F496175

General Info

Members Datasets Scaffolds Average Seq Length
1971 602 1881 404

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10000072|Ga0111539_1000007248
Length 481
Sequence LRPKTPSPRHGAKLGFSALRLSPGEARRSDPGPATAVGGLVQGAKKPLTSQSRRTRRLTANGRDIICGYRAARRGGIIHFRLCSNRRMAPVSSHLLPTYARVDLAFERGDGAWLVATNGERYLDFTSGIAVNLLGHAHPRLVEALTEQAQKLWHVSNLYRIPEGERLADRLCAASFADRVFFTNSGAEAMECAIKMARKYQSASGNPERFRIITFEGAFHGRTLATLAAGGQKKYLDGFGPVVEGFDQLVAGDLEAVKRTIGPETAAILVEPIQAEGGVRVISTQFLKGLRQLCDQHGLLLIFDEVQTGMGRTGELFAYQRTGVVPDIMAVAKGIGGGYPLGACLGTAEAAKGMTTGTHGSTFVLDVVLAPGFLDQVKRTALVLKQRLAELKDRHPQVIAEVRGEGLLIGLRAEVPAAELVDALRAEKMITAAAGDNVVRLLPPLIVGEQEIAAALASLDRAATRIEAALEPPRKVQGAAG

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2534681786 Brucella suis 92/29 Isolate Unclassified
8 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
9 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
10 2643221733 Bosea sp. Root381 Isolate Unclassified
11 2643221736 Bosea sp. Root483D1 Isolate Unclassified
12 2738543024 Aminobacter sp. AP02 Isolate Unclassified
13 2751185800 Brucella pituitosa AA2 Isolate Unclassified
14 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
15 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
16 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
17 2841760612 Bosea sp. Tri-49 Isolate Nodule
18 2842694124 Methylopila sp. R-72369 Isolate Unclassified
19 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
20 2844104063 Bosea sp. Tri-39 Isolate Nodule
21 2851182111 Bosea sp. Tri-44 Isolate Nodule
22 2851246043 Bosea sp. Tri-54 Isolate Nodule
23 2854911287 Brucella lupini LUP21 Isolate Unclassified
24 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
25 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
26 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
27 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
28 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
29 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
30 2909042592 Labrys sp. LIt4 Isolate Nodule
31 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
32 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
33 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
34 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
35 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
36 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
37 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
38 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
39 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
40 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
41 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
42 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
43 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
44 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
45 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
46 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
47 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
48 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
49 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
50 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
51 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
52 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
53 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
54 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
55 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
56 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
57 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
58 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
59 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
60 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
61 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
62 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
63 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
64 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
65 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
66 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
67 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
68 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
69 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
70 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
71 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
72 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
73 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
74 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
75 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
76 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
77 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
78 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
79 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
80 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
81 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
82 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
83 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
85 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
86 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
88 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
91 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
92 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
95 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
96 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
97 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
98 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
99 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
100 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
101 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
102 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
103 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
104 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
105 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
106 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
107 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
108 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
109 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
110 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
111 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
112 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
113 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
114 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
115 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
116 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
117 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
118 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
119 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
120 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
121 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
122 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
123 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
124 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
125 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
126 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
127 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
128 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
129 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
130 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
131 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
132 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
133 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
134 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
135 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
136 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
137 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
138 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
139 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
140 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
143 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
144 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
145 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
146 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
147 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
148 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
149 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
150 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
153 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
154 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
155 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
156 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
157 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
158 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
159 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
160 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
161 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
162 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
163 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
164 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
165 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
166 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
167 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
168 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
169 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
170 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
171 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
172 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
173 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
174 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
175 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
176 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
177 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
178 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
179 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
180 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
181 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
182 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
183 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
184 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
185 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
186 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
187 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
188 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
189 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
190 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
192 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
193 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
195 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
196 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
197 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
198 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
199 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
200 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
201 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
202 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
203 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
204 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
205 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
206 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
207 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
208 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
209 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
210 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
211 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
212 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
213 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
214 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
215 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
216 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
217 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
218 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
219 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
220 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
221 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
223 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
224 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
227 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
228 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
230 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
231 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
233 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
235 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
295 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
296 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
297 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
298 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
300 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
301 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
304 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
305 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
306 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
307 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
308 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
309 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
310 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
311 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
312 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
313 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
314 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
315 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
317 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
318 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
319 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
320 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
321 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
322 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
323 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
324 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
325 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
326 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
327 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
328 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
329 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
330 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
331 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
332 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
333 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
334 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
335 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
336 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
337 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
338 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
339 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
340 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
341 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
342 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
343 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
344 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
345 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
346 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
347 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
348 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
349 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
350 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
351 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
352 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
353 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
354 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
355 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
356 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
357 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
358 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
359 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
360 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
361 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
362 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
363 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
364 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
365 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
366 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
367 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
368 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
369 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
370 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
371 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
372 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
373 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
374 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
375 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
376 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
377 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
378 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
379 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
380 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
381 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
382 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
383 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
384 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
385 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
386 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
387 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
388 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
389 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
390 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
391 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
392 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
393 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
394 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
395 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
396 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
397 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
398 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
399 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
400 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
401 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
402 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
403 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
404 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
405 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
406 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
407 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
408 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
409 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
410 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
411 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
412 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
413 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
414 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
415 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
416 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
417 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
418 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
419 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
420 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
421 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
422 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
423 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
424 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
425 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
426 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
427 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
428 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
429 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
430 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
431 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
432 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
433 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
434 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
435 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
436 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
437 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
438 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
439 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
440 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
441 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
442 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
443 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
444 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
445 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
446 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
447 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
448 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
449 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
450 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
451 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
452 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
453 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
454 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
455 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
456 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
457 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
458 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
459 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
460 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
461 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
462 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
463 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
464 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
465 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
466 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
467 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
468 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
469 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
470 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
471 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
472 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
473 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
474 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
475 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
476 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
477 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
478 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
479 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
480 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
481 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
482 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
483 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
484 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
485 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
486 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
487 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
488 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
489 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
490 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
491 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
492 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
493 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
494 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
495 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
496 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
499 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
512 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
513 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
514 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
515 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
516 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
517 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
518 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
519 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
520 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
521 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
522 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
523 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
524 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
525 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
526 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
527 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
529 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
530 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
531 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
532 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
533 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
534 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
535 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
536 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
537 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
538 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
539 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
540 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
541 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
542 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
543 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
544 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
545 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
546 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
547 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
548 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
549 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
550 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
551 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
552 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
553 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
554 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
555 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
