_10037074 Ga0207643_100370745 180
911 3300025908 Ga0207643_10059113 Ga0207643_100591133 180
912 3300025908 Ga0207643_10101161 Ga0207643_101011613 180
913 3300025908 Ga0207643_10134193 Ga0207643_101341933 180
914 3300025908 Ga0207643_10152236 Ga0207643_101522363 180
915 3300025908 Ga0207643_10231269 Ga0207643_102312692 180
916 3300025908 Ga0207643_10272951 Ga0207643_102729513 180
917 3300025908 Ga0207643_10515030 Ga0207643_105150302 180
918 3300025909 Ga0207705_10108310 Ga0207705_101083103 180
919 3300025909 Ga0207705_10158610 Ga0207705_101586103 180
920 3300025910 Ga0207684_10186623 Ga0207684_101866234 180
921 3300025910 Ga0207684_10252087 Ga0207684_102520872 180
922 3300025912 Ga0207707_10161809 Ga0207707_101618094 180
923 3300025912 Ga0207707_10465226 Ga0207707_104652261 180
924 3300025912 Ga0207707_10710848 Ga0207707_107108482 180
925 3300025913 Ga0207695_10097911 Ga0207695_100979112 180
926 3300025913 Ga0207695_11370852 Ga0207695_113708521 180
927 3300025917 Ga0207660_10105617 Ga0207660_101056174 180
928 3300025917 Ga0207660_10186256 Ga0207660_101862562 180
929 3300025917 Ga0207660_10216564 Ga0207660_102165641 180
930 3300025917 Ga0207660_10254834 Ga0207660_102548343 180
931 3300025918 Ga0207662_10009410 Ga0207662_100094105 180
932 3300025918 Ga0207662_10034165 Ga0207662_100341653 180
933 3300025918 Ga0207662_10077779 Ga0207662_100777793 180
934 3300025918 Ga0207662_10096347 Ga0207662_100963474 180
935 3300025918 Ga0207662_10096484 Ga0207662_100964844 180
936 3300025918 Ga0207662_10160366 Ga0207662_101603663 180
937 3300025918 Ga0207662_10349672 Ga0207662_103496723 180
938 3300025919 Ga0207657_10013143 Ga0207657_100131436 180
939 3300025919 Ga0207657_10484905 Ga0207657_104849052 180
940 3300025920 Ga0207649_10028632 Ga0207649_100286326 180
941 3300025920 Ga0207649_10065329 Ga0207649_100653294 180
942 3300025920 Ga0207649_10235962 Ga0207649_102359622 180
943 3300025921 Ga0207652_10041098 Ga0207652_100410986 180
944 3300025921 Ga0207652_10270189 Ga0207652_102701893 180
945 3300025922 Ga0207646_10036909 Ga0207646_100369096 180
946 3300025922 Ga0207646_10039242 Ga0207646_100392426 180
947 3300025922 Ga0207646_10162614 Ga0207646_101626143 180
948 3300025922 Ga0207646_10241995 Ga0207646_102419951 180
949 3300025922 Ga0207646_10265943 Ga0207646_102659431 180
950 3300025922 Ga0207646_10813445 Ga0207646_108134451 180
951 3300025922 Ga0207646_10993522 Ga0207646_109935222 180
952 3300025923 Ga0207681_10017709 Ga0207681_100177096 180
953 3300025923 Ga0207681_10076294 Ga0207681_100762942 180
954 3300025923 Ga0207681_10102273 Ga0207681_101022732 180
955 3300025923 Ga0207681_10103828 Ga0207681_101038283 180
956 3300025923 Ga0207681_10108677 Ga0207681_101086772 180
957 3300025923 Ga0207681_10111776 Ga0207681_101117763 180
958 3300025923 Ga0207681_10160752 Ga0207681_101607522 180
959 3300025923 Ga0207681_10181371 Ga0207681_101813713 180
960 3300025923 Ga0207681_10222321 Ga0207681_102223213 180
961 3300025923 Ga0207681_10314348 Ga0207681_103143482 180
962 3300025923 Ga0207681_10444855 Ga0207681_104448551 180
963 3300025923 Ga0207681_10616653 Ga0207681_106166531 180
964 3300025923 Ga0207681_10652555 Ga0207681_106525552 180
965 3300025924 Ga0207694_10459900 Ga0207694_104599003 180
966 3300025925 Ga0207650_10010669 Ga0207650_1001066910 180
967 3300025925 Ga0207650_10042178 Ga0207650_100421786 180
968 3300025925 Ga0207650_10172001 Ga0207650_101720013 180
969 3300025925 Ga0207650_10174194 Ga0207650_101741943 180
970 3300025925 Ga0207650_10198170 Ga0207650_101981703 180
971 3300025925 Ga0207650_10380106 Ga0207650_103801063 180
972 3300025925 Ga0207650_10531602 Ga0207650_105316021 180
973 3300025925 Ga0207650_11111996 Ga0207650_111119961 180
974 3300025925 Ga0207650_11411028 Ga0207650_114110281 180
975 3300025926 Ga0207659_10001199 Ga0207659_1000119921 180
976 3300025926 Ga0207659_10003579 Ga0207659_100035798 180
977 3300025926 Ga0207659_10029153 Ga0207659_100291535 180
978 3300025926 Ga0207659_10054621 Ga0207659_100546212 180
979 3300025926 Ga0207659_10062434 Ga0207659_100624345 180
980 3300025926 Ga0207659_10071205 Ga0207659_100712054 180
981 3300025926 Ga0207659_10079888 Ga0207659_100798883 180
982 3300025926 Ga0207659_10209680 Ga0207659_102096803 180
983 3300025926 Ga0207659_10223278 Ga0207659_102232783 180
984 3300025926 Ga0207659_10484368 Ga0207659_104843683 180
985 3300025926 Ga0207659_10556102 Ga0207659_105561022 180
986 3300025927 Ga0207687_10015584 Ga0207687_100155848 180
987 3300025927 Ga0207687_10067367 Ga0207687_100673676 180
988 3300025927 Ga0207687_10103158 Ga0207687_101031585 180
989 3300025927 Ga0207687_10340427 Ga0207687_103404272 180
990 3300025927 Ga0207687_10365975 Ga0207687_103659752 180
991 3300025927 Ga0207687_10566897 Ga0207687_105668971 180
992 3300025927 Ga0207687_11000483 Ga0207687_110004832 180
993 3300025928 Ga0207700_10070594 Ga0207700_100705946 180
994 3300025931 Ga0207644_10007454 Ga0207644_1000745414 180
995 3300025931 Ga0207644_10049107 Ga0207644_100491076 180
996 3300025931 Ga0207644_10053903 Ga0207644_100539035 180
997 3300025931 Ga0207644_10079042 Ga0207644_100790422 180
998 3300025931 Ga0207644_10251870 Ga0207644_102518702 180
999 3300025931 Ga0207644_10298861 Ga0207644_102988611 180
1000 3300025931 Ga0207644_10976349 Ga0207644_109763492 180
1001 3300025931 Ga0207644_11195848 Ga0207644_111958481 180
1002 3300025932 Ga0207690_10078070 Ga0207690_100780703 180
1003 3300025932 Ga0207690_10256121 Ga0207690_102561211 180
1004 3300025932 Ga0207690_10549855 Ga0207690_105498551 180
1005 3300025933 Ga0207706_10003002 Ga0207706_100030029 180
1006 3300025933 Ga0207706_10047200 Ga0207706_100472005 180
1007 3300025933 Ga0207706_10061033 Ga0207706_100610337 180
1008 3300025933 Ga0207706_10105816 Ga0207706_101058162 180
1009 3300025933 Ga0207706_10107334 Ga0207706_101073343 180
1010 3300025933 Ga0207706_10173569 Ga0207706_101735694 180
1011 3300025933 Ga0207706_10258380 Ga0207706_102583803 180
1012 3300025933 Ga0207706_10286367 Ga0207706_102863672 180
1013 3300025933 Ga0207706_10371838 Ga0207706_103718383 180
1014 3300025933 Ga0207706_10719440 Ga0207706_107194401 180
1015 3300025934 Ga0207686_10011631 Ga0207686_100116316 180
1016 3300025934 Ga0207686_10013361 Ga0207686_100133617 180
1017 3300025934 Ga0207686_10068725 Ga0207686_100687256 180
1018 3300025934 Ga0207686_10087260 Ga0207686_100872604 180
1019 3300025934 Ga0207686_10111839 Ga0207686_101118392 180
1020 3300025934 Ga0207686_10250509 Ga0207686_102505093 180
1021 3300025934 Ga0207686_10340524 Ga0207686_103405241 180
1022 3300025935 Ga0207709_10007222 Ga0207709_100072227 180
1023 3300025935 Ga0207709_10024672 Ga0207709_100246726 180
1024 3300025935 Ga0207709_10412233 Ga0207709_104122332 180
1025 3300025935 Ga0207709_10884141 Ga0207709_108841412 180
1026 3300025935 Ga0207709_10927221 Ga0207709_109272211 180
1027 3300025936 Ga0207670_10050869 Ga0207670_100508692 180
1028 3300025936 Ga0207670_10068187 Ga0207670_100681873 180
1029 3300025936 Ga0207670_10086695 Ga0207670_100866954 180
1030 3300025936 Ga0207670_10097398 Ga0207670_100973985 180
1031 3300025936 Ga0207670_10133057 Ga0207670_101330573 180
1032 3300025936 Ga0207670_10210368 Ga0207670_102103684 180
1033 3300025936 Ga0207670_10216609 Ga0207670_102166092 180
1034 3300025936 Ga0207670_10234615 Ga0207670_102346152 180
1035 3300025936 Ga0207670_10237257 Ga0207670_102372572 180
1036 3300025936 Ga0207670_10242392 Ga0207670_102423922 180
1037 3300025936 Ga0207670_10826796 Ga0207670_108267962 180
1038 3300025937 Ga0207669_10007924 Ga0207669_1000792410 180
1039 3300025937 Ga0207669_10047024 Ga0207669_100470241 180
1040 3300025937 Ga0207669_10052960 Ga0207669_100529606 180
1041 3300025937 Ga0207669_10107365 Ga0207669_101073654 180
1042 3300025937 Ga0207669_10257031 Ga0207669_102570313 180
1043 3300025937 Ga0207669_10287152 Ga0207669_102871522 180
1044 3300025937 Ga0207669_10370024 Ga0207669_103700241 180
1045 3300025937 Ga0207669_10521918 Ga0207669_105219182 180
1046 3300025937 Ga0207669_10675009 Ga0207669_106750092 180
1047 3300025938 Ga0207704_10001666 Ga0207704_1000166613 180
1048 3300025938 Ga0207704_10005828 Ga0207704_100058289 180
1049 3300025938 Ga0207704_10025041 Ga0207704_100250412 180
1050 3300025938 Ga0207704_10028528 Ga0207704_100285286 180
1051 3300025938 Ga0207704_10068220 Ga0207704_100682204 180
1052 3300025938 Ga0207704_10091254 Ga0207704_100912541 180
1053 3300025938 Ga0207704_10250405 Ga0207704_102504053 180
1054 3300025938 Ga0207704_10539838 Ga0207704_105398382 180
1055 3300025938 Ga0207704_10666006 Ga0207704_106660061 180
1056 3300025938 Ga0207704_10850642 Ga0207704_108506422 180
1057 3300025940 Ga0207691_10008380 Ga0207691_100083809 180
1058 3300025940 Ga0207691_10012406 Ga0207691_1001240614 180
1059 3300025940 Ga0207691_10017406 Ga0207691_100174066 180
1060 3300025940 Ga0207691_10018907 Ga0207691_100189079 180
1061 3300025940 Ga0207691_10046195 Ga0207691_100461955 180
1062 3300025940 Ga0207691_10053434 Ga0207691_100534343 180
1063 3300025940 Ga0207691_10070802 Ga0207691_100708024 180
1064 3300025940 Ga0207691_10100700 Ga0207691_101007002 180
1065 3300025940 Ga0207691_10543533 Ga0207691_105435332 180
1066 3300025941 Ga0207711_10026433 Ga0207711_100264332 180
1067 3300025941 Ga0207711_10042393 Ga0207711_100423938 180
1068 3300025941 Ga0207711_10050382 Ga0207711_100503826 180
1069 3300025941 Ga0207711_10050802 Ga0207711_100508026 180
1070 3300025941 Ga0207711_10115511 Ga0207711_101155114 180
1071 3300025941 Ga0207711_10142830 Ga0207711_101428302 180
1072 3300025941 Ga0207711_10159325 Ga0207711_101593254 180
1073 3300025941 Ga0207711_10159462 Ga0207711_101594623 180
1074 3300025941 Ga0207711_10262952 Ga0207711_102629522 180
1075 3300025941 Ga0207711_10398014 Ga0207711_103980142 180
1076 3300025941 Ga0207711_10595796 Ga0207711_105957962 180
1077 3300025942 Ga0207689_10003297 Ga0207689_1000329716 180
1078 3300025942 Ga0207689_10007360 Ga0207689_100073606 180
1079 3300025942 Ga0207689_10034411 Ga0207689_100344118 180
1080 3300025942 Ga0207689_10038286 Ga0207689_100382866 180
1081 3300025942 Ga0207689_10086089 Ga0207689_100860895 180
1082 3300025942 Ga0207689_10106986 Ga0207689_101069862 180
1083 3300025942 Ga0207689_10328007 Ga0207689_103280073 180
1084 3300025942 Ga0207689_10775043 Ga0207689_107750432 180
1085 3300025944 Ga0207661_10071900 Ga0207661_100719006 180
1086 3300025944 Ga0207661_10090383 Ga0207661_100903831 180
1087 3300025944 Ga0207661_10134307 Ga0207661_101343074 180
1088 3300025944 Ga0207661_10355104 Ga0207661_103551042 180
1089 3300025944 Ga0207661_10455152 Ga0207661_104551522 180
1090 3300025945 Ga0207679_10001422 Ga0207679_100014225 180
1091 3300025945 Ga0207679_10005490 Ga0207679_1000549012 180
1092 3300025945 Ga0207679_10027564 Ga0207679_100275647 180
1093 3300025945 Ga0207679_10073634 Ga0207679_100736345 180
1094 3300025945 Ga0207679_10142613 Ga0207679_101426133 180
1095 3300025945 Ga0207679_11088644 Ga0207679_110886442 180
1096 3300025945 Ga0207679_11216838 Ga0207679_112168382 180
1097 3300025949 Ga0207667_10017864 Ga0207667_1001786412 180
1098 3300025949 Ga0207667_10142701 Ga0207667_101427013 180
1099 3300025949 Ga0207667_10271090 Ga0207667_102710902 180
1100 3300025960 Ga0207651_10010012 Ga0207651_1001001211 180
1101 3300025960 Ga0207651_10030950 Ga0207651_100309503 180
1102 3300025960 Ga0207651_10046695 Ga0207651_100466952 180
1103 3300025960 Ga0207651_10050040 Ga0207651_100500403 180
1104 3300025960 Ga0207651_10068872 Ga0207651_100688722 180
1105 3300025960 Ga0207651_10159576 Ga0207651_101595762 180
1106 3300025960 Ga0207651_10355698 Ga0207651_103556981 180
1107 3300025960 Ga0207651_10361305 Ga0207651_103613052 180
1108 3300025960 Ga0207651_10390878 Ga0207651_103908781 180
1109 3300025960 Ga0207651_10742557 Ga0207651_107425572 180
1110 3300025960 Ga0207651_10778775 Ga0207651_107787751 180
1111 3300025961 Ga0207712_10080357 Ga0207712_100803571 180
1112 3300025961 Ga0207712_10095501 Ga0207712_100955013 180
1113 3300025961 Ga0207712_10393022 Ga0207712_103930222 180
1114 3300025961 Ga0207712_10404199 Ga0207712_104041992 180
1115 3300025961 Ga0207712_10470471 Ga0207712_104704712 180
1116 3300025961 Ga0207712_10518014 Ga0207712_105180143 180
1117 3300025961 Ga0207712_10545672 Ga0207712_105456722 180
1118 3300025961 Ga0207712_11083200 Ga0207712_110832001 180
1119 3300025972 Ga0207668_10020156 Ga0207668_100201569 180
1120 3300025972 Ga0207668_10056063 Ga0207668_100560636 180
1121 3300025972 Ga0207668_10113909 Ga0207668_101139092 180
1122 3300025972 Ga0207668_10175342 Ga0207668_101753423 180
1123 3300025972 Ga0207668_10307462 Ga0207668_103074623 180
1124 3300025972 Ga0207668_10325044 Ga0207668_103250443 180
1125 3300025972 Ga0207668_10711130 Ga0207668_107111302 180
1126 3300025981 Ga0207640_10044089 Ga0207640_100440894 180
1127 3300025981 Ga0207640_10088384 Ga0207640_100883844 180
1128 3300025981 Ga0207640_10233267 Ga0207640_102332672 180
1129 3300025981 Ga0207640_10814752 Ga0207640_108147522 180
1130 3300025981 Ga0207640_11121504 Ga0207640_111215041 180
1131 3300025981 Ga0207640_11419956 Ga0207640_114199561 180
1132 3300025981 Ga0207640_11711666 Ga0207640_117116661 180
1133 3300025986 Ga0207658_10065901 Ga0207658_100659015 180
1134 3300025986 Ga0207658_10202397 Ga0207658_102023974 180
1135 3300025986 Ga0207658_10259922 Ga0207658_102599222 180
1136 3300025986 Ga0207658_10281351 Ga0207658_102813513 180
1137 3300025986 Ga0207658_10296291 Ga0207658_102962911 180
1138 3300025986 Ga0207658_10613732 Ga0207658_106137321 180
1139 3300026023 Ga0207677_10044957 Ga0207677_100449577 180
1140 3300026023 Ga0207677_10084348 Ga0207677_100843481 180
1141 3300026023 Ga0207677_10088689 Ga0207677_100886893 180
1142 3300026023 Ga0207677_10278463 Ga0207677_102784631 180
1143 3300026023 Ga0207677_10327234 Ga0207677_103272342 180
1144 3300026023 Ga0207677_10507972 Ga0207677_105079723 180
1145 3300026023 Ga0207677_10589455 Ga0207677_105894551 180
1146 3300026023 Ga0207677_10777951 Ga0207677_107779512 180
1147 3300026035 Ga0207703_10032004 Ga0207703_100320049 180
1148 3300026035 Ga0207703_10033254 Ga0207703_100332543 180
1149 3300026035 Ga0207703_10070384 Ga0207703_100703844 180
1150 3300026035 Ga0207703_10076318 Ga0207703_100763183 180
1151 3300026035 Ga0207703_10084790 Ga0207703_100847902 180
1152 3300026035 Ga0207703_10114306 Ga0207703_101143063 180
1153 3300026035 Ga0207703_10347095 Ga0207703_103470953 180
1154 3300026035 Ga0207703_10453150 Ga0207703_104531502 180
1155 3300026035 Ga0207703_10535929 Ga0207703_105359292 180
1156 3300026041 Ga0207639_10214899 Ga0207639_102148992 180
1157 3300026041 Ga0207639_10306084 Ga0207639_103060842 180
1158 3300026067 Ga0207678_10065410 Ga0207678_100654103 180
1159 3300026067 Ga0207678_10078447 Ga0207678_100784476 180
1160 3300026067 Ga0207678_10113825 Ga0207678_101138251 180
1161 3300026075 Ga0207708_10025274 Ga0207708_100252746 180
1162 3300026075 Ga0207708_10087134 Ga0207708_100871344 180
1163 3300026075 Ga0207708_10115929 Ga0207708_101159296 180
1164 3300026075 Ga0207708_10121037 Ga0207708_101210373 180
1165 3300026075 Ga0207708_10124112 Ga0207708_101241124 180
1166 3300026075 Ga0207708_10154806 Ga0207708_101548063 180
1167 3300026075 Ga0207708_10349089 Ga0207708_103490893 180
1168 3300026075 Ga0207708_10550301 Ga0207708_105503012 180
1169 3300026075 Ga0207708_10774544 Ga0207708_107745441 180
1170 3300026075 Ga0207708_11243810 Ga0207708_112438102 180
1171 3300026078 Ga0207702_10300635 Ga0207702_103006353 180
1172 3300026088 Ga0207641_10055386 Ga0207641_100553864 180
1173 3300026088 Ga0207641_10087096 Ga0207641_100870962 180
1174 3300026088 Ga0207641_10099999 Ga0207641_100999992 180
1175 3300026088 Ga0207641_10132999 Ga0207641_101329993 180
1176 3300026088 Ga0207641_10149478 Ga0207641_101494785 180
1177 3300026088 Ga0207641_10252335 Ga0207641_102523353 180
1178 3300026088 Ga0207641_10282235 Ga0207641_102822354 180
1179 3300026088 Ga0207641_10766745 Ga0207641_107667451 180
1180 3300026088 Ga0207641_10949210 Ga0207641_109492101 180
1181 3300026088 Ga0207641_11075589 Ga0207641_110755891 180
1182 3300026088 Ga0207641_11155664 Ga0207641_111556642 180
1183 3300026089 Ga0207648_10001325 Ga0207648_1000132531 180
1184 3300026089 Ga0207648_10013253 Ga0207648_100132534 180
1185 3300026089 Ga0207648_10016724 Ga0207648_100167243 180
1186 3300026089 Ga0207648_10074761 Ga0207648_100747617 180
1187 3300026089 Ga0207648_10090323 Ga0207648_100903235 180
1188 3300026089 Ga0207648_10134253 Ga0207648_101342534 180
1189 3300026089 Ga0207648_10165633 Ga0207648_101656334 180
1190 3300026089 Ga0207648_10179905 Ga0207648_101799054 180
1191 3300026089 Ga0207648_10323852 Ga0207648_103238522 180
1192 3300026089 Ga0207648_10381942 Ga0207648_103819423 180
1193 3300026089 Ga0207648_10470729 Ga0207648_104707292 180
1194 3300026089 Ga0207648_11024330 Ga0207648_110243301 180
1195 3300026095 Ga0207676_10028142 Ga0207676_100281427 180
1196 3300026095 Ga0207676_10175694 Ga0207676_101756943 180
1197 3300026095 Ga0207676_10234105 Ga0207676_102341054 180
1198 3300026095 Ga0207676_10243707 Ga0207676_102437072 180
1199 3300026095 Ga0207676_10246645 Ga0207676_102466453 180
1200 3300026095 Ga0207676_10386099 Ga0207676_103860993 180
1201 3300026095 Ga0207676_10512550 Ga0207676_105125503 180
1202 3300026095 Ga0207676_10742833 Ga0207676_107428331 180
1203 3300026095 Ga0207676_10989453 Ga0207676_109894532 180
1204 3300026095 Ga0207676_11106469 Ga0207676_111064692 180
1205 3300026095 Ga0207676_11504823 Ga0207676_115048231 180
1206 3300026116 Ga0207674_10204292 Ga0207674_102042924 180
1207 3300026116 Ga0207674_10308751 Ga0207674_103087514 180
1208 3300026116 Ga0207674_10631029 Ga0207674_106310292 180
1209 3300026116 Ga0207674_10990988 Ga0207674_109909882 180
1210 3300026116 Ga0207674_11088242 Ga0207674_110882421 180
1211 3300026118 Ga0207675_100014045 Ga0207675_1000140459 180
1212 3300026118 Ga0207675_100022725 Ga0207675_1000227256 180
1213 3300026118 Ga0207675_100038967 Ga0207675_1000389679 180
1214 3300026118 Ga0207675_100052806 Ga0207675_1000528063 180
1215 3300026118 Ga0207675_100094597 Ga0207675_1000945973 180
1216 3300026118 Ga0207675_100099958 Ga0207675_1000999583 180
1217 3300026118 Ga0207675_100190984 Ga0207675_1001909843 180
1218 3300026118 Ga0207675_100282097 Ga0207675_1002820971 180
1219 3300026118 Ga0207675_100327098 Ga0207675_1003270983 180
1220 3300026118 Ga0207675_100367127 Ga0207675_1003671273 180
1221 3300026121 Ga0207683_10054170 Ga0207683_100541708 180
1222 3300026121 Ga0207683_10054620 Ga0207683_100546205 180
1223 3300026121 Ga0207683_10109399 Ga0207683_101093996 180