556 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
557 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
558 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
559 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
560 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
561 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
562 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
563 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
564 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
565 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
566 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
567 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
568 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
569 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
570 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
571 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
572 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
573 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
574 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
575 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
576 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
577 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
578 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
579 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
580 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
581 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
582 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
583 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
584 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
585 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
586 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
587 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
588 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
589 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
590 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
591 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
592 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
593 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
594 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
595 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
596 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
597 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
598 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
599 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
600 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
601 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
602 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.28
Metatranscriptomes 0.15
Isolates 4.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 4.31
Rhizoplane 6.65
Rhizosphere 75.44
Stem 0
Stem Tuber 0
Unclassified 6.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24032J14994_100023 3300001430 Bacteria 5519
2 JGI24740J21852_10009741 3300001979 Bacteria 3742
3 JGI25159J45721_1011968 3300002987 Bacteria 2095
4 JGI25151J46595_10000030 3300003187 Bacteria 202084
5 JGI25406J46586_10000059 3300003203 Bacteria 50077
6 JGI25406J46586_10020200 3300003203 Bacteria 2698
7 JGI25153J46596_10010198 3300003215 Bacteria 4273
8 JGI25153J46596_10010247 3300003215 Bacteria 4257
9 JGI25153J46596_10013242 3300003215 Bacteria 3500
10 JGI25160J50197_1007252 3300003354 Bacteria 4359
11 JGI25404J52841_10003156 3300003659 Bacteria 3225
12 JGI25404J52841_10013749 3300003659 Bacteria 1756
13 JGI25404J52841_10024754 3300003659 Bacteria 1293
14 Ga0055542_1000656 3300003762 Bacteria 28388
15 Ga0055524_1000189 3300003775 Bacteria 68000
16 Ga0055524_1025056 3300003775 Bacteria 1875
17 Ga0055531_10008258 3300003794 Bacteria 5535
18 Ga0065165_1000229 3300005262 Bacteria 98699
19 Ga0065165_1006887 3300005262 Bacteria 5774
20 Ga0065165_1014916 3300005262 Bacteria 2992
21 Ga0065165_1018018 3300005262 Bacteria 2576
22 Ga0065712_10041299 3300005290 Bacteria 1483
23 Ga0070658_10060898 3300005327 Bacteria 3075
24 Ga0070658_10152185 3300005327 Bacteria 1937
25 Ga0070683_100083124 3300005329 Bacteria 2999
26 Ga0070683_100123171 3300005329 Bacteria 2450
27 Ga0070690_100045259 3300005330 Bacteria 2795
28 Ga0070690_100046376 3300005330 Bacteria 2763
29 Ga0070690_100079136 3300005330 Bacteria 2149
30 Ga0070690_100101891 3300005330 Bacteria 1905
31 Ga0070690_100109911 3300005330 Bacteria 1838
32 Ga0070670_100117490 3300005331 Bacteria 2294
33 Ga0070677_10020965 3300005333 Bacteria 2390
34 Ga0068869_100003148 3300005334 Bacteria 10069
35 Ga0070666_10000553 3300005335 Bacteria 22588
36 Ga0070666_10004225 3300005335 Bacteria 8722
37 Ga0070666_10079083 3300005335 Bacteria 2246
38 Ga0070680_100010233 3300005336 Bacteria 7231
39 Ga0070680_100010948 3300005336 Bacteria 7010
40 Ga0070680_100012989 3300005336 Bacteria 6479
41 Ga0070680_100016219 3300005336 Bacteria 5859
42 Ga0070680_100029337 3300005336 Bacteria 4419
43 Ga0070680_100038840 3300005336 Bacteria 3851
44 Ga0070680_100080629 3300005336 Bacteria 2684
45 Ga0070680_100137744 3300005336 Bacteria 2046
46 Ga0070682_100190758 3300005337 Bacteria 1439
47 Ga0070682_100201894 3300005337 Bacteria 1403
48 Ga0068868_100002807 3300005338 Bacteria 12069
49 Ga0068868_100073155 3300005338 Bacteria 2736
50 Ga0070660_100016213 3300005339 Bacteria 5404
51 Ga0070689_100010075 3300005340 Bacteria 6728
52 Ga0070691_10000365 3300005341 Bacteria 16356
53 Ga0070691_10073241 3300005341 Bacteria 1665
54 Ga0070687_100075182 3300005343 Bacteria 1826
55 Ga0070661_100045611 3300005344 Bacteria 3205
56 Ga0070661_100084794 3300005344 Bacteria 2340
57 Ga0070661_100217158 3300005344 Bacteria 1465
58 Ga0070692_10089850 3300005345 Bacteria 1668
59 Ga0070668_100005625 3300005347 Bacteria 9292
60 Ga0070669_100284639 3300005353 Bacteria 1325
61 Ga0070671_100059698 3300005355 Bacteria 3174
62 Ga0070671_100076532 3300005355 Bacteria 2795
63 Ga0070671_100107516 3300005355 Bacteria 2342
64 Ga0070671_100243239 3300005355 Bacteria 1528
65 Ga0070674_100001719 3300005356 Bacteria 11861
66 Ga0070674_100121080 3300005356 Bacteria 1937
67 Ga0070688_100006669 3300005365 Bacteria 6187
68 Ga0070688_100013108 3300005365 Bacteria 4667
69 Ga0070688_100088051 3300005365 Bacteria 2024
70 Ga0070659_100047835 3300005366 Bacteria 3357
71 Ga0070667_100087949 3300005367 Bacteria 2667
72 Ga0070667_100118289 3300005367 Bacteria 2303
73 Ga0070709_10000576 3300005434 Bacteria 21459
74 Ga0070709_10001614 3300005434 Bacteria 12187
75 Ga0070709_10002181 3300005434 Bacteria 10604
76 Ga0070709_10021695 3300005434 Bacteria 3744
77 Ga0070709_10128880 3300005434 Bacteria 1725
78 Ga0070709_10142545 3300005434 Bacteria 1648
79 Ga0070714_100020306 3300005435 Bacteria 5423
80 Ga0070714_100020464 3300005435 Bacteria 5403
81 Ga0070714_100029247 3300005435 Bacteria 4580
82 Ga0070714_100038921 3300005435 Bacteria 4001
83 Ga0070714_100084431 3300005435 Bacteria 2771
84 Ga0070714_100095664 3300005435 Bacteria 2608
85 Ga0070714_100176983 3300005435 Bacteria 1939
86 Ga0070714_100250746 3300005435 Bacteria 1637
87 Ga0070713_100000001 3300005436 Bacteria 257984
88 Ga0070713_100000386 3300005436 Bacteria 28227
89 Ga0070713_100000783 3300005436 Bacteria 20312
90 Ga0070713_100005333 3300005436 Bacteria 8772
91 Ga0070713_100047028 3300005436 Bacteria 3544
92 Ga0070713_100051304 3300005436 Unclassified 3411
93 Ga0070713_100060850 3300005436 Bacteria 3158
94 Ga0070713_100064354 3300005436 Bacteria 3078
95 Ga0070713_100072684 3300005436 Bacteria 2909
96 Ga0070713_100090586 3300005436 Bacteria 2629
97 Ga0070713_100097153 3300005436 Bacteria 2545
98 Ga0070710_10009408 3300005437 Bacteria 4779
99 Ga0070710_10013274 3300005437 Bacteria 4121
100 Ga0070710_10050502 3300005437 Bacteria 2332
101 Ga0070710_10073638 3300005437 Unclassified 1975
102 Ga0070711_100002004 3300005439 Bacteria 11471
103 Ga0070711_100002298 3300005439 Bacteria 10834
104 Ga0070711_100009879 3300005439 Bacteria 5886
105 Ga0070711_100034183 3300005439 Bacteria 3390
106 Ga0070711_100036630 3300005439 Bacteria 3287
107 Ga0070711_100089369 3300005439 Bacteria 2216
108 Ga0070711_100227968 3300005439 Bacteria 1451
109 Ga0070705_100062301 3300005440 Bacteria 2220
110 Ga0070663_100022329 3300005455 Bacteria 4229
111 Ga0070663_100048274 3300005455 Bacteria 3018
112 Ga0070663_100062402 3300005455 Bacteria 2686
113 Ga0070678_100003549 3300005456 Bacteria 8704
114 Ga0070678_100055537 3300005456 Bacteria 2891
115 Ga0070678_100135616 3300005456 Bacteria 1962
116 Ga0070678_100204272 3300005456 Bacteria 1633
117 Ga0070662_100040755 3300005457 Bacteria 3308
118 Ga0070662_100052304 3300005457 Bacteria 2951
119 Ga0070681_10016662 3300005458 Bacteria 7337
120 Ga0070681_10023118 3300005458 Bacteria 6251
121 Ga0070681_10025706 3300005458 Bacteria 5921
122 Ga0070681_10025965 3300005458 Bacteria 5889
123 Ga0070681_10083474 3300005458 Bacteria 3148
124 Ga0068867_100025491 3300005459 Bacteria 4242
125 Ga0068867_100057165 3300005459 Bacteria 2888
126 Ga0070685_10152241 3300005466 Bacteria 1467
127 Ga0070699_100035205 3300005518 Bacteria 4327
128 Ga0070679_100029348 3300005530 Bacteria 5427
129 Ga0070679_100041336 3300005530 Bacteria 4589
130 Ga0070679_100045573 3300005530 Bacteria 4370
131 Ga0070679_100064857 3300005530 Bacteria 3641
132 Ga0070679_100085100 3300005530 Bacteria 3149
133 Ga0070679_100114326 3300005530 Bacteria 2684
134 Ga0070679_100264410 3300005530 Bacteria 1675
135 Ga0070684_100001316 3300005535 Bacteria 17776
136 Ga0070684_100003206 3300005535 Bacteria 12234
137 Ga0070684_100005711 3300005535 Bacteria 9557
138 Ga0070684_100037737 3300005535 Bacteria 4147
139 Ga0068853_100001956 3300005539 Bacteria 15182
140 Ga0068853_100007961 3300005539 Bacteria 8499
141 Ga0068853_100029002 3300005539 Bacteria 4659
142 Ga0068853_100084745 3300005539 Bacteria 2777
143 Ga0068853_100143915 3300005539 Bacteria 2141
144 Ga0068853_100194676 3300005539 Bacteria 1843
145 Ga0070672_100032787 3300005543 Bacteria 3925
146 Ga0070686_100060993 3300005544 Bacteria 2435
147 Ga0070686_100073451 3300005544 Bacteria 2245
148 Ga0070695_100165865 3300005545 Bacteria 1554
149 Ga0070693_100011286 3300005547 Bacteria 4498
150 Ga0070693_100041996 3300005547 Bacteria 2575
151 Ga0070665_100000707 3300005548 Bacteria 44382
152 Ga0070665_100075677 3300005548 Bacteria 3373
153 Ga0070665_100194240 3300005548 Bacteria 2030
154 Ga0070704_100000828 3300005549 Bacteria 15365
155 Ga0070704_100008815 3300005549 Bacteria 6070
156 Ga0070704_100104443 3300005549 Bacteria 2143
157 Ga0068855_100018110 3300005563 Bacteria 8464
158 Ga0068855_100046224 3300005563 Bacteria 5146
159 Ga0068855_100077395 3300005563 Bacteria 3859
160 Ga0070664_100100430 3300005564 Bacteria 2516
161 Ga0068857_100000759 3300005577 Bacteria 23985
162 Ga0068857_100047478 3300005577 Bacteria 3813
163 Ga0068857_100064850 3300005577 Bacteria 3248
164 Ga0068857_100089874 3300005577 Bacteria 2748
165 Ga0068854_100048805 3300005578 Bacteria 3021
166 Ga0068856_100001359 3300005614 Bacteria 25713
167 Ga0068856_100005630 3300005614 Bacteria 12327
168 Ga0068856_100030985 3300005614 Bacteria 5232
169 Ga0068856_100089825 3300005614 Bacteria 3055
170 Ga0068856_100139768 3300005614 Bacteria 2429
171 Ga0068856_100209636 3300005614 Bacteria 1964
172 Ga0070702_100016461 3300005615 Bacteria 3794
173 Ga0068852_100060020 3300005616 Bacteria 3300
174 Ga0068852_100109810 3300005616 Bacteria 2505
175 Ga0068852_100136704 3300005616 Bacteria 2263
176 Ga0068859_100024833 3300005617 Bacteria 6015
177 Ga0068859_100078065 3300005617 Bacteria 3352
178 Ga0068859_100202173 3300005617 Bacteria 2071
179 Ga0068864_100017053 3300005618 Bacteria 6053
180 Ga0068864_100026834 3300005618 Bacteria 4858
181 Ga0068864_100118272 3300005618 Bacteria 2366
182 Ga0068864_100238718 3300005618 Bacteria 1684
183 Ga0068861_100042257 3300005719 Bacteria 3415
184 Ga0068851_10020995 3300005834 Bacteria 3167
185 Ga0068870_10086192 3300005840 Bacteria 1747
186 Ga0068863_100052581 3300005841 Bacteria 3860
187 Ga0068863_100233749 3300005841 Bacteria 1773
188 Ga0068858_100057440 3300005842 Bacteria 3596
189 Ga0068860_100049640 3300005843 Bacteria 3995
190 Ga0068860_100238781 3300005843 Bacteria 1767
191 Ga0081455_10000607 3300005937 Bacteria 46359
192 Ga0081455_10003030 3300005937 Bacteria 19580
193 Ga0081455_10007394 3300005937 Bacteria 11573
194 Ga0081455_10024711 3300005937 Bacteria 5557
195 Ga0081455_10030564 3300005937 Bacteria 4891
196 Ga0081455_10033082 3300005937 Bacteria 4650
197 Ga0081455_10049396 3300005937 Bacteria 3627
198 Ga0081538_10002248 3300005981 Bacteria 19113
199 Ga0081538_10016589 3300005981 Bacteria 5638
200 Ga0081538_10053618 3300005981 Bacteria 2395
201 Ga0081540_1000198 3300005983 Bacteria 62526
202 Ga0081540_1002088 3300005983 Bacteria 16651
203 Ga0081540_1003995 3300005983 Bacteria 11435
204 Ga0081540_1004695 3300005983 Bacteria 10339
205 Ga0081540_1009469 3300005983 Bacteria 6711
206 Ga0081540_1027831 3300005983 Bacteria 3192
207 Ga0081540_1034735 3300005983 Bacteria 2713
208 Ga0081540_1092722 3300005983 Bacteria 1325
209 Ga0081539_10000324 3300005985 Bacteria 106549
210 Ga0081539_10000902 3300005985 Bacteria 56412
211 Ga0070717_10008922 3300006028 Bacteria 7515
212 Ga0070717_10035443 3300006028 Unclassified 4039
213 Ga0070717_10051989 3300006028 Bacteria 3373
214 Ga0070717_10070550 3300006028 Bacteria 2912
215 Ga0070717_10108949 3300006028 Bacteria 2360
216 Ga0070717_10122060 3300006028 Bacteria 2233
217 Ga0070717_10223673 3300006028 Bacteria 1655
218 Ga0075365_10002773 3300006038 Bacteria 8750
219 Ga0075365_10010355 3300006038 Bacteria 5424
220 Ga0075365_10019530 3300006038 Bacteria 4184
221 Ga0075368_10008049 3300006042 Bacteria 3740
222 Ga0075368_10015289 3300006042 Bacteria 2845
223 Ga0075363_100014598 3300006048 Bacteria 3844
224 Ga0075363_100059775 3300006048 Bacteria 2050
225 Ga0075363_100073361 3300006048 Bacteria 1862
226 Ga0075363_100124163 3300006048 Bacteria 1444
227 Ga0075364_10007635 3300006051 Bacteria 6431
228 Ga0075364_10027441 3300006051 Bacteria 3637
229 Ga0075364_10040152 3300006051 Bacteria 3035
230 Ga0075432_10009380 3300006058 Bacteria 3332
231 Ga0070715_10002559 3300006163 Bacteria 5607
232 Ga0070715_10005811 3300006163 Bacteria 4150
233 Ga0070715_10010996 3300006163 Bacteria 3244
234 Ga0070712_100000209 3300006175 Bacteria 33053
235 Ga0070712_100000486 3300006175 Bacteria 22668
236 Ga0070712_100000761 3300006175 Bacteria 18982
237 Ga0070712_100023499 3300006175 Bacteria 4074
238 Ga0070712_100052641 3300006175 Bacteria 2840
239 Ga0070712_100077449 3300006175 Bacteria 2397
240 Ga0070712_100161442 3300006175 Bacteria 1731
241 Ga0075362_10001295 3300006177 Bacteria 7924
242 Ga0075367_10034607 3300006178 Bacteria 2919
243 Ga0075367_10037023 3300006178 Bacteria 2832
244 Ga0075367_10059102 3300006178 Bacteria 2282
245 Ga0075367_10145961 3300006178 Bacteria 1467
246 Ga0075369_10033540 3300006186 Bacteria 2176
247 Ga0075427_10002056 3300006194 Bacteria 2663
248 Ga0075366_10002180 3300006195 Bacteria 9991
249 Ga0097621_100102038 3300006237 Bacteria 2415
250 Ga0097621_100109379 3300006237 Bacteria 2335
251 Ga0097621_100167935 3300006237 Bacteria 1890
252 Ga0075370_10020306 3300006353 Bacteria 3629
253 Ga0075370_10072641 3300006353 Bacteria 1969
254 Ga0075370_10073839 3300006353 Bacteria 1954
255 Ga0068871_100015220 3300006358 Bacteria 5752
256 Ga0068871_100086991 3300006358 Bacteria 2597
257 Ga0068871_100268974 3300006358 Bacteria 1488
258 Ga0075428_100000557 3300006844 Bacteria 38146
259 Ga0075428_100003602 3300006844 Bacteria 16977
260 Ga0075428_100040840 3300006844 Bacteria 5102
261 Ga0075428_100102159 3300006844 Bacteria 3126
262 Ga0075428_100271043 3300006844 Bacteria 1826
263 Ga0075430_100000367 3300006846 Bacteria 33161
264 Ga0075430_100001911 3300006846 Bacteria 17092
265 Ga0075430_100159477 3300006846 Bacteria 1878
266 Ga0075431_100000469 3300006847 Bacteria 33367
267 Ga0075431_100005940 3300006847 Bacteria 12079
268 Ga0075431_100040876 3300006847 Bacteria 4780
269 Ga0075433_10000501 3300006852 Bacteria 25541
270 Ga0075434_100038727 3300006871 Bacteria 4723
271 Ga0075434_100052989 3300006871 Bacteria 4032
272 Ga0075434_100082585 3300006871 Bacteria 3210
273 Ga0075434_100083774 3300006871 Bacteria 3187
274 Ga0075434_100095046 3300006871 Bacteria 2986
275 Ga0075434_100141996 3300006871 Bacteria 2421
276 Ga0075434_100277705 3300006871 Unclassified 1695
277 Ga0075429_100001022 3300006880 Bacteria 22312
278 Ga0075429_100230943 3300006880 Bacteria 1620
279 Ga0075436_100000553 3300006914 Bacteria 24405
280 Ga0075436_100005140 3300006914 Bacteria 9005
281 Ga0075436_100045817 3300006914 Bacteria 3016
282 Ga0097620_100024829 3300006931 Bacteria 6015
283 Ga0097620_100078065 3300006931 Bacteria 3352
284 Ga0097620_100202168 3300006931 Bacteria 2071
285 Ga0099825_1020543 3300006941 Bacteria 4672
286 Ga0099824_1013062 3300006942 Bacteria 8786
287 Ga0099822_1002961 3300006943 Bacteria 21559
288 Ga0099822_1047865 3300006943 Bacteria 1922
289 Ga0075435_100002541 3300007076 Bacteria 12143
290 Ga0075435_100102539 3300007076 Bacteria 2372
291 Ga0099794_10022266 3300007265 Bacteria 2888
292 Ga0099794_10050861 3300007265 Unclassified 1994
293 Ga0099795_10027844 3300007788 Bacteria 1916
294 Ga0105240_10010579 3300009093 Bacteria 12962
295 Ga0105240_10012113 3300009093 Bacteria 11944
296 Ga0105240_10032211 3300009093 Bacteria 6789
297 Ga0105240_10102021 3300009093 Bacteria 3488
298 Ga0105240_10129286 3300009093 Bacteria 3031
299 Ga0111539_10000072 3300009094 Bacteria 100461
300 Ga0111539_10013322 3300009094 Bacteria 10276
301 Ga0111539_10088469 3300009094 Bacteria 3639
302 Ga0111539_10603517 3300009094 Bacteria 1278
303 Ga0105245_10005172 3300009098 Bacteria 11461
304 Ga0105245_10025622 3300009098 Bacteria 5187
305 Ga0105245_10033872 3300009098 Bacteria 4527
306 Ga0105245_10096425 3300009098 Bacteria 2729
307 Ga0105245_10099428 3300009098 Bacteria 2689
308 Ga0105245_10217890 3300009098 Bacteria 1840
309 Ga0105247_10028650 3300009101 Bacteria 3370
310 Ga0105247_10069631 3300009101 Bacteria 2196
311 Ga0114129_10000134 3300009147 Bacteria 76265
312 Ga0114129_10013510 3300009147 Bacteria 11636
313 Ga0114129_10014841 3300009147 Bacteria 11102
314 Ga0114129_10017061 3300009147 Bacteria 10336
315 Ga0114129_10042413 3300009147 Bacteria 6408
316 Ga0114129_10059988 3300009147 Bacteria 5319
317 Ga0114129_10073532 3300009147 Bacteria 4762
318 Ga0114129_10093159 3300009147 Bacteria 4174
319 Ga0114129_10188445 3300009147 Bacteria 2802
320 Ga0114129_10242070 3300009147 Bacteria 2425
321 Ga0105243_10076590 3300009148 Bacteria 2718
322 Ga0105243_10152483 3300009148 Bacteria 1984
323 Ga0105241_10015454 3300009174 Bacteria 5591
324 Ga0105241_10068495 3300009174 Bacteria 2750
325 Ga0105241_10109019 3300009174 Bacteria 2214
326 Ga0105241_10142137 3300009174 Bacteria 1955
327 Ga0105242_10021935 3300009176 Bacteria 5019
328 Ga0105242_10044548 3300009176 Bacteria 3593
329 Ga0105242_10166258 3300009176 Bacteria 1935
330 Ga0105248_10031915 3300009177 Bacteria 5885
331 Ga0105248_10084399 3300009177 Bacteria 3573
332 Ga0105248_10112475 3300009177 Bacteria 3071
333 Ga0105248_10134276 3300009177 Bacteria 2792
334 Ga0105237_10007920 3300009545 Bacteria 11580
335 Ga0105237_10013837 3300009545 Bacteria 8448
336 Ga0105237_10049458 3300009545 Bacteria 4225
337 Ga0105237_10050169 3300009545 Bacteria 4193
338 Ga0105237_10079116 3300009545 Bacteria 3278
339 Ga0105238_10007409 3300009551 Bacteria 10991
340 Ga0105238_10009028 3300009551 Bacteria 9975
341 Ga0105238_10072323 3300009551 Bacteria 3444
342 Ga0105238_10083838 3300009551 Bacteria 3176
343 Ga0105238_10124582 3300009551 Bacteria 2556
344 Ga0105028_102329 3300009993 Bacteria 1993
345 Ga0099796_10022083 3300010159 Bacteria 1970
346 Ga0099796_10046085 3300010159 Bacteria 1495
347 Ga0105239_10031843 3300010375 Bacteria 5795
348 Ga0105239_10086707 3300010375 Bacteria 3451
349 Ga0105239_10107832 3300010375 Bacteria 3086
350 Ga0105239_10127764 3300010375 Bacteria 2826
351 Ga0105239_10182571 3300010375 Bacteria 2347
352 Ga0105246_10007751 3300011119 Bacteria 6590
353 Ga0105246_10045819 3300011119 Bacteria 2980
354 Ga0157373_10019637 3300013100 Bacteria 4915
355 Ga0157373_10099736 3300013100 Bacteria 2044
356 Ga0157370_10035418 3300013104 Bacteria 4851
357 Ga0157370_10036937 3300013104 Bacteria 4738
358 Ga0157370_10054783 3300013104 Bacteria 3801
359 Ga0157370_10092499 3300013104 Bacteria 2839
360 Ga0157369_10004483 3300013105 Bacteria 16454
361 Ga0157369_10019918 3300013105 Bacteria 7504
362 Ga0157369_10040438 3300013105 Bacteria 5090
363 Ga0157369_10114752 3300013105 Bacteria 2860
364 Ga0157374_10115241 3300013296 Bacteria 2588
365 Ga0157374_10219437 3300013296 Bacteria 1865
366 Ga0157374_10401111 3300013296 Bacteria 1368
367 Ga0163162_10155932 3300013306 Bacteria 2403
368 Ga0157372_10032483 3300013307 Bacteria 5724
369 Ga0157372_10056074 3300013307 Bacteria 4403
370 Ga0157372_10122943 3300013307 Bacteria 2983
371 Ga0157372_10135408 3300013307 Bacteria 2836
372 Ga0157372_10236555 3300013307 Bacteria 2119
373 Ga0157372_10482387 3300013307 Bacteria 1445
374 Ga0157375_10352896 3300013308 Bacteria 1637
375 Ga0163163_10002136 3300014325 Bacteria 16698
376 Ga0163163_10011126 3300014325 Bacteria 8146
377 Ga0163163_10018516 3300014325 Bacteria 6522
378 Ga0163163_10032611 3300014325 Bacteria 5033
379 Ga0163163_10032850 3300014325 Bacteria 5015
380 Ga0163163_10085597 3300014325 Bacteria 3160
381 Ga0157380_10009202 3300014326 Bacteria 7068
382 Ga0157377_10058081 3300014745 Bacteria 2202
383 Ga0157377_10193182 3300014745 Bacteria 1288
384 Ga0157379_10001102 3300014968 Bacteria 22075
385 Ga0157379_10002471 3300014968 Bacteria 15470
386 Ga0157379_10012482 3300014968 Bacteria 7418
387 Ga0157379_10026550 3300014968 Bacteria 5155
388 Ga0157376_10219367 3300014969 Bacteria 1760
389 Ga0157376_10220703 3300014969 Bacteria 1755
390 Ga0157376_10302524 3300014969 Bacteria 1514
391 Ga0206354_10460772 3300020081 Bacteria 1729
392 Ga0214544_1000003 3300021320 Bacteria 643752
393 Ga0214542_1000003 3300021321 Bacteria 435700
394 Ga0214545_1000004 3300021324 Bacteria 453352
395 Ga0214543_1000007 3300021327 Bacteria 414744
396 Ga0213874_10005194 3300021377 Bacteria 3023
397 Ga0213876_10004500 3300021384 Bacteria 7789
398 Ga0213876_10009014 3300021384 Bacteria 5374
399 Ga0213876_10015252 3300021384 Bacteria 4070
400 Ga0213876_10048817 3300021384 Bacteria 2235
401 Ga0213876_10059733 3300021384 Bacteria 2012
402 Ga0213875_10000011 3300021388 Bacteria 332447
403 Ga0213875_10006158 3300021388 Bacteria 6332
404 Ga0209563_102209 3300025230 Bacteria 4522
405 Ga0207425_1010016 3300025245 Bacteria 2326
406 Ga0209026_1000013 3300025250 Bacteria 415633
407 Ga0209677_101479 3300025253 Bacteria 10105
408 Ga0209148_1000210 3300025254 Bacteria 102885
409 Ga0209148_1001144 3300025254 Bacteria 15493
410 Ga0209759_1000884 3300025256 Bacteria 22738
411 Ga0209233_1000034 3300025261 Bacteria 578898
412 Ga0209233_1001617 3300025261 Bacteria 8766
413 Ga0209233_1001701 3300025261 Bacteria 8514
414 Ga0209233_1002286 3300025261 Bacteria 7139
415 Ga0209233_1002951 3300025261 Bacteria 6069
416 Ga0209455_1000098 3300025272 Bacteria 213890
417 Ga0209130_1000045 3300025284 Bacteria 240278
418 Ga0209025_1000063 3300025294 Bacteria 303962
419 Ga0209025_1003689 3300025294 Bacteria 14117
420 Ga0209564_1000076 3300025295 Bacteria 283602
421 Ga0209564_1000384 3300025295 Bacteria 80490
422 Ga0209564_1011770 3300025295 Bacteria 3884
423 Ga0209564_1016013 3300025295 Bacteria 3015
424 Ga0209758_1000015 3300025297 Bacteria 851943
425 Ga0209758_1001131 3300025297 Bacteria 34274
426 Ga0209758_1008479 3300025297 Bacteria 6643
427 Ga0209758_1011698 3300025297 Bacteria 5040
428 Ga0209256_1000316 3300025299 Bacteria 83704
429 Ga0209256_1010891 3300025299 Bacteria 3732
430 Ga0209256_1017679 3300025299 Bacteria 2354
431 Ga0207426_1000832 3300025302 Bacteria 32765
432 Ga0207426_1001988 3300025302 Bacteria 14453
433 Ga0207426_1005678 3300025302 Bacteria 5635
434 Ga0209257_1007257 3300025304 Bacteria 6772
435 Ga0207656_10069232 3300025321 Bacteria 1565
436 Ga0207653_10003313 3300025885 Bacteria 5082
437 Ga0207682_10001760 3300025893 Bacteria 9943
438 Ga0207692_10003626 3300025898 Bacteria 6042
439 Ga0207692_10005503 3300025898 Bacteria 5079
440 Ga0207692_10062198 3300025898 Bacteria 1937
441 Ga0207710_10002358 3300025900 Bacteria 8829
442 Ga0207688_10009201 3300025901 Bacteria 5382
443 Ga0207680_10002983 3300025903 Bacteria 7934
444 Ga0207685_10000983 3300025905 Bacteria 5501
445 Ga0207685_10035003 3300025905 Bacteria 1829
446 Ga0207685_10043393 3300025905 Bacteria 1694
447 Ga0207699_10000445 3300025906 Bacteria 21151
448 Ga0207699_10000523 3300025906 Bacteria 18988
449 Ga0207699_10000580 3300025906 Bacteria 17999
450 Ga0207699_10012908 3300025906 Bacteria 4259
451 Ga0207645_10013862 3300025907 Bacteria 5409
452 Ga0207645_10045055 3300025907 Bacteria 2820
453 Ga0207643_10003382 3300025908 Bacteria 8597
454 Ga0207643_10059115 3300025908 Bacteria 2187
455 Ga0207705_10013966 3300025909 Bacteria 5791
456 Ga0207705_10107507 3300025909 Bacteria 2058
457 Ga0207705_10239219 3300025909 Bacteria 1382
458 Ga0207684_10018439 3300025910 Bacteria 5976
459 Ga0207654_10175922 3300025911 Bacteria 1393
460 Ga0207707_10005171 3300025912 Bacteria 11434
461 Ga0207707_10025019 3300025912 Bacteria 5223
462 Ga0207707_10059393 3300025912 Bacteria 3327
463 Ga0207707_10069494 3300025912 Bacteria 3069
464 Ga0207707_10193979 3300025912 Bacteria 1772
465 Ga0207695_10000065 3300025913 Bacteria 336949
466 Ga0207695_10019503 3300025913 Bacteria 7808
467 Ga0207695_10040856 3300025913 Bacteria 4968
468 Ga0207695_10074744 3300025913 Bacteria 3449
469 Ga0207695_10195034 3300025913 Bacteria 1941
470 Ga0207671_10003508 3300025914 Bacteria 15575
471 Ga0207671_10009356 3300025914 Bacteria 8195
472 Ga0207671_10032293 3300025914 Bacteria 3898
473 Ga0207671_10182117 3300025914 Bacteria 1635
474 Ga0207693_10000116 3300025915 Bacteria 71473
475 Ga0207693_10000456 3300025915 Bacteria 37291
476 Ga0207693_10008969 3300025915 Bacteria 8161
477 Ga0207693_10020654 3300025915 Bacteria 5237
478 Ga0207693_10022492 3300025915 Bacteria 5009
479 Ga0207693_10025591 3300025915 Bacteria 4678
480 Ga0207693_10034523 3300025915 Bacteria 3989
481 Ga0207693_10048454 3300025915 Bacteria 3336
482 Ga0207693_10068994 3300025915 Bacteria 2767
483 Ga0207693_10078840 3300025915 Bacteria 2577
484 Ga0207663_10001039 3300025916 Bacteria 12734
485 Ga0207663_10002358 3300025916 Bacteria 9073
486 Ga0207663_10008388 3300025916 Bacteria 5399
487 Ga0207663_10009522 3300025916 Bacteria 5136
488 Ga0207663_10032768 3300025916 Bacteria 3088
489 Ga0207663_10080460 3300025916 Bacteria 2130
490 Ga0207660_10042399 3300025917 Bacteria 3194
491 Ga0207660_10053936 3300025917 Bacteria 2867
492 Ga0207660_10069528 3300025917 Bacteria 2557