1224 3300026121 Ga0207683_10143122 Ga0207683_101431223 180
1225 3300026121 Ga0207683_10253977 Ga0207683_102539774 180
1226 3300026121 Ga0207683_10294147 Ga0207683_102941473 180
1227 3300026121 Ga0207683_10324309 Ga0207683_103243093 180
1228 3300026121 Ga0207683_10411318 Ga0207683_104113181 180
1229 3300026121 Ga0207683_10659178 Ga0207683_106591782 180
1230 3300026121 Ga0207683_10755321 Ga0207683_107553212 180
1231 3300026121 Ga0207683_10796366 Ga0207683_107963662 180
1232 3300026121 Ga0207683_10898286 Ga0207683_108982862 180
1233 3300026121 Ga0207683_11015433 Ga0207683_110154332 180
1234 3300026142 Ga0207698_10165914 Ga0207698_101659142 180
1235 3300026142 Ga0207698_10328937 Ga0207698_103289373 180
1236 3300026142 Ga0207698_11050855 Ga0207698_110508551 180
1237 3300027424 Ga0209984_1006288 Ga0209984_10062883 180
1238 3300027543 Ga0209999_1021187 Ga0209999_10211872 180
1239 3300027665 Ga0209983_1003671 Ga0209983_10036711 180
1240 3300027665 Ga0209983_1076551 Ga0209983_10765511 180
1241 3300027682 Ga0209971_1008254 Ga0209971_10082544 180
1242 3300027682 Ga0209971_1049431 Ga0209971_10494312 180
1243 3300027682 Ga0209971_1105826 Ga0209971_11058261 180
1244 3300027682 Ga0209971_1106524 Ga0209971_11065241 180
1245 3300027682 Ga0209971_1109884 Ga0209971_11098841 180
1246 3300027717 Ga0209998_10050364 Ga0209998_100503642 180
1247 3300027866 Ga0209813_10042156 Ga0209813_100421563 180
1248 3300027876 Ga0209974_10012249 Ga0209974_100122495 180
1249 3300027876 Ga0209974_10036907 Ga0209974_100369073 180
1250 3300027876 Ga0209974_10113882 Ga0209974_101138822 180
1251 3300027876 Ga0209974_10180128 Ga0209974_101801281 180
1252 3300027907 Ga0207428_10000034 Ga0207428_10000034180 180
1253 3300027907 Ga0207428_10001541 Ga0207428_1000154123 180
1254 3300027907 Ga0207428_10002655 Ga0207428_1000265518 180
1255 3300027907 Ga0207428_10003291 Ga0207428_1000329118 180
1256 3300027907 Ga0207428_10041247 Ga0207428_100412472 180
1257 3300027907 Ga0207428_10047323 Ga0207428_100473235 180
1258 3300027907 Ga0207428_10061497 Ga0207428_100614973 180
1259 3300027907 Ga0207428_10102792 Ga0207428_101027924 180
1260 3300027907 Ga0207428_10110710 Ga0207428_101107103 180
1261 3300027907 Ga0207428_10126076 Ga0207428_101260763 180
1262 3300027907 Ga0207428_10134350 Ga0207428_101343503 180
1263 3300027907 Ga0207428_10152809 Ga0207428_101528092 180
1264 3300027907 Ga0207428_10185122 Ga0207428_101851223 180
1265 3300027907 Ga0207428_10249344 Ga0207428_102493442 180
1266 3300027907 Ga0207428_10311694 Ga0207428_103116942 180
1267 3300028379 Ga0268266_10005896 Ga0268266_100058965 180
1268 3300028379 Ga0268266_10034166 Ga0268266_100341668 180
1269 3300028379 Ga0268266_10045638 Ga0268266_100456384 180
1270 3300028379 Ga0268266_10054819 Ga0268266_100548198 180
1271 3300028379 Ga0268266_10083997 Ga0268266_100839976 180
1272 3300028379 Ga0268266_10162259 Ga0268266_101622594 180
1273 3300028379 Ga0268266_10480140 Ga0268266_104801403 180
1274 3300028380 Ga0268265_10000103 Ga0268265_100001038 180
1275 3300028380 Ga0268265_10005520 Ga0268265_1000552012 180
1276 3300028380 Ga0268265_10040884 Ga0268265_100408845 180
1277 3300028380 Ga0268265_10050150 Ga0268265_100501505 180
1278 3300028380 Ga0268265_10060408 Ga0268265_100604086 180
1279 3300028380 Ga0268265_10079157 Ga0268265_100791574 180
1280 3300028380 Ga0268265_10252038 Ga0268265_102520384 180
1281 3300028380 Ga0268265_10256100 Ga0268265_102561003 180
1282 3300028380 Ga0268265_10308043 Ga0268265_103080431 180
1283 3300028380 Ga0268265_10493540 Ga0268265_104935403 180
1284 3300028380 Ga0268265_10567553 Ga0268265_105675532 180
1285 3300028380 Ga0268265_11033187 Ga0268265_110331871 180
1286 3300028381 Ga0268264_10010645 Ga0268264_100106459 180
1287 3300028381 Ga0268264_10027905 Ga0268264_100279054 180
1288 3300028381 Ga0268264_10056447 Ga0268264_100564476 180
1289 3300028381 Ga0268264_10106377 Ga0268264_101063774 180
1290 3300028381 Ga0268264_10156694 Ga0268264_101566945 180
1291 3300028381 Ga0268264_10484587 Ga0268264_104845872 180
1292 3300028381 Ga0268264_10701517 Ga0268264_107015171 180
1293 3300028381 Ga0268264_11037134 Ga0268264_110371342 180
1294 3300028381 Ga0268264_11595850 Ga0268264_115958501 180
1295 3300028558 Ga0265326_10065209 Ga0265326_100652092 180
1296 3300028800 Ga0265338_10113495 Ga0265338_101134954 180
1297 3300029957 Ga0265324_10011911 Ga0265324_100119112 180
1298 3300031235 Ga0265330_10037126 Ga0265330_100371264 180
1299 3300031238 Ga0265332_10010141 Ga0265332_100101412 180
1300 3300031238 Ga0265332_10085113 Ga0265332_100851132 180
1301 3300031239 Ga0265328_10154609 Ga0265328_101546091 180
1302 3300031240 Ga0265320_10012074 Ga0265320_100120749 180
1303 3300031240 Ga0265320_10186182 Ga0265320_101861823 180
1304 3300031242 Ga0265329_10008336 Ga0265329_100083363 180
1305 3300031247 Ga0265340_10020784 Ga0265340_100207844 180
1306 3300031250 Ga0265331_10038287 Ga0265331_100382874 180
1307 3300031344 Ga0265316_10025425 Ga0265316_100254259 180
1308 3300031344 Ga0265316_10132996 Ga0265316_101329964 180
1309 3300031456 Ga0307513_10669904 Ga0307513_106699042 180
1310 3300031507 Ga0307509_10427512 Ga0307509_104275122 180
1311 3300031548 Ga0307408_100038013 Ga0307408_1000380136 180
1312 3300031548 Ga0307408_100057488 Ga0307408_1000574887 180
1313 3300031548 Ga0307408_100081795 Ga0307408_1000817956 180
1314 3300031548 Ga0307408_100204003 Ga0307408_1002040034 180
1315 3300031548 Ga0307408_100225649 Ga0307408_1002256493 180
1316 3300031548 Ga0307408_100530685 Ga0307408_1005306853 180
1317 3300031548 Ga0307408_100680889 Ga0307408_1006808892 180
1318 3300031548 Ga0307408_100755938 Ga0307408_1007559382 180
1319 3300031711 Ga0265314_10005858 Ga0265314_100058583 180
1320 3300031711 Ga0265314_10007579 Ga0265314_1000757910 180
1321 3300031712 Ga0265342_10081550 Ga0265342_100815503 180
1322 3300031727 Ga0316576_10244689 Ga0316576_102446891 180
1323 3300031731 Ga0307405_10003705 Ga0307405_1000370515 180
1324 3300031731 Ga0307405_10016138 Ga0307405_100161385 180
1325 3300031731 Ga0307405_10030751 Ga0307405_100307516 180
1326 3300031731 Ga0307405_10138224 Ga0307405_101382242 180
1327 3300031731 Ga0307405_10297854 Ga0307405_102978542 180
1328 3300031731 Ga0307405_10674016 Ga0307405_106740162 180
1329 3300031824 Ga0307413_10030050 Ga0307413_100300504 180
1330 3300031824 Ga0307413_10077755 Ga0307413_100777552 180
1331 3300031824 Ga0307413_10113611 Ga0307413_101136113 180
1332 3300031824 Ga0307413_10223029 Ga0307413_102230292 180
1333 3300031824 Ga0307413_10678229 Ga0307413_106782292 180
1334 3300031824 Ga0307413_11333368 Ga0307413_113333681 180
1335 3300031852 Ga0307410_10006003 Ga0307410_100060033 180
1336 3300031852 Ga0307410_10017954 Ga0307410_100179545 180
1337 3300031852 Ga0307410_10047643 Ga0307410_100476435 180
1338 3300031852 Ga0307410_10221253 Ga0307410_102212533 180
1339 3300031852 Ga0307410_10234760 Ga0307410_102347603 180
1340 3300031852 Ga0307410_10499257 Ga0307410_104992572 180
1341 3300031901 Ga0307406_10006390 Ga0307406_100063909 180
1342 3300031901 Ga0307406_10234504 Ga0307406_102345042 180
1343 3300031901 Ga0307406_10306001 Ga0307406_103060013 180
1344 3300031901 Ga0307406_11180440 Ga0307406_111804401 180
1345 3300031903 Ga0307407_10002685 Ga0307407_100026853 180
1346 3300031903 Ga0307407_10045517 Ga0307407_100455173 180
1347 3300031903 Ga0307407_10050963 Ga0307407_100509633 180
1348 3300031903 Ga0307407_10091366 Ga0307407_100913662 180
1349 3300031903 Ga0307407_10156691 Ga0307407_101566912 180
1350 3300031903 Ga0307407_10325266 Ga0307407_103252662 180
1351 3300031903 Ga0307407_10411656 Ga0307407_104116563 180
1352 3300031903 Ga0307407_10420175 Ga0307407_104201752 180
1353 3300031911 Ga0307412_10010747 Ga0307412_1001074710 180
1354 3300031911 Ga0307412_10107881 Ga0307412_101078813 180
1355 3300031911 Ga0307412_10126226 Ga0307412_101262264 180
1356 3300031911 Ga0307412_10152701 Ga0307412_101527013 180
1357 3300031911 Ga0307412_10267132 Ga0307412_102671323 180
1358 3300031911 Ga0307412_10301772 Ga0307412_103017722 180
1359 3300031911 Ga0307412_10350372 Ga0307412_103503723 180
1360 3300031911 Ga0307412_10442676 Ga0307412_104426762 180
1361 3300031911 Ga0307412_10452487 Ga0307412_104524873 180
1362 3300031911 Ga0307412_10681319 Ga0307412_106813192 180
1363 3300031995 Ga0307409_100020053 Ga0307409_1000200537 180
1364 3300031995 Ga0307409_100087327 Ga0307409_1000873272 180
1365 3300031995 Ga0307409_100107444 Ga0307409_1001074444 180
1366 3300031995 Ga0307409_100112567 Ga0307409_1001125672 180
1367 3300031995 Ga0307409_100127380 Ga0307409_1001273803 180
1368 3300031995 Ga0307409_100854042 Ga0307409_1008540422 180
1369 3300031995 Ga0307409_101158764 Ga0307409_1011587642 180
1370 3300031995 Ga0307409_101759026 Ga0307409_1017590261 180
1371 3300032002 Ga0307416_100003624 Ga0307416_1000036247 180
1372 3300032002 Ga0307416_100045169 Ga0307416_1000451696 180
1373 3300032002 Ga0307416_100048189 Ga0307416_1000481893 180
1374 3300032002 Ga0307416_100056176 Ga0307416_1000561766 180
1375 3300032002 Ga0307416_100079895 Ga0307416_1000798956 180
1376 3300032002 Ga0307416_100089739 Ga0307416_1000897393 180
1377 3300032002 Ga0307416_100101244 Ga0307416_1001012444 180
1378 3300032002 Ga0307416_100117449 Ga0307416_1001174493 180
1379 3300032002 Ga0307416_100943827 Ga0307416_1009438272 180
1380 3300032002 Ga0307416_102059606 Ga0307416_1020596061 180
1381 3300032002 Ga0307416_102140929 Ga0307416_1021409291 180
1382 3300032004 Ga0307414_10142455 Ga0307414_101424552 180
1383 3300032004 Ga0307414_10152732 Ga0307414_101527323 180
1384 3300032004 Ga0307414_10197495 Ga0307414_101974953 180
1385 3300032004 Ga0307414_10316215 Ga0307414_103162153 180
1386 3300032004 Ga0307414_10450865 Ga0307414_104508653 180
1387 3300032004 Ga0307414_11334422 Ga0307414_113344221 180
1388 3300032005 Ga0307411_10000416 Ga0307411_1000041619 180
1389 3300032005 Ga0307411_10016125 Ga0307411_100161259 180
1390 3300032005 Ga0307411_10055467 Ga0307411_100554676 180
1391 3300032005 Ga0307411_10106711 Ga0307411_101067112 180
1392 3300032005 Ga0307411_10110820 Ga0307411_101108204 180
1393 3300032005 Ga0307411_10130074 Ga0307411_101300742 180
1394 3300032005 Ga0307411_10246351 Ga0307411_102463512 180
1395 3300032005 Ga0307411_10300832 Ga0307411_103008323 180
1396 3300032005 Ga0307411_10607368 Ga0307411_106073682 180
1397 3300032126 Ga0307415_100000625 Ga0307415_10000062522 180
1398 3300032126 Ga0307415_100106352 Ga0307415_1001063524 180
1399 3300032126 Ga0307415_100441434 Ga0307415_1004414342 180
1400 3300032126 Ga0307415_101121615 Ga0307415_1011216151 180
1401 3300034817 Ga0373948_0116479 Ga0373948_0116479_39_581 180
1402 3300034818 Ga0373950_0005290 Ga0373950_0005290_1154_1699 180
1403 3300034819 Ga0373958_0000045 Ga0373958_0000045_3740_4285 180
1404 3300034820 Ga0373959_0001151 Ga0373959_0001151_2138_2683 180
1405 3300034957 Ga0373938_0000418 Ga0373938_0000418_3075_3620 180
1406 3300034957 Ga0373938_0026047 Ga0373938_0026047_565_1107 180
1407 3300035084 Ga0373928_0001212 Ga0373928_0001212_3919_4464 180
1408 3300035084 Ga0373928_0015408 Ga0373928_0015408_186_728 180
1409 3300035085 Ga0373929_0000116 Ga0373929_0000116_11082_11627 180
1410 3300035086 Ga0373934_0065468 Ga0373934_0065468_419_961 180
1411 3300035088 Ga0373940_0000084 Ga0373940_0000084_3675_4220 180
1412 3300035089 Ga0373944_0303872 Ga0373944_0303872_42_584 180
1413 3300035090 Ga0373949_0000597 Ga0373949_0000597_6637_7182 180
1414 3300035090 Ga0373949_0038576 Ga0373949_0038576_532_1074 180
1415 3300035091 Ga0373951_0001673 Ga0373951_0001673_1073_1618 180
1416 3300035092 Ga0373952_0001387 Ga0373952_0001387_3161_3706 180
1417 3300035111 Ga0373923_0271448 Ga0373923_0271448_52_600 180
1418 3300035112 Ga0373932_0006095 Ga0373932_0006095_169_714 180
1419 3300035112 Ga0373932_0037176 Ga0373932_0037176_506_1048 180
1420 3300035112 Ga0373932_0176427 Ga0373932_0176427_95_637 180
1421 3300035114 Ga0373939_0001888 Ga0373939_0001888_307_852 180
1422 3300035115 Ga0373941_0000161 Ga0373941_0000161_4854_5399 180
1423 3300035115 Ga0373941_0168810 Ga0373941_0168810_127_669 180
1424 3300035117 Ga0373953_0067476 Ga0373953_0067476_121_663 180
1425 3300035117 Ga0373953_0098621 Ga0373953_0098621_75_617 180
1426 3300035119 Ga0373956_0183744 Ga0373956_0183744_352_894 180
1427 3300035121 Ga0373960_0001448 Ga0373960_0001448_2481_3026 180
1428 3300035170 Ga0373943_0022741 Ga0373943_0022741_1908_2450 180
1429 3300035171 Ga0373946_0062792 Ga0373946_0062792_579_1121 180
1430 3300035171 Ga0373946_0074104 Ga0373946_0074104_765_1307 180
1431 3300035171 Ga0373946_0160914 Ga0373946_0160914_330_872 180
1432 3300035207 Ga0373942_0001420 Ga0373942_0001420_542_1087 180
1433 3300035207 Ga0373942_0142636 Ga0373942_0142636_202_744 180
1434 3300035241 Ga0373961_0001591 Ga0373961_0001591_2017_2562 180
1435 3300035241 Ga0373961_0150062 Ga0373961_0150062_211_753 180
1436 3300035242 Ga0373962_0000245 Ga0373962_0000245_5902_6447 180
1437 3300035691 Ga0373931_0002441 Ga0373931_0002441_7148_7693 180
1438 3300035691 Ga0373931_0084404 Ga0373931_0084404_574_1116 180
1439 3300035691 Ga0373931_0085636 Ga0373931_0085636_649_1191 180
1440 3300035691 Ga0373931_0167215 Ga0373931_0167215_465_1010 180
1441 3300035724 Ga0373933_0596789 Ga0373933_0596789_18_560 180
1442 3300035725 Ga0373947_0034097 Ga0373947_0034097_723_1265 180
1443 3300035725 Ga0373947_0206717 Ga0373947_0206717_305_847 180
1444 3300035725 Ga0373947_0380536 Ga0373947_0380536_211_759 180
1445 3300035725 Ga0373947_0535016 Ga0373947_0535016_13_555 180
1446 3300036401 Ga0373937_0055667 Ga0373937_0055667_1775_2317 180
1447 3300036401 Ga0373937_0068497 Ga0373937_0068497_1653_2195 180
1448 3300036401 Ga0373937_0156528 Ga0373937_0156528_383_928 180
1449 3300036401 Ga0373937_0985887 Ga0373937_0985887_95_637 180
1450 3300036401 Ga0373937_1083223 Ga0373937_1083223_160_702 180
1451 3300037068 Ga0373925_0035123 Ga0373925_0035123_1540_2082 180
1452 3300037068 Ga0373925_0185734 Ga0373925_0185734_556_1098 180
1453 3300037068 Ga0373925_0320151 Ga0373925_0320151_652_1194 180
1454 3300039437 Ga0436365_0036290 Ga0436365_0036290_556_1101 180
1455 3300039437 Ga0436365_0581991 Ga0436365_0581991_800_1348 180
1456 3300041406 Ga0439439_0034189 Ga0439439_0034189_731_1273 180
1457 3300041406 Ga0439439_0038937 Ga0439439_0038937_390_932 180
1458 3300041408 Ga0439453_0004336 Ga0439453_0004336_1067_1609 180
1459 3300041511 Ga0451855_0468162 Ga0451855_0468162_79_621 180
1460 3300041997 Ga0439431_0028869 Ga0439431_0028869_333_875 180
1461 3300042001 Ga0439441_009987 Ga0439441_009987_372_917 180
1462 3300042001 Ga0439441_052477 Ga0439441_052477_247_789 180
1463 3300042003 Ga0439443_038709 Ga0439443_038709_74_616 180
1464 3300042008 Ga0439450_001122 Ga0439450_001122_1284_1826 180
1465 3300042008 Ga0439450_067497 Ga0439450_067497_92_643 180
1466 3300042012 Ga0439455_0110887 Ga0439455_0110887_68_610 180
1467 3300042014 Ga0439457_031767 Ga0439457_031767_16_558 180
1468 3300042015 Ga0439462_0078638 Ga0439462_0078638_58_600 180
1469 3300042015 Ga0439462_0126319 Ga0439462_0126319_11_553 180
1470 3300042117 Ga0450913_009550 Ga0450913_009550_191_742 180
1471 3300042122 Ga0450920_022971 Ga0450920_022971_306_857 180
1472 3300042130 Ga0450892_030457 Ga0450892_030457_13_555 180
1473 3300042133 Ga0450896_016030 Ga0450896_016030_265_813 180
1474 3300042133 Ga0450896_037581 Ga0450896_037581_172_714 180
1475 3300042133 Ga0450896_043641 Ga0450896_043641_116_658 180
1476 3300042435 Ga0439434_0028691 Ga0439434_0028691_444_986 180
1477 3300042435 Ga0439434_0146090 Ga0439434_0146090_38_580 180
1478 3300042435 Ga0439434_0166329 Ga0439434_0166329_107_649 180
1479 3300042436 Ga0439435_0027034 Ga0439435_0027034_505_1047 180
1480 3300042436 Ga0439435_0150939 Ga0439435_0150939_162_704 180
1481 3300042439 Ga0439464_0002679 Ga0439464_0002679_3091_3633 180
1482 3300042439 Ga0439464_0028831 Ga0439464_0028831_51_593 180
1483 3300042439 Ga0439464_0029074 Ga0439464_0029074_234_776 180
1484 3300042461 Ga0439460_0054239 Ga0439460_0054239_418_960 180
1485 3300042530 Ga0450916_000502 Ga0450916_000502_319_870 180
1486 3300042530 Ga0450916_019009 Ga0450916_019009_186_728 180
1487 3300042876 Ga0451577_0011517 Ga0451577_0011517_480_1022 180
1488 3300042876 Ga0451577_0284963 Ga0451577_0284963_61_603 180
1489 3300042876 Ga0451577_0286314 Ga0451577_0286314_583_1125 180
1490 3300044683 Ga0466965_0146653 Ga0466965_0146653_259_801 180
1491 3300044712 Ga0453684_0026145 Ga0453684_0026145_3103_3645 180
1492 3300044712 Ga0453684_0287763 Ga0453684_0287763_75_617 180
1493 3300044712 Ga0453684_0685249 Ga0453684_0685249_31_573 180
1494 3300044842 Ga0466957_0659541 Ga0466957_0659541_37_582 180
1495 3300045049 Ga0466959_0074856 Ga0466959_0074856_862_1407 180
1496 3300045051 Ga0451576_0018296 Ga0451576_0018296_947_1489 180
1497 3300045051 Ga0451576_0049051 Ga0451576_0049051_21_563 180
1498 3300045051 Ga0451576_0055541 Ga0451576_0055541_466_1011 180
1499 3300045051 Ga0451576_0084364 Ga0451576_0084364_854_1396 180
1500 3300045051 Ga0451576_0596282 Ga0451576_0596282_122_664 180
1501 3300045976 Ga0466967_0057235 Ga0466967_0057235_582_1124 180
1502 3300046454 Ga0495592_0313574 Ga0495592_0313574_260_802 180
1503 3300046455 Ga0495603_0011963 Ga0495603_0011963_3110_3658 180
1504 3300046455 Ga0495603_0073260 Ga0495603_0073260_612_1160 180
1505 3300046455 Ga0495603_0178189 Ga0495603_0178189_72_614 180
1506 3300046455 Ga0495603_0195150 Ga0495603_0195150_431_973 180
1507 3300046457 Ga0495590_0101823 Ga0495590_0101823_110_652 180
1508 3300046459 Ga0495629_0005673 Ga0495629_0005673_3893_4435 180
1509 3300046459 Ga0495629_0032718 Ga0495629_0032718_2027_2569 180
1510 3300046459 Ga0495629_0247911 Ga0495629_0247911_427_975 180
1511 3300046459 Ga0495629_0323121 Ga0495629_0323121_112_654 180
1512 3300046459 Ga0495629_0431206 Ga0495629_0431206_170_712 180
1513 3300046461 Ga0495641_0038066 Ga0495641_0038066_558_1100 180
1514 3300046462 Ga0495651_0083661 Ga0495651_0083661_391_933 180
1515 3300046462 Ga0495651_0416830 Ga0495651_0416830_265_810 180
1516 3300046463 Ga0495653_0154914 Ga0495653_0154914_437_979 180
1517 3300046472 Ga0495580_0160420 Ga0495580_0160420_363_905 180
1518 3300046472 Ga0495580_0735816 Ga0495580_0735816_42_584 180
1519 3300046473 Ga0495582_0084059 Ga0495582_0084059_1016_1558 180
1520 3300046473 Ga0495582_0308473 Ga0495582_0308473_193_738 180
1521 3300046475 Ga0495639_0030139 Ga0495639_0030139_22_564 180
1522 3300046475 Ga0495639_0159747 Ga0495639_0159747_361_903 180
1523 3300046475 Ga0495639_0220820 Ga0495639_0220820_78_620 180