493 Ga0207660_10071960 3300025917 Bacteria 2517
494 Ga0207660_10084678 3300025917 Bacteria 2337
495 Ga0207660_10126077 3300025917 Bacteria 1944
496 Ga0207662_10003713 3300025918 Bacteria 7911
497 Ga0207662_10071937 3300025918 Bacteria 2095
498 Ga0207657_10004333 3300025919 Bacteria 15034
499 Ga0207657_10011826 3300025919 Bacteria 8640
500 Ga0207657_10033134 3300025919 Bacteria 4660
501 Ga0207657_10050538 3300025919 Bacteria 3619
502 Ga0207657_10077989 3300025919 Bacteria 2791
503 Ga0207657_10089419 3300025919 Bacteria 2573
504 Ga0207649_10081851 3300025920 Bacteria 2092
505 Ga0207652_10002845 3300025921 Bacteria 14496
506 Ga0207652_10008744 3300025921 Bacteria 8151
507 Ga0207652_10047907 3300025921 Bacteria 3652
508 Ga0207652_10055475 3300025921 Bacteria 3408
509 Ga0207652_10078382 3300025921 Bacteria 2885
510 Ga0207652_10131285 3300025921 Bacteria 2234
511 Ga0207694_10014401 3300025924 Bacteria 5961
512 Ga0207694_10026560 3300025924 Bacteria 4406
513 Ga0207694_10045896 3300025924 Bacteria 3376
514 Ga0207694_10256573 3300025924 Bacteria 1431
515 Ga0207650_10010230 3300025925 Bacteria 6429
516 Ga0207650_10302119 3300025925 Bacteria 1307
517 Ga0207687_10008995 3300025927 Bacteria 6528
518 Ga0207687_10019625 3300025927 Bacteria 4480
519 Ga0207687_10034405 3300025927 Bacteria 3440
520 Ga0207687_10095997 3300025927 Bacteria 2172
521 Ga0207700_10000015 3300025928 Bacteria 224772
522 Ga0207700_10000516 3300025928 Bacteria 22674
523 Ga0207700_10003630 3300025928 Bacteria 8995
524 Ga0207700_10005253 3300025928 Bacteria 7722
525 Ga0207700_10021702 3300025928 Bacteria 4389
526 Ga0207700_10028241 3300025928 Bacteria 3941
527 Ga0207700_10040049 3300025928 Bacteria 3417
528 Ga0207700_10071025 3300025928 Bacteria 2679
529 Ga0207700_10131166 3300025928 Bacteria 2046
530 Ga0207700_10200387 3300025928 Bacteria 1682
531 Ga0207700_10213289 3300025928 Bacteria 1633
532 Ga0207664_10006689 3300025929 Bacteria 7953
533 Ga0207664_10014199 3300025929 Bacteria 5744
534 Ga0207664_10093443 3300025929 Bacteria 2470
535 Ga0207664_10093823 3300025929 Bacteria 2466
536 Ga0207664_10097583 3300025929 Bacteria 2421
537 Ga0207664_10147027 3300025929 Bacteria 1999
538 Ga0207644_10004768 3300025931 Bacteria 8820
539 Ga0207644_10022357 3300025931 Bacteria 4320
540 Ga0207644_10252961 3300025931 Bacteria 1406
541 Ga0207690_10020962 3300025932 Bacteria 4047
542 Ga0207690_10229066 3300025932 Bacteria 1425
543 Ga0207706_10009539 3300025933 Bacteria 8913
544 Ga0207706_10013202 3300025933 Bacteria 7515
545 Ga0207706_10065007 3300025933 Bacteria 3212
546 Ga0207706_10075191 3300025933 Bacteria 2970
547 Ga0207706_10118706 3300025933 Bacteria 2326
548 Ga0207706_10120812 3300025933 Bacteria 2303
549 Ga0207686_10055332 3300025934 Bacteria 2489
550 Ga0207686_10130760 3300025934 Bacteria 1721
551 Ga0207670_10052059 3300025936 Bacteria 2752
552 Ga0207669_10001009 3300025937 Bacteria 12002
553 Ga0207669_10010746 3300025937 Bacteria 4420
554 Ga0207669_10112237 3300025937 Bacteria 1830
555 Ga0207665_10001517 3300025939 Bacteria 15630
556 Ga0207665_10005893 3300025939 Bacteria 8153
557 Ga0207665_10010061 3300025939 Bacteria 6212
558 Ga0207665_10030639 3300025939 Bacteria 3556
559 Ga0207665_10072945 3300025939 Bacteria 2346
560 Ga0207665_10099454 3300025939 Bacteria 2029
561 Ga0207691_10017667 3300025940 Bacteria 6760
562 Ga0207691_10153466 3300025940 Bacteria 2024
563 Ga0207711_10111990 3300025941 Bacteria 2428
564 Ga0207711_10149075 3300025941 Bacteria 2110
565 Ga0207689_10005044 3300025942 Bacteria 11901
566 Ga0207689_10078978 3300025942 Bacteria 2704
567 Ga0207661_10002892 3300025944 Bacteria 11870
568 Ga0207661_10027220 3300025944 Bacteria 4365
569 Ga0207661_10059469 3300025944 Bacteria 3080
570 Ga0207661_10129391 3300025944 Bacteria 2160
571 Ga0207679_10077483 3300025945 Bacteria 2529
572 Ga0207679_10092055 3300025945 Bacteria 2348
573 Ga0207667_10005157 3300025949 Bacteria 15956
574 Ga0207667_10007935 3300025949 Bacteria 12667
575 Ga0207667_10027066 3300025949 Bacteria 6252
576 Ga0207667_10059537 3300025949 Bacteria 3999
577 Ga0207667_10148688 3300025949 Bacteria 2411
578 Ga0207667_10305042 3300025949 Bacteria 1627
579 Ga0207651_10004616 3300025960 Bacteria 6974
580 Ga0207651_10031477 3300025960 Bacteria 3392
581 Ga0207712_10187605 3300025961 Bacteria 1630
582 Ga0207712_10258624 3300025961 Bacteria 1411
583 Ga0207658_10021972 3300025986 Bacteria 4437
584 Ga0207658_10208037 3300025986 Bacteria 1638
585 Ga0207677_10007760 3300026023 Bacteria 5957
586 Ga0207677_10031240 3300026023 Bacteria 3409
587 Ga0207703_10087603 3300026035 Bacteria 2611
588 Ga0207703_10101755 3300026035 Bacteria 2437
589 Ga0207639_10011429 3300026041 Bacteria 6166
590 Ga0207639_10120244 3300026041 Bacteria 2157
591 Ga0207639_10219193 3300026041 Bacteria 1642
592 Ga0207678_10012607 3300026067 Bacteria 7427
593 Ga0207678_10017602 3300026067 Bacteria 6274
594 Ga0207678_10073972 3300026067 Bacteria 2920
595 Ga0207708_10108175 3300026075 Bacteria 2156
596 Ga0207702_10000011 3300026078 Bacteria 284514
597 Ga0207702_10000936 3300026078 Bacteria 30149
598 Ga0207702_10070665 3300026078 Bacteria 3003
599 Ga0207641_10071264 3300026088 Bacteria 2989
600 Ga0207641_10190873 3300026088 Bacteria 1883
601 Ga0207648_10002342 3300026089 Bacteria 20440
602 Ga0207648_10049557 3300026089 Bacteria 3674
603 Ga0207676_10020653 3300026095 Bacteria 4821
604 Ga0207676_10131641 3300026095 Bacteria 2127
605 Ga0207676_10138311 3300026095 Bacteria 2081
606 Ga0207674_10000002 3300026116 Bacteria 279738
607 Ga0207674_10014338 3300026116 Bacteria 8757
608 Ga0207674_10017127 3300026116 Bacteria 7910
609 Ga0207674_10046112 3300026116 Bacteria 4478
610 Ga0207674_10077850 3300026116 Bacteria 3321
611 Ga0207674_10092342 3300026116 Bacteria 3017
612 Ga0207674_10135451 3300026116 Bacteria 2425
613 Ga0207674_10275333 3300026116 Bacteria 1631
614 Ga0207674_10384555 3300026116 Bacteria 1357
615 Ga0207675_100004192 3300026118 Bacteria 13953
616 Ga0207675_100051954 3300026118 Bacteria 3825
617 Ga0207675_100195727 3300026118 Bacteria 1940
618 Ga0207683_10001554 3300026121 Bacteria 20658
619 Ga0207683_10007469 3300026121 Bacteria 9376
620 Ga0207683_10011567 3300026121 Bacteria 7534
621 Ga0207683_10028691 3300026121 Bacteria 4814
622 Ga0207683_10078713 3300026121 Bacteria 2922
623 Ga0207683_10207758 3300026121 Bacteria 1781
624 Ga0207683_10217100 3300026121 Bacteria 1742
625 Ga0207698_10020379 3300026142 Bacteria 4563
626 Ga0207698_10026641 3300026142 Bacteria 4092
627 Ga0207698_10128870 3300026142 Bacteria 2158
628 Ga0209389_1000015 3300027296 Bacteria 188311
629 Ga0209389_1032369 3300027296 Bacteria 4347
630 Ga0209589_1000055 3300027357 Bacteria 111890
631 Ga0209589_1002201 3300027357 Bacteria 33478
632 Ga0209489_100128 3300027361 Bacteria 111890
633 Ga0209489_102968 3300027361 Bacteria 33736
634 Ga0209489_116568 3300027361 Bacteria 3858
635 Ga0209700_100034 3300027363 Bacteria 197276
636 Ga0209700_100137 3300027363 Bacteria 111890
637 Ga0209588_1011265 3300027671 Bacteria 2699
638 Ga0209813_10008096 3300027866 Bacteria 2645
639 Ga0209813_10016507 3300027866 Bacteria 2016
640 Ga0207428_10000141 3300027907 Bacteria 97064
641 Ga0207428_10006238 3300027907 Bacteria 11016
642 Ga0268266_10001112 3300028379 Bacteria 33635
643 Ga0268266_10063854 3300028379 Bacteria 3179
644 Ga0268266_10087021 3300028379 Bacteria 2733
645 Ga0268266_10145092 3300028379 Bacteria 2133
646 Ga0268266_10270085 3300028379 Bacteria 1578
647 Ga0268264_10000049 3300028381 Bacteria 329992
648 Ga0265337_1002978 3300028556 Bacteria 7510
649 Ga0265319_1010601 3300028563 Bacteria 3834
650 Ga0265334_10005113 3300028573 Bacteria 5746
651 Ga0265318_10000703 3300028577 Bacteria 22479
652 Ga0265318_10011887 3300028577 Bacteria 3725
653 Ga0265318_10017863 3300028577 Bacteria 2904
654 Ga0265323_10000980 3300028653 Bacteria 14837
655 Ga0265322_10017457 3300028654 Bacteria 2067
656 Ga0265336_10000380 3300028666 Bacteria 28330
657 Ga0307517_10120123 3300028786 Bacteria 1947
658 Ga0307515_10052115 3300028794 Bacteria 6079
659 Ga0307515_10132107 3300028794 Bacteria 2741
660 Ga0265338_10000024 3300028800 Bacteria 297778
661 Ga0265338_10004162 3300028800 Bacteria 19765
662 Ga0265338_10064975 3300028800 Bacteria 3169
663 Ga0265324_10008016 3300029957 Bacteria 4232
664 Ga0307511_10041122 3300030521 Bacteria 3909
665 Ga0265760_10033378 3300031090 Bacteria 1521
666 Ga0265760_10044243 3300031090 Bacteria 1332
667 Ga0265330_10016863 3300031235 Bacteria 3367
668 Ga0265330_10044001 3300031235 Bacteria 1973
669 Ga0265330_10072319 3300031235 Bacteria 1491
670 Ga0265332_10000302 3300031238 Bacteria 38680
671 Ga0265332_10023261 3300031238 Bacteria 2733
672 Ga0265332_10033802 3300031238 Bacteria 2225
673 Ga0265332_10054964 3300031238 Bacteria 1707
674 Ga0265320_10007384 3300031240 Bacteria 6826
675 Ga0265320_10048738 3300031240 Bacteria 2065
676 Ga0265325_10000119 3300031241 Bacteria 54195
677 Ga0265325_10000284 3300031241 Bacteria 35970
678 Ga0265325_10002411 3300031241 Bacteria 12630
679 Ga0265325_10003262 3300031241 Bacteria 10665
680 Ga0265325_10011064 3300031241 Bacteria 5193
681 Ga0265325_10014686 3300031241 Bacteria 4419
682 Ga0265325_10016461 3300031241 Bacteria 4134
683 Ga0265325_10021861 3300031241 Bacteria 3508
684 Ga0265325_10027457 3300031241 Bacteria 3077
685 Ga0265325_10032841 3300031241 Bacteria 2769
686 Ga0265325_10036941 3300031241 Bacteria 2585
687 Ga0265325_10044454 3300031241 Bacteria 2313
688 Ga0265340_10002351 3300031247 Bacteria 10779
689 Ga0265340_10007917 3300031247 Bacteria 5762
690 Ga0265340_10012145 3300031247 Bacteria 4552
691 Ga0265340_10018657 3300031247 Bacteria 3577
692 Ga0265340_10025417 3300031247 Bacteria 2999
693 Ga0265340_10028412 3300031247 Bacteria 2814
694 Ga0265340_10051279 3300031247 Bacteria 1998
695 Ga0265339_10003035 3300031249 Bacteria 11826
696 Ga0265339_10007030 3300031249 Bacteria 7306
697 Ga0265339_10015581 3300031249 Bacteria 4553
698 Ga0265339_10015795 3300031249 Bacteria 4517
699 Ga0265339_10017139 3300031249 Bacteria 4295
700 Ga0265339_10018855 3300031249 Bacteria 4060
701 Ga0265339_10076331 3300031249 Bacteria 1777
702 Ga0265339_10082302 3300031249 Bacteria 1699
703 Ga0265339_10088360 3300031249 Bacteria 1628
704 Ga0265331_10000956 3300031250 Bacteria 22980
705 Ga0265331_10019768 3300031250 Bacteria 3471
706 Ga0265331_10024467 3300031250 Bacteria 3054
707 Ga0265331_10036649 3300031250 Bacteria 2406
708 Ga0265331_10039325 3300031250 Bacteria 2307
709 Ga0265316_10029060 3300031344 Bacteria 4550
710 Ga0265316_10085213 3300031344 Bacteria 2418
711 Ga0265316_10137618 3300031344 Bacteria 1837
712 Ga0265316_10198104 3300031344 Bacteria 1490
713 Ga0265316_10237443 3300031344 Bacteria 1341
714 Ga0307513_10126352 3300031456 Bacteria 2512
715 Ga0307513_10136119 3300031456 Bacteria 2392
716 Ga0307513_10265244 3300031456 Bacteria 1504
717 Ga0307509_10115544 3300031507 Bacteria 2676
718 Ga0307509_10143226 3300031507 Bacteria 2321
719 Ga0307509_10161035 3300031507 Bacteria 2141
720 Ga0265313_10000510 3300031595 Bacteria 40838
721 Ga0265313_10001228 3300031595 Bacteria 24429
722 Ga0265313_10001568 3300031595 Bacteria 21212
723 Ga0265313_10008081 3300031595 Bacteria 7045
724 Ga0265313_10009447 3300031595 Bacteria 6332
725 Ga0265313_10022122 3300031595 Bacteria 3457
726 Ga0265313_10035759 3300031595 Bacteria 2498
727 Ga0307508_10000046 3300031616 Bacteria 139709
728 Ga0307508_10013866 3300031616 Bacteria 7354
729 Ga0307508_10102437 3300031616 Bacteria 2459
730 Ga0265314_10001380 3300031711 Bacteria 27286
731 Ga0265314_10001388 3300031711 Bacteria 27152
732 Ga0265314_10002126 3300031711 Bacteria 20783
733 Ga0265314_10005008 3300031711 Bacteria 12070
734 Ga0265314_10027967 3300031711 Bacteria 4213
735 Ga0265314_10042734 3300031711 Bacteria 3229
736 Ga0265314_10055517 3300031711 Bacteria 2733
737 Ga0265314_10113553 3300031711 Bacteria 1717
738 Ga0265342_10000238 3300031712 Bacteria 61599
739 Ga0265342_10005835 3300031712 Bacteria 9299
740 Ga0265342_10012970 3300031712 Bacteria 5618
741 Ga0265342_10018907 3300031712 Bacteria 4451
742 Ga0265342_10031511 3300031712 Bacteria 3277
743 Ga0265342_10035295 3300031712 Bacteria 3062
744 Ga0265342_10118196 3300031712 Bacteria 1495
745 Ga0265342_10129825 3300031712 Bacteria 1413
746 Ga0307516_10036684 3300031730 Bacteria 4905
747 Ga0307410_10133142 3300031852 Bacteria 1829
748 Ga0307407_10095764 3300031903 Bacteria 1831
749 Ga0307409_100181482 3300031995 Bacteria 1864
750 Ga0307507_10023736 3300033179 Bacteria 6716
751 Ga0307510_10105256 3300033180 Bacteria 2590
752 Ga0315911_1000005 3300033442 Bacteria 426255
753 Ga0373948_0007378 3300034817 Bacteria 1848
754 Ga0373926_0006714 3300035083 Bacteria 3822
755 Ga0373929_0004452 3300035085 Bacteria 2512
756 Ga0373934_0010262 3300035086 Bacteria 3516
757 Ga0373934_0016623 3300035086 Bacteria 2798
758 Ga0373934_0036506 3300035086 Bacteria 1936
759 Ga0373940_0036621 3300035088 Bacteria 1333
760 Ga0373944_0009076 3300035089 Bacteria 2690
761 Ga0373944_0012228 3300035089 Bacteria 2363
762 Ga0373951_0006037 3300035091 Bacteria 2788
763 Ga0373952_0003873 3300035092 Bacteria 2709
764 Ga0373923_0000567 3300035111 Bacteria 9102
765 Ga0373923_0001936 3300035111 Bacteria 6197
766 Ga0373923_0004482 3300035111 Bacteria 4638
767 Ga0373923_0010170 3300035111 Bacteria 3416
768 Ga0373932_0005447 3300035112 Bacteria 2993
769 Ga0373936_0001380 3300035113 Bacteria 8813
770 Ga0373936_0001859 3300035113 Bacteria 7786
771 Ga0373936_0010082 3300035113 Bacteria 3568
772 Ga0373936_0039860 3300035113 Bacteria 1880
773 Ga0373936_0062942 3300035113 Bacteria 1518
774 Ga0373939_0001794 3300035114 Bacteria 5165
775 Ga0373945_0006052 3300035116 Bacteria 3890
776 Ga0373945_0035932 3300035116 Bacteria 1773
777 Ga0373945_0042194 3300035116 Bacteria 1653
778 Ga0373953_0000329 3300035117 Bacteria 12805
779 Ga0373953_0003642 3300035117 Bacteria 4829
780 Ga0373953_0004086 3300035117 Bacteria 4621
781 Ga0373953_0011455 3300035117 Bacteria 3112
782 Ga0373953_0022632 3300035117 Bacteria 2372
783 Ga0373953_0022837 3300035117 Bacteria 2363
784 Ga0373953_0029646 3300035117 Bacteria 2117
785 Ga0373954_0002889 3300035118 Bacteria 7248
786 Ga0373954_0007132 3300035118 Bacteria 4880
787 Ga0373954_0007220 3300035118 Bacteria 4854
788 Ga0373954_0007464 3300035118 Bacteria 4785
789 Ga0373954_0036360 3300035118 Bacteria 2286
790 Ga0373954_0043580 3300035118 Bacteria 2092
791 Ga0373956_0000937 3300035119 Bacteria 12121
792 Ga0373956_0006742 3300035119 Bacteria 4605
793 Ga0373956_0012241 3300035119 Bacteria 3552
794 Ga0373956_0015967 3300035119 Bacteria 3150
795 Ga0373956_0021966 3300035119 Bacteria 2726
796 Ga0373956_0033082 3300035119 Bacteria 2272
797 Ga0373956_0045994 3300035119 Bacteria 1948
798 Ga0373956_0080217 3300035119 Bacteria 1497
799 Ga0373957_0001896 3300035120 Bacteria 5812
800 Ga0373957_0002553 3300035120 Bacteria 5216
801 Ga0373957_0010402 3300035120 Bacteria 3076
802 Ga0373957_0011568 3300035120 Bacteria 2949
803 Ga0373957_0019419 3300035120 Bacteria 2391
804 Ga0373960_0022035 3300035121 Bacteria 1701
805 Ga0373943_0008091 3300035170 Bacteria 4716
806 Ga0373943_0012606 3300035170 Bacteria 3811
807 Ga0373943_0013873 3300035170 Bacteria 3643
808 Ga0373943_0019686 3300035170 Bacteria 3105
809 Ga0373943_0042327 3300035170 Bacteria 2207
810 Ga0373943_0048476 3300035170 Bacteria 2081
811 Ga0373943_0059906 3300035170 Bacteria 1899
812 Ga0373946_0012421 3300035171 Bacteria 3188
813 Ga0373946_0015363 3300035171 Bacteria 2902
814 Ga0373946_0059967 3300035171 Bacteria 1616
815 Ga0373955_0000333 3300035172 Bacteria 19680
816 Ga0373955_0000362 3300035172 Bacteria 19112
817 Ga0373955_0002729 3300035172 Bacteria 7733
818 Ga0373955_0004309 3300035172 Bacteria 6287
819 Ga0373955_0011209 3300035172 Bacteria 4262
820 Ga0373955_0029587 3300035172 Bacteria 2850
821 Ga0373955_0048605 3300035172 Bacteria 2301
822 Ga0373955_0050653 3300035172 Bacteria 2259
823 Ga0373955_0073466 3300035172 Bacteria 1917
824 Ga0373955_0113793 3300035172 Bacteria 1566
825 Ga0373942_0006047 3300035207 Bacteria 2795
826 Ga0373924_0000516 3300035410 Bacteria 11840
827 Ga0373924_0012377 3300035410 Bacteria 3186
828 Ga0373924_0015001 3300035410 Bacteria 2936
829 Ga0373924_0037642 3300035410 Bacteria 1971
830 Ga0373931_0007322 3300035691 Bacteria 5193
831 Ga0373931_0010986 3300035691 Bacteria 4365
832 Ga0373931_0130944 3300035691 Bacteria 1444
833 Ga0373935_0000097 3300035692 Bacteria 38808
834 Ga0373935_0001998 3300035692 Bacteria 11490
835 Ga0373935_0004782 3300035692 Bacteria 7962
836 Ga0373935_0010217 3300035692 Bacteria 5624
837 Ga0373935_0018255 3300035692 Bacteria 4265
838 Ga0373935_0020994 3300035692 Bacteria 3995
839 Ga0373935_0059332 3300035692 Bacteria 2445
840 Ga0373935_0070877 3300035692 Bacteria 2247
841 Ga0373927_0003475 3300035695 Bacteria 11278
842 Ga0373927_0003849 3300035695 Bacteria 10655
843 Ga0373927_0004049 3300035695 Bacteria 10361
844 Ga0373927_0004347 3300035695 Bacteria 9939
845 Ga0373927_0008112 3300035695 Bacteria 7086
846 Ga0373927_0009168 3300035695 Bacteria 6642
847 Ga0373927_0011315 3300035695 Bacteria 5938
848 Ga0373927_0039618 3300035695 Bacteria 3058
849 Ga0373927_0054956 3300035695 Bacteria 2575
850 Ga0373927_0055299 3300035695 Bacteria 2567
851 Ga0373927_0057447 3300035695 Bacteria 2516
852 Ga0373927_0058472 3300035695 Bacteria 2493
853 Ga0373927_0067363 3300035695 Bacteria 2316
854 Ga0373927_0122419 3300035695 Bacteria 1698
855 Ga0373933_0000288 3300035724 Bacteria 32574
856 Ga0373933_0001277 3300035724 Bacteria 14811
857 Ga0373933_0002624 3300035724 Bacteria 10079
858 Ga0373933_0005306 3300035724 Bacteria 7023
859 Ga0373933_0011488 3300035724 Bacteria 4884
860 Ga0373933_0014092 3300035724 Bacteria 4439
861 Ga0373933_0016841 3300035724 Bacteria 4095
862 Ga0373933_0017405 3300035724 Bacteria 4033
863 Ga0373933_0029509 3300035724 Bacteria 3172
864 Ga0373933_0032839 3300035724 Bacteria 3017
865 Ga0373947_0000241 3300035725 Bacteria 30788
866 Ga0373947_0000353 3300035725 Bacteria 26005
867 Ga0373947_0000405 3300035725 Bacteria 24396
868 Ga0373947_0012204 3300035725 Bacteria 4919
869 Ga0373947_0023187 3300035725 Bacteria 3608
870 Ga0373947_0070288 3300035725 Bacteria 2145
871 Ga0373947_0078911 3300035725 Bacteria 2033
872 Ga0373947_0088393 3300035725 Bacteria 1928
873 Ga0373937_0000006 3300036401 Bacteria 194781
874 Ga0373937_0000454 3300036401 Bacteria 37835
875 Ga0373937_0004939 3300036401 Bacteria 11336
876 Ga0373937_0013069 3300036401 Bacteria 7313
877 Ga0373937_0023732 3300036401 Bacteria 5527
878 Ga0373937_0025582 3300036401 Bacteria 5330
879 Ga0373937_0029139 3300036401 Bacteria 4998
880 Ga0373937_0075672 3300036401 Bacteria 3108
881 Ga0373937_0142418 3300036401 Bacteria 2243
882 Ga0373937_0339234 3300036401 Bacteria 1423
883 Ga0373925_0000002 3300037068 Bacteria 368879
884 Ga0373925_0002992 3300037068 Bacteria 13311
885 Ga0373925_0004479 3300037068 Bacteria 10556
886 Ga0373925_0005523 3300037068 Bacteria 9410
887 Ga0373925_0018623 3300037068 Bacteria 5049
888 Ga0373925_0021539 3300037068 Bacteria 4698
889 Ga0373925_0033385 3300037068 Bacteria 3792
890 Ga0373925_0034624 3300037068 Bacteria 3723
891 Ga0373925_0050327 3300037068 Bacteria 3107
892 Ga0373925_0074650 3300037068 Bacteria 2568
893 Ga0373925_0094225 3300037068 Bacteria 2293
894 Ga0373925_0139133 3300037068 Bacteria 1899
895 Ga0395899_0012432 3300037312 Bacteria 6522
896 Ga0395899_0222424 3300037312 Bacteria 1307
897 Ga0395900_0008332 3300037418 Bacteria 10672
898 Ga0395900_0050996 3300037418 Bacteria 4262
899 Ga0395900_0076695 3300037418 Bacteria 3435
900 Ga0395900_0077119 3300037418 Bacteria 3424
901 Ga0395900_0145731 3300037418 Bacteria 2421
902 Ga0395898_0042441 3300037466 Bacteria 4487
903 Ga0395898_0076871 3300037466 Bacteria 3223
904 Ga0395898_0115742 3300037466 Bacteria 2569
905 Ga0395898_0124069 3300037466 Bacteria 2474
906 Ga0395898_0361455 3300037466 Bacteria 1384
907 Ga0395905_0008102 3300037471 Bacteria 10380
908 Ga0395905_0023497 3300037471 Bacteria 5824
909 Ga0395905_0064872 3300037471 Bacteria 3418
910 Ga0395905_0162294 3300037471 Bacteria 2100
911 Ga0436364_0102623 3300037853 Bacteria 19059
912 Ga0436364_0473030 3300037853 Bacteria 2968
913 Ga0436364_0845782 3300037853 Bacteria 1794
914 Ga0436364_1251988 3300037853 Bacteria 7530
915 Ga0436364_1357879 3300037853 Bacteria 5754
916 Ga0395901_0019029 3300038443 Bacteria 7021
917 Ga0395901_0047179 3300038443 Bacteria 4473
918 Ga0395901_0090562 3300038443 Bacteria 3201
919 Ga0395901_0267608 3300038443 Bacteria 1778
920 Ga0237819_02188 3300038705 Bacteria 4147
921 Ga0400489_74307 3300039093 Bacteria 2940
922 Ga0436365_0065969 3300039437 Bacteria 4458
923 Ga0436365_0144792 3300039437 Bacteria 1559
924 Ga0436365_0184625 3300039437 Bacteria 24233
925 Ga0436365_0274689 3300039437 Bacteria 6607
926 Ga0436365_0404467 3300039437 Bacteria 5327
927 Ga0436365_1066319 3300039437 Bacteria 1974
928 Ga0436365_1117139 3300039437 Bacteria 26783
929 Ga0436365_1287068 3300039437 Bacteria 5756
930 Ga0436365_1354398 3300039437 Bacteria 6498
931 Ga0436365_1389173 3300039437 Bacteria 2617
932 Ga0436365_1482914 3300039437 Bacteria 2571
933 Ga0436365_1537089 3300039437 Bacteria 1872
934 Ga0436365_1759934 3300039437 Bacteria 4687
935 Ga0436365_1852558 3300039437 Bacteria 7682
936 Ga0436360_0039401 3300039438 Bacteria 2286
937 Ga0436360_0423846 3300039438 Bacteria 2595
938 Ga0436360_0614349 3300039438 Bacteria 3882
939 Ga0436360_0683827 3300039438 Bacteria 2894
940 Ga0436360_0706927 3300039438 Bacteria 3045
941 Ga0436360_0915147 3300039438 Bacteria 2412
942 Ga0436360_0922836 3300039438 Bacteria 3614
943 Ga0436361_0200318 3300039447 Bacteria 12914
944 Ga0436361_0296943 3300039447 Bacteria 2671
945 Ga0436361_0330482 3300039447 Bacteria 3138
946 Ga0436361_0766127 3300039447 Bacteria 3903
947 Ga0436363_0135568 3300039450 Bacteria 1538
948 Ga0436363_0184239 3300039450 Bacteria 1496
949 Ga0436363_0191652 3300039450 Bacteria 2211
950 Ga0436363_0416230 3300039450 Unclassified 2142
951 Ga0436363_0705589 3300039450 Bacteria 5355
952 Ga0436363_1334576 3300039450 Bacteria 2493
953 Ga0436362_0935373 3300039453 Bacteria 4841
954 Ga0436362_1043177 3300039453 Bacteria 2685
955 Ga0436362_1090359 3300039453 Bacteria 3192
956 Ga0439453_0000204 3300041408 Bacteria 5747
957 Ga0439443_000558 3300042003 Bacteria 3418
958 Ga0439464_0036631 3300042439 Bacteria 1388
959 Ga0439460_0016769 3300042461 Bacteria 1955
960 Ga0466972_0002054 3300044658 Bacteria 9859
961 Ga0466972_0024192 3300044658 Bacteria 3014
962 Ga0466972_0034706 3300044658 Bacteria 2470
963 Ga0466966_0001410 3300044684 Bacteria 15480
964 Ga0466966_0141178 3300044684 Bacteria 1472
965 Ga0466961_0000126 3300044693 Bacteria 51032
966 Ga0466961_0071534 3300044693 Bacteria 2201
967 Ga0466963_0086260 3300044694 Bacteria 2133
968 Ga0466963_0129265 3300044694 Bacteria 1744
969 Ga0466968_0036087 3300044735 Bacteria 2070
970 Ga0466970_0044062 3300044765 Bacteria 2376
971 Ga0466957_0125695 3300044842 Bacteria 1638
972 Ga0466957_0165350 3300044842 Bacteria 1439
973 Ga0466960_0051111 3300044901 Bacteria 1995
974 Ga0466959_0005140 3300045049 Bacteria 8913
975 Ga0466959_0144973 3300045049 Bacteria 1676
976 Ga0451576_0010468 3300045051 Bacteria 10633
977 Ga0466958_0021830 3300045836 Bacteria 3744
978 Ga0466958_0028778 3300045836 Bacteria 3296
979 Ga0466967_0008187 3300045976 Bacteria 7634
980 Ga0466967_0052839 3300045976 Bacteria 3569
981 Ga0466967_0077773 3300045976 Bacteria 2987
982 Ga0495617_007369 3300046452 Bacteria 3819
983 Ga0495592_0000039 3300046454 Bacteria 124471
984 Ga0495592_0001087 3300046454 Bacteria 18850
985 Ga0495592_0004304 3300046454 Bacteria 10411
986 Ga0495592_0012653 3300046454 Bacteria 6413
987 Ga0495592_0025633 3300046454 Bacteria 4474
988 Ga0495592_0028613 3300046454 Bacteria 4220
989 Ga0495592_0036153 3300046454 Bacteria 3720
990 Ga0495592_0086693 3300046454 Bacteria 2254
991 Ga0495603_0000066 3300046455 Bacteria 45635
992 Ga0495603_0004642 3300046455 Bacteria 8210
993 Ga0495603_0005315 3300046455 Bacteria 7681
994 Ga0495603_0012242 3300046455 Bacteria 5196
995 Ga0495603_0066175 3300046455 Bacteria 2128
996 Ga0495590_0008019 3300046457 Bacteria 4051
997 Ga0495629_0000232 3300046459 Bacteria 49422
998 Ga0495629_0000393 3300046459 Bacteria 36754
999 Ga0495629_0001396 3300046459 Bacteria 19022
1000 Ga0495629_0008058 3300046459 Bacteria 7756
1001 Ga0495629_0017359 3300046459 Bacteria 5157
1002 Ga0495629_0017702 3300046459 Bacteria 5107
1003 Ga0495629_0035381 3300046459 Bacteria 3529
1004 Ga0495629_0060405 3300046459 Bacteria 2649
1005 Ga0495629_0063719 3300046459 Bacteria 2574
1006 Ga0495638_0106711 3300046460 Bacteria 1668
1007 Ga0495638_0115222 3300046460 Bacteria 1593
1008 Ga0495641_0033475 3300046461 Bacteria 2438
1009 Ga0495651_0000376 3300046462 Bacteria 34540
1010 Ga0495651_0001660 3300046462 Bacteria 17235
1011 Ga0495651_0002916 3300046462 Bacteria 13240
1012 Ga0495651_0010616 3300046462 Bacteria 7085
1013 Ga0495651_0011255 3300046462 Bacteria 6875
1014 Ga0495651_0022958 3300046462 Bacteria 4851
1015 Ga0495651_0075404 3300046462 Bacteria 2557
1016 Ga0495651_0113964 3300046462 Bacteria 1995
1017 Ga0495651_0126124 3300046462 Bacteria 1874
1018 Ga0495653_0000006 3300046463 Bacteria 363285
1019 Ga0495653_0000575 3300046463 Bacteria 28178
1020 Ga0495653_0001162 3300046463 Bacteria 20279
1021 Ga0495653_0003920 3300046463 Bacteria 12035
1022 Ga0495653_0005424 3300046463 Bacteria 10383
1023 Ga0495580_0008059 3300046472 Bacteria 8409
1024 Ga0495580_0018481 3300046472 Bacteria 5190
1025 Ga0495580_0060064 3300046472 Bacteria 2671
1026 Ga0495580_0102687 3300046472 Bacteria 1987
1027 Ga0495582_0003398 3300046473 Bacteria 8963
1028 Ga0495582_0038293 3300046473 Bacteria 2639
1029 Ga0495582_0043732 3300046473 Bacteria 2466
1030 Ga0495605_0025165 3300046474 Bacteria 3103
1031 Ga0495639_0011855 3300046475 Bacteria 3759
1032 Ga0495639_0026983 3300046475 Bacteria 2541
1033 Ga0495662_0000386 3300046476 Bacteria 19623
1034 Ga0495662_0002816 3300046476 Bacteria 8801
1035 Ga0495662_0016903 3300046476 Bacteria 3530
1036 Ga0495662_0034612 3300046476 Bacteria 2438
1037 Ga0495662_0040341 3300046476 Bacteria 2254
1038 Ga0495664_0000002 3300046477 Bacteria 625183
1039 Ga0495664_0003821 3300046477 Bacteria 8216
1040 Ga0495664_0016446 3300046477 Bacteria 4214
1041 Ga0495664_0021717 3300046477 Bacteria 3709
1042 Ga0495664_0023237 3300046477 Bacteria 3597
1043 Ga0495664_0032876 3300046477 Bacteria 3046
1044 Ga0495664_0045911 3300046477 Bacteria 2591
1045 Ga0495664_0048400 3300046477 Bacteria 2524
1046 Ga0495664_0091524 3300046477 Bacteria 1828
1047 Ga0495664_0093020 3300046477 Bacteria 1814
1048 Ga0495584_0024343 3300046491 Bacteria 3070
1049 Ga0495584_0051542 3300046491 Bacteria 2072
1050 Ga0495585_0001185 3300046492 Bacteria 21166
1051 Ga0495594_0017473 3300046499 Bacteria 3791
1052 Ga0495594_0099089 3300046499 Bacteria 1639
1053 Ga0495607_0002979 3300046501 Bacteria 13276
1054 Ga0495606_0033803 3300046507 Bacteria 3520