1524 3300046477 Ga0495664_0214431 Ga0495664_0214431_28_576 180
1525 3300046491 Ga0495584_0484325 Ga0495584_0484325_39_584 180
1526 3300046492 Ga0495585_0131680 Ga0495585_0131680_117_659 180
1527 3300046499 Ga0495594_0009792 Ga0495594_0009792_1068_1610 180
1528 3300046499 Ga0495594_0013061 Ga0495594_0013061_1751_2299 180
1529 3300046499 Ga0495594_0044838 Ga0495594_0044838_389_931 180
1530 3300046499 Ga0495594_0153882 Ga0495594_0153882_202_744 180
1531 3300046500 Ga0495596_0048137 Ga0495596_0048137_945_1487 180
1532 3300046511 Ga0495608_0235194 Ga0495608_0235194_507_1049 180
1533 3300046516 Ga0495628_0226237 Ga0495628_0226237_624_1172 180
1534 3300046517 Ga0495630_0195846 Ga0495630_0195846_361_903 180
1535 3300046517 Ga0495630_0473089 Ga0495630_0473089_255_797 180
1536 3300046523 Ga0495644_0196354 Ga0495644_0196354_213_755 180
1537 3300046525 Ga0495663_0083941 Ga0495663_0083941_307_849 180
1538 3300046525 Ga0495663_0154142 Ga0495663_0154142_99_641 180
1539 3300046528 Ga0495642_0004633 Ga0495642_0004633_2406_2948 180
1540 3300046528 Ga0495642_0261654 Ga0495642_0261654_205_747 180
1541 3300046531 Ga0495665_0150034 Ga0495665_0150034_651_1193 180
1542 3300046533 Ga0495640_0030475 Ga0495640_0030475_2316_2858 180
1543 3300046533 Ga0495640_0056439 Ga0495640_0056439_790_1338 180
1544 3300046535 Ga0495586_0202366 Ga0495586_0202366_534_1076 180
1545 3300046536 Ga0495587_0366704 Ga0495587_0366704_54_602 180
1546 3300046537 Ga0495598_0004409 Ga0495598_0004409_1521_2063 180
1547 3300046537 Ga0495598_0012857 Ga0495598_0012857_353_895 180
1548 3300046537 Ga0495598_0054140 Ga0495598_0054140_77_619 180
1549 3300046538 Ga0495609_0019662 Ga0495609_0019662_1742_2284 180
1550 3300046538 Ga0495609_0023705 Ga0495609_0023705_724_1266 180
1551 3300046539 Ga0495621_0013237 Ga0495621_0013237_1461_2003 180
1552 3300046539 Ga0495621_0018299 Ga0495621_0018299_136_684 180
1553 3300046539 Ga0495621_0034876 Ga0495621_0034876_1028_1570 180
1554 3300046539 Ga0495621_0045294 Ga0495621_0045294_529_1071 180
1555 3300046539 Ga0495621_0045398 Ga0495621_0045398_120_665 180
1556 3300046539 Ga0495621_0106156 Ga0495621_0106156_46_588 180
1557 3300046539 Ga0495621_0125550 Ga0495621_0125550_427_972 180
1558 3300046539 Ga0495621_0367758 Ga0495621_0367758_10_555 180
1559 3300046543 Ga0495645_0004427 Ga0495645_0004427_1382_1924 180
1560 3300046543 Ga0495645_0146884 Ga0495645_0146884_862_1410 180
1561 3300046543 Ga0495645_0242401 Ga0495645_0242401_642_1184 180
1562 3300046558 Ga0495633_0081374 Ga0495633_0081374_754_1308 180
1563 3300046615 Ga0495656_0013358 Ga0495656_0013358_709_1251 180
1564 3300046615 Ga0495656_0104798 Ga0495656_0104798_353_898 180
1565 3300046615 Ga0495656_0105318 Ga0495656_0105318_410_952 180
1566 3300046615 Ga0495656_0211187 Ga0495656_0211187_242_784 180
1567 3300046616 Ga0495668_0201813 Ga0495668_0201813_520_1062 180
1568 3300046642 Ga0495634_0132458 Ga0495634_0132458_519_1061 180
1569 3300046648 Ga0495611_0202351 Ga0495611_0202351_38_580 180
1570 3300046663 Ga0495635_0293510 Ga0495635_0293510_61_609 180
1571 3300046664 Ga0495659_0009558 Ga0495659_0009558_1138_1680 180
1572 3300046664 Ga0495659_0011236 Ga0495659_0011236_289_831 180
1573 3300046664 Ga0495659_0013370 Ga0495659_0013370_406_948 180
1574 3300046664 Ga0495659_0013901 Ga0495659_0013901_1270_1812 180
1575 3300046664 Ga0495659_0038786 Ga0495659_0038786_217_771 180
1576 3300046664 Ga0495659_0045980 Ga0495659_0045980_281_823 180
1577 3300046664 Ga0495659_0072239 Ga0495659_0072239_484_1026 180
1578 3300046664 Ga0495659_0189963 Ga0495659_0189963_285_827 180
1579 3300046674 Ga0495588_0004710 Ga0495588_0004710_3648_4196 180
1580 3300046675 Ga0495657_0179033 Ga0495657_0179033_236_778 180
1581 3300046680 Ga0495646_0162193 Ga0495646_0162193_405_950 180
1582 3300046681 Ga0495647_0067201 Ga0495647_0067201_396_938 180
1583 3300046681 Ga0495647_0168281 Ga0495647_0168281_370_912 180
1584 3300046683 Ga0495658_0115758 Ga0495658_0115758_970_1518 180
1585 3300046683 Ga0495658_0169867 Ga0495658_0169867_470_1012 180
1586 3300046683 Ga0495658_0398530 Ga0495658_0398530_246_788 180
1587 3300046689 Ga0495613_0056428 Ga0495613_0056428_571_1119 180
1588 3300046690 Ga0495624_0356946 Ga0495624_0356946_144_686 180
1589 3300046691 Ga0495670_0265060 Ga0495670_0265060_93_635 180
1590 3300046691 Ga0495670_0343500 Ga0495670_0343500_227_769 180
1591 3300046809 Ga0495600_0158681 Ga0495600_0158681_576_1124 180
1592 3300046809 Ga0495600_0503675 Ga0495600_0503675_37_579 180
1593 3300047315 Ga0495581_0286146 Ga0495581_0286146_239_781 180
1594 3300047318 Ga0495636_0002384 Ga0495636_0002384_4471_5013 180
1595 3300047318 Ga0495636_0207950 Ga0495636_0207950_30_572 180
1596 3300047318 Ga0495636_0392301 Ga0495636_0392301_103_645 180
1597 3300047319 Ga0495674_0225933 Ga0495674_0225933_462_1010 180
1598 3300047319 Ga0495674_0344427 Ga0495674_0344427_44_586 180
1599 3300047319 Ga0495674_0364505 Ga0495674_0364505_542_1084 180
1600 3300047319 Ga0495674_0513669 Ga0495674_0513669_189_731 180
1601 3300047320 Ga0495672_0088102 Ga0495672_0088102_928_1476 180
1602 3300047321 Ga0495676_0264865 Ga0495676_0264865_392_934 180
1603 3300047322 Ga0495680_0069116 Ga0495680_0069116_1384_1932 180
1604 3300047444 Ga0495675_0232880 Ga0495675_0232880_472_1020 180
1605 3300047673 Ga0495593_0316955 Ga0495593_0316955_119_661 180
1606 3300048903 Ga0496100_0004796 Ga0496100_0004796_869_1411 180
1607 3300048903 Ga0496100_0366146 Ga0496100_0366146_435_977 180
1608 3300048903 Ga0496100_0382037 Ga0496100_0382037_332_877 180
1609 3300048903 Ga0496100_0687195 Ga0496100_0687195_81_623 180
1610 3300048904 Ga0496101_0000396 Ga0496101_0000396_22522_23064 180
1611 3300048904 Ga0496101_0029477 Ga0496101_0029477_2333_2875 180
1612 3300048904 Ga0496101_0181057 Ga0496101_0181057_914_1456 180
1613 3300048904 Ga0496101_0402930 Ga0496101_0402930_18_560 180
1614 3300048904 Ga0496101_0425109 Ga0496101_0425109_361_903 180
1615 3300048905 Ga0496102_0002334 Ga0496102_0002334_10590_11132 180
1616 3300048905 Ga0496102_0164766 Ga0496102_0164766_1486_2028 180
1617 3300048905 Ga0496102_0219233 Ga0496102_0219233_490_1035 180
1618 3300048905 Ga0496102_0234216 Ga0496102_0234216_995_1537 180
1619 3300048905 Ga0496102_0246276 Ga0496102_0246276_683_1228 180
1620 3300048905 Ga0496102_1101616 Ga0496102_1101616_41_583 180
1621 3300048906 Ga0496103_0289329 Ga0496103_0289329_415_957 180
1622 3300048906 Ga0496103_0366714 Ga0496103_0366714_354_896 180
1623 3300048907 Ga0496104_0002699 Ga0496104_0002699_13080_13622 180
1624 3300048907 Ga0496104_0015461 Ga0496104_0015461_849_1391 180
1625 3300048907 Ga0496104_0021813 Ga0496104_0021813_4246_4788 180
1626 3300048907 Ga0496104_0083357 Ga0496104_0083357_2165_2707 180
1627 3300048907 Ga0496104_0169675 Ga0496104_0169675_826_1368 180
1628 3300048907 Ga0496104_0379989 Ga0496104_0379989_297_839 180
1629 3300048907 Ga0496104_0720055 Ga0496104_0720055_337_879 180
1630 3300048908 Ga0496105_0089711 Ga0496105_0089711_984_1526 180
1631 3300048908 Ga0496105_0105843 Ga0496105_0105843_383_925 180
1632 3300048908 Ga0496105_0212809 Ga0496105_0212809_789_1331 180
1633 3300048909 Ga0496106_0019828 Ga0496106_0019828_366_908 180
1634 3300048909 Ga0496106_0058558 Ga0496106_0058558_1336_1878 180
1635 3300048909 Ga0496106_0264255 Ga0496106_0264255_289_831 180
1636 3300048909 Ga0496106_0447819 Ga0496106_0447819_429_971 180
1637 3300048909 Ga0496106_0465220 Ga0496106_0465220_41_586 180
1638 3300048910 Ga0496107_0031098 Ga0496107_0031098_967_1509 180
1639 3300048910 Ga0496107_0330833 Ga0496107_0330833_336_878 180
1640 3300048910 Ga0496107_0380450 Ga0496107_0380450_195_740 180
1641 3300048910 Ga0496107_0474855 Ga0496107_0474855_196_738 180
1642 3300048910 Ga0496107_0605056 Ga0496107_0605056_211_753 180
1643 3300048911 Ga0496108_0011060 Ga0496108_0011060_4429_4971 180
1644 3300048911 Ga0496108_0039080 Ga0496108_0039080_70_612 180
1645 3300048911 Ga0496108_0137002 Ga0496108_0137002_699_1244 180
1646 3300048911 Ga0496108_0375295 Ga0496108_0375295_435_977 180
1647 3300048911 Ga0496108_0432665 Ga0496108_0432665_214_756 180
1648 3300048911 Ga0496108_0501720 Ga0496108_0501720_46_588 180
1649 3300048912 Ga0496109_0001514 Ga0496109_0001514_10506_11048 180
1650 3300048912 Ga0496109_0159807 Ga0496109_0159807_819_1361 180
1651 3300048912 Ga0496109_0184229 Ga0496109_0184229_1078_1620 180
1652 3300048912 Ga0496109_0360754 Ga0496109_0360754_772_1314 180
1653 3300048912 Ga0496109_0826534 Ga0496109_0826534_143_685 180
1654 3300048912 Ga0496109_0922402 Ga0496109_0922402_71_613 180
1655 3300048912 Ga0496109_1165469 Ga0496109_1165469_26_568 180
1656 3300048913 Ga0496110_0015263 Ga0496110_0015263_5390_5932 180
1657 3300048913 Ga0496110_0152762 Ga0496110_0152762_421_963 180
1658 3300048913 Ga0496110_0241917 Ga0496110_0241917_850_1392 180
1659 3300048913 Ga0496110_0594849 Ga0496110_0594849_306_848 180
1660 3300048913 Ga0496110_1215116 Ga0496110_1215116_97_639 180
1661 3300048914 Ga0496111_0027389 Ga0496111_0027389_3429_3971 180
1662 3300048914 Ga0496111_0607052 Ga0496111_0607052_65_607 180
1663 3300048915 Ga0496112_0002153 Ga0496112_0002153_4582_5124 180
1664 3300048915 Ga0496112_0046122 Ga0496112_0046122_3010_3552 180
1665 3300048915 Ga0496112_0069136 Ga0496112_0069136_1353_1895 180
1666 3300048915 Ga0496112_0165394 Ga0496112_0165394_530_1072 180