1055 Ga0495606_0118459 3300046507 Bacteria 1588
1056 Ga0495608_0000006 3300046511 Bacteria 324334
1057 Ga0495608_0001846 3300046511 Bacteria 15120
1058 Ga0495608_0012765 3300046511 Bacteria 5829
1059 Ga0495608_0014465 3300046511 Bacteria 5474
1060 Ga0495608_0017778 3300046511 Bacteria 4915
1061 Ga0495608_0066113 3300046511 Bacteria 2367
1062 Ga0495610_0040323 3300046512 Bacteria 2354
1063 Ga0495616_0018754 3300046513 Bacteria 3790
1064 Ga0495618_0000027 3300046514 Bacteria 112522
1065 Ga0495618_0004373 3300046514 Bacteria 8694
1066 Ga0495618_0004744 3300046514 Bacteria 8311
1067 Ga0495618_0005316 3300046514 Bacteria 7861
1068 Ga0495618_0034137 3300046514 Bacteria 3189
1069 Ga0495628_0000002 3300046516 Bacteria 589399
1070 Ga0495628_0006552 3300046516 Bacteria 10159
1071 Ga0495628_0013861 3300046516 Bacteria 6772
1072 Ga0495628_0047408 3300046516 Bacteria 3409
1073 Ga0495630_0000950 3300046517 Bacteria 20249
1074 Ga0495630_0012686 3300046517 Bacteria 6124
1075 Ga0495630_0049267 3300046517 Bacteria 3153
1076 Ga0495630_0050945 3300046517 Bacteria 3098
1077 Ga0495630_0057681 3300046517 Bacteria 2910
1078 Ga0495630_0138326 3300046517 Bacteria 1851
1079 Ga0495637_0025272 3300046520 Bacteria 2677
1080 Ga0495637_0038417 3300046520 Bacteria 2073
1081 Ga0495643_0030903 3300046522 Bacteria 2985
1082 Ga0495644_0005612 3300046523 Bacteria 4895
1083 Ga0495648_0012019 3300046524 Bacteria 6486
1084 Ga0495648_0014403 3300046524 Bacteria 5791
1085 Ga0495648_0015800 3300046524 Bacteria 5459
1086 Ga0495648_0046032 3300046524 Bacteria 2708
1087 Ga0495648_0049475 3300046524 Bacteria 2576
1088 Ga0495666_0034562 3300046526 Bacteria 2466
1089 Ga0495652_0000004 3300046529 Bacteria 588877
1090 Ga0495652_0006629 3300046529 Bacteria 10753
1091 Ga0495652_0009321 3300046529 Bacteria 8922
1092 Ga0495652_0045917 3300046529 Bacteria 3752
1093 Ga0495652_0089350 3300046529 Bacteria 2522
1094 Ga0495652_0089603 3300046529 Bacteria 2518
1095 Ga0495652_0111015 3300046529 Bacteria 2205
1096 Ga0495654_0038861 3300046530 Bacteria 2377
1097 Ga0495665_0001006 3300046531 Bacteria 14964
1098 Ga0495665_0014448 3300046531 Bacteria 4259
1099 Ga0495640_0000005 3300046533 Bacteria 318271
1100 Ga0495640_0002934 3300046533 Bacteria 13731
1101 Ga0495640_0006082 3300046533 Bacteria 9574
1102 Ga0495640_0029214 3300046533 Bacteria 3961
1103 Ga0495640_0029545 3300046533 Bacteria 3934
1104 Ga0495640_0042069 3300046533 Bacteria 3190
1105 Ga0495640_0049273 3300046533 Bacteria 2905
1106 Ga0495640_0121398 3300046533 Bacteria 1698
1107 Ga0495586_0028008 3300046535 Bacteria 3015
1108 Ga0495586_0042791 3300046535 Bacteria 2438
1109 Ga0495587_0000007 3300046536 Bacteria 290788
1110 Ga0495587_0001888 3300046536 Bacteria 13942
1111 Ga0495587_0005079 3300046536 Bacteria 8601
1112 Ga0495587_0006228 3300046536 Bacteria 7788
1113 Ga0495587_0006763 3300046536 Bacteria 7466
1114 Ga0495587_0014102 3300046536 Bacteria 5019
1115 Ga0495587_0120581 3300046536 Bacteria 1502
1116 Ga0495598_0000728 3300046537 Bacteria 6259
1117 Ga0495621_0022389 3300046539 Bacteria 2094
1118 Ga0495645_0000003 3300046543 Bacteria 570133
1119 Ga0495645_0003676 3300046543 Bacteria 10423
1120 Ga0495645_0043024 3300046543 Bacteria 3294
1121 Ga0495645_0065918 3300046543 Bacteria 2619
1122 Ga0495622_0014375 3300046557 Bacteria 3676
1123 Ga0495622_0016669 3300046557 Bacteria 3421
1124 Ga0495622_0017818 3300046557 Bacteria 3306
1125 Ga0495622_0025108 3300046557 Bacteria 2784
1126 Ga0495622_0040468 3300046557 Bacteria 2169
1127 Ga0495622_0046932 3300046557 Bacteria 2007
1128 Ga0495633_0001515 3300046558 Bacteria 17958
1129 Ga0495667_0000002 3300046559 Bacteria 437535
1130 Ga0495667_0001388 3300046559 Bacteria 15942
1131 Ga0495667_0001608 3300046559 Bacteria 14975
1132 Ga0495667_0028833 3300046559 Bacteria 3738
1133 Ga0495667_0038813 3300046559 Bacteria 3170
1134 Ga0495667_0080694 3300046559 Bacteria 2115
1135 Ga0495667_0134436 3300046559 Bacteria 1594
1136 Ga0495656_0007156 3300046615 Bacteria 3937
1137 Ga0495668_0156597 3300046616 Bacteria 1248
1138 Ga0495634_0003380 3300046642 Bacteria 12806
1139 Ga0495634_0003870 3300046642 Bacteria 11889
1140 Ga0495634_0003977 3300046642 Bacteria 11728
1141 Ga0495634_0015273 3300046642 Bacteria 5521
1142 Ga0495634_0102593 3300046642 Bacteria 1847
1143 Ga0495635_0000022 3300046663 Bacteria 160907
1144 Ga0495635_0001444 3300046663 Bacteria 15882
1145 Ga0495635_0002607 3300046663 Bacteria 12348
1146 Ga0495635_0003533 3300046663 Bacteria 10817
1147 Ga0495635_0023909 3300046663 Bacteria 4258
1148 Ga0495635_0024366 3300046663 Bacteria 4217
1149 Ga0495635_0025287 3300046663 Bacteria 4135
1150 Ga0495635_0136801 3300046663 Bacteria 1670
1151 Ga0495659_0004573 3300046664 Bacteria 4354
1152 Ga0495661_0031637 3300046665 Bacteria 3354
1153 Ga0495661_0094072 3300046665 Bacteria 1699
1154 Ga0495588_0003439 3300046674 Bacteria 6883
1155 Ga0495588_0006576 3300046674 Bacteria 5243
1156 Ga0495588_0014899 3300046674 Bacteria 3731
1157 Ga0495657_0000072 3300046675 Bacteria 91747
1158 Ga0495657_0001743 3300046675 Bacteria 18626
1159 Ga0495657_0002950 3300046675 Bacteria 14098
1160 Ga0495657_0030234 3300046675 Bacteria 3795
1161 Ga0495657_0036223 3300046675 Bacteria 3411
1162 Ga0495599_0000001 3300046678 Bacteria 537563
1163 Ga0495599_0000374 3300046678 Bacteria 26092
1164 Ga0495599_0017853 3300046678 Bacteria 4416
1165 Ga0495599_0024055 3300046678 Bacteria 3809
1166 Ga0495599_0029589 3300046678 Bacteria 3433
1167 Ga0495599_0029873 3300046678 Bacteria 3418
1168 Ga0495623_0000001 3300046679 Bacteria 313861
1169 Ga0495623_0003313 3300046679 Bacteria 10645
1170 Ga0495623_0007104 3300046679 Bacteria 7276
1171 Ga0495623_0017451 3300046679 Bacteria 4637
1172 Ga0495623_0025283 3300046679 Bacteria 3824
1173 Ga0495623_0049973 3300046679 Bacteria 2650
1174 Ga0495623_0050162 3300046679 Bacteria 2643
1175 Ga0495623_0109422 3300046679 Bacteria 1676
1176 Ga0495646_0000014 3300046680 Bacteria 143781
1177 Ga0495646_0006685 3300046680 Bacteria 7311
1178 Ga0495646_0007150 3300046680 Bacteria 7091
1179 Ga0495646_0012826 3300046680 Bacteria 5327
1180 Ga0495646_0020360 3300046680 Bacteria 4197
1181 Ga0495646_0138919 3300046680 Bacteria 1360
1182 Ga0495647_0002294 3300046681 Bacteria 6000
1183 Ga0495647_0009919 3300046681 Bacteria 3234
1184 Ga0495658_0001124 3300046683 Bacteria 14152
1185 Ga0495658_0030880 3300046683 Bacteria 2913
1186 Ga0495658_0047517 3300046683 Bacteria 2417
1187 Ga0495613_0007227 3300046689 Bacteria 8269
1188 Ga0495613_0017619 3300046689 Bacteria 5319
1189 Ga0495613_0017779 3300046689 Bacteria 5298
1190 Ga0495613_0019159 3300046689 Bacteria 5101
1191 Ga0495613_0025210 3300046689 Bacteria 4432
1192 Ga0495613_0038278 3300046689 Bacteria 3554
1193 Ga0495613_0064425 3300046689 Bacteria 2680
1194 Ga0495613_0110945 3300046689 Bacteria 1976
1195 Ga0495613_0118370 3300046689 Bacteria 1904
1196 Ga0495613_0133663 3300046689 Bacteria 1776
1197 Ga0495624_0003188 3300046690 Bacteria 12214
1198 Ga0495624_0006483 3300046690 Bacteria 8302
1199 Ga0495624_0040554 3300046690 Bacteria 2981
1200 Ga0495624_0047827 3300046690 Bacteria 2717
1201 Ga0495624_0055630 3300046690 Bacteria 2491
1202 Ga0495670_0000124 3300046691 Bacteria 33461
1203 Ga0495670_0001611 3300046691 Bacteria 11055
1204 Ga0495670_0006357 3300046691 Bacteria 5802
1205 Ga0495670_0035456 3300046691 Bacteria 2487
1206 Ga0495671_0042148 3300046692 Bacteria 2295
1207 Ga0495600_0000006 3300046809 Bacteria 151916
1208 Ga0495600_0002118 3300046809 Bacteria 11234
1209 Ga0495600_0017437 3300046809 Bacteria 4568
1210 Ga0495600_0017846 3300046809 Bacteria 4516
1211 Ga0495600_0021283 3300046809 Bacteria 4151
1212 Ga0495600_0022444 3300046809 Bacteria 4051
1213 Ga0495600_0035324 3300046809 Bacteria 3245
1214 Ga0495600_0056753 3300046809 Bacteria 2559
1215 Ga0495581_0002582 3300047315 Bacteria 10297
1216 Ga0495581_0003397 3300047315 Bacteria 9147
1217 Ga0495581_0022201 3300047315 Bacteria 3677
1218 Ga0495581_0030375 3300047315 Bacteria 3131
1219 Ga0495581_0039669 3300047315 Bacteria 2726
1220 Ga0495581_0060918 3300047315 Bacteria 2181
1221 Ga0495581_0150610 3300047315 Bacteria 1358
1222 Ga0495604_0000005 3300047317 Bacteria 424516
1223 Ga0495604_0002321 3300047317 Bacteria 15234
1224 Ga0495604_0003737 3300047317 Bacteria 12122
1225 Ga0495604_0017333 3300047317 Bacteria 5764
1226 Ga0495604_0036718 3300047317 Bacteria 3862
1227 Ga0495604_0043219 3300047317 Bacteria 3529
1228 Ga0495604_0087512 3300047317 Bacteria 2320
1229 Ga0495674_0000003 3300047319 Bacteria 562126
1230 Ga0495674_0004312 3300047319 Bacteria 13679
1231 Ga0495674_0005482 3300047319 Bacteria 12190
1232 Ga0495674_0009574 3300047319 Bacteria 9201
1233 Ga0495674_0016683 3300047319 Bacteria 6852
1234 Ga0495674_0037223 3300047319 Bacteria 4372
1235 Ga0495674_0045603 3300047319 Bacteria 3892
1236 Ga0495672_0011537 3300047320 Bacteria 6230
1237 Ga0495676_0022985 3300047321 Bacteria 5418
1238 Ga0495676_0054869 3300047321 Bacteria 3164
1239 Ga0495676_0102964 3300047321 Bacteria 2109
1240 Ga0495676_0169806 3300047321 Bacteria 1536
1241 Ga0495676_0188127 3300047321 Bacteria 1442
1242 Ga0495680_0000961 3300047322 Bacteria 31964
1243 Ga0495680_0001324 3300047322 Bacteria 27020
1244 Ga0495680_0001718 3300047322 Bacteria 23247
1245 Ga0495680_0004018 3300047322 Bacteria 14195
1246 Ga0495680_0009502 3300047322 Bacteria 8739
1247 Ga0495680_0021413 3300047322 Bacteria 5412
1248 Ga0495680_0033763 3300047322 Bacteria 4139
1249 Ga0495680_0172114 3300047322 Bacteria 1567
1250 Ga0495675_0000338 3300047444 Bacteria 33019
1251 Ga0495675_0002797 3300047444 Bacteria 10468
1252 Ga0495675_0014203 3300047444 Bacteria 5035
1253 Ga0495675_0043669 3300047444 Bacteria 2855
1254 Ga0495675_0045207 3300047444 Bacteria 2804
1255 Ga0495675_0050201 3300047444 Bacteria 2652
1256 Ga0495673_0011425 3300047469 Bacteria 4774
1257 Ga0495673_0033231 3300047469 Bacteria 2396
1258 Ga0495673_0057840 3300047469 Bacteria 1673
1259 Ga0495684_0000028 3300047471 Bacteria 123549
1260 Ga0495684_0000052 3300047471 Bacteria 85125
1261 Ga0495684_0004953 3300047471 Bacteria 10400
1262 Ga0495684_0007703 3300047471 Bacteria 8333
1263 Ga0495684_0014496 3300047471 Bacteria 6066
1264 Ga0495684_0027037 3300047471 Bacteria 4407
1265 Ga0495684_0043155 3300047471 Bacteria 3452
1266 Ga0495684_0072989 3300047471 Bacteria 2607
1267 Ga0495684_0190506 3300047471 Bacteria 1516
1268 Ga0495686_0011887 3300047472 Bacteria 6120
1269 Ga0495686_0034583 3300047472 Bacteria 3253
1270 Ga0495686_0042494 3300047472 Bacteria 2890
1271 Ga0495593_0001828 3300047673 Bacteria 12660
1272 Ga0495593_0001852 3300047673 Bacteria 12584
1273 Ga0495593_0003570 3300047673 Bacteria 9299
1274 Ga0495593_0003982 3300047673 Bacteria 8814
1275 Ga0495593_0006965 3300047673 Bacteria 6625
1276 Ga0495593_0027880 3300047673 Bacteria 3105
1277 Ga0495593_0028697 3300047673 Bacteria 3055
1278 Ga0495593_0038211 3300047673 Bacteria 2593
1279 Ga0495593_0045391 3300047673 Bacteria 2345
1280 Ga0495593_0091925 3300047673 Bacteria 1562
1281 Ga0495602_0000029 3300048088 Bacteria 142344
1282 Ga0495602_0008058 3300048088 Bacteria 11010
1283 Ga0495602_0017570 3300048088 Bacteria 7165
1284 Ga0495602_0034768 3300048088 Bacteria 4707
1285 Ga0495602_0054389 3300048088 Bacteria 3534
1286 Ga0495602_0070644 3300048088 Bacteria 2986
1287 Ga0495602_0103461 3300048088 Bacteria 2331
1288 Ga0495614_0005613 3300048089 Bacteria 5658
1289 Ga0495614_0013126 3300048089 Bacteria 3633
1290 Ga0496100_0011196 3300048903 Bacteria 5099
1291 Ga0496100_0035603 3300048903 Bacteria 3133
1292 Ga0496100_0121175 3300048903 Bacteria 1830
1293 Ga0496101_0001512 3300048904 Bacteria 13914
1294 Ga0496101_0004567 3300048904 Bacteria 8744
1295 Ga0496101_0009095 3300048904 Bacteria 6517
1296 Ga0496101_0015209 3300048904 Bacteria 5179
1297 Ga0496101_0017029 3300048904 Bacteria 4921
1298 Ga0496102_0003670 3300048905 Bacteria 12982
1299 Ga0496102_0022318 3300048905 Bacteria 5608
1300 Ga0496102_0033844 3300048905 Bacteria 4594
1301 Ga0496102_0039644 3300048905 Bacteria 4257
1302 Ga0496102_0055179 3300048905 Bacteria 3624
1303 Ga0496102_0093882 3300048905 Bacteria 2779
1304 Ga0496102_0146619 3300048905 Bacteria 2215
1305 Ga0496102_0239422 3300048905 Bacteria 1711
1306 Ga0496103_0012833 3300048906 Bacteria 4969
1307 Ga0496103_0021398 3300048906 Bacteria 3890
1308 Ga0496103_0056694 3300048906 Bacteria 2432
1309 Ga0496104_0001385 3300048907 Bacteria 20962
1310 Ga0496104_0001994 3300048907 Bacteria 17714
1311 Ga0496104_0002605 3300048907 Bacteria 15534
1312 Ga0496104_0003097 3300048907 Bacteria 14340
1313 Ga0496104_0004487 3300048907 Bacteria 12159
1314 Ga0496104_0005851 3300048907 Bacteria 10771
1315 Ga0496104_0027243 3300048907 Bacteria 5288
1316 Ga0496104_0032952 3300048907 Bacteria 4823
1317 Ga0496104_0047328 3300048907 Bacteria 4053
1318 Ga0496104_0056813 3300048907 Bacteria 3702
1319 Ga0496104_0060822 3300048907 Bacteria 3579
1320 Ga0496104_0121078 3300048907 Bacteria 2512
1321 Ga0496104_0141139 3300048907 Bacteria 2314
1322 Ga0496104_0190625 3300048907 Bacteria 1961
1323 Ga0496105_0000058 3300048908 Bacteria 87226
1324 Ga0496105_0002533 3300048908 Bacteria 13261
1325 Ga0496105_0014056 3300048908 Bacteria 6370
1326 Ga0496105_0014408 3300048908 Bacteria 6293
1327 Ga0496105_0018848 3300048908 Bacteria 5557
1328 Ga0496105_0019261 3300048908 Bacteria 5503
1329 Ga0496105_0026465 3300048908 Bacteria 4731
1330 Ga0496105_0042069 3300048908 Bacteria 3766
1331 Ga0496105_0099239 3300048908 Bacteria 2405
1332 Ga0496105_0114438 3300048908 Bacteria 2225
1333 Ga0496105_0181000 3300048908 Bacteria 1726
1334 Ga0496106_0000713 3300048909 Bacteria 23943
1335 Ga0496106_0005608 3300048909 Bacteria 9292
1336 Ga0496106_0006604 3300048909 Bacteria 8587
1337 Ga0496106_0011702 3300048909 Bacteria 6479
1338 Ga0496106_0028107 3300048909 Bacteria 4188
1339 Ga0496106_0043614 3300048909 Bacteria 3365
1340 Ga0496106_0051938 3300048909 Bacteria 3091
1341 Ga0496106_0064968 3300048909 Bacteria 2777
1342 Ga0496106_0105601 3300048909 Bacteria 2188
1343 Ga0496106_0129975 3300048909 Bacteria 1974
1344 Ga0496107_0006298 3300048910 Bacteria 8156
1345 Ga0496107_0011187 3300048910 Bacteria 6247
1346 Ga0496107_0019686 3300048910 Bacteria 4762
1347 Ga0496107_0024303 3300048910 Bacteria 4287
1348 Ga0496107_0035949 3300048910 Bacteria 3553
1349 Ga0496107_0041466 3300048910 Bacteria 3305
1350 Ga0496107_0044052 3300048910 Bacteria 3207
1351 Ga0496107_0053648 3300048910 Unclassified 2908
1352 Ga0496108_0001956 3300048911 Bacteria 16502
1353 Ga0496108_0003527 3300048911 Bacteria 12544
1354 Ga0496108_0007201 3300048911 Bacteria 9016
1355 Ga0496108_0016333 3300048911 Bacteria 6055
1356 Ga0496108_0020704 3300048911 Bacteria 5406
1357 Ga0496108_0025631 3300048911 Bacteria 4860
1358 Ga0496108_0037967 3300048911 Bacteria 4012
1359 Ga0496108_0040968 3300048911 Bacteria 3864
1360 Ga0496108_0102410 3300048911 Bacteria 2443
1361 Ga0496108_0128447 3300048911 Bacteria 2177
1362 Ga0496109_0000239 3300048912 Bacteria 53236
1363 Ga0496109_0015645 3300048912 Bacteria 6618
1364 Ga0496109_0040371 3300048912 Bacteria 4226
1365 Ga0496109_0124424 3300048912 Bacteria 2403
1366 Ga0496109_0124874 3300048912 Bacteria 2399
1367 Ga0496109_0317218 3300048912 Bacteria 1471
1368 Ga0496110_0003008 3300048913 Bacteria 12783
1369 Ga0496110_0003749 3300048913 Bacteria 11704
1370 Ga0496110_0019605 3300048913 Bacteria 5695
1371 Ga0496110_0020370 3300048913 Bacteria 5601
1372 Ga0496110_0045194 3300048913 Bacteria 3848
1373 Ga0496110_0048401 3300048913 Bacteria 3727
1374 Ga0496110_0051824 3300048913 Bacteria 3606
1375 Ga0496110_0084097 3300048913 Bacteria 2840
1376 Ga0496110_0112205 3300048913 Bacteria 2451
1377 Ga0496110_0147816 3300048913 Bacteria 2126
1378 Ga0496110_0156393 3300048913 Bacteria 2065
1379 Ga0496110_0339871 3300048913 Bacteria 1367
1380 Ga0496111_0000118 3300048914 Bacteria 34263
1381 Ga0496111_0001890 3300048914 Bacteria 12398
1382 Ga0496111_0026276 3300048914 Bacteria 4110
1383 Ga0496111_0054472 3300048914 Bacteria 2891
1384 Ga0496111_0080724 3300048914 Bacteria 2373
1385 Ga0496112_0000019 3300048915 Bacteria 185531
1386 Ga0496112_0001834 3300048915 Bacteria 16719
1387 Ga0496112_0001865 3300048915 Bacteria 16603
1388 Ga0496112_0004370 3300048915 Bacteria 11961
1389 Ga0496112_0008354 3300048915 Bacteria 9270
1390 Ga0496112_0035292 3300048915 Bacteria 4870
1391 Ga0496112_0045180 3300048915 Bacteria 4317
1392 Ga0496112_0050952 3300048915 Bacteria 4060
1393 Ga0496112_0358090 3300048915 Bacteria 1401
1394 Ga0496113_0000167 3300048916 Bacteria 29216
1395 Ga0496113_0000507 3300048916 Bacteria 19242
1396 Ga0496113_0002933 3300048916 Bacteria 10071
1397 Ga0496113_0093271 3300048916 Bacteria 2323
1398 Ga0496113_0123955 3300048916 Bacteria 2022
1399 Ga0496113_0137846 3300048916 Bacteria 1918
1400 Ga0496114_0012164 3300048917 Bacteria 6886
1401 Ga0496114_0029297 3300048917 Bacteria 4522
1402 Ga0496114_0062416 3300048917 Bacteria 3118
1403 Ga0496114_0066986 3300048917 Bacteria 3011
1404 Ga0496114_0081679 3300048917 Bacteria 2731
1405 Ga0496114_0084465 3300048917 Bacteria 2688
1406 Ga0496114_0114541 3300048917 Bacteria 2312
1407 Ga0496114_0134669 3300048917 Bacteria 2136
1408 Ga0496114_0293092 3300048917 Bacteria 1436
1409 Ga0496115_0006689 3300048918 Bacteria 8456
1410 Ga0496115_0014328 3300048918 Bacteria 6002
1411 Ga0496115_0030055 3300048918 Bacteria 4271
1412 Ga0496115_0030876 3300048918 Bacteria 4218
1413 Ga0496115_0039884 3300048918 Bacteria 3731
1414 Ga0496115_0075896 3300048918 Bacteria 2731
1415 Ga0496115_0080864 3300048918 Bacteria 2646
1416 Ga0496115_0104977 3300048918 Bacteria 2319
1417 Ga0496115_0106723 3300048918 Bacteria 2299
1418 Ga0496115_0118770 3300048918 Bacteria 2174
1419 Ga0496115_0152078 3300048918 Bacteria 1911
1420 Ga0496117_0022401 3300048920 Bacteria 5067
1421 Ga0496117_0054529 3300048920 Bacteria 2800
1422 Ga0496117_0115086 3300048920 Bacteria 1665
1423 Ga0496118_0005960 3300048921 Bacteria 13608
1424 Ga0496118_0045022 3300048921 Bacteria 3449
1425 Ga0496118_0061077 3300048921 Bacteria 2793
1426 Ga0496118_0107145 3300048921 Bacteria 1867
1427 Ga0496118_0113941 3300048921 Bacteria 1784
1428 Ga0496119_0001924 3300048922 Bacteria 23705
1429 Ga0496119_0010822 3300048922 Bacteria 7634
1430 Ga0496119_0048937 3300048922 Bacteria 2617
1431 Ga0496119_0093812 3300048922 Bacteria 1699
1432 Ga0496120_0002411 3300048923 Bacteria 18988
1433 Ga0496120_0030921 3300048923 Bacteria 3248
1434 Ga0496120_0072220 3300048923 Bacteria 1891
1435 Ga0496120_0088189 3300048923 Bacteria 1663
1436 Ga0496121_0000261 3300048924 Bacteria 110085
1437 Ga0496121_0000416 3300048924 Bacteria 84469
1438 Ga0496121_0002241 3300048924 Bacteria 30145
1439 Ga0496121_0018726 3300048924 Bacteria 6964
1440 Ga0496121_0056166 3300048924 Bacteria 3272
1441 Ga0496121_0099271 3300048924 Bacteria 2250
1442 Ga0496122_0003848 3300048925 Bacteria 19282
1443 Ga0496122_0015013 3300048925 Bacteria 7439
1444 Ga0496122_0085383 3300048925 Bacteria 2178
1445 Ga0496122_0091202 3300048925 Bacteria 2075
1446 Ga0496122_0099044 3300048925 Bacteria 1956
1447 Ga0496123_0002454 3300048926 Bacteria 22981
1448 Ga0496123_0025579 3300048926 Bacteria 4446
1449 Ga0496123_0115653 3300048926 Bacteria 1521
1450 Ga0496124_0001094 3300048927 Bacteria 42597
1451 Ga0496124_0112091 3300048927 Bacteria 2194
1452 Ga0496124_0196622 3300048927 Bacteria 1538
1453 Ga0496125_0000048 3300048928 Bacteria 290651
1454 Ga0496125_0004764 3300048928 Bacteria 15457
1455 Ga0496125_0006117 3300048928 Bacteria 13129
1456 Ga0496125_0055474 3300048928 Bacteria 3228
1457 Ga0496125_0063033 3300048928 Bacteria 2959
1458 Ga0496125_0078302 3300048928 Bacteria 2542
1459 Ga0496125_0084474 3300048928 Bacteria 2410
1460 Ga0496125_0090135 3300048928 Bacteria 2303
1461 Ga0496125_0094227 3300048928 Bacteria 2232
1462 Ga0496126_0000727 3300048929 Bacteria 59803
1463 Ga0496126_0006245 3300048929 Bacteria 13318
1464 Ga0496126_0008552 3300048929 Bacteria 11029
1465 Ga0496126_0015209 3300048929 Bacteria 7748
1466 Ga0496126_0021826 3300048929 Bacteria 6246
1467 Ga0496126_0028075 3300048929 Bacteria 5365
1468 Ga0496126_0035934 3300048929 Bacteria 4638
1469 Ga0496126_0047444 3300048929 Bacteria 3932
1470 Ga0496126_0081369 3300048929 Bacteria 2863
1471 Ga0501031_0073208 3300049568 Bacteria 2231
1472 Ga0501031_0080606 3300049568 Bacteria 2121
1473 Ga0501032_0000150 3300049569 Bacteria 56406
1474 Ga0501032_0006661 3300049569 Bacteria 8478
1475 Ga0501032_0013159 3300049569 Bacteria 5889
1476 Ga0501032_0020871 3300049569 Bacteria 4557
1477 Ga0501032_0028739 3300049569 Bacteria 3818
1478 Ga0501032_0067777 3300049569 Bacteria 2383
1479 Ga0501033_0000202 3300049570 Bacteria 57109
1480 Ga0501033_0000230 3300049570 Bacteria 53911
1481 Ga0501033_0006434 3300049570 Bacteria 9198
1482 Ga0501033_0014240 3300049570 Bacteria 6045
1483 Ga0501033_0018902 3300049570 Bacteria 5208
1484 Ga0501033_0022967 3300049570 Bacteria 4702
1485 Ga0501033_0063793 3300049570 Bacteria 2711
1486 Ga0501033_0082354 3300049570 Bacteria 2359
1487 Ga0501034_0000113 3300049571 Bacteria 149824
1488 Ga0501034_0014022 3300049571 Bacteria 8252
1489 Ga0501034_0016915 3300049571 Bacteria 7476
1490 Ga0501034_0025924 3300049571 Bacteria 5971
1491 Ga0501034_0051481 3300049571 Bacteria 4152
1492 Ga0501034_0069974 3300049571 Bacteria 3520
1493 Ga0501034_0072143 3300049571 Bacteria 3461
1494 Ga0501034_0079523 3300049571 Bacteria 3282
1495 Ga0501034_0091982 3300049571 Bacteria 3031
1496 Ga0501034_0097515 3300049571 Bacteria 2935
1497 Ga0501034_0122010 3300049571 Bacteria 2592
1498 Ga0501034_0143974 3300049571 Bacteria 2361
1499 Ga0501034_0182383 3300049571 Bacteria 2064
1500 Ga0501034_0282102 3300049571 Bacteria 1600
1501 Ga0501034_0326334 3300049571 Bacteria 1467
1502 Ga0501034_0332453 3300049571 Bacteria 1451
1503 Ga0501036_0000059 3300049572 Bacteria 72347
1504 Ga0501036_0000325 3300049572 Bacteria 33156
1505 Ga0501036_0021764 3300049572 Bacteria 5390
1506 Ga0501036_0062812 3300049572 Bacteria 3145
1507 Ga0501036_0067677 3300049572 Bacteria 3022
1508 Ga0501036_0071491 3300049572 Bacteria 2934
1509 Ga0501036_0080651 3300049572 Bacteria 2750
1510 Ga0501036_0119515 3300049572 Bacteria 2225
1511 Ga0501036_0119745 3300049572 Bacteria 2223
1512 Ga0501037_0000168 3300049573 Bacteria 61484
1513 Ga0501037_0000270 3300049573 Bacteria 44650
1514 Ga0501037_0003704 3300049573 Bacteria 11097
1515 Ga0501037_0011451 3300049573 Bacteria 6529
1516 Ga0501037_0012134 3300049573 Bacteria 6344
1517 Ga0501037_0025673 3300049573 Bacteria 4352
1518 Ga0501037_0056785 3300049573 Bacteria 2859
1519 Ga0501037_0243645 3300049573 Bacteria 1259
1520 Ga0501038_0000774 3300049574 Bacteria 28322
1521 Ga0501038_0004693 3300049574 Bacteria 12713
1522 Ga0501038_0005137 3300049574 Bacteria 12159
1523 Ga0501038_0005755 3300049574 Bacteria 11484
1524 Ga0501038_0031651 3300049574 Bacteria 4673
1525 Ga0501038_0044959 3300049574 Bacteria 3834
1526 Ga0501038_0048289 3300049574 Bacteria 3683
1527 Ga0501038_0048960 3300049574 Bacteria 3655
1528 Ga0501038_0075338 3300049574 Bacteria 2852
1529 Ga0501038_0097278 3300049574 Bacteria 2455
1530 Ga0501038_0258191 3300049574 Bacteria 1378
1531 Ga0501039_0000067 3300049575 Bacteria 79511
1532 Ga0501039_0008309 3300049575 Bacteria 7910
1533 Ga0501039_0015340 3300049575 Bacteria 5865
1534 Ga0501039_0032824 3300049575 Bacteria 4004
1535 Ga0501039_0048689 3300049575 Bacteria 3276
1536 Ga0501039_0067781 3300049575 Bacteria 2771
1537 Ga0501039_0095111 3300049575 Bacteria 2322
1538 Ga0501039_0171629 3300049575 Bacteria 1705
1539 Ga0501040_0071455 3300049576 Bacteria 2396
1540 Ga0501041_0036215 3300049577 Bacteria 2991
1541 Ga0501042_0053866 3300049578 Bacteria 2870
1542 Ga0501042_0095722 3300049578 Bacteria 2133
1543 Ga0501043_0000005 3300049579 Bacteria 254466
1544 Ga0501043_0000017 3300049579 Bacteria 166630
1545 Ga0501043_0011242 3300049579 Bacteria 7011
1546 Ga0501043_0049134 3300049579 Bacteria 3316
1547 Ga0501043_0059469 3300049579 Bacteria 2999
1548 Ga0501043_0075762 3300049579 Bacteria 2642
1549 Ga0501043_0091019 3300049579 Bacteria 2398
1550 Ga0501043_0122728 3300049579 Bacteria 2037
1551 Ga0501043_0129304 3300049579 Bacteria 1979
1552 Ga0501046_0018920 3300049580 Bacteria 5721
1553 Ga0501046_0035041 3300049580 Bacteria 4046
1554 Ga0501046_0042858 3300049580 Bacteria 3606
1555 Ga0501046_0056431 3300049580 Bacteria 3083
1556 Ga0501046_0134278 3300049580 Bacteria 1875
1557 Ga0501046_0192746 3300049580 Bacteria 1519
1558 Ga0501046_0204440 3300049580 Bacteria 1468
1559 Ga0501047_0000161 3300049581 Bacteria 81928
1560 Ga0501047_0000181 3300049581 Bacteria 76945
1561 Ga0501047_0005309 3300049581 Bacteria 12104
1562 Ga0501047_0019360 3300049581 Bacteria 6529
1563 Ga0501047_0021289 3300049581 Bacteria 6225
1564 Ga0501047_0023641 3300049581 Bacteria 5900
1565 Ga0501047_0033103 3300049581 Bacteria 4990
1566 Ga0501047_0033614 3300049581 Bacteria 4949
1567 Ga0501047_0039906 3300049581 Bacteria 4540
1568 Ga0501047_0078506 3300049581 Bacteria 3174
1569 Ga0501047_0084045 3300049581 Bacteria 3060
1570 Ga0501047_0142000 3300049581 Bacteria 2279
1571 Ga0501047_0175542 3300049581 Bacteria 2010
1572 Ga0501047_0263726 3300049581 Bacteria 1570
1573 Ga0501048_0000030 3300049582 Bacteria 66042
1574 Ga0501048_0000127 3300049582 Bacteria 44609
1575 Ga0501048_0001241 3300049582 Bacteria 19334
1576 Ga0501048_0028240 3300049582 Bacteria 4072
1577 Ga0501048_0153693 3300049582 Bacteria 1628
1578 Ga0501048_0198303 3300049582 Bacteria 1423
1579 Ga0501067_0000196 3300049583 Bacteria 34030
1580 Ga0501067_0003745 3300049583 Bacteria 8374
1581 Ga0501067_0011140 3300049583 Bacteria 4974
1582 Ga0501067_0024618 3300049583 Bacteria 3338
1583 Ga0501067_0039354 3300049583 Bacteria 2626
1584 Ga0501067_0083104 3300049583 Bacteria 1776
1585 Ga0501068_0001466 3300049584 Bacteria 12553
1586 Ga0501068_0010011 3300049584 Bacteria 5317
1587 Ga0501068_0035775 3300049584 Bacteria 2966
1588 Ga0501068_0078170 3300049584 Bacteria 2027
1589 Ga0501068_0097878 3300049584 Bacteria 1816
1590 Ga0501069_0000011 3300049585 Bacteria 153214
1591 Ga0501069_0000569 3300049585 Bacteria 17033
1592 Ga0501069_0011292 3300049585 Bacteria 4736
1593 Ga0501069_0011343 3300049585 Bacteria 4725
1594 Ga0501069_0023608 3300049585 Bacteria 3354
1595 Ga0501069_0027081 3300049585 Bacteria 3141
1596 Ga0501069_0117730 3300049585 Bacteria 1516
1597 Ga0501069_0154820 3300049585 Bacteria 1318
1598 Ga0501070_0000055 3300049586 Bacteria 99156
1599 Ga0501070_0002216 3300049586 Bacteria 17069
1600 Ga0501070_0006401 3300049586 Bacteria 10018
1601 Ga0501070_0021173 3300049586 Bacteria 5457
1602 Ga0501070_0032671 3300049586 Bacteria 4355
1603 Ga0501070_0033572 3300049586 Bacteria 4294
1604 Ga0501070_0047081 3300049586 Bacteria 3585
1605 Ga0501070_0049366 3300049586 Bacteria 3495
1606 Ga0501070_0069573 3300049586 Bacteria 2914
1607 Ga0501070_0079930 3300049586 Bacteria 2705
1608 Ga0501070_0116735 3300049586 Bacteria 2204
1609 Ga0501070_0121622 3300049586 Bacteria 2157
1610 Ga0501070_0144139 3300049586 Bacteria 1966