1667 3300048915 Ga0496112_0172476 Ga0496112_0172476_1072_1614 180
1668 3300048915 Ga0496112_0196906 Ga0496112_0196906_1232_1774 180
1669 3300048915 Ga0496112_0222947 Ga0496112_0222947_1259_1801 180
1670 3300048915 Ga0496112_0460455 Ga0496112_0460455_104_646 180
1671 3300048915 Ga0496112_0557841 Ga0496112_0557841_21_566 180
1672 3300048915 Ga0496112_0629340 Ga0496112_0629340_259_801 180
1673 3300048916 Ga0496113_0006726 Ga0496113_0006726_967_1509 180
1674 3300048916 Ga0496113_0045212 Ga0496113_0045212_753_1295 180
1675 3300048916 Ga0496113_0185984 Ga0496113_0185984_366_908 180
1676 3300048916 Ga0496113_0371949 Ga0496113_0371949_90_632 180
1677 3300048916 Ga0496113_0541207 Ga0496113_0541207_348_893 180
1678 3300048917 Ga0496114_0000246 Ga0496114_0000246_14022_14564 180
1679 3300048917 Ga0496114_0013645 Ga0496114_0013645_3792_4334 180
1680 3300048917 Ga0496114_0063145 Ga0496114_0063145_550_1092 180
1681 3300048917 Ga0496114_0152111 Ga0496114_0152111_618_1160 180
1682 3300048917 Ga0496114_0206262 Ga0496114_0206262_471_1013 180
1683 3300048917 Ga0496114_0231201 Ga0496114_0231201_428_970 180
1684 3300048917 Ga0496114_0256738 Ga0496114_0256738_190_732 180
1685 3300048917 Ga0496114_0316093 Ga0496114_0316093_751_1293 180
1686 3300048917 Ga0496114_0438645 Ga0496114_0438645_314_856 180
1687 3300048917 Ga0496114_0480816 Ga0496114_0480816_530_1072 180
1688 3300048918 Ga0496115_0031358 Ga0496115_0031358_1619_2161 180
1689 3300048918 Ga0496115_0203505 Ga0496115_0203505_974_1516 180
1690 3300049514 Ga0501291_023051 Ga0501291_023051_240_782 180
1691 3300049515 Ga0501292_076083 Ga0501292_076083_44_586 180
1692 3300049516 Ga0501293_029053 Ga0501293_029053_12_554 180
1693 3300049519 Ga0501296_013170 Ga0501296_013170_10_564 180
1694 3300049522 Ga0501299_009069 Ga0501299_009069_411_953 180
1695 3300049568 Ga0501031_0043373 Ga0501031_0043373_2297_2839 180
1696 3300049568 Ga0501031_0073573 Ga0501031_0073573_210_752 180
1697 3300049568 Ga0501031_0267930 Ga0501031_0267930_354_896 180
1698 3300049568 Ga0501031_0288261 Ga0501031_0288261_394_936 180
1699 3300049568 Ga0501031_0643177 Ga0501031_0643177_84_626 180
1700 3300049569 Ga0501032_0054572 Ga0501032_0054572_1165_1707 180
1701 3300049569 Ga0501032_0067399 Ga0501032_0067399_1498_2040 180
1702 3300049569 Ga0501032_0148425 Ga0501032_0148425_439_981 180
1703 3300049569 Ga0501032_0292881 Ga0501032_0292881_337_879 180
1704 3300049570 Ga0501033_0010156 Ga0501033_0010156_5338_5880 180
1705 3300049570 Ga0501033_0017769 Ga0501033_0017769_2174_2716 180
1706 3300049570 Ga0501033_0249266 Ga0501033_0249266_254_796 180
1707 3300049570 Ga0501033_0328211 Ga0501033_0328211_397_939 180
1708 3300049571 Ga0501034_0031932 Ga0501034_0031932_2179_2721 180
1709 3300049571 Ga0501034_0035468 Ga0501034_0035468_3131_3673 180
1710 3300049571 Ga0501034_0098192 Ga0501034_0098192_1756_2298 180
1711 3300049571 Ga0501034_0123450 Ga0501034_0123450_627_1169 180
1712 3300049571 Ga0501034_0181183 Ga0501034_0181183_527_1069 180
1713 3300049571 Ga0501034_0307864 Ga0501034_0307864_912_1454 180
1714 3300049571 Ga0501034_0544910 Ga0501034_0544910_503_1045 180
1715 3300049572 Ga0501036_0011660 Ga0501036_0011660_457_999 180
1716 3300049572 Ga0501036_0030598 Ga0501036_0030598_1731_2273 180
1717 3300049572 Ga0501036_0057133 Ga0501036_0057133_2308_2850 180
1718 3300049572 Ga0501036_0089808 Ga0501036_0089808_1227_1769 180
1719 3300049572 Ga0501036_0215663 Ga0501036_0215663_728_1270 180
1720 3300049572 Ga0501036_0294508 Ga0501036_0294508_511_1053 180
1721 3300049572 Ga0501036_0383121 Ga0501036_0383121_615_1157 180
1722 3300049573 Ga0501037_0035865 Ga0501037_0035865_2665_3207 180
1723 3300049573 Ga0501037_0369197 Ga0501037_0369197_226_768 180
1724 3300049574 Ga0501038_0060881 Ga0501038_0060881_66_608 180
1725 3300049574 Ga0501038_0100507 Ga0501038_0100507_1411_1953 180
1726 3300049574 Ga0501038_0390261 Ga0501038_0390261_417_959 180
1727 3300049575 Ga0501039_0039586 Ga0501039_0039586_39_581 180
1728 3300049575 Ga0501039_0123895 Ga0501039_0123895_94_636 180
1729 3300049575 Ga0501039_0140837 Ga0501039_0140837_1109_1651 180
1730 3300049575 Ga0501039_0151380 Ga0501039_0151380_974_1516 180
1731 3300049575 Ga0501039_0912668 Ga0501039_0912668_43_585 180
1732 3300049576 Ga0501040_0221528 Ga0501040_0221528_72_614 180
1733 3300049576 Ga0501040_0252242 Ga0501040_0252242_253_795 180
1734 3300049577 Ga0501041_0035058 Ga0501041_0035058_223_774 180
1735 3300049577 Ga0501041_0061920 Ga0501041_0061920_386_928 180
1736 3300049577 Ga0501041_0168357 Ga0501041_0168357_775_1317 180
1737 3300049577 Ga0501041_0231293 Ga0501041_0231293_473_1015 180
1738 3300049577 Ga0501041_0267909 Ga0501041_0267909_341_883 180
1739 3300049577 Ga0501041_0325199 Ga0501041_0325199_96_638 180
1740 3300049577 Ga0501041_0336126 Ga0501041_0336126_190_732 180
1741 3300049577 Ga0501041_0669749 Ga0501041_0669749_21_563 180
1742 3300049577 Ga0501041_0746652 Ga0501041_0746652_10_552 180
1743 3300049578 Ga0501042_0009478 Ga0501042_0009478_4570_5112 180
1744 3300049578 Ga0501042_0050664 Ga0501042_0050664_298_840 180
1745 3300049578 Ga0501042_0121338 Ga0501042_0121338_1059_1601 180
1746 3300049578 Ga0501042_0173184 Ga0501042_0173184_187_729 180
1747 3300049578 Ga0501042_0187599 Ga0501042_0187599_603_1145 180
1748 3300049578 Ga0501042_0271926 Ga0501042_0271926_543_1085 180
1749 3300049578 Ga0501042_0480827 Ga0501042_0480827_250_792 180
1750 3300049578 Ga0501042_0762196 Ga0501042_0762196_141_683 180
1751 3300049579 Ga0501043_0034818 Ga0501043_0034818_2883_3425 180
1752 3300049579 Ga0501043_0126335 Ga0501043_0126335_435_977 180
1753 3300049579 Ga0501043_0160054 Ga0501043_0160054_999_1541 180
1754 3300049580 Ga0501046_0022396 Ga0501046_0022396_2665_3207 180
1755 3300049580 Ga0501046_0030233 Ga0501046_0030233_1476_2018 180
1756 3300049580 Ga0501046_0147309 Ga0501046_0147309_439_981 180
1757 3300049581 Ga0501047_0007192 Ga0501047_0007192_8345_8887 180
1758 3300049581 Ga0501047_0008209 Ga0501047_0008209_8832_9374 180
1759 3300049581 Ga0501047_0032236 Ga0501047_0032236_3131_3673 180
1760 3300049581 Ga0501047_0033605 Ga0501047_0033605_2460_3002 180
1761 3300049581 Ga0501047_0053218 Ga0501047_0053218_3206_3748 180
1762 3300049581 Ga0501047_0061080 Ga0501047_0061080_248_790 180
1763 3300049581 Ga0501047_0092564 Ga0501047_0092564_132_674 180
1764 3300049582 Ga0501048_0027688 Ga0501048_0027688_1341_1883 180
1765 3300049582 Ga0501048_0050069 Ga0501048_0050069_2283_2825 180
1766 3300049582 Ga0501048_0054176 Ga0501048_0054176_429_971 180
1767 3300049582 Ga0501048_0065073 Ga0501048_0065073_279_821 180
1768 3300049582 Ga0501048_0123213 Ga0501048_0123213_978_1520 180
1769 3300049582 Ga0501048_0165784 Ga0501048_0165784_718_1260 180
1770 3300049582 Ga0501048_0197312 Ga0501048_0197312_639_1181 180
1771 3300049582 Ga0501048_0228115 Ga0501048_0228115_470_1012 180
1772 3300049582 Ga0501048_0967210 Ga0501048_0967210_16_558 180
1773 3300049583 Ga0501067_0015088 Ga0501067_0015088_2194_2736 180
1774 3300049583 Ga0501067_0049579 Ga0501067_0049579_167_709 180
1775 3300049583 Ga0501067_0322947 Ga0501067_0322947_257_799 180
1776 3300049584 Ga0501068_0008979 Ga0501068_0008979_3063_3605 180
1777 3300049584 Ga0501068_0019337 Ga0501068_0019337_2958_3500 180
1778 3300049584 Ga0501068_0030055 Ga0501068_0030055_305_847 180
1779 3300049584 Ga0501068_0155925 Ga0501068_0155925_526_1068 180
1780 3300049584 Ga0501068_0216169 Ga0501068_0216169_164_706 180
1781 3300049584 Ga0501068_0341021 Ga0501068_0341021_238_780 180
1782 3300049584 Ga0501068_0412514 Ga0501068_0412514_264_806 180
1783 3300049585 Ga0501069_0001595 Ga0501069_0001595_9035_9577 180
1784 3300049585 Ga0501069_0031141 Ga0501069_0031141_52_594 180
1785 3300049585 Ga0501069_0184857 Ga0501069_0184857_438_983 180
1786 3300049585 Ga0501069_0299174 Ga0501069_0299174_368_910 180
1787 3300049586 Ga0501070_0012118 Ga0501070_0012118_2883_3425 180
1788 3300049586 Ga0501070_0014951 Ga0501070_0014951_4700_5242 180
1789 3300049586 Ga0501070_0171737 Ga0501070_0171737_926_1468 180
1790 3300049586 Ga0501070_0189507 Ga0501070_0189507_748_1290 180
1791 3300049587 Ga0501071_0002536 Ga0501071_0002536_4291_4833 180
1792 3300049587 Ga0501071_0338803 Ga0501071_0338803_188_730 180
1793 3300049587 Ga0501071_0349023 Ga0501071_0349023_154_696 180
1794 3300049587 Ga0501071_0388828 Ga0501071_0388828_510_1052 180
1795 3300049587 Ga0501071_0443512 Ga0501071_0443512_192_734 180
1796 3300049587 Ga0501071_0469731 Ga0501071_0469731_62_613 180
1797 3300049587 Ga0501071_0547828 Ga0501071_0547828_78_620 180
1798 3300049588 Ga0501072_0012080 Ga0501072_0012080_231_773 180
1799 3300049588 Ga0501072_0013067 Ga0501072_0013067_3658_4200 180
1800 3300049588 Ga0501072_0095139 Ga0501072_0095139_1638_2180 180
1801 3300049588 Ga0501072_0101866 Ga0501072_0101866_323_865 180
1802 3300049588 Ga0501072_0102741 Ga0501072_0102741_1195_1737 180
1803 3300049588 Ga0501072_0424619 Ga0501072_0424619_183_725 180
1804 3300049589 Ga0501073_0004894 Ga0501073_0004894_536_1078 180
1805 3300049589 Ga0501073_0052788 Ga0501073_0052788_812_1354 180
1806 3300049589 Ga0501073_0091800 Ga0501073_0091800_1033_1575 180
1807 3300049589 Ga0501073_0131275 Ga0501073_0131275_157_699 180
1808 3300049589 Ga0501073_0248770 Ga0501073_0248770_498_1040 180