1611 Ga0501070_0174889 3300049586 Bacteria 1768
1612 Ga0501071_0030168 3300049587 Bacteria 3833
1613 Ga0501071_0032744 3300049587 Bacteria 3692
1614 Ga0501071_0091217 3300049587 Bacteria 2238
1615 Ga0501072_0000275 3300049588 Bacteria 37187
1616 Ga0501072_0001354 3300049588 Bacteria 18378
1617 Ga0501072_0012929 3300049588 Bacteria 6385
1618 Ga0501072_0030467 3300049588 Bacteria 4220
1619 Ga0501072_0229405 3300049588 Bacteria 1479
1620 Ga0501073_0000069 3300049589 Bacteria 63198
1621 Ga0501073_0005896 3300049589 Bacteria 9143
1622 Ga0501073_0015978 3300049589 Bacteria 5440
1623 Ga0501073_0020706 3300049589 Bacteria 4743
1624 Ga0501073_0036641 3300049589 Bacteria 3485
1625 Ga0501073_0046509 3300049589 Bacteria 3052
1626 Ga0501073_0054034 3300049589 Bacteria 2812
1627 Ga0501073_0078779 3300049589 Bacteria 2293
1628 Ga0501073_0165683 3300049589 Bacteria 1530
1629 Ga0501073_0182491 3300049589 Bacteria 1452
1630 Ga0501073_0192153 3300049589 Bacteria 1412
1631 Ga0501073_0220938 3300049589 Bacteria 1309
1632 Ga0501074_0000039 3300049590 Bacteria 60866
1633 Ga0501074_0000073 3300049590 Bacteria 48551
1634 Ga0501074_0058536 3300049590 Bacteria 2776
1635 Ga0501074_0063040 3300049590 Bacteria 2670
1636 Ga0501074_0070320 3300049590 Bacteria 2516
1637 Ga0501074_0250096 3300049590 Bacteria 1260
1638 Ga0501075_0040833 3300049591 Bacteria 3476
1639 Ga0501075_0046711 3300049591 Bacteria 3253
1640 Ga0501076_0015009 3300049592 Bacteria 5850
1641 Ga0501076_0052263 3300049592 Bacteria 3237
1642 Ga0501077_0101266 3300049593 Bacteria 1825
1643 Ga0501079_0000998 3300049741 Bacteria 19556
1644 Ga0501079_0007420 3300049741 Bacteria 8295
1645 Ga0501079_0047612 3300049741 Bacteria 3308
1646 Ga0501079_0101655 3300049741 Bacteria 2229
1647 Ga0501079_0116794 3300049741 Bacteria 2074
1648 Ga0501079_0232832 3300049741 Bacteria 1439
1649 Ga0501080_0000181 3300049742 Bacteria 45949
1650 Ga0501080_0000217 3300049742 Bacteria 42758
1651 Ga0501080_0000593 3300049742 Bacteria 28623
1652 Ga0501080_0016770 3300049742 Bacteria 6766
1653 Ga0501080_0019895 3300049742 Bacteria 6216
1654 Ga0501080_0029348 3300049742 Bacteria 5120
1655 Ga0501080_0031716 3300049742 Bacteria 4924
1656 Ga0501080_0037235 3300049742 Bacteria 4542
1657 Ga0501080_0039468 3300049742 Bacteria 4406
1658 Ga0501080_0068045 3300049742 Bacteria 3313
1659 Ga0501080_0081794 3300049742 Bacteria 3000
1660 Ga0501080_0101038 3300049742 Bacteria 2675
1661 Ga0501080_0114052 3300049742 Bacteria 2505
1662 Ga0501080_0211867 3300049742 Bacteria 1775
1663 Ga0501080_0217914 3300049742 Bacteria 1747
1664 Ga0501080_0226309 3300049742 Bacteria 1710
1665 Ga0501080_0348553 3300049742 Bacteria 1337
1666 Ga0501081_0030088 3300049743 Bacteria 3673
1667 Ga0501083_0000063 3300049744 Bacteria 74976
1668 Ga0501083_0000336 3300049744 Bacteria 29766
1669 Ga0501083_0000423 3300049744 Bacteria 27160
1670 Ga0501083_0006039 3300049744 Bacteria 8580
1671 Ga0501083_0020067 3300049744 Bacteria 4650
1672 Ga0501083_0043713 3300049744 Bacteria 3034
1673 Ga0501083_0200340 3300049744 Bacteria 1302
1674 Ga0501035_0000086 3300049822 Bacteria 115822
1675 Ga0501035_0000393 3300049822 Bacteria 49959
1676 Ga0501035_0002112 3300049822 Bacteria 19769
1677 Ga0501035_0002772 3300049822 Bacteria 16971
1678 Ga0501035_0003189 3300049822 Bacteria 15719
1679 Ga0501035_0015336 3300049822 Bacteria 7073
1680 Ga0501035_0035579 3300049822 Bacteria 4518
1681 Ga0501035_0039307 3300049822 Bacteria 4281
1682 Ga0501035_0056734 3300049822 Bacteria 3493
1683 Ga0501035_0070318 3300049822 Bacteria 3100
1684 Ga0501035_0217192 3300049822 Bacteria 1634
1685 Ga0501035_0252063 3300049822 Bacteria 1498
1686 Ga0501044_0000242 3300049823 Bacteria 69190
1687 Ga0501044_0000332 3300049823 Bacteria 59619
1688 Ga0501044_0000387 3300049823 Bacteria 54729
1689 Ga0501044_0006216 3300049823 Bacteria 13198
1690 Ga0501044_0010067 3300049823 Bacteria 10275
1691 Ga0501044_0021180 3300049823 Bacteria 6942
1692 Ga0501044_0031202 3300049823 Bacteria 5610
1693 Ga0501044_0040588 3300049823 Bacteria 4849
1694 Ga0501044_0061947 3300049823 Bacteria 3826
1695 Ga0501044_0067968 3300049823 Bacteria 3630
1696 Ga0501044_0072847 3300049823 Bacteria 3492
1697 Ga0501044_0087367 3300049823 Bacteria 3149
1698 Ga0501044_0103458 3300049823 Bacteria 2862
1699 Ga0501044_0105780 3300049823 Bacteria 2826
1700 Ga0501044_0116989 3300049823 Bacteria 2670
1701 Ga0501044_0127202 3300049823 Bacteria 2544
1702 Ga0501044_0128755 3300049823 Bacteria 2527
1703 Ga0501045_0002048 3300049824 Bacteria 13613
1704 Ga0501045_0025676 3300049824 Bacteria 4237
1705 Ga0501045_0047243 3300049824 Bacteria 3135
1706 Ga0501045_0065375 3300049824 Bacteria 2670
1707 Ga0501045_0277604 3300049824 Bacteria 1247
1708 nmdc:mga03n38_114707_c1 3300050490 Bacteria 1317
1709 nmdc:mga03n38_26302_c1 3300050490 Bacteria 2401
1710 nmdc:mga03n38_50036_c1 3300050490 Bacteria 1861
1711 nmdc:mga00v17_71211_c1 3300050491 Bacteria 2155
1712 nmdc:mga0yw44_11287_c1 3300050492 Bacteria 4605
1713 nmdc:mga0yw44_133910_c1 3300050492 Bacteria 1606
1714 nmdc:mga0yw44_1637_c2 3300050492 Bacteria 8468
1715 nmdc:mga0yw44_22217_c1 3300050492 Bacteria 3554
1716 nmdc:mga0yw44_9110_c1 3300050492 Bacteria 4994
1717 nmdc:mga0yw44_99388_c1 3300050492 Bacteria 1851
1718 nmdc:mga0k408_17957_c1 3300050493 Bacteria 3943
1719 nmdc:mga0k408_71060_c1 3300050493 Bacteria 2031
1720 nmdc:mga06z11_27678_c1 3300050494 Bacteria 2712
1721 nmdc:mga06z11_50238_c1 3300050494 Bacteria 2131
1722 nmdc:mga06z11_9073_c2 3300050494 Bacteria 3572
1723 nmdc:mga04h51_11753_c1 3300050495 Bacteria 2439
1724 nmdc:mga07m45_126428_c1 3300050496 Bacteria 1478
1725 nmdc:mga07m45_32041_c1 3300050496 Bacteria 2914
1726 nmdc:mga05p37_1104_c1 3300050507 Bacteria 31014
1727 nmdc:mga05p37_147599_c1 3300050507 Bacteria 2878
1728 nmdc:mga05p37_22613_c1 3300050507 Bacteria 7624
1729 nmdc:mga05p37_23845_c1 3300050507 Bacteria 7430
1730 nmdc:mga05p37_50587_c1 3300050507 Bacteria 5110
1731 nmdc:mga05p37_51_c1 3300050507 Bacteria 103396
1732 nmdc:mga05p37_6511_c1 3300050507 Bacteria 13777
1733 nmdc:mga05p37_6767_c1 3300050507 Bacteria 13512
1734 nmdc:mga05p37_99068_c1 3300050507 Bacteria 3591
1735 nmdc:mga09592_121334_c1 3300050508 Bacteria 2245
1736 nmdc:mga09592_250846_c1 3300050508 Bacteria 1534
1737 nmdc:mga09592_5959_c1 3300050508 Bacteria 9935
1738 nmdc:mga09592_90283_c1 3300050508 Bacteria 2617
1739 nmdc:mga09592_9044_c2 3300050508 Bacteria 5766
1740 nmdc:mga0qj67_2775_c1 3300050509 Bacteria 12562
1741 nmdc:mga0qj67_28_c1 3300050509 Bacteria 102760
1742 nmdc:mga06r32_135530_c1 3300050510 Bacteria 2437
1743 nmdc:mga06r32_16_c1 3300050510 Bacteria 101899
1744 nmdc:mga06r32_28286_c1 3300050510 Bacteria 5243
1745 nmdc:mga06r32_736_c1 3300050510 Bacteria 28719
1746 nmdc:mga06r32_93470_c1 3300050510 Bacteria 2941
1747 nmdc:mga06r32_95007_c1 3300050510 Bacteria 2917
1748 nmdc:mga08y16_120981_c1 3300050511 Bacteria 2724
1749 nmdc:mga08y16_67591_c1 3300050511 Bacteria 3727
1750 nmdc:mga08y16_79_c2 3300050511 Bacteria 54400
1751 nmdc:mga0n895_135227_c1 3300050512 Bacteria 2492
1752 nmdc:mga0n895_18432_c1 3300050512 Bacteria 6460
1753 nmdc:mga0n895_188564_c1 3300050512 Bacteria 2093
1754 nmdc:mga0n895_1980_c1 3300050512 Bacteria 15715
1755 nmdc:mga0n895_33594_c2 3300050512 Bacteria 3020
1756 nmdc:mga0n895_38223_c1 3300050512 Bacteria 4649
1757 nmdc:mga0n895_45575_c1 3300050512 Bacteria 4279
1758 nmdc:mga0n895_63645_c1 3300050512 Bacteria 3647
1759 nmdc:mga0rr50_137650_c1 3300050513 Bacteria 1961
1760 nmdc:mga0rr50_18315_c1 3300050513 Bacteria 4701
1761 nmdc:mga0rr50_19043_c1 3300050513 Bacteria 4624
1762 nmdc:mga0rr50_46435_c1 3300050513 Bacteria 3197
1763 nmdc:mga08x19_21_c1 3300050514 Bacteria 302369
1764 nmdc:mga08x19_381_c1 3300050514 Bacteria 31108
1765 nmdc:mga08x19_67532_c1 3300050514 Bacteria 2325
1766 nmdc:mga0a205_159109_c1 3300050515 Bacteria 2156
1767 nmdc:mga0a205_16697_c1 3300050515 Bacteria 6876
1768 nmdc:mga0a205_2279_c1 3300050515 Bacteria 16921
1769 nmdc:mga0a205_57124_c1 3300050515 Bacteria 3768
1770 Ga0495601_0000008 3300053077 Bacteria 362152
1771 Ga0495601_0000735 3300053077 Bacteria 17656
1772 Ga0495601_0008131 3300053077 Bacteria 6186
1773 Ga0495601_0024295 3300053077 Bacteria 3732
1774 Ga0495601_0042930 3300053077 Bacteria 2839
1775 Ga0495601_0047541 3300053077 Bacteria 2701
1776 Ga0495601_0075837 3300053077 Bacteria 2152
1777 Ga0495601_0198417 3300053077 Bacteria 1311
1778 Ga0495612_0000002 3300053078 Bacteria 310466
1779 Ga0495612_0005516 3300053078 Bacteria 5229
1780 Ga0495612_0007834 3300053078 Bacteria 4356
1781 Ga0495612_0023110 3300053078 Bacteria 2493
1782 Ga0495612_0033066 3300053078 Bacteria 2092
1783 Ga0495612_0062365 3300053078 Bacteria 1545
1784 Ga0500635_0006439 3300053080 Bacteria 3136
1785 Ga0500635_0008440 3300053080 Bacteria 2824
1786 Ga0500635_0011913 3300053080 Bacteria 2484
1787 Ga0495655_0017313 3300053083 Bacteria 1567
1788 Ga0495595_0000008 3300053084 Bacteria 196206
1789 Ga0495595_0001971 3300053084 Bacteria 7977
1790 Ga0495595_0002152 3300053084 Bacteria 7652
1791 Ga0495595_0002327 3300053084 Bacteria 7416
1792 Ga0495595_0057531 3300053084 Bacteria 1813
1793 Ga0495595_0061528 3300053084 Bacteria 1759
1794 Ga0495619_0000002 3300053085 Bacteria 530226
1795 Ga0495619_0000292 3300053085 Bacteria 35551
1796 Ga0495619_0000458 3300053085 Bacteria 27498
1797 Ga0495619_0004010 3300053085 Bacteria 9437
1798 Ga0495619_0004510 3300053085 Bacteria 8893
1799 Ga0495619_0009064 3300053085 Bacteria 6277
1800 Ga0495619_0015609 3300053085 Bacteria 4806
1801 Ga0495619_0031766 3300053085 Bacteria 3423
1802 Ga0495619_0040472 3300053085 Bacteria 3047
1803 Ga0495619_0053175 3300053085 Bacteria 2678
1804 Ga0495619_0054427 3300053085 Bacteria 2648
1805 Ga0495619_0075982 3300053085 Bacteria 2254
1806 Ga0500578_0053970 3300053086 Bacteria 2573
1807 Ga0500646_0003293 3300053090 Bacteria 4149
1808 Ga0500647_0066988 3300053091 Bacteria 1726
1809 Ga0500651_0083938 3300053093 Bacteria 1970
1810 Ga0500566_0000095 3300053094 Bacteria 44474
1811 Ga0500566_0000144 3300053094 Bacteria 36317
1812 Ga0500566_0001431 3300053094 Bacteria 13964
1813 Ga0500566_0005897 3300053094 Bacteria 7285
1814 Ga0500566_0007934 3300053094 Bacteria 6282
1815 Ga0500641_0005415 3300053096 Bacteria 4525
1816 Ga0500641_0012425 3300053096 Bacteria 3109
1817 Ga0500650_0009613 3300053098 Bacteria 3893
1818 Ga0500555_012209 3300053103 Bacteria 2470
1819 Ga0500556_0000250 3300053104 Bacteria 43584
1820 Ga0500556_0002542 3300053104 Bacteria 5774
1821 Ga0500556_0004808 3300053104 Bacteria 3829
1822 Ga0500562_009270 3300053108 Bacteria 2488
1823 Ga0500569_002659 3300053109 Bacteria 3555
1824 Ga0500592_012239 3300053116 Bacteria 1371
1825 Ga0500595_000836 3300053119 Bacteria 17587
1826 Ga0500595_001782 3300053119 Bacteria 11209
1827 Ga0500595_009309 3300053119 Bacteria 3968
1828 Ga0500595_024216 3300053119 Bacteria 2121
1829 Ga0500608_004412 3300053122 Bacteria 5445
1830 Ga0500642_0000017 3300053130 Bacteria 167670
1831 Ga0500642_0000725 3300053130 Bacteria 9717
1832 Ga0500652_000672 3300053131 Bacteria 11602
1833 Ga0500559_0001890 3300053136 Bacteria 11359
1834 Ga0500559_0036908 3300053136 Bacteria 2116
1835 Ga0500568_0001797 3300053139 Bacteria 13202
1836 Ga0500568_0003072 3300053139 Bacteria 9535
1837 Ga0500577_0000790 3300053142 Bacteria 8156
1838 Ga0500586_001688 3300053145 Bacteria 4762
1839 Ga0500590_096952 3300053148 Bacteria 1422
1840 Ga0500603_001707 3300053150 Bacteria 4945
1841 Ga0500604_0007346 3300053151 Bacteria 2917
1842 Ga0500616_0000001 3300053153 Bacteria 1986011
1843 Ga0500616_0000046 3300053153 Bacteria 333409
1844 Ga0500616_0000118 3300053153 Bacteria 143496
1845 Ga0500616_0030744 3300053153 Bacteria 2946
1846 Ga0500622_0002059 3300053156 Bacteria 14986
1847 Ga0500622_0005001 3300053156 Bacteria 8072
1848 Ga0500634_0007038 3300053161 Bacteria 5506
1849 Ga0500638_007664 3300053162 Bacteria 4537
1850 Ga0500636_0000617 3300053177 Bacteria 19244
1851 Ga0500636_0026918 3300053177 Bacteria 3395
1852 Ga0500636_0055253 3300053177 Bacteria 2327
1853 Ga0500637_0000438 3300053178 Bacteria 15908
1854 Ga0500637_0004366 3300053178 Bacteria 6701
1855 Ga0500637_0017825 3300053178 Bacteria 3806
1856 Ga0500637_0026671 3300053178 Bacteria 3184
1857 Ga0500637_0036223 3300053178 Bacteria 2770
1858 Ga0500649_083594 3300053722 Bacteria 1294
1859 Ga0500567_076713 3300053723 Bacteria 1453
1860 Ga0500625_002931 3300053729 Bacteria 6580
1861 Ga0500645_004871 3300053730 Bacteria 5057
1862 Ga0500609_003923 3300053731 Bacteria 2073
1863 Ga0500599_000600 3300053736 Bacteria 3815
1864 Ga0500601_000512 3300053737 Bacteria 5947
1865 Ga0501084_0000898 3300054114 Bacteria 23029
1866 Ga0501084_0029430 3300054114 Bacteria 4594
1867 Ga0501084_0058772 3300054114 Bacteria 3218
1868 Ga0501084_0068863 3300054114 Bacteria 2962
1869 Ga0501084_0087347 3300054114 Bacteria 2618
1870 Ga0501084_0186059 3300054114 Bacteria 1753
1871 Ga0500661_001158 3300055283 Bacteria 4929
1872 Ga0501082_0000555 3300060353 Bacteria 33188
1873 Ga0501082_0000635 3300060353 Bacteria 30998
1874 Ga0501082_0007160 3300060353 Bacteria 9616
1875 Ga0501082_0017789 3300060353 Bacteria 6124
1876 Ga0501082_0125145 3300060353 Bacteria 2229
1877 Ga0501082_0128227 3300060353 Bacteria 2201
1878 Ga0501082_0252635 3300060353 Bacteria 1534
1879 Ga0501082_0321333 3300060353 Bacteria 1348
1880 Ga0530510_0015166 3300061734 Bacteria 5441
1881 Ga0530510_0077380 3300061734 Bacteria 2418

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_63645_c1 nmdc:mga0n895_63645_c1_21_1064 346
2 3300046616 Ga0495668_0156597 Ga0495668_0156597_26_1072 347
3 3300048921 Ga0496118_0113941 Ga0496118_0113941_23_1081 347
4 iso_pu_bacteria 2979095461 2979099518 371
5 3300031852 Ga0307410_10133142 Ga0307410_101331421 373
6 3300045836 Ga0466958_0028778 Ga0466958_0028778_684_1949 375
7 3300048927 Ga0496124_0196622 Ga0496124_0196622_257_1438 379
8 3300031241 Ga0265325_10014686 Ga0265325_100146863 380
9 3300031595 Ga0265313_10009447 Ga0265313_100094473 380
10 3300031711 Ga0265314_10055517 Ga0265314_100555172 380
11 3300049744 Ga0501083_0200340 Ga0501083_0200340_41_1249 380
12 3300053085 Ga0495619_0040472 Ga0495619_0040472_922_2133 380
13 3300031247 Ga0265340_10012145 Ga0265340_100121452 383
14 3300053086 Ga0500578_0053970 Ga0500578_0053970_766_2028 383
15 3300006028 Ga0070717_10070550 Ga0070717_100705503 384
16 3300035695 Ga0373927_0004049 Ga0373927_0004049_2703_3908 384
17 3300035725 Ga0373947_0070288 Ga0373947_0070288_560_1765 384
18 3300037068 Ga0373925_0034624 Ga0373925_0034624_2237_3442 384
19 3300025909 Ga0207705_10239219 Ga0207705_102392191 385
20 3300035086 Ga0373934_0016623 Ga0373934_0016623_657_1814 385
21 3300035114 Ga0373939_0001794 Ga0373939_0001794_2027_3229 385
22 3300035117 Ga0373953_0022837 Ga0373953_0022837_430_1587 385
23 3300035119 Ga0373956_0080217 Ga0373956_0080217_144_1301 385
24 3300035172 Ga0373955_0029587 Ga0373955_0029587_1022_2179 385
25 3300035172 Ga0373955_0050653 Ga0373955_0050653_55_1272 385
26 3300035724 Ga0373933_0005306 Ga0373933_0005306_5752_6969 385
27 3300035724 Ga0373933_0014092 Ga0373933_0014092_2680_3837 385
28 3300036401 Ga0373937_0029139 Ga0373937_0029139_1146_2363 385
29 3300036401 Ga0373937_0075672 Ga0373937_0075672_1284_2441 385
30 3300046536 Ga0495587_0120581 Ga0495587_0120581_142_1359 385
31 3300046559 Ga0495667_0080694 Ga0495667_0080694_52_1209 385
32 3300046559 Ga0495667_0134436 Ga0495667_0134436_253_1470 385
33 3300053077 Ga0495601_0198417 Ga0495601_0198417_54_1271 385
34 3300053084 Ga0495595_0057531 Ga0495595_0057531_357_1574 385
35 3300053085 Ga0495619_0054427 Ga0495619_0054427_193_1410 385
36 3300053085 Ga0495619_0075982 Ga0495619_0075982_535_1692 385
37 3300007265 Ga0099794_10022266 Ga0099794_100222662 386
38 3300027671 Ga0209588_1011265 Ga0209588_10112652 386
39 3300046809 Ga0495600_0035324 Ga0495600_0035324_959_2176 386
40 3300049741 Ga0501079_0232832 Ga0501079_0232832_215_1378 386
41 3300049824 Ga0501045_0277604 Ga0501045_0277604_33_1196 386
42 3300061734 Ga0530510_0015166 Ga0530510_0015166_911_2074 386
43 3300014745 Ga0157377_10193182 Ga0157377_101931821 387
44 3300046511 Ga0495608_0012765 Ga0495608_0012765_4407_5624 387
45 3300046679 Ga0495623_0025283 Ga0495623_0025283_915_2132 387
46 3300050490 nmdc:mga03n38_26302_c1 nmdc:mga03n38_26302_c1_759_1925 387
47 3300050495 nmdc:mga04h51_11753_c1 nmdc:mga04h51_11753_c1_290_1456 387
48 3300005547 Ga0070693_100011286 Ga0070693_1000112862 388
49 3300005983 Ga0081540_1009469 Ga0081540_10094693 388
50 3300006844 Ga0075428_100000557 Ga0075428_10000055739 388
51 3300006847 Ga0075431_100000469 Ga0075431_10000046921 388
52 3300009094 Ga0111539_10000072 Ga0111539_1000007248 388
53 3300009094 Ga0111539_10603517 Ga0111539_106035171 388
54 3300009147 Ga0114129_10000134 Ga0114129_1000013447 388
55 3300025932 Ga0207690_10020962 Ga0207690_100209623 388
56 3300027907 Ga0207428_10006238 Ga0207428_100062385 388
57 3300039438 Ga0436360_0915147 Ga0436360_0915147_382_1560 388
58 3300042439 Ga0439464_0036631 Ga0439464_0036631_23_1243 388
59 3300049570 Ga0501033_0063793 Ga0501033_0063793_464_1666 388
60 3300049573 Ga0501037_0011451 Ga0501037_0011451_1547_2749 388
61 3300049574 Ga0501038_0044959 Ga0501038_0044959_2191_3393 388
62 3300049575 Ga0501039_0067781 Ga0501039_0067781_132_1334 388
63 3300049581 Ga0501047_0033614 Ga0501047_0033614_3484_4686 388
64 3300049589 Ga0501073_0015978 Ga0501073_0015978_398_1600 388
65 3300049742 Ga0501080_0016770 Ga0501080_0016770_5209_6411 388
66 3300050507 nmdc:mga05p37_51_c1 nmdc:mga05p37_51_c1_55987_57207 388
67 3300050508 nmdc:mga09592_9044_c2 nmdc:mga09592_9044_c2_3593_4813 388
68 3300050510 nmdc:mga06r32_16_c1 nmdc:mga06r32_16_c1_33495_34715 388
69 3300050511 nmdc:mga08y16_79_c2 nmdc:mga08y16_79_c2_7016_8236 388
70 3300035119 Ga0373956_0006742 Ga0373956_0006742_894_2123 389
71 3300035410 Ga0373924_0037642 Ga0373924_0037642_32_1249 389
72 3300037068 Ga0373925_0139133 Ga0373925_0139133_50_1279 389
73 3300047317 Ga0495604_0036718 Ga0495604_0036718_1109_2338 389
74 3300047322 Ga0495680_0172114 Ga0495680_0172114_142_1371 389
75 3300048088 Ga0495602_0070644 Ga0495602_0070644_877_2106 389
76 3300049570 Ga0501033_0018902 Ga0501033_0018902_3919_5088 389
77 3300049571 Ga0501034_0097515 Ga0501034_0097515_1094_2263 389
78 3300049571 Ga0501034_0122010 Ga0501034_0122010_528_1697 389
79 3300049572 Ga0501036_0080651 Ga0501036_0080651_355_1524 389
80 3300049573 Ga0501037_0012134 Ga0501037_0012134_2784_3953 389
81 3300049574 Ga0501038_0004693 Ga0501038_0004693_6143_7312 389
82 3300049579 Ga0501043_0011242 Ga0501043_0011242_4616_5785 389
83 3300049580 Ga0501046_0042858 Ga0501046_0042858_285_1454 389
84 3300049589 Ga0501073_0054034 Ga0501073_0054034_327_1496 389
85 3300049590 Ga0501074_0250096 Ga0501074_0250096_28_1197 389
86 3300049741 Ga0501079_0007420 Ga0501079_0007420_2624_3793 389
87 3300049822 Ga0501035_0039307 Ga0501035_0039307_950_2119 389
88 3300049823 Ga0501044_0105780 Ga0501044_0105780_1547_2716 389
89 3300013104 Ga0157370_10036937 Ga0157370_100369372 390
90 3300013307 Ga0157372_10056074 Ga0157372_100560745 390
91 iso_pu_bacteria 2889306138 2889307111 390
92 3300005458 Ga0070681_10016662 Ga0070681_100166626 391
93 3300005530 Ga0070679_100029348 Ga0070679_1000293482 391
94 3300025912 Ga0207707_10193979 Ga0207707_101939791 391
95 3300025921 Ga0207652_10047907 Ga0207652_100479072 391
96 3300028379 Ga0268266_10270085 Ga0268266_102700852 391
97 3300044693 Ga0466961_0071534 Ga0466961_0071534_870_2072 391
98 3300049571 Ga0501034_0326334 Ga0501034_0326334_53_1327 391
99 3300049576 Ga0501040_0071455 Ga0501040_0071455_842_2083 391
100 3300049586 Ga0501070_0174889 Ga0501070_0174889_160_1398 391
101 3300049824 Ga0501045_0025676 Ga0501045_0025676_119_1360 391
102 3300053078 Ga0495612_0062365 Ga0495612_0062365_142_1371 391
103 iso_pu_bacteria 2840878972 2840882381 391
104 3300005336 Ga0070680_100010948 Ga0070680_1000109486 392
105 3300005339 Ga0070660_100016213 Ga0070660_1000162131 392
106 3300005548 Ga0070665_100000707 Ga0070665_1000007076 392
107 3300005577 Ga0068857_100089874 Ga0068857_1000898742 392
108 3300005616 Ga0068852_100136704 Ga0068852_1001367042 392
109 3300006042 Ga0075368_10015289 Ga0075368_100152892 392
110 3300006178 Ga0075367_10145961 Ga0075367_101459611 392
111 3300006358 Ga0068871_100268974 Ga0068871_1002689741 392
112 3300025909 Ga0207705_10013966 Ga0207705_100139661 392
113 3300025913 Ga0207695_10074744 Ga0207695_100747442 392
114 3300025913 Ga0207695_10195034 Ga0207695_101950343 392
115 3300025919 Ga0207657_10077989 Ga0207657_100779891 392
116 3300025921 Ga0207652_10008744 Ga0207652_100087445 392
117 3300026041 Ga0207639_10120244 Ga0207639_101202443 392
118 3300026116 Ga0207674_10077850 Ga0207674_100778502 392
119 3300027866 Ga0209813_10016507 Ga0209813_100165071 392
120 3300028379 Ga0268266_10001112 Ga0268266_1000111215 392
121 3300028577 Ga0265318_10000703 Ga0265318_1000070317 392
122 3300028800 Ga0265338_10004162 Ga0265338_100041628 392
123 3300031235 Ga0265330_10016863 Ga0265330_100168633 392
124 3300031238 Ga0265332_10023261 Ga0265332_100232613 392
125 3300031247 Ga0265340_10018657 Ga0265340_100186571 392
126 3300031249 Ga0265339_10088360 Ga0265339_100883602 392
127 3300031250 Ga0265331_10000956 Ga0265331_1000095626 392
128 3300031250 Ga0265331_10024467 Ga0265331_100244671 392
129 3300031344 Ga0265316_10085213 Ga0265316_100852132 392
130 3300031344 Ga0265316_10137618 Ga0265316_101376182 392
131 3300031595 Ga0265313_10001228 Ga0265313_100012287 392
132 3300031711 Ga0265314_10001388 Ga0265314_1000138824 392
133 3300031711 Ga0265314_10042734 Ga0265314_100427341 392
134 3300031712 Ga0265342_10129825 Ga0265342_101298251 392
135 3300035116 Ga0373945_0042194 Ga0373945_0042194_154_1383 392
136 3300039093 Ga0400489_74307 Ga0400489_74307_458_1660 392
137 3300039437 Ga0436365_0065969 Ga0436365_0065969_1445_2635 392
138 3300045051 Ga0451576_0010468 Ga0451576_0010468_1221_2420 392
139 3300046457 Ga0495590_0008019 Ga0495590_0008019_1537_2724 392
140 3300046557 Ga0495622_0046932 Ga0495622_0046932_182_1369 392
141 3300048908 Ga0496105_0042069 Ga0496105_0042069_2328_3551 392
142 3300048912 Ga0496109_0317218 Ga0496109_0317218_128_1309 392
143 3300048917 Ga0496114_0134669 Ga0496114_0134669_683_1906 392
144 3300048929 Ga0496126_0035934 Ga0496126_0035934_1100_2305 392
145 3300049568 Ga0501031_0080606 Ga0501031_0080606_474_1664 392
146 3300049569 Ga0501032_0006661 Ga0501032_0006661_1145_2335 392
147 3300049570 Ga0501033_0000230 Ga0501033_0000230_11010_12200 392
148 3300049570 Ga0501033_0022967 Ga0501033_0022967_1149_2354 392
149 3300049571 Ga0501034_0016915 Ga0501034_0016915_5268_6461 392
150 3300049572 Ga0501036_0067677 Ga0501036_0067677_271_1464 392
151 3300049573 Ga0501037_0000168 Ga0501037_0000168_19807_20997 392
152 3300049579 Ga0501043_0000005 Ga0501043_0000005_151439_152629 392
153 3300049579 Ga0501043_0049134 Ga0501043_0049134_1890_3095 392
154 3300049579 Ga0501043_0091019 Ga0501043_0091019_917_2110 392
155 3300049580 Ga0501046_0018920 Ga0501046_0018920_1585_2778 392
156 3300049581 Ga0501047_0021289 Ga0501047_0021289_649_1854 392
157 3300049581 Ga0501047_0142000 Ga0501047_0142000_594_1796 392
158 3300049583 Ga0501067_0083104 Ga0501067_0083104_494_1684 392
159 3300049584 Ga0501068_0035775 Ga0501068_0035775_960_2249 392
160 3300049584 Ga0501068_0078170 Ga0501068_0078170_430_1620 392
161 3300049585 Ga0501069_0000011 Ga0501069_0000011_146750_147940 392
162 3300049586 Ga0501070_0000055 Ga0501070_0000055_53625_54815 392
163 3300049586 Ga0501070_0002216 Ga0501070_0002216_13859_15148 392
164 3300049587 Ga0501071_0032744 Ga0501071_0032744_2434_3624 392
165 3300049589 Ga0501073_0036641 Ga0501073_0036641_1111_2301 392
166 3300049589 Ga0501073_0078779 Ga0501073_0078779_138_1427 392
167 3300049590 Ga0501074_0000039 Ga0501074_0000039_21560_22750 392
168 3300049590 Ga0501074_0063040 Ga0501074_0063040_982_2271 392
169 3300049741 Ga0501079_0116794 Ga0501079_0116794_321_1511 392
170 3300049742 Ga0501080_0000217 Ga0501080_0000217_20340_21530 392
171 3300049742 Ga0501080_0031716 Ga0501080_0031716_2364_3653 392
172 3300049742 Ga0501080_0068045 Ga0501080_0068045_195_1400 392
173 3300049744 Ga0501083_0000063 Ga0501083_0000063_5211_6401 392
174 3300049822 Ga0501035_0000086 Ga0501035_0000086_12750_13940 392
175 3300049822 Ga0501035_0002112 Ga0501035_0002112_17210_18499 392
176 3300049822 Ga0501035_0002772 Ga0501035_0002772_891_2096 392
177 3300049822 Ga0501035_0056734 Ga0501035_0056734_2040_3233 392
178 3300049823 Ga0501044_0000242 Ga0501044_0000242_55231_56421 392
179 3300049823 Ga0501044_0006216 Ga0501044_0006216_3326_4531 392
180 3300049823 Ga0501044_0067968 Ga0501044_0067968_170_1459 392
181 3300053080 Ga0500635_0011913 Ga0500635_0011913_146_1333 392
182 3300053090 Ga0500646_0003293 Ga0500646_0003293_469_1656 392
183 3300053178 Ga0500637_0004366 Ga0500637_0004366_4357_5544 392
184 3300054114 Ga0501084_0186059 Ga0501084_0186059_38_1228 392
185 3300060353 Ga0501082_0017789 Ga0501082_0017789_2310_3500 392
186 iso_pu_bacteria 2643221623 2644130010 392
187 iso_pu_bacteria 2738543024 2739309997 392
188 iso_pu_bacteria 2842775625 2842777868 392
189 3300005435 Ga0070714_100038921 Ga0070714_1000389213 393
190 3300005435 Ga0070714_100176983 Ga0070714_1001769831 393
191 3300005614 Ga0068856_100209636 Ga0068856_1002096362 393
192 3300005981 Ga0081538_10053618 Ga0081538_100536181 393
193 3300006871 Ga0075434_100141996 Ga0075434_1001419961 393
194 3300009993 Ga0105028_102329 Ga0105028_1023292 393
195 3300013307 Ga0157372_10482387 Ga0157372_104823872 393
196 3300014325 Ga0163163_10018516 Ga0163163_100185163 393
197 3300021384 Ga0213876_10015252 Ga0213876_100152523 393
198 3300021384 Ga0213876_10059733 Ga0213876_100597332 393
199 3300021388 Ga0213875_10006158 Ga0213875_100061588 393
200 3300025295 Ga0209564_1000384 Ga0209564_10003848 393
201 3300031238 Ga0265332_10033802 Ga0265332_100338022 393
202 3300031712 Ga0265342_10118196 Ga0265342_101181961 393
203 3300037853 Ga0436364_0473030 Ga0436364_0473030_1114_2304 393
204 3300037853 Ga0436364_1251988 Ga0436364_1251988_5363_6559 393
205 3300039437 Ga0436365_1354398 Ga0436365_1354398_1544_2734 393
206 3300039437 Ga0436365_1759934 Ga0436365_1759934_622_1824 393
207 3300039453 Ga0436362_1043177 Ga0436362_1043177_1219_2421 393
208 3300046460 Ga0495638_0106711 Ga0495638_0106711_12_1196 393
209 3300046530 Ga0495654_0038861 Ga0495654_0038861_1035_2231 393
210 3300048920 Ga0496117_0022401 Ga0496117_0022401_20_1216 393
211 3300048928 Ga0496125_0006117 Ga0496125_0006117_7524_8708 393
212 3300048929 Ga0496126_0000727 Ga0496126_0000727_875_2065 393
213 3300049581 Ga0501047_0263726 Ga0501047_0263726_159_1361 393
214 3300049585 Ga0501069_0117730 Ga0501069_0117730_272_1468 393
215 3300049744 Ga0501083_0020067 Ga0501083_0020067_1632_2828 393
216 3300049823 Ga0501044_0116989 Ga0501044_0116989_1368_2564 393
217 3300050511 nmdc:mga08y16_120981_c1 nmdc:mga08y16_120981_c1_525_1712 393
218 3300050512 nmdc:mga0n895_188564_c1 nmdc:mga0n895_188564_c1_51_1238 393
219 3300050515 nmdc:mga0a205_159109_c1 nmdc:mga0a205_159109_c1_869_2056 393
220 3300053130 Ga0500642_0000017 Ga0500642_0000017_163017_164201 393
221 3300053131 Ga0500652_000672 Ga0500652_000672_5877_7073 393
222 3300060353 Ga0501082_0321333 Ga0501082_0321333_115_1311 393
223 3300061734 Ga0530510_0077380 Ga0530510_0077380_1118_2317 393
224 iso_pu_bacteria 2828305725 2828308090 393
225 iso_pu_bacteria 2856342000 2856346691 393
226 iso_pu_bacteria 2881155292 2881158608 393
227 iso_pu_bacteria 2904578770 2904579223 393
228 iso_pu_bacteria 2919119836 2919121951 393
229 iso_pu_bacteria 2919450847 2919454740 393
230 iso_pu_bacteria 2970524798 2970525411 393
231 iso_pu_bacteria 8001845381 8001850379 393
232 3300001979 JGI24740J21852_10009741 JGI24740J21852_100097413 394
233 3300003762 Ga0055542_1000656 Ga0055542_10006565 394
234 3300005327 Ga0070658_10152185 Ga0070658_101521851 394
235 3300005335 Ga0070666_10000553 Ga0070666_1000055324 394
236 3300005341 Ga0070691_10000365 Ga0070691_1000036511 394
237 3300005367 Ga0070667_100118289 Ga0070667_1001182893 394
238 3300005434 Ga0070709_10000576 Ga0070709_1000057613 394
239 3300005436 Ga0070713_100000001 Ga0070713_100000001223 394
240 3300005436 Ga0070713_100064354 Ga0070713_1000643543 394
241 3300005439 Ga0070711_100036630 Ga0070711_1000366302 394
242 3300005440 Ga0070705_100062301 Ga0070705_1000623012 394
243 3300005539 Ga0068853_100007961 Ga0068853_1000079612 394
244 3300005539 Ga0068853_100143915 Ga0068853_1001439151 394
245 3300005545 Ga0070695_100165865 Ga0070695_1001658651 394
246 3300005563 Ga0068855_100077395 Ga0068855_1000773954 394
247 3300005577 Ga0068857_100000759 Ga0068857_1000007596 394
248 3300005614 Ga0068856_100001359 Ga0068856_10000135919 394
249 3300005614 Ga0068856_100030985 Ga0068856_1000309852 394
250 3300005983 Ga0081540_1000198 Ga0081540_100019852 394
251 3300005983 Ga0081540_1004695 Ga0081540_100469511 394
252 3300006028 Ga0070717_10108949 Ga0070717_101089492 394
253 3300006038 Ga0075365_10010355 Ga0075365_100103552 394
254 3300006163 Ga0070715_10005811 Ga0070715_100058114 394
255 3300006175 Ga0070712_100000209 Ga0070712_10000020928 394
256 3300006175 Ga0070712_100000761 Ga0070712_10000076115 394
257 3300006237 Ga0097621_100167935 Ga0097621_1001679351 394
258 3300006353 Ga0075370_10072641 Ga0075370_100726412 394
259 3300006871 Ga0075434_100052989 Ga0075434_1000529894 394
260 3300006914 Ga0075436_100000553 Ga0075436_1000005532 394
261 3300009093 Ga0105240_10032211 Ga0105240_100322113 394
262 3300009147 Ga0114129_10042413 Ga0114129_100424134 394
263 3300009174 Ga0105241_10068495 Ga0105241_100684953 394
264 3300009545 Ga0105237_10050169 Ga0105237_100501693 394
265 3300009551 Ga0105238_10007409 Ga0105238_100074097 394
266 3300010375 Ga0105239_10031843 Ga0105239_100318436 394
267 3300010375 Ga0105239_10127764 Ga0105239_101277641 394
268 3300013100 Ga0157373_10019637 Ga0157373_100196373 394
269 3300013104 Ga0157370_10035418 Ga0157370_100354183 394
270 3300013104 Ga0157370_10054783 Ga0157370_100547833 394
271 3300013105 Ga0157369_10004483 Ga0157369_1000448314 394
272 3300013105 Ga0157369_10114752 Ga0157369_101147523 394
273 3300013296 Ga0157374_10115241 Ga0157374_101152413 394
274 3300013307 Ga0157372_10135408 Ga0157372_101354083 394
275 3300014968 Ga0157379_10001102 Ga0157379_100011023 394
276 3300014968 Ga0157379_10002471 Ga0157379_1000247114 394
277 3300014968 Ga0157379_10026550 Ga0157379_100265504 394
278 3300021388 Ga0213875_10000011 Ga0213875_1000001185 394
279 3300025250 Ga0209026_1000013 Ga0209026_100001376 394
280 3300025254 Ga0209148_1000210 Ga0209148_100021053 394
281 3300025256 Ga0209759_1000884 Ga0209759_10008845 394
282 3300025261 Ga0209233_1000034 Ga0209233_1000034500 394
283 3300025261 Ga0209233_1002951 Ga0209233_10029512 394
284 3300025272 Ga0209455_1000098 Ga0209455_100009840 394
285 3300025297 Ga0209758_1008479 Ga0209758_10084793 394
286 3300025898 Ga0207692_10062198 Ga0207692_100621982 394
287 3300025903 Ga0207680_10002983 Ga0207680_100029834 394
288 3300025906 Ga0207699_10000445 Ga0207699_1000044513 394
289 3300025909 Ga0207705_10107507 Ga0207705_101075071 394
290 3300025911 Ga0207654_10175922 Ga0207654_101759221 394
291 3300025913 Ga0207695_10040856 Ga0207695_100408562 394
292 3300025914 Ga0207671_10009356 Ga0207671_100093566 394
293 3300025914 Ga0207671_10032293 Ga0207671_100322933 394
294 3300025915 Ga0207693_10000116 Ga0207693_1000011624 394
295 3300025915 Ga0207693_10000456 Ga0207693_1000045630 394
296 3300025916 Ga0207663_10032768 Ga0207663_100327682 394
297 3300025919 Ga0207657_10033134 Ga0207657_100331343 394
298 3300025924 Ga0207694_10014401 Ga0207694_100144012 394
299 3300025928 Ga0207700_10000015 Ga0207700_1000001543 394
300 3300025939 Ga0207665_10099454 Ga0207665_100994542 394
301 3300025949 Ga0207667_10005157 Ga0207667_1000515710 394
302 3300025986 Ga0207658_10021972 Ga0207658_100219724 394
303 3300026035 Ga0207703_10087603 Ga0207703_100876033 394
304 3300026041 Ga0207639_10011429 Ga0207639_100114293 394
305 3300026078 Ga0207702_10000011 Ga0207702_1000001138 394
306 3300026116 Ga0207674_10000002 Ga0207674_1000000240 394
307 3300026116 Ga0207674_10092342 Ga0207674_100923422 394
308 3300028381 Ga0268264_10000049 Ga0268264_10000049113 394
309 3300028786 Ga0307517_10120123 Ga0307517_101201232 394
310 3300028800 Ga0265338_10064975 Ga0265338_100649753 394
311 3300031240 Ga0265320_10007384 Ga0265320_100073845 394
312 3300031241 Ga0265325_10000284 Ga0265325_1000028427 394
313 3300031241 Ga0265325_10036941 Ga0265325_100369412 394
314 3300031247 Ga0265340_10025417 Ga0265340_100254172 394
315 3300031344 Ga0265316_10029060 Ga0265316_100290601 394
316 3300031456 Ga0307513_10136119 Ga0307513_101361192 394
317 3300031595 Ga0265313_10001568 Ga0265313_100015689 394
318 3300035112 Ga0373932_0005447 Ga0373932_0005447_992_2197 394
319 3300035172 Ga0373955_0004309 Ga0373955_0004309_1896_3101 394
320 3300035695 Ga0373927_0122419 Ga0373927_0122419_28_1224 394
321 3300035724 Ga0373933_0029509 Ga0373933_0029509_97_1302 394
322 3300036401 Ga0373937_0004939 Ga0373937_0004939_4775_5980 394
323 3300037068 Ga0373925_0018623 Ga0373925_0018623_3509_4705 394
324 3300037418 Ga0395900_0145731 Ga0395900_0145731_60_1259 394
325 3300037471 Ga0395905_0064872 Ga0395905_0064872_501_1700 394
326 3300037853 Ga0436364_0102623 Ga0436364_0102623_11472_12656 394
327 3300038443 Ga0395901_0019029 Ga0395901_0019029_5291_6490 394
328 3300039437 Ga0436365_0144792 Ga0436365_0144792_176_1360 394
329 3300039437 Ga0436365_1287068 Ga0436365_1287068_3685_4869 394
330 3300044901 Ga0466960_0051111 Ga0466960_0051111_150_1349 394
331 3300046520 Ga0495637_0038417 Ga0495637_0038417_725_1924 394
332 3300046689 Ga0495613_0118370 Ga0495613_0118370_354_1550 394
333 3300047321 Ga0495676_0102964 Ga0495676_0102964_468_1664 394
334 3300047469 Ga0495673_0057840 Ga0495673_0057840_199_1437 394
335 3300048917 Ga0496114_0293092 Ga0496114_0293092_50_1249 394
336 3300048918 Ga0496115_0104977 Ga0496115_0104977_892_2091 394
337 3300048922 Ga0496119_0010822 Ga0496119_0010822_3364_4563 394
338 3300048922 Ga0496119_0048937 Ga0496119_0048937_981_2180 394
339 3300048923 Ga0496120_0002411 Ga0496120_0002411_6155_7354 394
340 3300048926 Ga0496123_0025579 Ga0496123_0025579_3193_4404 394
341 3300048928 Ga0496125_0090135 Ga0496125_0090135_168_1367 394
342 3300048929 Ga0496126_0081369 Ga0496126_0081369_1469_2668 394
343 3300049569 Ga0501032_0013159 Ga0501032_0013159_2419_3603 394
344 3300049571 Ga0501034_0014022 Ga0501034_0014022_7048_8232 394
345 3300049571 Ga0501034_0079523 Ga0501034_0079523_1924_3120 394
346 3300049571 Ga0501034_0332453 Ga0501034_0332453_76_1272 394
347 3300049572 Ga0501036_0000325 Ga0501036_0000325_29963_31147 394
348 3300049572 Ga0501036_0071491 Ga0501036_0071491_1309_2505 394
349 3300049573 Ga0501037_0003704 Ga0501037_0003704_394_1578 394
350 3300049573 Ga0501037_0243645 Ga0501037_0243645_49_1233 394
351 3300049574 Ga0501038_0031651 Ga0501038_0031651_1231_2415 394
352 3300049574 Ga0501038_0258191 Ga0501038_0258191_25_1254 394
353 3300049575 Ga0501039_0032824 Ga0501039_0032824_1046_2230 394
354 3300049575 Ga0501039_0171629 Ga0501039_0171629_120_1385 394
355 3300049579 Ga0501043_0059469 Ga0501043_0059469_659_1855 394
356 3300049579 Ga0501043_0129304 Ga0501043_0129304_454_1638 394
357 3300049580 Ga0501046_0035041 Ga0501046_0035041_1975_3252 394
358 3300049580 Ga0501046_0056431 Ga0501046_0056431_751_1947 394
359 3300049581 Ga0501047_0000161 Ga0501047_0000161_35627_36811 394
360 3300049581 Ga0501047_0019360 Ga0501047_0019360_3016_4293 394
361 3300049581 Ga0501047_0023641 Ga0501047_0023641_412_1656 394
362 3300049581 Ga0501047_0033103 Ga0501047_0033103_2947_4143 394
363 3300049581 Ga0501047_0039906 Ga0501047_0039906_1499_2683 394
364 3300049582 Ga0501048_0000030 Ga0501048_0000030_23366_24550 394
365 3300049585 Ga0501069_0011343 Ga0501069_0011343_1747_2943 394
366 3300049585 Ga0501069_0154820 Ga0501069_0154820_108_1304 394
367 3300049586 Ga0501070_0032671 Ga0501070_0032671_2948_4147 394
368 3300049586 Ga0501070_0033572 Ga0501070_0033572_189_1373 394
369 3300049586 Ga0501070_0079930 Ga0501070_0079930_773_2038 394
370 3300049586 Ga0501070_0144139 Ga0501070_0144139_451_1647 394
371 3300049587 Ga0501071_0030168 Ga0501071_0030168_427_1626 394
372 3300049588 Ga0501072_0229405 Ga0501072_0229405_207_1406 394
373 3300049589 Ga0501073_0220938 Ga0501073_0220938_42_1238 394
374 3300049590 Ga0501074_0058536 Ga0501074_0058536_1162_2358 394
375 3300049742 Ga0501080_0000181 Ga0501080_0000181_41824_43008 394
376 3300049742 Ga0501080_0019895 Ga0501080_0019895_1796_3061 394
377 3300049742 Ga0501080_0226309 Ga0501080_0226309_350_1546 394
378 3300049744 Ga0501083_0000423 Ga0501083_0000423_13672_14856 394
379 3300049822 Ga0501035_0003189 Ga0501035_0003189_2863_4092 394
380 3300049822 Ga0501035_0015336 Ga0501035_0015336_967_2163 394
381 3300049822 Ga0501035_0035579 Ga0501035_0035579_2808_4004 394
382 3300049822 Ga0501035_0252063 Ga0501035_0252063_66_1265 394
383 3300049823 Ga0501044_0010067 Ga0501044_0010067_2056_3240 394
384 3300049823 Ga0501044_0021180 Ga0501044_0021180_3589_4785 394
385 3300049823 Ga0501044_0031202 Ga0501044_0031202_837_2036 394
386 3300049823 Ga0501044_0040588 Ga0501044_0040588_2687_3883 394
387 3300050490 nmdc:mga03n38_50036_c1 nmdc:mga03n38_50036_c1_72_1271 394
388 3300050492 nmdc:mga0yw44_22217_c1 nmdc:mga0yw44_22217_c1_822_2021 394
389 3300050496 nmdc:mga07m45_32041_c1 nmdc:mga07m45_32041_c1_930_2129 394
390 3300050512 nmdc:mga0n895_45575_c1 nmdc:mga0n895_45575_c1_802_2007 394
391 3300050513 nmdc:mga0rr50_46435_c1 nmdc:mga0rr50_46435_c1_789_1979 394
392 3300050514 nmdc:mga08x19_381_c1 nmdc:mga08x19_381_c1_29777_30982 394
393 3300053077 Ga0495601_0024295 Ga0495601_0024295_460_1656 394
394 3300054114 Ga0501084_0058772 Ga0501084_0058772_1772_2968 394
395 3300060353 Ga0501082_0252635 Ga0501082_0252635_251_1516 394
396 iso_pu_bacteria 2513237351 2514587894 394
397 iso_pu_bacteria 2534681786 2535484078 394
398 iso_pu_bacteria 2751185800 2753358638 394
399 iso_pu_bacteria 2758568016 2758640877 394
400 iso_pu_bacteria 2854911287 2854914205 394
401 iso_pu_bacteria 2917554339 2917557940 394
402 3300003215 JGI25153J46596_10010198 JGI25153J46596_100101983 395
403 3300005344 Ga0070661_100217158 Ga0070661_1002171581 395
404 3300005437 Ga0070710_10050502 Ga0070710_100505022 395
405 3300005455 Ga0070663_100022329 Ga0070663_1000223294 395
406 3300005455 Ga0070663_100062402 Ga0070663_1000624023 395
407 3300005981 Ga0081538_10002248 Ga0081538_100022482 395
408 3300005983 Ga0081540_1034735 Ga0081540_10347352 395
409 3300006038 Ga0075365_10002773 Ga0075365_100027735 395
410 3300006178 Ga0075367_10059102 Ga0075367_100591022 395
411 3300006237 Ga0097621_100102038 Ga0097621_1001020381 395
412 3300006844 Ga0075428_100271043 Ga0075428_1002710432 395
413 3300006846 Ga0075430_100159477 Ga0075430_1001594772 395
414 3300009093 Ga0105240_10012113 Ga0105240_100121138 395
415 3300009101 Ga0105247_10069631 Ga0105247_100696312 395
416 3300009147 Ga0114129_10188445 Ga0114129_101884452 395
417 3300009148 Ga0105243_10076590 Ga0105243_100765902 395
418 3300009174 Ga0105241_10015454 Ga0105241_100154542 395
419 3300009545 Ga0105237_10007920 Ga0105237_100079208 395
420 3300010159 Ga0099796_10022083 Ga0099796_100220832 395
421 3300025254 Ga0209148_1001144 Ga0209148_100114411 395
422 3300025295 Ga0209564_1011770 Ga0209564_10117702 395
423 3300025297 Ga0209758_1001131 Ga0209758_100113128 395
424 3300025299 Ga0209256_1017679 Ga0209256_10176792 395
425 3300025302 Ga0207426_1001988 Ga0207426_10019888 395
426 3300025913 Ga0207695_10000065 Ga0207695_1000006599 395
427 3300025914 Ga0207671_10003508 Ga0207671_100035085 395
428 3300025919 Ga0207657_10050538 Ga0207657_100505382 395
429 3300025928 Ga0207700_10028241 Ga0207700_100282414 395
430 3300026067 Ga0207678_10012607 Ga0207678_100126075 395
431 3300026067 Ga0207678_10073972 Ga0207678_100739722 395
432 3300026142 Ga0207698_10026641 Ga0207698_100266414 395
433 3300031090 Ga0265760_10044243 Ga0265760_100442432 395
434 3300031241 Ga0265325_10027457 Ga0265325_100274573 395
435 3300031241 Ga0265325_10032841 Ga0265325_100328411 395
436 3300031507 Ga0307509_10143226 Ga0307509_101432262 395
437 3300031711 Ga0265314_10001380 Ga0265314_1000138019 395
438 3300031711 Ga0265314_10005008 Ga0265314_1000500813 395
439 3300031712 Ga0265342_10031511 Ga0265342_100315113 395
440 3300034817 Ga0373948_0007378 Ga0373948_0007378_149_1342 395
441 3300035083 Ga0373926_0006714 Ga0373926_0006714_1022_2215 395
442 3300035085 Ga0373929_0004452 Ga0373929_0004452_1128_2315 395
443 3300035086 Ga0373934_0036506 Ga0373934_0036506_345_1538 395
444 3300035091 Ga0373951_0006037 Ga0373951_0006037_1178_2365 395
445 3300035092 Ga0373952_0003873 Ga0373952_0003873_597_1784 395
446 3300035111 Ga0373923_0004482 Ga0373923_0004482_2939_4132 395
447 3300035113 Ga0373936_0001859 Ga0373936_0001859_4770_5963 395
448 3300035116 Ga0373945_0035932 Ga0373945_0035932_177_1364 395
449 3300035117 Ga0373953_0003642 Ga0373953_0003642_1005_2198 395
450 3300035118 Ga0373954_0002889 Ga0373954_0002889_3448_4641 395
451 3300035119 Ga0373956_0045994 Ga0373956_0045994_732_1925 395
452 3300035120 Ga0373957_0010402 Ga0373957_0010402_781_1974 395
453 3300035121 Ga0373960_0022035 Ga0373960_0022035_336_1523 395
454 3300035170 Ga0373943_0008091 Ga0373943_0008091_2803_3996 395
455 3300035170 Ga0373943_0048476 Ga0373943_0048476_880_2067 395
456 3300035171 Ga0373946_0059967 Ga0373946_0059967_210_1397 395
457 3300035172 Ga0373955_0000333 Ga0373955_0000333_16574_17767 395
458 3300035207 Ga0373942_0006047 Ga0373942_0006047_693_1880 395
459 3300035410 Ga0373924_0000516 Ga0373924_0000516_9216_10409 395
460 3300035691 Ga0373931_0130944 Ga0373931_0130944_209_1402 395
461 3300035692 Ga0373935_0000097 Ga0373935_0000097_6031_7224 395
462 3300035692 Ga0373935_0018255 Ga0373935_0018255_2881_4068 395
463 3300035695 Ga0373927_0004347 Ga0373927_0004347_5794_6981 395
464 3300035695 Ga0373927_0054956 Ga0373927_0054956_1026_2219 395
465 3300035724 Ga0373933_0011488 Ga0373933_0011488_2596_3789 395
466 3300035725 Ga0373947_0000353 Ga0373947_0000353_8812_10005 395
467 3300035725 Ga0373947_0023187 Ga0373947_0023187_513_1700 395
468 3300036401 Ga0373937_0000006 Ga0373937_0000006_27488_28681 395
469 3300037068 Ga0373925_0000002 Ga0373925_0000002_159064_160257 395
470 3300037068 Ga0373925_0004479 Ga0373925_0004479_7286_8473 395
471 3300037068 Ga0373925_0021539 Ga0373925_0021539_2362_3555 395
472 3300037068 Ga0373925_0094225 Ga0373925_0094225_958_2151 395
473 3300038705 Ga0237819_02188 Ga0237819_02188_316_1527 395
474 3300039437 Ga0436365_0404467 Ga0436365_0404467_1214_2407 395
475 3300039450 Ga0436363_0184239 Ga0436363_0184239_180_1400 395
476 3300044684 Ga0466966_0001410 Ga0466966_0001410_2780_4195 395
477 3300044693 Ga0466961_0000126 Ga0466961_0000126_47771_49186 395
478 3300045049 Ga0466959_0005140 Ga0466959_0005140_3854_5269 395
479 3300045976 Ga0466967_0008187 Ga0466967_0008187_3385_4587 395
480 3300046454 Ga0495592_0000039 Ga0495592_0000039_32310_33503 395
481 3300046455 Ga0495603_0005315 Ga0495603_0005315_180_1367 395
482 3300046459 Ga0495629_0000393 Ga0495629_0000393_15554_16741 395
483 3300046459 Ga0495629_0008058 Ga0495629_0008058_3389_4582 395
484 3300046459 Ga0495629_0035381 Ga0495629_0035381_319_1521 395
485 3300046462 Ga0495651_0000376 Ga0495651_0000376_31178_32371 395
486 3300046462 Ga0495651_0113964 Ga0495651_0113964_705_1907 395
487 3300046463 Ga0495653_0000006 Ga0495653_0000006_159212_160405 395
488 3300046473 Ga0495582_0003398 Ga0495582_0003398_410_1597 395
489 3300046476 Ga0495662_0002816 Ga0495662_0002816_330_1523 395
490 3300046476 Ga0495662_0034612 Ga0495662_0034612_216_1472 395
491 3300046477 Ga0495664_0000002 Ga0495664_0000002_194846_196039 395
492 3300046477 Ga0495664_0091524 Ga0495664_0091524_519_1775 395
493 3300046507 Ga0495606_0033803 Ga0495606_0033803_1058_2260 395
494 3300046511 Ga0495608_0000006 Ga0495608_0000006_18507_19700 395
495 3300046511 Ga0495608_0066113 Ga0495608_0066113_915_2117 395
496 3300046514 Ga0495618_0000027 Ga0495618_0000027_26569_27762 395
497 3300046516 Ga0495628_0000002 Ga0495628_0000002_159231_160424 395
498 3300046516 Ga0495628_0013861 Ga0495628_0013861_443_1699 395
499 3300046517 Ga0495630_0000950 Ga0495630_0000950_15558_16751 395
500 3300046517 Ga0495630_0138326 Ga0495630_0138326_325_1578 395
501 3300046524 Ga0495648_0014403 Ga0495648_0014403_3182_4384 395
502 3300046529 Ga0495652_0000004 Ga0495652_0000004_428459_429652 395
503 3300046529 Ga0495652_0045917 Ga0495652_0045917_118_1374 395
504 3300046529 Ga0495652_0089603 Ga0495652_0089603_28_1230 395
505 3300046533 Ga0495640_0000005 Ga0495640_0000005_284411_285604 395
506 3300046533 Ga0495640_0121398 Ga0495640_0121398_51_1307 395
507 3300046536 Ga0495587_0000007 Ga0495587_0000007_32638_33831 395
508 3300046536 Ga0495587_0006228 Ga0495587_0006228_1352_2608 395
509 3300046543 Ga0495645_0000003 Ga0495645_0000003_140482_141675 395
510 3300046543 Ga0495645_0043024 Ga0495645_0043024_1195_2451 395
511 3300046559 Ga0495667_0000002 Ga0495667_0000002_277299_278492 395
512 3300046642 Ga0495634_0003380 Ga0495634_0003380_2505_3698 395
513 3300046642 Ga0495634_0102593 Ga0495634_0102593_81_1337 395
514 3300046663 Ga0495635_0000022 Ga0495635_0000022_129514_130707 395
515 3300046663 Ga0495635_0002607 Ga0495635_0002607_8840_10042 395
516 3300046675 Ga0495657_0000072 Ga0495657_0000072_19658_20851 395
517 3300046675 Ga0495657_0036223 Ga0495657_0036223_204_1460 395
518 3300046678 Ga0495599_0000001 Ga0495599_0000001_297909_299102 395
519 3300046678 Ga0495599_0017853 Ga0495599_0017853_1463_2719 395
520 3300046679 Ga0495623_0000001 Ga0495623_0000001_66854_68047 395
521 3300046679 Ga0495623_0017451 Ga0495623_0017451_1108_2364 395
522 3300046680 Ga0495646_0000014 Ga0495646_0000014_61258_62451 395
523 3300046680 Ga0495646_0138919 Ga0495646_0138919_147_1349 395
524 3300046681 Ga0495647_0002294 Ga0495647_0002294_627_1814 395
525 3300046683 Ga0495658_0001124 Ga0495658_0001124_6275_7462 395
526 3300046689 Ga0495613_0007227 Ga0495613_0007227_693_1886 395
527 3300046689 Ga0495613_0025210 Ga0495613_0025210_792_1979 395
528 3300046689 Ga0495613_0064425 Ga0495613_0064425_433_1689 395
529 3300046690 Ga0495624_0006483 Ga0495624_0006483_3911_5104 395
530 3300046690 Ga0495624_0040554 Ga0495624_0040554_782_1984 395
531 3300046809 Ga0495600_0000006 Ga0495600_0000006_28389_29582 395
532 3300046809 Ga0495600_0021283 Ga0495600_0021283_1730_2986 395
533 3300046809 Ga0495600_0056753 Ga0495600_0056753_487_1680 395
534 3300047315 Ga0495581_0003397 Ga0495581_0003397_4069_5262 395
535 3300047315 Ga0495581_0022201 Ga0495581_0022201_53_1240 395
536 3300047315 Ga0495581_0060918 Ga0495581_0060918_546_1739 395
537 3300047317 Ga0495604_0000005 Ga0495604_0000005_184875_186068 395
538 3300047317 Ga0495604_0017333 Ga0495604_0017333_2080_3336 395
539 3300047317 Ga0495604_0043219 Ga0495604_0043219_2275_3477 395
540 3300047319 Ga0495674_0000003 Ga0495674_0000003_401702_402895 395
541 3300047319 Ga0495674_0005482 Ga0495674_0005482_16_1218 395
542 3300047321 Ga0495676_0054869 Ga0495676_0054869_1065_2267 395
543 3300047321 Ga0495676_0188127 Ga0495676_0188127_205_1398 395
544 3300047322 Ga0495680_0001324 Ga0495680_0001324_755_1948 395
545 3300047322 Ga0495680_0004018 Ga0495680_0004018_7513_8769 395
546 3300047322 Ga0495680_0009502 Ga0495680_0009502_5640_6827 395
547 3300047444 Ga0495675_0000338 Ga0495675_0000338_27942_29135 395
548 3300047444 Ga0495675_0014203 Ga0495675_0014203_1261_2517 395
549 3300047471 Ga0495684_0000028 Ga0495684_0000028_89854_91047 395
550 3300047471 Ga0495684_0072989 Ga0495684_0072989_922_2178 395
551 3300047673 Ga0495593_0001828 Ga0495593_0001828_6935_8128 395
552 3300047673 Ga0495593_0006965 Ga0495593_0006965_137_1324 395
553 3300047673 Ga0495593_0028697 Ga0495593_0028697_1274_2476 395
554 3300048088 Ga0495602_0000029 Ga0495602_0000029_140374_141567 395
555 3300048088 Ga0495602_0054389 Ga0495602_0054389_41_1243 395
556 3300048904 Ga0496101_0009095 Ga0496101_0009095_211_1404 395
557 3300048904 Ga0496101_0015209 Ga0496101_0015209_3832_5019 395
558 3300048905 Ga0496102_0022318 Ga0496102_0022318_1292_2485 395
559 3300048907 Ga0496104_0002605 Ga0496104_0002605_1007_2209 395
560 3300048907 Ga0496104_0027243 Ga0496104_0027243_779_1972 395
561 3300048908 Ga0496105_0018848 Ga0496105_0018848_1048_2241 395
562 3300048908 Ga0496105_0181000 Ga0496105_0181000_320_1639 395
563 3300048909 Ga0496106_0006604 Ga0496106_0006604_6755_7942 395
564 3300048909 Ga0496106_0129975 Ga0496106_0129975_626_1819 395
565 3300048910 Ga0496107_0024303 Ga0496107_0024303_1826_3019 395
566 3300048911 Ga0496108_0003527 Ga0496108_0003527_637_1830 395
567 3300048911 Ga0496108_0025631 Ga0496108_0025631_906_2093 395
568 3300048911 Ga0496108_0128447 Ga0496108_0128447_19_1212 395
569 3300048912 Ga0496109_0000239 Ga0496109_0000239_1321_2514 395
570 3300048913 Ga0496110_0003008 Ga0496110_0003008_7636_8829 395
571 3300048913 Ga0496110_0051824 Ga0496110_0051824_566_1753 395
572 3300048914 Ga0496111_0000118 Ga0496111_0000118_1004_2197 395
573 3300048915 Ga0496112_0001834 Ga0496112_0001834_11273_12466 395
574 3300048916 Ga0496113_0002933 Ga0496113_0002933_8611_9804 395
575 3300048917 Ga0496114_0012164 Ga0496114_0012164_1417_2604 395
576 3300048917 Ga0496114_0114541 Ga0496114_0114541_811_2004 395
577 3300048918 Ga0496115_0075896 Ga0496115_0075896_317_1504 395
578 3300048918 Ga0496115_0118770 Ga0496115_0118770_16_1209 395
579 3300048923 Ga0496120_0072220 Ga0496120_0072220_599_1801 395
580 3300048927 Ga0496124_0112091 Ga0496124_0112091_446_1648 395
581 3300048928 Ga0496125_0084474 Ga0496125_0084474_222_1529 395
582 3300048928 Ga0496125_0094227 Ga0496125_0094227_577_1764 395
583 3300049569 Ga0501032_0020871 Ga0501032_0020871_28_1218 395
584 3300049572 Ga0501036_0119745 Ga0501036_0119745_476_1801 395
585 3300049575 Ga0501039_0015340 Ga0501039_0015340_1232_2557 395
586 3300049577 Ga0501041_0036215 Ga0501041_0036215_1289_2485 395
587 3300049578 Ga0501042_0095722 Ga0501042_0095722_589_1785 395
588 3300049582 Ga0501048_0153693 Ga0501048_0153693_53_1261 395
589 3300049583 Ga0501067_0024618 Ga0501067_0024618_1924_3144 395
590 3300049589 Ga0501073_0165683 Ga0501073_0165683_145_1332 395
591 3300050491 nmdc:mga00v17_71211_c1 nmdc:mga00v17_71211_c1_872_2077 395
592 3300050492 nmdc:mga0yw44_1637_c2 nmdc:mga0yw44_1637_c2_4955_6160 395
593 3300050492 nmdc:mga0yw44_99388_c1 nmdc:mga0yw44_99388_c1_597_1790 395
594 3300050496 nmdc:mga07m45_126428_c1 nmdc:mga07m45_126428_c1_101_1408 395
595 3300050507 nmdc:mga05p37_147599_c1 nmdc:mga05p37_147599_c1_969_2189 395
596 3300050507 nmdc:mga05p37_99068_c1 nmdc:mga05p37_99068_c1_867_2060 395
597 3300050508 nmdc:mga09592_250846_c1 nmdc:mga09592_250846_c1_221_1423 395
598 3300050510 nmdc:mga06r32_28286_c1 nmdc:mga06r32_28286_c1_684_1886 395
599 3300050510 nmdc:mga06r32_93470_c1 nmdc:mga06r32_93470_c1_1163_2356 395
600 3300050512 nmdc:mga0n895_38223_c1 nmdc:mga0n895_38223_c1_779_1972 395
601 3300050513 nmdc:mga0rr50_19043_c1 nmdc:mga0rr50_19043_c1_2524_3711 395
602 3300053077 Ga0495601_0000008 Ga0495601_0000008_162318_163511 395
603 3300053078 Ga0495612_0000002 Ga0495612_0000002_70827_72020 395
604 3300053084 Ga0495595_0000008 Ga0495595_0000008_162446_163639 395
605 3300053085 Ga0495619_0000002 Ga0495619_0000002_159234_160427 395
606 3300053085 Ga0495619_0000292 Ga0495619_0000292_21564_22751 395
607 3300053094 Ga0500566_0007934 Ga0500566_0007934_2610_3812 395
608 3300053119 Ga0500595_024216 Ga0500595_024216_626_1828 395
609 3300053130 Ga0500642_0000725 Ga0500642_0000725_1049_2251 395
610 3300053136 Ga0500559_0036908 Ga0500559_0036908_864_2066 395
611 3300053729 Ga0500625_002931 Ga0500625_002931_2523_3725 395
612 iso_pu_bacteria 2508501042 2508695048 395
613 iso_pu_bacteria 2513237094 2513641827 395
614 iso_pu_bacteria 2842694124 2842696105 395
615 iso_pu_bacteria 2909042592 2909042824 395
616 iso_pu_bacteria 2935648319 2935651608 395
617 iso_pu_bacteria 2935656913 2935659624 395
618 iso_pu_bacteria 2935975950 2935977992 395
619 iso_pu_bacteria 2935984226 2935984708 395
620 iso_pu_bacteria 2936011229 2936014040 395
621 iso_pu_bacteria 2936019824 2936023051 395
622 iso_pu_bacteria 2936028420 2936031187 395
623 iso_pu_bacteria 2936046547 2936049309 395
624 iso_pu_bacteria 2936055302 2936055878 395
625 iso_pu_bacteria 2941531003 2941532272 395
626 iso_pu_bacteria 3005718088 3005724874 395
627 iso_pu_bacteria 8016630954 8016636173 395
628 iso_pu_bacteria 8019619141 8019622458 395
629 iso_pu_bacteria 8019629233 8019630658 395
630 iso_pu_bacteria 8019638758 8019639962 395
631 iso_pu_bacteria 8019678201 8019678734 395
632 3300002987 JGI25159J45721_1011968 JGI25159J45721_10119681 396
633 3300003187 JGI25151J46595_10000030 JGI25151J46595_10000030182 396
634 3300003203 JGI25406J46586_10020200 JGI25406J46586_100202002 396
635 3300003659 JGI25404J52841_10013749 JGI25404J52841_100137491 396
636 3300003775 Ga0055524_1000189 Ga0055524_100018930 396
637 3300005262 Ga0065165_1000229 Ga0065165_100022954 396
638 3300005327 Ga0070658_10060898 Ga0070658_100608983 396
639 3300005330 Ga0070690_100079136 Ga0070690_1000791361 396
640 3300005336 Ga0070680_100080629 Ga0070680_1000806292 396
641 3300005337 Ga0070682_100201894 Ga0070682_1002018941 396
642 3300005435 Ga0070714_100029247 Ga0070714_1000292471 396
643 3300005436 Ga0070713_100005333 Ga0070713_1000053337 396
644 3300005436 Ga0070713_100060850 Ga0070713_1000608501 396
645 3300005436 Ga0070713_100072684 Ga0070713_1000726842 396
646 3300005439 Ga0070711_100227968 Ga0070711_1002279681 396
647 3300005458 Ga0070681_10023118 Ga0070681_100231181 396
648 3300005458 Ga0070681_10025706 Ga0070681_100257063 396
649 3300005530 Ga0070679_100045573 Ga0070679_1000455735 396
650 3300005530 Ga0070679_100114326 Ga0070679_1001143261 396
651 3300005535 Ga0070684_100001316 Ga0070684_1000013167 396