1809 3300049589 Ga0501073_0355491 Ga0501073_0355491_455_997 180
1810 3300049589 Ga0501073_0661020 Ga0501073_0661020_119_661 180
1811 3300049590 Ga0501074_0005968 Ga0501074_0005968_3843_4385 180
1812 3300049590 Ga0501074_0111424 Ga0501074_0111424_868_1410 180
1813 3300049590 Ga0501074_0190566 Ga0501074_0190566_382_924 180
1814 3300049590 Ga0501074_0284823 Ga0501074_0284823_247_789 180
1815 3300049591 Ga0501075_0044834 Ga0501075_0044834_1250_1792 180
1816 3300049591 Ga0501075_0082026 Ga0501075_0082026_1698_2240 180
1817 3300049591 Ga0501075_0095949 Ga0501075_0095949_1203_1745 180
1818 3300049591 Ga0501075_0119064 Ga0501075_0119064_258_800 180
1819 3300049591 Ga0501075_0171793 Ga0501075_0171793_659_1201 180
1820 3300049591 Ga0501075_0287430 Ga0501075_0287430_690_1232 180
1821 3300049591 Ga0501075_0359146 Ga0501075_0359146_72_614 180
1822 3300049591 Ga0501075_0674481 Ga0501075_0674481_128_670 180
1823 3300049592 Ga0501076_0022347 Ga0501076_0022347_3059_3601 180
1824 3300049592 Ga0501076_0099638 Ga0501076_0099638_545_1087 180
1825 3300049592 Ga0501076_0102721 Ga0501076_0102721_939_1481 180
1826 3300049592 Ga0501076_0111850 Ga0501076_0111850_1366_1908 180
1827 3300049592 Ga0501076_0114579 Ga0501076_0114579_1200_1742 180
1828 3300049592 Ga0501076_0129675 Ga0501076_0129675_1262_1804 180
1829 3300049592 Ga0501076_0628777 Ga0501076_0628777_11_553 180
1830 3300049593 Ga0501077_0054477 Ga0501077_0054477_129_671 180
1831 3300049652 Ga0501202_035075 Ga0501202_035075_116_658 180
1832 3300049656 Ga0501209_040504 Ga0501209_040504_665_1207 180
1833 3300049660 Ga0501216_044425 Ga0501216_044425_248_790 180
1834 3300049661 Ga0501217_051587 Ga0501217_051587_39_581 180
1835 3300049669 Ga0501235_031096 Ga0501235_031096_388_930 180
1836 3300049679 Ga0501249_146244 Ga0501249_146244_11_565 180
1837 3300049705 Ga0501225_0085627 Ga0501225_0085627_128_670 180
1838 3300049705 Ga0501225_0174579 Ga0501225_0174579_43_585 180
1839 3300049741 Ga0501079_0018519 Ga0501079_0018519_2184_2726 180
1840 3300049741 Ga0501079_0021349 Ga0501079_0021349_3954_4496 180
1841 3300049741 Ga0501079_0038135 Ga0501079_0038135_984_1526 180
1842 3300049741 Ga0501079_0068731 Ga0501079_0068731_1737_2279 180
1843 3300049741 Ga0501079_0072836 Ga0501079_0072836_1529_2071 180
1844 3300049741 Ga0501079_0147420 Ga0501079_0147420_491_1033 180
1845 3300049741 Ga0501079_0188310 Ga0501079_0188310_456_998 180
1846 3300049741 Ga0501079_0228349 Ga0501079_0228349_23_565 180
1847 3300049741 Ga0501079_0268723 Ga0501079_0268723_50_592 180
1848 3300049741 Ga0501079_0356038 Ga0501079_0356038_516_1058 180
1849 3300049741 Ga0501079_0452924 Ga0501079_0452924_172_714 180
1850 3300049742 Ga0501080_0049182 Ga0501080_0049182_1143_1685 180
1851 3300049742 Ga0501080_0057688 Ga0501080_0057688_2995_3537 180
1852 3300049742 Ga0501080_0075641 Ga0501080_0075641_1767_2309 180
1853 3300049742 Ga0501080_0086218 Ga0501080_0086218_1592_2134 180
1854 3300049742 Ga0501080_0088731 Ga0501080_0088731_73_615 180
1855 3300049742 Ga0501080_0181947 Ga0501080_0181947_1063_1605 180
1856 3300049742 Ga0501080_0243581 Ga0501080_0243581_737_1279 180
1857 3300049742 Ga0501080_0254913 Ga0501080_0254913_239_781 180
1858 3300049742 Ga0501080_0258166 Ga0501080_0258166_391_933 180
1859 3300049742 Ga0501080_0682871 Ga0501080_0682871_66_608 180
1860 3300049743 Ga0501081_0020963 Ga0501081_0020963_231_773 180
1861 3300049743 Ga0501081_0048503 Ga0501081_0048503_1699_2241 180
1862 3300049743 Ga0501081_0086874 Ga0501081_0086874_1314_1856 180
1863 3300049743 Ga0501081_0307755 Ga0501081_0307755_244_795 180
1864 3300049743 Ga0501081_0444570 Ga0501081_0444570_392_934 180
1865 3300049743 Ga0501081_0483710 Ga0501081_0483710_256_798 180
1866 3300049743 Ga0501081_0489325 Ga0501081_0489325_130_672 180
1867 3300049743 Ga0501081_0497693 Ga0501081_0497693_12_554 180
1868 3300049743 Ga0501081_0805258 Ga0501081_0805258_13_555 180
1869 3300049744 Ga0501083_0018519 Ga0501083_0018519_3131_3673 180
1870 3300049744 Ga0501083_0032228 Ga0501083_0032228_1379_1921 180
1871 3300049744 Ga0501083_0081846 Ga0501083_0081846_1092_1634 180
1872 3300049744 Ga0501083_0082866 Ga0501083_0082866_225_767 180
1873 3300049744 Ga0501083_0190089 Ga0501083_0190089_56_598 180
1874 3300049744 Ga0501083_0277863 Ga0501083_0277863_91_633 180
1875 3300049744 Ga0501083_0813819 Ga0501083_0813819_23_565 180
1876 3300049822 Ga0501035_0031573 Ga0501035_0031573_1399_1941 180
1877 3300049822 Ga0501035_0125804 Ga0501035_0125804_1016_1558 180
1878 3300049822 Ga0501035_0209539 Ga0501035_0209539_850_1392 180
1879 3300049822 Ga0501035_0957258 Ga0501035_0957258_51_593 180
1880 3300049823 Ga0501044_0075438 Ga0501044_0075438_2541_3083 180
1881 3300049823 Ga0501044_0557394 Ga0501044_0557394_275_817 180
1882 3300049823 Ga0501044_0666082 Ga0501044_0666082_30_572 180
1883 3300049824 Ga0501045_0031277 Ga0501045_0031277_1024_1566 180
1884 3300049824 Ga0501045_0051561 Ga0501045_0051561_1687_2229 180
1885 3300049824 Ga0501045_0207264 Ga0501045_0207264_516_1058 180
1886 3300049824 Ga0501045_0253934 Ga0501045_0253934_453_995 180
1887 3300049824 Ga0501045_0336872 Ga0501045_0336872_231_773 180
1888 3300050491 nmdc:mga00v17_14500_c1 nmdc:mga00v17_14500_c1_3318_3860 180
1889 3300050494 nmdc:mga06z11_18170_c1 nmdc:mga06z11_18170_c1_467_1009 180
1890 3300050495 nmdc:mga04h51_32128_c1 nmdc:mga04h51_32128_c1_890_1432 180
1891 3300050507 nmdc:mga05p37_11036_c1 nmdc:mga05p37_11036_c1_4577_5119 180
1892 3300050507 nmdc:mga05p37_1346306_c1 nmdc:mga05p37_1346306_c1_78_623 180
1893 3300050507 nmdc:mga05p37_1426373_c1 nmdc:mga05p37_1426373_c1_143_685 180
1894 3300050507 nmdc:mga05p37_154199_c1 nmdc:mga05p37_154199_c1_883_1425 180
1895 3300050507 nmdc:mga05p37_158310_c1 nmdc:mga05p37_158310_c1_1801_2343 180
1896 3300050507 nmdc:mga05p37_17386_c1 nmdc:mga05p37_17386_c1_5958_6500 180
1897 3300050507 nmdc:mga05p37_18820_c1 nmdc:mga05p37_18820_c1_6914_7456 180
1898 3300050507 nmdc:mga05p37_192822_c1 nmdc:mga05p37_192822_c1_1401_1943 180
1899 3300050507 nmdc:mga05p37_199866_c1 nmdc:mga05p37_199866_c1_81_626 180
1900 3300050507 nmdc:mga05p37_2249_c1 nmdc:mga05p37_2249_c1_865_1407 180
1901 3300050507 nmdc:mga05p37_250653_c1 nmdc:mga05p37_250653_c1_875_1417 180
1902 3300050507 nmdc:mga05p37_252783_c1 nmdc:mga05p37_252783_c1_714_1256 180
1903 3300050507 nmdc:mga05p37_324604_c1 nmdc:mga05p37_324604_c1_491_1033 180
1904 3300050507 nmdc:mga05p37_442_c2 nmdc:mga05p37_442_c2_1556_2098 180
1905 3300050507 nmdc:mga05p37_4833_c1 nmdc:mga05p37_4833_c1_1325_1870 180
1906 3300050507 nmdc:mga05p37_529385_c1 nmdc:mga05p37_529385_c1_550_1092 180
1907 3300050507 nmdc:mga05p37_551470_c1 nmdc:mga05p37_551470_c1_93_635 180
1908 3300050507 nmdc:mga05p37_555890_c1 nmdc:mga05p37_555890_c1_122_667 180
1909 3300050507 nmdc:mga05p37_57020_c1 nmdc:mga05p37_57020_c1_1304_1846 180
1910 3300050507 nmdc:mga05p37_58588_c1 nmdc:mga05p37_58588_c1_2222_2764 180
1911 3300050507 nmdc:mga05p37_595_c1 nmdc:mga05p37_595_c1_5886_6431 180
1912 3300050507 nmdc:mga05p37_742081_c1 nmdc:mga05p37_742081_c1_515_1057 180
1913 3300050507 nmdc:mga05p37_808529_c1 nmdc:mga05p37_808529_c1_272_814 180
1914 3300050507 nmdc:mga05p37_811014_c1 nmdc:mga05p37_811014_c1_359_910 180
1915 3300050507 nmdc:mga05p37_838889_c1 nmdc:mga05p37_838889_c1_280_822 180
1916 3300050507 nmdc:mga05p37_84446_c1 nmdc:mga05p37_84446_c1_2126_2668 180
1917 3300050508 nmdc:mga09592_120146_c1 nmdc:mga09592_120146_c1_297_839 180
1918 3300050508 nmdc:mga09592_26926_c1 nmdc:mga09592_26926_c1_198_740 180
1919 3300050508 nmdc:mga09592_302004_c1 nmdc:mga09592_302004_c1_743_1294 180
1920 3300050508 nmdc:mga09592_339628_c1 nmdc:mga09592_339628_c1_663_1205 180
1921 3300050508 nmdc:mga09592_430610_c1 nmdc:mga09592_430610_c1_160_702 180
1922 3300050508 nmdc:mga09592_481847_c1 nmdc:mga09592_481847_c1_193_735 180
1923 3300050508 nmdc:mga09592_97790_c1 nmdc:mga09592_97790_c1_1745_2287 180
1924 3300050509 nmdc:mga0qj67_15565_c1 nmdc:mga0qj67_15565_c1_1326_1868 180
1925 3300050509 nmdc:mga0qj67_165452_c1 nmdc:mga0qj67_165452_c1_301_843 180
1926 3300050509 nmdc:mga0qj67_22250_c1 nmdc:mga0qj67_22250_c1_2249_2791 180
1927 3300050509 nmdc:mga0qj67_224752_c1 nmdc:mga0qj67_224752_c1_431_973 180
1928 3300050509 nmdc:mga0qj67_2372_c1 nmdc:mga0qj67_2372_c1_8807_9349 180
1929 3300050509 nmdc:mga0qj67_325247_c1 nmdc:mga0qj67_325247_c1_624_1166 180
1930 3300050509 nmdc:mga0qj67_4157_c1 nmdc:mga0qj67_4157_c1_738_1283 180
1931 3300050509 nmdc:mga0qj67_564347_c1 nmdc:mga0qj67_564347_c1_303_848 180
1932 3300050509 nmdc:mga0qj67_665977_c1 nmdc:mga0qj67_665977_c1_66_608 180
1933 3300050509 nmdc:mga0qj67_731210_c1 nmdc:mga0qj67_731210_c1_87_635 180
1934 3300050510 nmdc:mga06r32_193106_c1 nmdc:mga06r32_193106_c1_252_794 180
1935 3300050510 nmdc:mga06r32_274980_c1 nmdc:mga06r32_274980_c1_744_1286 180
1936 3300050510 nmdc:mga06r32_418267_c1 nmdc:mga06r32_418267_c1_715_1257 180
1937 3300050510 nmdc:mga06r32_460045_c1 nmdc:mga06r32_460045_c1_210_761 180
1938 3300050510 nmdc:mga06r32_550438_c1 nmdc:mga06r32_550438_c1_244_795 180
1939 3300050510 nmdc:mga06r32_712509_c1 nmdc:mga06r32_712509_c1_141_683 180
1940 3300050510 nmdc:mga06r32_79535_c1 nmdc:mga06r32_79535_c1_2116_2658 180
1941 3300050510 nmdc:mga06r32_85956_c1 nmdc:mga06r32_85956_c1_763_1305 180
1942 3300050510 nmdc:mga06r32_9166_c1 nmdc:mga06r32_9166_c1_6625_7167 180