652 3300005843 Ga0068860_100238781 Ga0068860_1002387812 396
653 3300005983 Ga0081540_1003995 Ga0081540_10039957 396
654 3300005985 Ga0081539_10000902 Ga0081539_100009022 396
655 3300006028 Ga0070717_10223673 Ga0070717_102236732 396
656 3300006048 Ga0075363_100073361 Ga0075363_1000733611 396
657 3300006048 Ga0075363_100124163 Ga0075363_1001241631 396
658 3300006175 Ga0070712_100052641 Ga0070712_1000526412 396
659 3300006178 Ga0075367_10037023 Ga0075367_100370232 396
660 3300006186 Ga0075369_10033540 Ga0075369_100335402 396
661 3300006914 Ga0075436_100045817 Ga0075436_1000458172 396
662 3300009094 Ga0111539_10088469 Ga0111539_100884692 396
663 3300009147 Ga0114129_10013510 Ga0114129_100135109 396
664 3300009545 Ga0105237_10049458 Ga0105237_100494583 396
665 3300009551 Ga0105238_10072323 Ga0105238_100723233 396
666 3300010375 Ga0105239_10182571 Ga0105239_101825712 396
667 3300013307 Ga0157372_10122943 Ga0157372_101229432 396
668 3300014969 Ga0157376_10219367 Ga0157376_102193672 396
669 3300021384 Ga0213876_10009014 Ga0213876_100090141 396
670 3300025284 Ga0209130_1000045 Ga0209130_100004535 396
671 3300025294 Ga0209025_1000063 Ga0209025_100006343 396
672 3300025294 Ga0209025_1003689 Ga0209025_10036898 396
673 3300025295 Ga0209564_1000076 Ga0209564_1000076258 396
674 3300025299 Ga0209256_1000316 Ga0209256_100031638 396
675 3300025302 Ga0207426_1000832 Ga0207426_10008328 396
676 3300025906 Ga0207699_10012908 Ga0207699_100129082 396
677 3300025912 Ga0207707_10025019 Ga0207707_100250196 396
678 3300025915 Ga0207693_10068994 Ga0207693_100689942 396
679 3300025919 Ga0207657_10011826 Ga0207657_100118262 396
680 3300025921 Ga0207652_10078382 Ga0207652_100783823 396
681 3300025921 Ga0207652_10131285 Ga0207652_101312852 396
682 3300025924 Ga0207694_10045896 Ga0207694_100458962 396
683 3300025928 Ga0207700_10131166 Ga0207700_101311662 396
684 3300025928 Ga0207700_10213289 Ga0207700_102132892 396
685 3300025929 Ga0207664_10093443 Ga0207664_100934432 396
686 3300025929 Ga0207664_10097583 Ga0207664_100975832 396
687 3300025944 Ga0207661_10002892 Ga0207661_100028927 396
688 3300026095 Ga0207676_10138311 Ga0207676_101383112 396
689 3300026116 Ga0207674_10384555 Ga0207674_103845551 396
690 3300028379 Ga0268266_10145092 Ga0268266_101450922 396
691 3300035088 Ga0373940_0036621 Ga0373940_0036621_94_1305 396
692 3300035089 Ga0373944_0009076 Ga0373944_0009076_366_1556 396
693 3300035111 Ga0373923_0000567 Ga0373923_0000567_6249_7439 396
694 3300035113 Ga0373936_0001380 Ga0373936_0001380_4305_5495 396
695 3300035118 Ga0373954_0043580 Ga0373954_0043580_480_1670 396
696 3300035119 Ga0373956_0012241 Ga0373956_0012241_569_1759 396
697 3300035170 Ga0373943_0019686 Ga0373943_0019686_954_2144 396
698 3300035172 Ga0373955_0002729 Ga0373955_0002729_11_1201 396
699 3300035410 Ga0373924_0015001 Ga0373924_0015001_556_1746 396
700 3300035691 Ga0373931_0007322 Ga0373931_0007322_2382_3593 396
701 3300035724 Ga0373933_0016841 Ga0373933_0016841_1799_2989 396
702 3300035725 Ga0373947_0088393 Ga0373947_0088393_202_1392 396
703 3300039437 Ga0436365_0274689 Ga0436365_0274689_1893_3179 396
704 3300039437 Ga0436365_1482914 Ga0436365_1482914_644_1858 396
705 3300039437 Ga0436365_1852558 Ga0436365_1852558_6015_7220 396
706 3300039438 Ga0436360_0683827 Ga0436360_0683827_374_1582 396
707 3300039438 Ga0436360_0706927 Ga0436360_0706927_935_2143 396
708 3300039438 Ga0436360_0922836 Ga0436360_0922836_1425_2633 396
709 3300039447 Ga0436361_0296943 Ga0436361_0296943_519_1781 396
710 3300039447 Ga0436361_0766127 Ga0436361_0766127_548_1756 396
711 3300039450 Ga0436363_0135568 Ga0436363_0135568_253_1461 396
712 3300039450 Ga0436363_0191652 Ga0436363_0191652_371_1579 396
713 3300039453 Ga0436362_0935373 Ga0436362_0935373_351_1637 396
714 3300044658 Ga0466972_0002054 Ga0466972_0002054_7396_8601 396
715 3300044694 Ga0466963_0129265 Ga0466963_0129265_336_1544 396
716 3300044842 Ga0466957_0125695 Ga0466957_0125695_40_1239 396
717 3300045836 Ga0466958_0021830 Ga0466958_0021830_2319_3518 396
718 3300045976 Ga0466967_0052839 Ga0466967_0052839_1819_3027 396
719 3300046452 Ga0495617_007369 Ga0495617_007369_2381_3571 396
720 3300046454 Ga0495592_0036153 Ga0495592_0036153_704_1894 396
721 3300046459 Ga0495629_0017359 Ga0495629_0017359_671_1861 396
722 3300046462 Ga0495651_0002916 Ga0495651_0002916_8008_9198 396
723 3300046463 Ga0495653_0005424 Ga0495653_0005424_960_2150 396
724 3300046475 Ga0495639_0011855 Ga0495639_0011855_798_1988 396
725 3300046477 Ga0495664_0016446 Ga0495664_0016446_1558_2748 396
726 3300046477 Ga0495664_0023237 Ga0495664_0023237_1065_2270 396
727 3300046492 Ga0495585_0001185 Ga0495585_0001185_15280_16470 396
728 3300046501 Ga0495607_0002979 Ga0495607_0002979_6452_7642 396
729 3300046517 Ga0495630_0057681 Ga0495630_0057681_1297_2487 396
730 3300046520 Ga0495637_0025272 Ga0495637_0025272_1308_2498 396
731 3300046523 Ga0495644_0005612 Ga0495644_0005612_3693_4883 396
732 3300046526 Ga0495666_0034562 Ga0495666_0034562_316_1506 396
733 3300046529 Ga0495652_0089350 Ga0495652_0089350_76_1266 396
734 3300046531 Ga0495665_0014448 Ga0495665_0014448_1368_2558 396
735 3300046537 Ga0495598_0000728 Ga0495598_0000728_498_1688 396
736 3300046543 Ga0495645_0003676 Ga0495645_0003676_7932_9137 396
737 3300046557 Ga0495622_0017818 Ga0495622_0017818_547_1737 396
738 3300046558 Ga0495633_0001515 Ga0495633_0001515_3662_4852 396
739 3300046615 Ga0495656_0007156 Ga0495656_0007156_2043_3233 396
740 3300046663 Ga0495635_0024366 Ga0495635_0024366_1785_2975 396
741 3300046664 Ga0495659_0004573 Ga0495659_0004573_2424_3614 396
742 3300046665 Ga0495661_0094072 Ga0495661_0094072_414_1604 396
743 3300046674 Ga0495588_0003439 Ga0495588_0003439_27_1217 396
744 3300046690 Ga0495624_0055630 Ga0495624_0055630_326_1516 396
745 3300046691 Ga0495670_0000124 Ga0495670_0000124_20016_21206 396
746 3300046809 Ga0495600_0002118 Ga0495600_0002118_960_2150 396
747 3300047320 Ga0495672_0011537 Ga0495672_0011537_2678_3889 396
748 3300047471 Ga0495684_0007703 Ga0495684_0007703_1322_2512 396
749 3300047673 Ga0495593_0003570 Ga0495593_0003570_1599_2789 396
750 3300048904 Ga0496101_0017029 Ga0496101_0017029_2348_3559 396
751 3300048905 Ga0496102_0033844 Ga0496102_0033844_1017_2228 396
752 3300048906 Ga0496103_0021398 Ga0496103_0021398_597_1808 396
753 3300048907 Ga0496104_0004487 Ga0496104_0004487_5441_6667 396
754 3300048907 Ga0496104_0047328 Ga0496104_0047328_1442_2653 396
755 3300048907 Ga0496104_0121078 Ga0496104_0121078_21_1244 396
756 3300048907 Ga0496104_0190625 Ga0496104_0190625_331_1545 396
757 3300048908 Ga0496105_0000058 Ga0496105_0000058_72424_73743 396
758 3300048908 Ga0496105_0019261 Ga0496105_0019261_512_1738 396
759 3300048908 Ga0496105_0026465 Ga0496105_0026465_1871_3082 396
760 3300048908 Ga0496105_0099239 Ga0496105_0099239_717_1925 396
761 3300048909 Ga0496106_0105601 Ga0496106_0105601_864_2075 396
762 3300048911 Ga0496108_0102410 Ga0496108_0102410_996_2207 396
763 3300048913 Ga0496110_0003749 Ga0496110_0003749_9178_10404 396
764 3300048913 Ga0496110_0112205 Ga0496110_0112205_207_1403 396
765 3300048914 Ga0496111_0026276 Ga0496111_0026276_1801_3012 396
766 3300048915 Ga0496112_0008354 Ga0496112_0008354_1086_2312 396
767 3300048915 Ga0496112_0050952 Ga0496112_0050952_2497_3708 396
768 3300048916 Ga0496113_0093271 Ga0496113_0093271_760_1971 396
769 3300048917 Ga0496114_0081679 Ga0496114_0081679_659_1870 396
770 3300048918 Ga0496115_0039884 Ga0496115_0039884_495_1718 396
771 3300048918 Ga0496115_0106723 Ga0496115_0106723_457_1668 396
772 3300048918 Ga0496115_0152078 Ga0496115_0152078_169_1377 396
773 3300048920 Ga0496117_0054529 Ga0496117_0054529_214_1434 396
774 3300048922 Ga0496119_0001924 Ga0496119_0001924_4100_5323 396
775 3300048922 Ga0496119_0093812 Ga0496119_0093812_257_1483 396
776 3300048924 Ga0496121_0000416 Ga0496121_0000416_39905_41113 396
777 3300048924 Ga0496121_0056166 Ga0496121_0056166_1014_2237 396
778 3300048925 Ga0496122_0015013 Ga0496122_0015013_5060_6280 396
779 3300048925 Ga0496122_0085383 Ga0496122_0085383_55_1278 396
780 3300049569 Ga0501032_0000150 Ga0501032_0000150_51620_52945 396
781 3300049569 Ga0501032_0028739 Ga0501032_0028739_1898_3109 396
782 3300049570 Ga0501033_0000202 Ga0501033_0000202_12219_13544 396
783 3300049570 Ga0501033_0082354 Ga0501033_0082354_691_1902 396
784 3300049571 Ga0501034_0000113 Ga0501034_0000113_59169_60494 396
785 3300049571 Ga0501034_0072143 Ga0501034_0072143_458_1669 396
786 3300049571 Ga0501034_0282102 Ga0501034_0282102_228_1439 396
787 3300049572 Ga0501036_0000059 Ga0501036_0000059_27457_28782 396
788 3300049572 Ga0501036_0062812 Ga0501036_0062812_710_1921 396
789 3300049573 Ga0501037_0000270 Ga0501037_0000270_20365_21690 396
790 3300049573 Ga0501037_0056785 Ga0501037_0056785_1584_2795 396
791 3300049574 Ga0501038_0000774 Ga0501038_0000774_7171_8496 396
792 3300049574 Ga0501038_0005755 Ga0501038_0005755_358_1626 396
793 3300049574 Ga0501038_0048960 Ga0501038_0048960_124_1335 396
794 3300049574 Ga0501038_0097278 Ga0501038_0097278_710_1921 396
795 3300049575 Ga0501039_0000067 Ga0501039_0000067_28892_30217 396
796 3300049575 Ga0501039_0095111 Ga0501039_0095111_710_1921 396
797 3300049579 Ga0501043_0000017 Ga0501043_0000017_36649_37974 396
798 3300049579 Ga0501043_0075762 Ga0501043_0075762_239_1450 396
799 3300049579 Ga0501043_0122728 Ga0501043_0122728_32_1243 396
800 3300049580 Ga0501046_0134278 Ga0501046_0134278_45_1253 396
801 3300049580 Ga0501046_0192746 Ga0501046_0192746_160_1371 396
802 3300049580 Ga0501046_0204440 Ga0501046_0204440_178_1407 396
803 3300049581 Ga0501047_0000181 Ga0501047_0000181_6769_8094 396
804 3300049581 Ga0501047_0005309 Ga0501047_0005309_2892_4100 396
805 3300049581 Ga0501047_0078506 Ga0501047_0078506_112_1380 396
806 3300049581 Ga0501047_0084045 Ga0501047_0084045_663_1874 396
807 3300049582 Ga0501048_0000127 Ga0501048_0000127_21248_22573 396
808 3300049582 Ga0501048_0028240 Ga0501048_0028240_865_2076 396
809 3300049582 Ga0501048_0198303 Ga0501048_0198303_17_1225 396
810 3300049583 Ga0501067_0000196 Ga0501067_0000196_31006_32331 396
811 3300049583 Ga0501067_0039354 Ga0501067_0039354_1408_2607 396
812 3300049584 Ga0501068_0001466 Ga0501068_0001466_5732_7057 396
813 3300049585 Ga0501069_0011292 Ga0501069_0011292_916_2124 396
814 3300049585 Ga0501069_0027081 Ga0501069_0027081_959_2170 396
815 3300049586 Ga0501070_0006401 Ga0501070_0006401_2660_3985 396
816 3300049586 Ga0501070_0069573 Ga0501070_0069573_299_1507 396
817 3300049586 Ga0501070_0116735 Ga0501070_0116735_30_1238 396
818 3300049587 Ga0501071_0091217 Ga0501071_0091217_960_2168 396
819 3300049588 Ga0501072_0000275 Ga0501072_0000275_2421_3746 396
820 3300049588 Ga0501072_0012929 Ga0501072_0012929_3084_4295 396
821 3300049589 Ga0501073_0000069 Ga0501073_0000069_54897_56222 396
822 3300049589 Ga0501073_0020706 Ga0501073_0020706_2843_4042 396
823 3300049589 Ga0501073_0182491 Ga0501073_0182491_54_1322 396
824 3300049589 Ga0501073_0192153 Ga0501073_0192153_42_1253 396
825 3300049590 Ga0501074_0000073 Ga0501074_0000073_39812_41137 396
826 3300049592 Ga0501076_0052263 Ga0501076_0052263_1850_3061 396
827 3300049741 Ga0501079_0000998 Ga0501079_0000998_11763_12971 396
828 3300049741 Ga0501079_0101655 Ga0501079_0101655_945_2156 396
829 3300049742 Ga0501080_0000593 Ga0501080_0000593_8444_9769 396
830 3300049742 Ga0501080_0039468 Ga0501080_0039468_750_2021 396
831 3300049742 Ga0501080_0211867 Ga0501080_0211867_176_1387 396
832 3300049742 Ga0501080_0217914 Ga0501080_0217914_526_1734 396
833 3300049742 Ga0501080_0348553 Ga0501080_0348553_73_1302 396
834 3300049744 Ga0501083_0000336 Ga0501083_0000336_24542_25867 396
835 3300049822 Ga0501035_0000393 Ga0501035_0000393_48621_49946 396
836 3300049822 Ga0501035_0217192 Ga0501035_0217192_132_1400 396
837 3300049823 Ga0501044_0000387 Ga0501044_0000387_13593_14918 396
838 3300049823 Ga0501044_0061947 Ga0501044_0061947_1516_2724 396
839 3300049824 Ga0501045_0047243 Ga0501045_0047243_575_1786 396
840 3300049824 Ga0501045_0065375 Ga0501045_0065375_720_2045 396
841 3300050490 nmdc:mga03n38_114707_c1 nmdc:mga03n38_114707_c1_55_1260 396
842 3300050494 nmdc:mga06z11_50238_c1 nmdc:mga06z11_50238_c1_321_1526 396
843 3300050507 nmdc:mga05p37_23845_c1 nmdc:mga05p37_23845_c1_4566_5762 396
844 3300050508 nmdc:mga09592_90283_c1 nmdc:mga09592_90283_c1_1232_2437 396
845 3300050510 nmdc:mga06r32_135530_c1 nmdc:mga06r32_135530_c1_409_1605 396
846 3300050511 nmdc:mga08y16_67591_c1 nmdc:mga08y16_67591_c1_1658_2863 396
847 3300053084 Ga0495595_0061528 Ga0495595_0061528_222_1457 396
848 3300053085 Ga0495619_0004510 Ga0495619_0004510_3788_4978 396
849 3300053096 Ga0500641_0005415 Ga0500641_0005415_76_1272 396
850 3300053142 Ga0500577_0000790 Ga0500577_0000790_2372_3580 396
851 3300054114 Ga0501084_0000898 Ga0501084_0000898_5592_6917 396
852 3300054114 Ga0501084_0068863 Ga0501084_0068863_821_2032 396
853 3300060353 Ga0501082_0000635 Ga0501082_0000635_6191_7516 396
854 3300060353 Ga0501082_0125145 Ga0501082_0125145_981_2192 396
855 iso_pu_bacteria 2643221733 2644730943 396
856 iso_pu_bacteria 2643221736 2644743862 396
857 iso_pu_bacteria 2841760612 2841764820 396
858 iso_pu_bacteria 2844104063 2844107732 396
859 iso_pu_bacteria 2851182111 2851183509 396
860 iso_pu_bacteria 2851246043 2851249838 396
861 iso_pu_bacteria 8056689827 8056692730 396
862 iso_pu_bacteria 8057529695 8057533152 396
863 3300003203 JGI25406J46586_10000059 JGI25406J46586_1000005919 397
864 3300003215 JGI25153J46596_10010247 JGI25153J46596_100102474 397
865 3300003215 JGI25153J46596_10013242 JGI25153J46596_100132422 397
866 3300003354 JGI25160J50197_1007252 JGI25160J50197_10072524 397
867 3300003659 JGI25404J52841_10003156 JGI25404J52841_100031562 397
868 3300003659 JGI25404J52841_10024754 JGI25404J52841_100247541 397
869 3300003775 Ga0055524_1025056 Ga0055524_10250562 397
870 3300003794 Ga0055531_10008258 Ga0055531_100082583 397
871 3300005262 Ga0065165_1006887 Ga0065165_10068874 397
872 3300005262 Ga0065165_1014916 Ga0065165_10149163 397
873 3300005262 Ga0065165_1018018 Ga0065165_10180182 397
874 3300005329 Ga0070683_100083124 Ga0070683_1000831242 397
875 3300005329 Ga0070683_100123171 Ga0070683_1001231712 397
876 3300005330 Ga0070690_100109911 Ga0070690_1001099112 397
877 3300005331 Ga0070670_100117490 Ga0070670_1001174902 397
878 3300005336 Ga0070680_100012989 Ga0070680_1000129892 397
879 3300005336 Ga0070680_100029337 Ga0070680_1000293372 397
880 3300005338 Ga0068868_100073155 Ga0068868_1000731551 397
881 3300005341 Ga0070691_10073241 Ga0070691_100732412 397
882 3300005344 Ga0070661_100045611 Ga0070661_1000456113 397
883 3300005345 Ga0070692_10089850 Ga0070692_100898502 397
884 3300005355 Ga0070671_100059698 Ga0070671_1000596983 397
885 3300005366 Ga0070659_100047835 Ga0070659_1000478352 397
886 3300005434 Ga0070709_10002181 Ga0070709_100021815 397
887 3300005435 Ga0070714_100020306 Ga0070714_1000203063 397
888 3300005435 Ga0070714_100095664 Ga0070714_1000956642 397
889 3300005436 Ga0070713_100000783 Ga0070713_1000007835 397
890 3300005437 Ga0070710_10009408 Ga0070710_100094082 397
891 3300005439 Ga0070711_100002004 Ga0070711_1000020042 397
892 3300005439 Ga0070711_100002298 Ga0070711_1000022983 397
893 3300005439 Ga0070711_100089369 Ga0070711_1000893692 397
894 3300005455 Ga0070663_100048274 Ga0070663_1000482743 397
895 3300005456 Ga0070678_100204272 Ga0070678_1002042721 397
896 3300005457 Ga0070662_100052304 Ga0070662_1000523042 397
897 3300005458 Ga0070681_10025965 Ga0070681_100259656 397
898 3300005458 Ga0070681_10083474 Ga0070681_100834743 397
899 3300005530 Ga0070679_100064857 Ga0070679_1000648571 397
900 3300005530 Ga0070679_100085100 Ga0070679_1000851003 397
901 3300005530 Ga0070679_100264410 Ga0070679_1002644102 397
902 3300005535 Ga0070684_100003206 Ga0070684_10000320611 397
903 3300005535 Ga0070684_100005711 Ga0070684_1000057113 397
904 3300005535 Ga0070684_100037737 Ga0070684_1000377372 397
905 3300005539 Ga0068853_100084745 Ga0068853_1000847453 397
906 3300005539 Ga0068853_100194676 Ga0068853_1001946761 397
907 3300005548 Ga0070665_100194240 Ga0070665_1001942402 397
908 3300005549 Ga0070704_100008815 Ga0070704_1000088152 397
909 3300005563 Ga0068855_100018110 Ga0068855_10001811010 397
910 3300005577 Ga0068857_100047478 Ga0068857_1000474782 397
911 3300005577 Ga0068857_100064850 Ga0068857_1000648502 397
912 3300005614 Ga0068856_100005630 Ga0068856_10000563010 397
913 3300005614 Ga0068856_100089825 Ga0068856_1000898253 397
914 3300005616 Ga0068852_100109810 Ga0068852_1001098102 397
915 3300005617 Ga0068859_100078065 Ga0068859_1000780652 397
916 3300005618 Ga0068864_100238718 Ga0068864_1002387182 397
917 3300005834 Ga0068851_10020995 Ga0068851_100209952 397
918 3300005841 Ga0068863_100233749 Ga0068863_1002337492 397
919 3300005937 Ga0081455_10000607 Ga0081455_1000060724 397
920 3300005937 Ga0081455_10007394 Ga0081455_100073949 397
921 3300005937 Ga0081455_10033082 Ga0081455_100330823 397
922 3300005983 Ga0081540_1002088 Ga0081540_10020882 397
923 3300005983 Ga0081540_1027831 Ga0081540_10278313 397
924 3300005983 Ga0081540_1092722 Ga0081540_10927221 397
925 3300005985 Ga0081539_10000324 Ga0081539_1000032420 397
926 3300006028 Ga0070717_10008922 Ga0070717_100089223 397
927 3300006028 Ga0070717_10051989 Ga0070717_100519892 397
928 3300006042 Ga0075368_10008049 Ga0075368_100080493 397
929 3300006048 Ga0075363_100059775 Ga0075363_1000597752 397
930 3300006051 Ga0075364_10027441 Ga0075364_100274413 397
931 3300006051 Ga0075364_10040152 Ga0075364_100401523 397
932 3300006175 Ga0070712_100023499 Ga0070712_1000234993 397
933 3300006175 Ga0070712_100077449 Ga0070712_1000774492 397
934 3300006175 Ga0070712_100161442 Ga0070712_1001614422 397
935 3300006178 Ga0075367_10034607 Ga0075367_100346072 397
936 3300006353 Ga0075370_10020306 Ga0075370_100203062 397
937 3300006353 Ga0075370_10073839 Ga0075370_100738391 397
938 3300006931 Ga0097620_100078065 Ga0097620_1000780652 397
939 3300006941 Ga0099825_1020543 Ga0099825_10205434 397
940 3300006942 Ga0099824_1013062 Ga0099824_10130625 397
941 3300006943 Ga0099822_1002961 Ga0099822_100296116 397
942 3300006943 Ga0099822_1047865 Ga0099822_10478652 397
943 3300007788 Ga0099795_10027844 Ga0099795_100278442 397
944 3300009093 Ga0105240_10102021 Ga0105240_101020211 397
945 3300009098 Ga0105245_10005172 Ga0105245_100051726 397
946 3300009098 Ga0105245_10025622 Ga0105245_100256224 397
947 3300009101 Ga0105247_10028650 Ga0105247_100286503 397
948 3300009176 Ga0105242_10166258 Ga0105242_101662581 397
949 3300009177 Ga0105248_10084399 Ga0105248_100843992 397
950 3300009177 Ga0105248_10134276 Ga0105248_101342763 397
951 3300009545 Ga0105237_10013837 Ga0105237_100138373 397
952 3300009551 Ga0105238_10009028 Ga0105238_100090289 397
953 3300009551 Ga0105238_10124582 Ga0105238_101245822 397
954 3300010375 Ga0105239_10107832 Ga0105239_101078322 397
955 3300011119 Ga0105246_10045819 Ga0105246_100458192 397
956 3300013105 Ga0157369_10019918 Ga0157369_100199187 397
957 3300013306 Ga0163162_10155932 Ga0163162_101559322 397
958 3300013307 Ga0157372_10236555 Ga0157372_102365552 397
959 3300013308 Ga0157375_10352896 Ga0157375_103528962 397
960 3300014325 Ga0163163_10002136 Ga0163163_1000213615 397
961 3300014325 Ga0163163_10032850 Ga0163163_100328504 397
962 3300014325 Ga0163163_10085597 Ga0163163_100855972 397
963 3300014745 Ga0157377_10058081 Ga0157377_100580812 397
964 3300014969 Ga0157376_10220703 Ga0157376_102207031 397
965 3300021320 Ga0214544_1000003 Ga0214544_1000003218 397
966 3300021321 Ga0214542_1000003 Ga0214542_1000003208 397
967 3300021324 Ga0214545_1000004 Ga0214545_1000004221 397
968 3300021327 Ga0214543_1000007 Ga0214543_1000007196 397
969 3300021377 Ga0213874_10005194 Ga0213874_100051942 397
970 3300021384 Ga0213876_10004500 Ga0213876_100045008 397
971 3300025230 Ga0209563_102209 Ga0209563_1022093 397
972 3300025245 Ga0207425_1010016 Ga0207425_10100162 397
973 3300025253 Ga0209677_101479 Ga0209677_1014792 397
974 3300025261 Ga0209233_1001617 Ga0209233_10016175 397
975 3300025261 Ga0209233_1001701 Ga0209233_10017013 397
976 3300025261 Ga0209233_1002286 Ga0209233_10022866 397
977 3300025295 Ga0209564_1016013 Ga0209564_10160132 397
978 3300025297 Ga0209758_1000015 Ga0209758_1000015261 397
979 3300025297 Ga0209758_1011698 Ga0209758_10116983 397
980 3300025299 Ga0209256_1010891 Ga0209256_10108912 397
981 3300025302 Ga0207426_1005678 Ga0207426_10056783 397
982 3300025304 Ga0209257_1007257 Ga0209257_10072573 397
983 3300025321 Ga0207656_10069232 Ga0207656_100692321 397
984 3300025898 Ga0207692_10003626 Ga0207692_100036264 397
985 3300025905 Ga0207685_10000983 Ga0207685_100009833 397
986 3300025906 Ga0207699_10000523 Ga0207699_100005234 397
987 3300025912 Ga0207707_10005171 Ga0207707_100051716 397
988 3300025912 Ga0207707_10069494 Ga0207707_100694942 397
989 3300025913 Ga0207695_10019503 Ga0207695_100195035 397
990 3300025914 Ga0207671_10182117 Ga0207671_101821172 397
991 3300025915 Ga0207693_10034523 Ga0207693_100345232 397
992 3300025915 Ga0207693_10048454 Ga0207693_100484542 397
993 3300025915 Ga0207693_10078840 Ga0207693_100788402 397
994 3300025916 Ga0207663_10001039 Ga0207663_100010392 397
995 3300025916 Ga0207663_10002358 Ga0207663_100023589 397
996 3300025917 Ga0207660_10069528 Ga0207660_100695283 397
997 3300025917 Ga0207660_10084678 Ga0207660_100846782 397
998 3300025917 Ga0207660_10126077 Ga0207660_101260772 397
999 3300025919 Ga0207657_10004333 Ga0207657_100043334 397
1000 3300025921 Ga0207652_10002845 Ga0207652_1000284515 397
1001 3300025921 Ga0207652_10055475 Ga0207652_100554752 397
1002 3300025924 Ga0207694_10026560 Ga0207694_100265604 397
1003 3300025924 Ga0207694_10256573 Ga0207694_102565732 397
1004 3300025927 Ga0207687_10008995 Ga0207687_100089956 397
1005 3300025927 Ga0207687_10019625 Ga0207687_100196253 397
1006 3300025928 Ga0207700_10003630 Ga0207700_100036302 397
1007 3300025928 Ga0207700_10021702 Ga0207700_100217022 397
1008 3300025928 Ga0207700_10040049 Ga0207700_100400492 397
1009 3300025928 Ga0207700_10071025 Ga0207700_100710252 397
1010 3300025929 Ga0207664_10014199 Ga0207664_100141994 397
1011 3300025929 Ga0207664_10093823 Ga0207664_100938232 397
1012 3300025933 Ga0207706_10120812 Ga0207706_101208122 397
1013 3300025937 Ga0207669_10010746 Ga0207669_100107463 397
1014 3300025939 Ga0207665_10001517 Ga0207665_100015173 397
1015 3300025939 Ga0207665_10010061 Ga0207665_100100612 397
1016 3300025939 Ga0207665_10030639 Ga0207665_100306392 397
1017 3300025940 Ga0207691_10153466 Ga0207691_101534662 397
1018 3300025941 Ga0207711_10111990 Ga0207711_101119901 397
1019 3300025941 Ga0207711_10149075 Ga0207711_101490752 397
1020 3300025944 Ga0207661_10027220 Ga0207661_100272205 397
1021 3300025944 Ga0207661_10129391 Ga0207661_101293912 397
1022 3300025949 Ga0207667_10027066 Ga0207667_100270663 397
1023 3300025949 Ga0207667_10059537 Ga0207667_100595372 397
1024 3300025949 Ga0207667_10148688 Ga0207667_101486882 397
1025 3300025949 Ga0207667_10305042 Ga0207667_103050422 397
1026 3300025960 Ga0207651_10031477 Ga0207651_100314772 397
1027 3300026023 Ga0207677_10007760 Ga0207677_100077604 397
1028 3300026023 Ga0207677_10031240 Ga0207677_100312402 397
1029 3300026035 Ga0207703_10101755 Ga0207703_101017552 397
1030 3300026041 Ga0207639_10219193 Ga0207639_102191931 397
1031 3300026078 Ga0207702_10000936 Ga0207702_100009363 397
1032 3300026078 Ga0207702_10070665 Ga0207702_100706652 397
1033 3300026116 Ga0207674_10017127 Ga0207674_100171277 397
1034 3300026116 Ga0207674_10046112 Ga0207674_100461123 397
1035 3300026116 Ga0207674_10135451 Ga0207674_101354512 397
1036 3300026118 Ga0207675_100051954 Ga0207675_1000519543 397
1037 3300026121 Ga0207683_10078713 Ga0207683_100787132 397
1038 3300026121 Ga0207683_10207758 Ga0207683_102077581 397
1039 3300026121 Ga0207683_10217100 Ga0207683_102171001 397
1040 3300026142 Ga0207698_10020379 Ga0207698_100203793 397
1041 3300026142 Ga0207698_10128870 Ga0207698_101288702 397
1042 3300027296 Ga0209389_1000015 Ga0209389_1000015180 397
1043 3300027296 Ga0209389_1032369 Ga0209389_10323691 397
1044 3300027357 Ga0209589_1000055 Ga0209589_100005545 397
1045 3300027357 Ga0209589_1002201 Ga0209589_100220130 397
1046 3300027361 Ga0209489_100128 Ga0209489_10012845 397
1047 3300027361 Ga0209489_102968 Ga0209489_1029683 397
1048 3300027361 Ga0209489_116568 Ga0209489_1165681 397
1049 3300027363 Ga0209700_100034 Ga0209700_1000343 397
1050 3300027363 Ga0209700_100137 Ga0209700_10013745 397
1051 3300027866 Ga0209813_10008096 Ga0209813_100080962 397
1052 3300028379 Ga0268266_10063854 Ga0268266_100638543 397
1053 3300028556 Ga0265337_1002978 Ga0265337_10029787 397
1054 3300028563 Ga0265319_1010601 Ga0265319_10106013 397
1055 3300028573 Ga0265334_10005113 Ga0265334_100051131 397
1056 3300028577 Ga0265318_10017863 Ga0265318_100178631 397
1057 3300028653 Ga0265323_10000980 Ga0265323_1000098012 397
1058 3300028654 Ga0265322_10017457 Ga0265322_100174572 397
1059 3300028666 Ga0265336_10000380 Ga0265336_1000038028 397
1060 3300028794 Ga0307515_10052115 Ga0307515_100521154 397
1061 3300028794 Ga0307515_10132107 Ga0307515_101321072 397
1062 3300028800 Ga0265338_10000024 Ga0265338_10000024158 397
1063 3300029957 Ga0265324_10008016 Ga0265324_100080163 397
1064 3300030521 Ga0307511_10041122 Ga0307511_100411224 397
1065 3300031235 Ga0265330_10044001 Ga0265330_100440012 397
1066 3300031235 Ga0265330_10072319 Ga0265330_100723191 397
1067 3300031241 Ga0265325_10011064 Ga0265325_100110645 397
1068 3300031247 Ga0265340_10051279 Ga0265340_100512792 397
1069 3300031249 Ga0265339_10015795 Ga0265339_100157953 397
1070 3300031249 Ga0265339_10017139 Ga0265339_100171394 397
1071 3300031249 Ga0265339_10018855 Ga0265339_100188554 397
1072 3300031250 Ga0265331_10039325 Ga0265331_100393252 397
1073 3300031344 Ga0265316_10237443 Ga0265316_102374431 397
1074 3300031456 Ga0307513_10126352 Ga0307513_101263522 397
1075 3300031507 Ga0307509_10115544 Ga0307509_101155441 397
1076 3300031507 Ga0307509_10161035 Ga0307509_101610352 397
1077 3300031616 Ga0307508_10000046 Ga0307508_1000004664 397
1078 3300031616 Ga0307508_10013866 Ga0307508_100138663 397
1079 3300031616 Ga0307508_10102437 Ga0307508_101024372 397
1080 3300031711 Ga0265314_10002126 Ga0265314_100021262 397
1081 3300031712 Ga0265342_10018907 Ga0265342_100189073 397
1082 3300031712 Ga0265342_10035295 Ga0265342_100352952 397
1083 3300031730 Ga0307516_10036684 Ga0307516_100366844 397
1084 3300033179 Ga0307507_10023736 Ga0307507_100237365 397
1085 3300033180 Ga0307510_10105256 Ga0307510_101052562 397
1086 3300033442 Ga0315911_1000005 Ga0315911_10000053 397
1087 3300035089 Ga0373944_0012228 Ga0373944_0012228_151_1371 397
1088 3300035111 Ga0373923_0001936 Ga0373923_0001936_2132_3403 397
1089 3300035111 Ga0373923_0010170 Ga0373923_0010170_1999_3219 397
1090 3300035113 Ga0373936_0010082 Ga0373936_0010082_1480_2700 397
1091 3300035113 Ga0373936_0039860 Ga0373936_0039860_228_1499 397