1943 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_433229_433780 180
1944 3300050511 nmdc:mga08y16_13623_c1 nmdc:mga08y16_13623_c1_1354_1896 180
1945 3300050511 nmdc:mga08y16_155_c1 nmdc:mga08y16_155_c1_7403_7945 180
1946 3300050511 nmdc:mga08y16_16207_c1 nmdc:mga08y16_16207_c1_4424_4966 180
1947 3300050511 nmdc:mga08y16_165837_c1 nmdc:mga08y16_165837_c1_45_587 180
1948 3300050511 nmdc:mga08y16_202_c1 nmdc:mga08y16_202_c1_384_929 180
1949 3300050511 nmdc:mga08y16_20665_c1 nmdc:mga08y16_20665_c1_2214_2756 180
1950 3300050511 nmdc:mga08y16_242231_c2 nmdc:mga08y16_242231_c2_430_972 180
1951 3300050511 nmdc:mga08y16_358929_c1 nmdc:mga08y16_358929_c1_558_1106 180
1952 3300050511 nmdc:mga08y16_373375_c1 nmdc:mga08y16_373375_c1_481_1023 180
1953 3300050511 nmdc:mga08y16_420500_c1 nmdc:mga08y16_420500_c1_181_723 180
1954 3300050511 nmdc:mga08y16_59755_c1 nmdc:mga08y16_59755_c1_2892_3434 180
1955 3300050511 nmdc:mga08y16_69932_c1 nmdc:mga08y16_69932_c1_1583_2128 180
1956 3300050511 nmdc:mga08y16_707160_c1 nmdc:mga08y16_707160_c1_360_902 180
1957 3300050511 nmdc:mga08y16_83813_c1 nmdc:mga08y16_83813_c1_856_1398 180
1958 3300050512 nmdc:mga0n895_1039503_c1 nmdc:mga0n895_1039503_c1_88_630 180
1959 3300050512 nmdc:mga0n895_1194231_c1 nmdc:mga0n895_1194231_c1_62_607 180
1960 3300050512 nmdc:mga0n895_1295565_c1 nmdc:mga0n895_1295565_c1_122_667 180
1961 3300050512 nmdc:mga0n895_159380_c1 nmdc:mga0n895_159380_c1_877_1419 180
1962 3300050512 nmdc:mga0n895_17757_c1 nmdc:mga0n895_17757_c1_858_1403 180
1963 3300050512 nmdc:mga0n895_21313_c1 nmdc:mga0n895_21313_c1_390_932 180
1964 3300050512 nmdc:mga0n895_24421_c1 nmdc:mga0n895_24421_c1_2993_3535 180
1965 3300050512 nmdc:mga0n895_29459_c1 nmdc:mga0n895_29459_c1_2724_3266 180
1966 3300050512 nmdc:mga0n895_36985_c1 nmdc:mga0n895_36985_c1_1899_2441 180
1967 3300050512 nmdc:mga0n895_440066_c1 nmdc:mga0n895_440066_c1_659_1201 180
1968 3300050512 nmdc:mga0n895_7101_c1 nmdc:mga0n895_7101_c1_495_1040 180
1969 3300050512 nmdc:mga0n895_83582_c1 nmdc:mga0n895_83582_c1_277_819 180
1970 3300050512 nmdc:mga0n895_987225_c1 nmdc:mga0n895_987225_c1_216_758 180
1971 3300050513 nmdc:mga0rr50_130334_c1 nmdc:mga0rr50_130334_c1_849_1391 180
1972 3300050513 nmdc:mga0rr50_1773_c1 nmdc:mga0rr50_1773_c1_8348_8890 180
1973 3300050513 nmdc:mga0rr50_185897_c1 nmdc:mga0rr50_185897_c1_442_984 180
1974 3300050513 nmdc:mga0rr50_1983_c1 nmdc:mga0rr50_1983_c1_91_633 180
1975 3300050513 nmdc:mga0rr50_261472_c1 nmdc:mga0rr50_261472_c1_510_1055 180
1976 3300050513 nmdc:mga0rr50_287992_c1 nmdc:mga0rr50_287992_c1_627_1169 180
1977 3300050513 nmdc:mga0rr50_32050_c1 nmdc:mga0rr50_32050_c1_22_567 180
1978 3300050513 nmdc:mga0rr50_37105_c1 nmdc:mga0rr50_37105_c1_2276_2818 180
1979 3300050513 nmdc:mga0rr50_373_c1 nmdc:mga0rr50_373_c1_20884_21429 180
1980 3300050513 nmdc:mga0rr50_404836_c1 nmdc:mga0rr50_404836_c1_127_669 180
1981 3300050513 nmdc:mga0rr50_43434_c1 nmdc:mga0rr50_43434_c1_1977_2522 180
1982 3300050513 nmdc:mga0rr50_440346_c1 nmdc:mga0rr50_440346_c1_69_614 180
1983 3300050513 nmdc:mga0rr50_8258_c1 nmdc:mga0rr50_8258_c1_1544_2089 180
1984 3300050514 nmdc:mga08x19_10007_c1 nmdc:mga08x19_10007_c1_2877_3419 180
1985 3300050514 nmdc:mga08x19_124254_c1 nmdc:mga08x19_124254_c1_669_1211 180
1986 3300050514 nmdc:mga08x19_228724_c1 nmdc:mga08x19_228724_c1_337_879 180
1987 3300050514 nmdc:mga08x19_30264_c1 nmdc:mga08x19_30264_c1_2011_2556 180
1988 3300050514 nmdc:mga08x19_78601_c1 nmdc:mga08x19_78601_c1_440_982 180
1989 3300050514 nmdc:mga08x19_95027_c1 nmdc:mga08x19_95027_c1_871_1416 180
1990 3300050515 nmdc:mga0a205_10220_c1 nmdc:mga0a205_10220_c1_7249_7791 180
1991 3300050515 nmdc:mga0a205_14317_c1 nmdc:mga0a205_14317_c1_2745_3287 180
1992 3300050515 nmdc:mga0a205_164147_c1 nmdc:mga0a205_164147_c1_1356_1898 180
1993 3300050515 nmdc:mga0a205_177662_c1 nmdc:mga0a205_177662_c1_906_1451 180
1994 3300050515 nmdc:mga0a205_183676_c1 nmdc:mga0a205_183676_c1_1253_1795 180
1995 3300050515 nmdc:mga0a205_2239_c1 nmdc:mga0a205_2239_c1_581_1123 180
1996 3300050515 nmdc:mga0a205_3001_c1 nmdc:mga0a205_3001_c1_2590_3132 180
1997 3300050515 nmdc:mga0a205_301479_c1 nmdc:mga0a205_301479_c1_621_1163 180
1998 3300050515 nmdc:mga0a205_3048_c1 nmdc:mga0a205_3048_c1_8127_8669 180
1999 3300050515 nmdc:mga0a205_334780_c1 nmdc:mga0a205_334780_c1_173_718 180
2000 3300050515 nmdc:mga0a205_45628_c1 nmdc:mga0a205_45628_c1_3019_3564 180
2001 3300050515 nmdc:mga0a205_6655_c1 nmdc:mga0a205_6655_c1_7341_7886 180
2002 3300050515 nmdc:mga0a205_69911_c1 nmdc:mga0a205_69911_c1_1701_2246 180
2003 3300050515 nmdc:mga0a205_7364_c1 nmdc:mga0a205_7364_c1_773_1315 180
2004 3300050515 nmdc:mga0a205_7753_c2 nmdc:mga0a205_7753_c2_2669_3211 180
2005 3300053077 Ga0495601_0139220 Ga0495601_0139220_128_676 180
2006 3300053084 Ga0495595_0091960 Ga0495595_0091960_242_784 180
2007 3300053084 Ga0495595_0096054 Ga0495595_0096054_491_1033 180
2008 3300053085 Ga0495619_0056922 Ga0495619_0056922_565_1113 180
2009 3300053085 Ga0495619_0188061 Ga0495619_0188061_536_1078 180
2010 3300053103 Ga0500555_000474 Ga0500555_000474_6338_6886 180
2011 3300053116 Ga0500592_001961 Ga0500592_001961_482_1030 180
2012 3300053134 Ga0500658_0086584 Ga0500658_0086584_517_1059 180
2013 3300053153 Ga0500616_0000173 Ga0500616_0000173_11864_12412 180
2014 3300053730 Ga0500645_002162 Ga0500645_002162_6310_6858 180
2015 3300054114 Ga0501084_0029531 Ga0501084_0029531_1062_1604 180
2016 3300054114 Ga0501084_0033473 Ga0501084_0033473_3324_3866 180
2017 3300054114 Ga0501084_0035989 Ga0501084_0035989_420_962 180
2018 3300054114 Ga0501084_0139356 Ga0501084_0139356_1313_1855 180
2019 3300054114 Ga0501084_0282971 Ga0501084_0282971_363_905 180
2020 3300054114 Ga0501084_0287940 Ga0501084_0287940_92_634 180
2021 3300054114 Ga0501084_0801611 Ga0501084_0801611_168_710 180
2022 3300059421 Ga0590071_000004 Ga0590071_000004_27874_28416 180
2023 3300059423 Ga0590074_000940 Ga0590074_000940_1721_2263 180
2024 3300059424 Ga0590075_000034 Ga0590075_000034_12898_13440 180
2025 3300059424 Ga0590075_037092 Ga0590075_037092_378_920 180
2026 3300059424 Ga0590075_110101 Ga0590075_110101_130_687 180
2027 3300059426 Ga0590077_000015 Ga0590077_000015_36407_36949 180
2028 3300059477 Ga0587084_035846 Ga0587084_035846_215_757 180
2029 3300059505 Ga0587083_0106660 Ga0587083_0106660_123_665 180
2030 3300059511 Ga0587091_010024 Ga0587091_010024_435_977 180
2031 3300059630 Ga0587128_004306 Ga0587128_004306_441_983 180
2032 3300059640 Ga0587067_008021 Ga0587067_008021_553_1095 180
2033 3300059655 Ga0587114_024982 Ga0587114_024982_224_766 180
2034 3300060353 Ga0501082_0030758 Ga0501082_0030758_2010_2552 180
2035 3300060353 Ga0501082_0042145 Ga0501082_0042145_3088_3630 180
2036 3300060353 Ga0501082_0067692 Ga0501082_0067692_791_1333 180
2037 3300060353 Ga0501082_0071934 Ga0501082_0071934_457_999 180
2038 3300060353 Ga0501082_0082568 Ga0501082_0082568_854_1396 180
2039 3300060353 Ga0501082_0126266 Ga0501082_0126266_1497_2039 180
2040 3300060353 Ga0501082_0132322 Ga0501082_0132322_739_1281 180
2041 3300060353 Ga0501082_0229652 Ga0501082_0229652_109_651 180
2042 3300060353 Ga0501082_0421528 Ga0501082_0421528_357_899 180
2043 3300060353 Ga0501082_0516312 Ga0501082_0516312_57_599 180
2044 3300060353 Ga0501082_0617786 Ga0501082_0617786_208_750 180
2045 3300061734 Ga0530510_0153816 Ga0530510_0153816_600_1142 180
2046 3300061734 Ga0530510_0167544 Ga0530510_0167544_846_1388 180
2047 3300061734 Ga0530510_0186296 Ga0530510_0186296_648_1190 180
2048 3300061734 Ga0530510_0188385 Ga0530510_0188385_528_1070 180
2049 3300061734 Ga0530510_0212203 Ga0530510_0212203_568_1110 180
2050 3300061734 Ga0530510_0911693 Ga0530510_0911693_66_608 180
2051 3300061734 Ga0530510_1014446 Ga0530510_1014446_24_566 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

66

122

0.99

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

126

219

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9782 4 178
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9781 1 178
5ns3-assembly1.cif.gz_A crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9767 4 178
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9712 1 178
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9696 4 178
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9282 3 178 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9183 3 178 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8965 22 177 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8927 22 177 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8797 22 177 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A3B9SJT6-F1-model_v4 50S ribosomal protein L5 0.9752 2 116 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7Y2XWP2-F1-model_v4 50S ribosomal protein L5 0.9745 1 125 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3C1DEH0-F1-model_v4 50S ribosomal protein L5 0.9737 2 116 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A6P0JPW0-F1-model_v4 50S ribosomal protein L5 0.9695 4 117 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-S6CQ79-F1-model_v4 50S ribosomal protein L5 0.9655 2 141 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
79.62 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map