1092 3300035116 Ga0373945_0006052 Ga0373945_0006052_760_2031 397
1093 3300035117 Ga0373953_0000329 Ga0373953_0000329_8642_9862 397
1094 3300035117 Ga0373953_0022632 Ga0373953_0022632_547_1755 397
1095 3300035118 Ga0373954_0007464 Ga0373954_0007464_2414_3634 397
1096 3300035119 Ga0373956_0000937 Ga0373956_0000937_2040_3260 397
1097 3300035120 Ga0373957_0002553 Ga0373957_0002553_2963_4183 397
1098 3300035120 Ga0373957_0011568 Ga0373957_0011568_460_1680 397
1099 3300035170 Ga0373943_0012606 Ga0373943_0012606_1585_2805 397
1100 3300035170 Ga0373943_0059906 Ga0373943_0059906_435_1697 397
1101 3300035171 Ga0373946_0012421 Ga0373946_0012421_1444_2715 397
1102 3300035171 Ga0373946_0015363 Ga0373946_0015363_1230_2450 397
1103 3300035172 Ga0373955_0000362 Ga0373955_0000362_12547_13767 397
1104 3300035172 Ga0373955_0048605 Ga0373955_0048605_974_2194 397
1105 3300035172 Ga0373955_0073466 Ga0373955_0073466_469_1674 397
1106 3300035172 Ga0373955_0113793 Ga0373955_0113793_133_1404 397
1107 3300035410 Ga0373924_0012377 Ga0373924_0012377_1756_2976 397
1108 3300035692 Ga0373935_0001998 Ga0373935_0001998_1515_2735 397
1109 3300035692 Ga0373935_0059332 Ga0373935_0059332_663_1934 397
1110 3300035695 Ga0373927_0003849 Ga0373927_0003849_8049_9269 397
1111 3300035695 Ga0373927_0008112 Ga0373927_0008112_4446_5657 397
1112 3300035695 Ga0373927_0009168 Ga0373927_0009168_2955_4175 397
1113 3300035695 Ga0373927_0039618 Ga0373927_0039618_804_2069 397
1114 3300035695 Ga0373927_0057447 Ga0373927_0057447_637_1908 397
1115 3300035724 Ga0373933_0000288 Ga0373933_0000288_11308_12519 397
1116 3300035724 Ga0373933_0002624 Ga0373933_0002624_3371_4591 397
1117 3300035724 Ga0373933_0032839 Ga0373933_0032839_1562_2782 397
1118 3300035725 Ga0373947_0000241 Ga0373947_0000241_29477_30697 397
1119 3300035725 Ga0373947_0012204 Ga0373947_0012204_3140_4411 397
1120 3300036401 Ga0373937_0023732 Ga0373937_0023732_1461_2732 397
1121 3300037068 Ga0373925_0002992 Ga0373925_0002992_5692_6912 397
1122 3300037068 Ga0373925_0050327 Ga0373925_0050327_363_1574 397
1123 3300037068 Ga0373925_0074650 Ga0373925_0074650_244_1464 397
1124 3300037312 Ga0395899_0012432 Ga0395899_0012432_3675_4895 397
1125 3300037312 Ga0395899_0222424 Ga0395899_0222424_49_1260 397
1126 3300037418 Ga0395900_0008332 Ga0395900_0008332_6142_7350 397
1127 3300037418 Ga0395900_0050996 Ga0395900_0050996_1106_2326 397
1128 3300037466 Ga0395898_0042441 Ga0395898_0042441_1861_3069 397
1129 3300037466 Ga0395898_0076871 Ga0395898_0076871_925_2136 397
1130 3300037466 Ga0395898_0115742 Ga0395898_0115742_1020_2243 397
1131 3300037466 Ga0395898_0361455 Ga0395898_0361455_149_1357 397
1132 3300037471 Ga0395905_0008102 Ga0395905_0008102_2590_3798 397
1133 3300037471 Ga0395905_0023497 Ga0395905_0023497_259_1509 397
1134 3300037471 Ga0395905_0162294 Ga0395905_0162294_248_1456 397
1135 3300037853 Ga0436364_0845782 Ga0436364_0845782_211_1422 397
1136 3300037853 Ga0436364_1357879 Ga0436364_1357879_2187_3386 397
1137 3300038443 Ga0395901_0047179 Ga0395901_0047179_900_2108 397
1138 3300038443 Ga0395901_0267608 Ga0395901_0267608_46_1254 397
1139 3300039437 Ga0436365_0184625 Ga0436365_0184625_16031_17281 397
1140 3300039437 Ga0436365_1066319 Ga0436365_1066319_635_1846 397
1141 3300039438 Ga0436360_0039401 Ga0436360_0039401_902_2125 397
1142 3300039438 Ga0436360_0423846 Ga0436360_0423846_392_1603 397
1143 3300039438 Ga0436360_0614349 Ga0436360_0614349_53_1264 397
1144 3300039450 Ga0436363_0705589 Ga0436363_0705589_3874_5085 397
1145 3300039450 Ga0436363_1334576 Ga0436363_1334576_1228_2442 397
1146 3300039453 Ga0436362_1090359 Ga0436362_1090359_194_1405 397
1147 3300044658 Ga0466972_0024192 Ga0466972_0024192_855_2063 397
1148 3300044658 Ga0466972_0034706 Ga0466972_0034706_200_1447 397
1149 3300044684 Ga0466966_0141178 Ga0466966_0141178_169_1380 397
1150 3300044694 Ga0466963_0086260 Ga0466963_0086260_322_1524 397
1151 3300044735 Ga0466968_0036087 Ga0466968_0036087_566_1774 397
1152 3300044765 Ga0466970_0044062 Ga0466970_0044062_231_1442 397
1153 3300044842 Ga0466957_0165350 Ga0466957_0165350_17_1231 397
1154 3300045049 Ga0466959_0144973 Ga0466959_0144973_284_1495 397
1155 3300045976 Ga0466967_0077773 Ga0466967_0077773_852_2063 397
1156 3300046454 Ga0495592_0001087 Ga0495592_0001087_6522_7742 397
1157 3300046454 Ga0495592_0012653 Ga0495592_0012653_4281_5501 397
1158 3300046454 Ga0495592_0028613 Ga0495592_0028613_20_1228 397
1159 3300046455 Ga0495603_0000066 Ga0495603_0000066_1128_2348 397
1160 3300046455 Ga0495603_0004642 Ga0495603_0004642_2244_3464 397
1161 3300046455 Ga0495603_0012242 Ga0495603_0012242_2168_3424 397
1162 3300046459 Ga0495629_0000232 Ga0495629_0000232_31839_33059 397
1163 3300046459 Ga0495629_0001396 Ga0495629_0001396_14205_15425 397
1164 3300046459 Ga0495629_0063719 Ga0495629_0063719_1054_2274 397
1165 3300046460 Ga0495638_0115222 Ga0495638_0115222_241_1455 397
1166 3300046461 Ga0495641_0033475 Ga0495641_0033475_1127_2347 397
1167 3300046462 Ga0495651_0010616 Ga0495651_0010616_4247_5467 397
1168 3300046462 Ga0495651_0022958 Ga0495651_0022958_1134_2354 397
1169 3300046462 Ga0495651_0126124 Ga0495651_0126124_58_1266 397
1170 3300046463 Ga0495653_0000575 Ga0495653_0000575_16373_17593 397
1171 3300046472 Ga0495580_0008059 Ga0495580_0008059_4736_5956 397
1172 3300046472 Ga0495580_0018481 Ga0495580_0018481_2233_3504 397
1173 3300046473 Ga0495582_0038293 Ga0495582_0038293_688_1959 397
1174 3300046476 Ga0495662_0000386 Ga0495662_0000386_7345_8565 397
1175 3300046476 Ga0495662_0016903 Ga0495662_0016903_1943_3214 397
1176 3300046477 Ga0495664_0003821 Ga0495664_0003821_4340_5560 397
1177 3300046477 Ga0495664_0032876 Ga0495664_0032876_820_2040 397
1178 3300046477 Ga0495664_0093020 Ga0495664_0093020_99_1319 397
1179 3300046491 Ga0495584_0051542 Ga0495584_0051542_121_1368 397
1180 3300046499 Ga0495594_0099089 Ga0495594_0099089_352_1572 397
1181 3300046507 Ga0495606_0118459 Ga0495606_0118459_70_1326 397
1182 3300046511 Ga0495608_0014465 Ga0495608_0014465_2475_3695 397
1183 3300046512 Ga0495610_0040323 Ga0495610_0040323_434_1672 397
1184 3300046513 Ga0495616_0018754 Ga0495616_0018754_582_1820 397
1185 3300046514 Ga0495618_0005316 Ga0495618_0005316_1821_3041 397
1186 3300046517 Ga0495630_0012686 Ga0495630_0012686_3075_4295 397
1187 3300046517 Ga0495630_0049267 Ga0495630_0049267_529_1800 397
1188 3300046517 Ga0495630_0050945 Ga0495630_0050945_1765_2985 397
1189 3300046522 Ga0495643_0030903 Ga0495643_0030903_1042_2250 397
1190 3300046524 Ga0495648_0012019 Ga0495648_0012019_2879_4105 397
1191 3300046524 Ga0495648_0015800 Ga0495648_0015800_3544_4782 397
1192 3300046524 Ga0495648_0046032 Ga0495648_0046032_1300_2547 397
1193 3300046524 Ga0495648_0049475 Ga0495648_0049475_793_2058 397
1194 3300046531 Ga0495665_0001006 Ga0495665_0001006_10340_11560 397
1195 3300046533 Ga0495640_0002934 Ga0495640_0002934_3066_4286 397
1196 3300046533 Ga0495640_0006082 Ga0495640_0006082_2546_3766 397
1197 3300046533 Ga0495640_0029545 Ga0495640_0029545_1127_2347 397
1198 3300046535 Ga0495586_0028008 Ga0495586_0028008_852_2072 397
1199 3300046536 Ga0495587_0006763 Ga0495587_0006763_1619_2839 397
1200 3300046543 Ga0495645_0065918 Ga0495645_0065918_980_2200 397
1201 3300046557 Ga0495622_0014375 Ga0495622_0014375_206_1471 397
1202 3300046557 Ga0495622_0016669 Ga0495622_0016669_1179_2399 397
1203 3300046557 Ga0495622_0025108 Ga0495622_0025108_407_1645 397
1204 3300046559 Ga0495667_0001388 Ga0495667_0001388_10095_11315 397
1205 3300046559 Ga0495667_0028833 Ga0495667_0028833_1153_2373 397
1206 3300046642 Ga0495634_0003870 Ga0495634_0003870_6980_8200 397
1207 3300046642 Ga0495634_0003977 Ga0495634_0003977_9525_10745 397
1208 3300046663 Ga0495635_0001444 Ga0495635_0001444_1319_2539 397
1209 3300046663 Ga0495635_0003533 Ga0495635_0003533_4938_6158 397
1210 3300046665 Ga0495661_0031637 Ga0495661_0031637_836_2074 397
1211 3300046674 Ga0495588_0006576 Ga0495588_0006576_1039_2265 397
1212 3300046674 Ga0495588_0014899 Ga0495588_0014899_997_2217 397
1213 3300046678 Ga0495599_0000374 Ga0495599_0000374_9353_10573 397
1214 3300046678 Ga0495599_0029873 Ga0495599_0029873_1234_2454 397
1215 3300046679 Ga0495623_0007104 Ga0495623_0007104_4791_6011 397
1216 3300046679 Ga0495623_0049973 Ga0495623_0049973_1113_2321 397
1217 3300046679 Ga0495623_0050162 Ga0495623_0050162_703_1923 397
1218 3300046680 Ga0495646_0006685 Ga0495646_0006685_2899_4119 397
1219 3300046680 Ga0495646_0007150 Ga0495646_0007150_1176_2396 397
1220 3300046681 Ga0495647_0009919 Ga0495647_0009919_1713_2933 397
1221 3300046683 Ga0495658_0030880 Ga0495658_0030880_459_1730 397
1222 3300046689 Ga0495613_0017779 Ga0495613_0017779_2565_3785 397
1223 3300046689 Ga0495613_0019159 Ga0495613_0019159_2565_3785 397
1224 3300046689 Ga0495613_0038278 Ga0495613_0038278_204_1424 397
1225 3300046689 Ga0495613_0133663 Ga0495613_0133663_206_1471 397
1226 3300046690 Ga0495624_0003188 Ga0495624_0003188_3421_4641 397
1227 3300046690 Ga0495624_0047827 Ga0495624_0047827_444_1664 397
1228 3300046691 Ga0495670_0001611 Ga0495670_0001611_9600_10838 397
1229 3300046692 Ga0495671_0042148 Ga0495671_0042148_893_2119 397
1230 3300046809 Ga0495600_0017846 Ga0495600_0017846_480_1700 397
1231 3300046809 Ga0495600_0022444 Ga0495600_0022444_1711_2931 397
1232 3300047315 Ga0495581_0002582 Ga0495581_0002582_1631_2851 397
1233 3300047315 Ga0495581_0030375 Ga0495581_0030375_1486_2757 397
1234 3300047319 Ga0495674_0004312 Ga0495674_0004312_9279_10499 397
1235 3300047319 Ga0495674_0009574 Ga0495674_0009574_849_2120 397
1236 3300047319 Ga0495674_0016683 Ga0495674_0016683_1057_2277 397
1237 3300047321 Ga0495676_0022985 Ga0495676_0022985_2685_3905 397
1238 3300047321 Ga0495676_0169806 Ga0495676_0169806_210_1448 397
1239 3300047322 Ga0495680_0001718 Ga0495680_0001718_5815_7035 397
1240 3300047322 Ga0495680_0021413 Ga0495680_0021413_2268_3488 397
1241 3300047444 Ga0495675_0002797 Ga0495675_0002797_5719_6939 397
1242 3300047469 Ga0495673_0011425 Ga0495673_0011425_2727_3947 397
1243 3300047469 Ga0495673_0033231 Ga0495673_0033231_820_2094 397
1244 3300047471 Ga0495684_0000052 Ga0495684_0000052_7383_8603 397
1245 3300047471 Ga0495684_0027037 Ga0495684_0027037_2156_3427 397
1246 3300047471 Ga0495684_0043155 Ga0495684_0043155_1456_2676 397
1247 3300047472 Ga0495686_0011887 Ga0495686_0011887_1774_3012 397
1248 3300047472 Ga0495686_0034583 Ga0495686_0034583_986_2203 397
1249 3300047472 Ga0495686_0042494 Ga0495686_0042494_1551_2816 397
1250 3300047673 Ga0495593_0001852 Ga0495593_0001852_7084_8304 397
1251 3300047673 Ga0495593_0003982 Ga0495593_0003982_953_2173 397
1252 3300047673 Ga0495593_0038211 Ga0495593_0038211_554_1774 397
1253 3300048088 Ga0495602_0034768 Ga0495602_0034768_1869_3089 397
1254 3300048903 Ga0496100_0035603 Ga0496100_0035603_1402_2601 397
1255 3300048904 Ga0496101_0001512 Ga0496101_0001512_1408_2622 397
1256 3300048905 Ga0496102_0003670 Ga0496102_0003670_2766_3980 397
1257 3300048905 Ga0496102_0093882 Ga0496102_0093882_566_1774 397
1258 3300048907 Ga0496104_0001994 Ga0496104_0001994_7509_8708 397
1259 3300048907 Ga0496104_0032952 Ga0496104_0032952_1941_3155 397
1260 3300048907 Ga0496104_0141139 Ga0496104_0141139_114_1361 397
1261 3300048908 Ga0496105_0002533 Ga0496105_0002533_6783_7982 397
1262 3300048908 Ga0496105_0014408 Ga0496105_0014408_3000_4214 397
1263 3300048909 Ga0496106_0000713 Ga0496106_0000713_852_2117 397
1264 3300048909 Ga0496106_0011702 Ga0496106_0011702_2766_3980 397
1265 3300048909 Ga0496106_0064968 Ga0496106_0064968_1308_2516 397
1266 3300048910 Ga0496107_0006298 Ga0496107_0006298_2998_4212 397
1267 3300048910 Ga0496107_0035949 Ga0496107_0035949_1100_2311 397
1268 3300048911 Ga0496108_0007201 Ga0496108_0007201_7706_8905 397
1269 3300048911 Ga0496108_0020704 Ga0496108_0020704_1269_2483 397
1270 3300048911 Ga0496108_0040968 Ga0496108_0040968_2361_3569 397
1271 3300048913 Ga0496110_0048401 Ga0496110_0048401_1026_2234 397
1272 3300048913 Ga0496110_0147816 Ga0496110_0147816_376_1590 397
1273 3300048913 Ga0496110_0156393 Ga0496110_0156393_805_2052 397
1274 3300048914 Ga0496111_0001890 Ga0496111_0001890_10576_11775 397
1275 3300048914 Ga0496111_0054472 Ga0496111_0054472_862_2076 397
1276 3300048915 Ga0496112_0000019 Ga0496112_0000019_37160_38386 397
1277 3300048915 Ga0496112_0001865 Ga0496112_0001865_7852_9051 397
1278 3300048915 Ga0496112_0004370 Ga0496112_0004370_3611_4897 397
1279 3300048915 Ga0496112_0035292 Ga0496112_0035292_2395_3603 397
1280 3300048916 Ga0496113_0000167 Ga0496113_0000167_16449_17648 397
1281 3300048916 Ga0496113_0137846 Ga0496113_0137846_353_1561 397
1282 3300048917 Ga0496114_0066986 Ga0496114_0066986_344_1558 397
1283 3300048917 Ga0496114_0084465 Ga0496114_0084465_295_1539 397
1284 3300048918 Ga0496115_0006689 Ga0496115_0006689_1143_2342 397
1285 3300048918 Ga0496115_0030876 Ga0496115_0030876_127_1341 397
1286 3300048920 Ga0496117_0115086 Ga0496117_0115086_34_1263 397
1287 3300048921 Ga0496118_0005960 Ga0496118_0005960_6178_7443 397
1288 3300048921 Ga0496118_0045022 Ga0496118_0045022_1281_2519 397
1289 3300048921 Ga0496118_0061077 Ga0496118_0061077_480_1688 397
1290 3300048921 Ga0496118_0107145 Ga0496118_0107145_182_1447 397
1291 3300048923 Ga0496120_0030921 Ga0496120_0030921_99_1325 397
1292 3300048923 Ga0496120_0088189 Ga0496120_0088189_362_1624 397
1293 3300048924 Ga0496121_0000261 Ga0496121_0000261_56022_57287 397
1294 3300048924 Ga0496121_0002241 Ga0496121_0002241_22086_23297 397
1295 3300048924 Ga0496121_0018726 Ga0496121_0018726_2434_3672 397
1296 3300048924 Ga0496121_0099271 Ga0496121_0099271_480_1727 397
1297 3300048925 Ga0496122_0091202 Ga0496122_0091202_557_1795 397
1298 3300048925 Ga0496122_0099044 Ga0496122_0099044_68_1315 397
1299 3300048926 Ga0496123_0115653 Ga0496123_0115653_42_1280 397
1300 3300048927 Ga0496124_0001094 Ga0496124_0001094_19226_20491 397
1301 3300048928 Ga0496125_0000048 Ga0496125_0000048_193001_194215 397
1302 3300048928 Ga0496125_0004764 Ga0496125_0004764_5603_6820 397
1303 3300048928 Ga0496125_0055474 Ga0496125_0055474_922_2133 397
1304 3300048928 Ga0496125_0063033 Ga0496125_0063033_651_1916 397
1305 3300048928 Ga0496125_0078302 Ga0496125_0078302_907_2115 397
1306 3300048929 Ga0496126_0006245 Ga0496126_0006245_6872_8083 397
1307 3300048929 Ga0496126_0008552 Ga0496126_0008552_8974_10182 397
1308 3300048929 Ga0496126_0015209 Ga0496126_0015209_247_1512 397
1309 3300048929 Ga0496126_0021826 Ga0496126_0021826_3420_4631 397
1310 3300048929 Ga0496126_0028075 Ga0496126_0028075_1340_2557 397
1311 3300048929 Ga0496126_0047444 Ga0496126_0047444_1273_2511 397
1312 3300049571 Ga0501034_0069974 Ga0501034_0069974_339_1535 397
1313 3300049571 Ga0501034_0182383 Ga0501034_0182383_56_1261 397
1314 3300049574 Ga0501038_0075338 Ga0501038_0075338_144_1340 397
1315 3300049583 Ga0501067_0011140 Ga0501067_0011140_1027_2235 397
1316 3300049586 Ga0501070_0021173 Ga0501070_0021173_355_1551 397
1317 3300049589 Ga0501073_0046509 Ga0501073_0046509_1621_2826 397
1318 3300049823 Ga0501044_0072847 Ga0501044_0072847_1631_2833 397
1319 3300049823 Ga0501044_0103458 Ga0501044_0103458_69_1265 397
1320 3300050492 nmdc:mga0yw44_11287_c1 nmdc:mga0yw44_11287_c1_1959_3185 397
1321 3300050492 nmdc:mga0yw44_9110_c1 nmdc:mga0yw44_9110_c1_3670_4917 397
1322 3300050494 nmdc:mga06z11_27678_c1 nmdc:mga06z11_27678_c1_482_1690 397
1323 3300053078 Ga0495612_0005516 Ga0495612_0005516_1041_2261 397
1324 3300053078 Ga0495612_0033066 Ga0495612_0033066_588_1808 397
1325 3300053080 Ga0500635_0006439 Ga0500635_0006439_288_1532 397
1326 3300053080 Ga0500635_0008440 Ga0500635_0008440_854_2182 397
1327 3300053084 Ga0495595_0002152 Ga0495595_0002152_1780_3000 397
1328 3300053085 Ga0495619_0000458 Ga0495619_0000458_11223_12443 397
1329 3300053085 Ga0495619_0053175 Ga0495619_0053175_1024_2244 397
1330 3300053091 Ga0500647_0066988 Ga0500647_0066988_169_1413 397
1331 3300053093 Ga0500651_0083938 Ga0500651_0083938_705_1943 397
1332 3300053094 Ga0500566_0000095 Ga0500566_0000095_22674_23918 397
1333 3300053094 Ga0500566_0000144 Ga0500566_0000144_17499_18737 397
1334 3300053094 Ga0500566_0001431 Ga0500566_0001431_5672_6880 397
1335 3300053096 Ga0500641_0012425 Ga0500641_0012425_153_1379 397
1336 3300053098 Ga0500650_0009613 Ga0500650_0009613_2111_3337 397
1337 3300053103 Ga0500555_012209 Ga0500555_012209_730_1995 397
1338 3300053104 Ga0500556_0002542 Ga0500556_0002542_1159_2385 397
1339 3300053104 Ga0500556_0004808 Ga0500556_0004808_2221_3486 397
1340 3300053108 Ga0500562_009270 Ga0500562_009270_26_1252 397
1341 3300053109 Ga0500569_002659 Ga0500569_002659_1764_3002 397
1342 3300053116 Ga0500592_012239 Ga0500592_012239_91_1329 397
1343 3300053119 Ga0500595_000836 Ga0500595_000836_4344_5561 397
1344 3300053119 Ga0500595_009309 Ga0500595_009309_1921_3186 397
1345 3300053122 Ga0500608_004412 Ga0500608_004412_125_1363 397
1346 3300053136 Ga0500559_0001890 Ga0500559_0001890_6040_7278 397
1347 3300053139 Ga0500568_0001797 Ga0500568_0001797_2789_4000 397
1348 3300053139 Ga0500568_0003072 Ga0500568_0003072_1190_2416 397
1349 3300053145 Ga0500586_001688 Ga0500586_001688_21_1259 397
1350 3300053148 Ga0500590_096952 Ga0500590_096952_113_1351 397
1351 3300053150 Ga0500603_001707 Ga0500603_001707_1065_2393 397
1352 3300053151 Ga0500604_0007346 Ga0500604_0007346_198_1424 397
1353 3300053153 Ga0500616_0000046 Ga0500616_0000046_131107_132327 397
1354 3300053153 Ga0500616_0000118 Ga0500616_0000118_119532_120758 397
1355 3300053153 Ga0500616_0030744 Ga0500616_0030744_681_1946 397
1356 3300053156 Ga0500622_0002059 Ga0500622_0002059_12054_13280 397
1357 3300053156 Ga0500622_0005001 Ga0500622_0005001_2209_3474 397
1358 3300053161 Ga0500634_0007038 Ga0500634_0007038_1497_2735 397
1359 3300053162 Ga0500638_007664 Ga0500638_007664_303_1511 397
1360 3300053177 Ga0500636_0000617 Ga0500636_0000617_5705_7012 397
1361 3300053177 Ga0500636_0026918 Ga0500636_0026918_1797_3035 397
1362 3300053177 Ga0500636_0055253 Ga0500636_0055253_605_1819 397
1363 3300053178 Ga0500637_0000438 Ga0500637_0000438_9246_10454 397
1364 3300053178 Ga0500637_0017825 Ga0500637_0017825_2181_3509 397
1365 3300053178 Ga0500637_0026671 Ga0500637_0026671_1064_2308 397
1366 3300053178 Ga0500637_0036223 Ga0500637_0036223_266_1474 397
1367 3300053722 Ga0500649_083594 Ga0500649_083594_33_1241 397
1368 3300053723 Ga0500567_076713 Ga0500567_076713_97_1335 397
1369 3300053731 Ga0500609_003923 Ga0500609_003923_359_1771 397
1370 3300053736 Ga0500599_000600 Ga0500599_000600_1649_2914 397
1371 3300053737 Ga0500601_000512 Ga0500601_000512_959_2167 397
1372 3300055283 Ga0500661_001158 Ga0500661_001158_3401_4609 397
1373 iso_pu_bacteria 2508501128 2509150827 397
1374 iso_pu_bacteria 2513237141 2513890475 397
1375 iso_pu_bacteria 2528768022 2528850307 397
1376 iso_pu_bacteria 2602042107 2603858130 397
1377 iso_pu_bacteria 2857524615 2857527519 397
1378 iso_pu_bacteria 2893066018 2893067013 397
1379 iso_pu_bacteria 2919073203 2919073368 397
1380 iso_pu_bacteria 2932784394 2932786257 397
1381 iso_pu_bacteria 2932809354 2932812669 397
1382 iso_pu_bacteria 2932818245 2932823031 397
1383 iso_pu_bacteria 2932828146 2932829495 397
1384 iso_pu_bacteria 2933577622 2933584463 397
1385 iso_pu_bacteria 2935616580 2935618013 397
1386 iso_pu_bacteria 2935638405 2935641589 397
1387 iso_pu_bacteria 2935665750 2935669353 397
1388 iso_pu_bacteria 2935675223 2935678051 397
1389 iso_pu_bacteria 2935684952 2935693630 397
1390 iso_pu_bacteria 2935694250 2935701712 397
1391 iso_pu_bacteria 2935703347 2935707177 397
1392 iso_pu_bacteria 2935713505 2935717019 397
1393 iso_pu_bacteria 2935722832 2935730147 397
1394 iso_pu_bacteria 2935732158 2935738433 397
1395 iso_pu_bacteria 2935741537 2935750221 397
1396 iso_pu_bacteria 2935750917 2935759815 397
1397 iso_pu_bacteria 2935760218 2935764534 397
1398 iso_pu_bacteria 2935801545 2935804443 397
1399 iso_pu_bacteria 2935810662 2935817304 397
1400 iso_pu_bacteria 2935827899 2935831320 397
1401 iso_pu_bacteria 2935837841 2935841929 397
1402 iso_pu_bacteria 2935855204 2935856488 397
1403 iso_pu_bacteria 2935864058 2935870970 397
1404 iso_pu_bacteria 2935873716 2935874486 397
1405 iso_pu_bacteria 2935959822 2935964230 397
1406 iso_pu_bacteria 2935992306 2935993947 397
1407 iso_pu_bacteria 2936002035 2936005042 397
1408 iso_pu_bacteria 2936037263 2936044101 397
1409 iso_pu_bacteria 2940556831 2940565731 397
1410 iso_pu_bacteria 2941538514 2941544002 397
1411 iso_pu_bacteria 8016511872 8016518737 397
1412 iso_pu_bacteria 8017057580 8017057940 397
1413 iso_pu_bacteria 8019586578 8019595884 397
1414 iso_pu_bacteria 8055742211 8055750909 397
1415 3300005336 Ga0070680_100010233 Ga0070680_1000102337 398
1416 3300005937 Ga0081455_10049396 Ga0081455_100493963 398
1417 3300009093 Ga0105240_10010579 Ga0105240_100105793 398
1418 3300013105 Ga0157369_10040438 Ga0157369_100404384 398
1419 3300020081 Ga0206354_10460772 Ga0206354_104607721 398
1420 3300021384 Ga0213876_10048817 Ga0213876_100488172 398
1421 3300025912 Ga0207707_10059393 Ga0207707_100593932 398
1422 3300025919 Ga0207657_10089419 Ga0207657_100894192 398
1423 3300025949 Ga0207667_10007935 Ga0207667_100079353 398
1424 3300031247 Ga0265340_10028412 Ga0265340_100284122 398
1425 3300031249 Ga0265339_10007030 Ga0265339_100070303 398
1426 3300031249 Ga0265339_10076331 Ga0265339_100763312 398
1427 3300031712 Ga0265342_10005835 Ga0265342_100058359 398
1428 3300035113 Ga0373936_0062942 Ga0373936_0062942_95_1309 398
1429 3300039437 Ga0436365_1117139 Ga0436365_1117139_11851_13047 398
1430 3300039447 Ga0436361_0330482 Ga0436361_0330482_1291_2493 398
1431 3300049571 Ga0501034_0051481 Ga0501034_0051481_2474_3679 398
1432 3300049584 Ga0501068_0097878 Ga0501068_0097878_371_1579 398
1433 3300049591 Ga0501075_0040833 Ga0501075_0040833_438_1646 398
1434 3300049592 Ga0501076_0015009 Ga0501076_0015009_4031_5239 398
1435 3300049742 Ga0501080_0037235 Ga0501080_0037235_1016_2212 398
1436 3300049742 Ga0501080_0081794 Ga0501080_0081794_1395_2603 398
1437 3300049743 Ga0501081_0030088 Ga0501081_0030088_1831_3039 398
1438 3300054114 Ga0501084_0029430 Ga0501084_0029430_710_1918 398
1439 3300060353 Ga0501082_0007160 Ga0501082_0007160_8172_9380 398
1440 3300005290 Ga0065712_10041299 Ga0065712_100412991 399
1441 3300005330 Ga0070690_100045259 Ga0070690_1000452593 399
1442 3300005330 Ga0070690_100046376 Ga0070690_1000463762 399
1443 3300005333 Ga0070677_10020965 Ga0070677_100209652 399
1444 3300005335 Ga0070666_10004225 Ga0070666_100042259 399
1445 3300005336 Ga0070680_100016219 Ga0070680_1000162191 399
1446 3300005337 Ga0070682_100190758 Ga0070682_1001907581 399
1447 3300005338 Ga0068868_100002807 Ga0068868_10000280711 399
1448 3300005343 Ga0070687_100075182 Ga0070687_1000751822 399
1449 3300005344 Ga0070661_100084794 Ga0070661_1000847942 399
1450 3300005353 Ga0070669_100284639 Ga0070669_1002846391 399
1451 3300005355 Ga0070671_100107516 Ga0070671_1001075162 399
1452 3300005356 Ga0070674_100001719 Ga0070674_10000171911 399
1453 3300005365 Ga0070688_100006669 Ga0070688_1000066695 399
1454 3300005434 Ga0070709_10001614 Ga0070709_100016143 399
1455 3300005434 Ga0070709_10021695 Ga0070709_100216951 399
1456 3300005436 Ga0070713_100000386 Ga0070713_10000038617 399
1457 3300005436 Ga0070713_100047028 Ga0070713_1000470283 399
1458 3300005437 Ga0070710_10013274 Ga0070710_100132743 399
1459 3300005439 Ga0070711_100009879 Ga0070711_1000098796 399
1460 3300005439 Ga0070711_100034183 Ga0070711_1000341833 399
1461 3300005456 Ga0070678_100003549 Ga0070678_1000035497 399
1462 3300005456 Ga0070678_100055537 Ga0070678_1000555373 399
1463 3300005459 Ga0068867_100025491 Ga0068867_1000254913 399
1464 3300005466 Ga0070685_10152241 Ga0070685_101522411 399
1465 3300005543 Ga0070672_100032787 Ga0070672_1000327872 399
1466 3300005544 Ga0070686_100073451 Ga0070686_1000734512 399
1467 3300005547 Ga0070693_100041996 Ga0070693_1000419962 399
1468 3300005563 Ga0068855_100046224 Ga0068855_1000462242 399
1469 3300005615 Ga0070702_100016461 Ga0070702_1000164614 399
1470 3300005617 Ga0068859_100024833 Ga0068859_1000248333 399
1471 3300005617 Ga0068859_100202173 Ga0068859_1002021732 399
1472 3300005618 Ga0068864_100026834 Ga0068864_1000268345 399
1473 3300005618 Ga0068864_100118272 Ga0068864_1001182722 399
1474 3300005841 Ga0068863_100052581 Ga0068863_1000525812 399
1475 3300005842 Ga0068858_100057440 Ga0068858_1000574404 399
1476 3300005843 Ga0068860_100049640 Ga0068860_1000496404 399
1477 3300005937 Ga0081455_10024711 Ga0081455_100247113 399
1478 3300005981 Ga0081538_10016589 Ga0081538_100165893 399
1479 3300006163 Ga0070715_10010996 Ga0070715_100109962 399
1480 3300006175 Ga0070712_100000486 Ga0070712_10000048612 399
1481 3300006237 Ga0097621_100109379 Ga0097621_1001093792 399
1482 3300006358 Ga0068871_100015220 Ga0068871_1000152204 399
1483 3300006844 Ga0075428_100102159 Ga0075428_1001021592 399
1484 3300006931 Ga0097620_100024829 Ga0097620_1000248295 399
1485 3300006931 Ga0097620_100202168 Ga0097620_1002021682 399
1486 3300009098 Ga0105245_10096425 Ga0105245_100964252 399
1487 3300009098 Ga0105245_10099428 Ga0105245_100994282 399
1488 3300009147 Ga0114129_10014841 Ga0114129_100148417 399
1489 3300009148 Ga0105243_10152483 Ga0105243_101524832 399
1490 3300009174 Ga0105241_10109019 Ga0105241_101090191 399
1491 3300009176 Ga0105242_10021935 Ga0105242_100219353 399
1492 3300009545 Ga0105237_10079116 Ga0105237_100791162 399
1493 3300009551 Ga0105238_10083838 Ga0105238_100838382 399
1494 3300011119 Ga0105246_10007751 Ga0105246_100077514 399
1495 3300013307 Ga0157372_10032483 Ga0157372_100324835 399
1496 3300014326 Ga0157380_10009202 Ga0157380_100092025 399
1497 3300014969 Ga0157376_10302524 Ga0157376_103025242 399
1498 3300025893 Ga0207682_10001760 Ga0207682_100017608 399
1499 3300025900 Ga0207710_10002358 Ga0207710_100023585 399
1500 3300025906 Ga0207699_10000580 Ga0207699_100005807 399
1501 3300025907 Ga0207645_10045055 Ga0207645_100450552 399
1502 3300025908 Ga0207643_10059115 Ga0207643_100591152 399
1503 3300025915 Ga0207693_10008969 Ga0207693_100089697 399
1504 3300025915 Ga0207693_10020654 Ga0207693_100206544 399
1505 3300025915 Ga0207693_10025591 Ga0207693_100255912 399
1506 3300025916 Ga0207663_10009522 Ga0207663_100095222 399
1507 3300025917 Ga0207660_10053936 Ga0207660_100539361 399
1508 3300025918 Ga0207662_10003713 Ga0207662_100037133 399
1509 3300025918 Ga0207662_10071937 Ga0207662_100719371 399
1510 3300025920 Ga0207649_10081851 Ga0207649_100818512 399
1511 3300025925 Ga0207650_10302119 Ga0207650_103021192 399
1512 3300025927 Ga0207687_10095997 Ga0207687_100959972 399
1513 3300025928 Ga0207700_10000516 Ga0207700_100005167 399
1514 3300025929 Ga0207664_10006689 Ga0207664_100066892 399
1515 3300025929 Ga0207664_10147027 Ga0207664_101470272 399
1516 3300025931 Ga0207644_10004768 Ga0207644_100047687 399
1517 3300025933 Ga0207706_10075191 Ga0207706_100751912 399
1518 3300025933 Ga0207706_10118706 Ga0207706_101187062 399
1519 3300025934 Ga0207686_10130760 Ga0207686_101307601 399
1520 3300025936 Ga0207670_10052059 Ga0207670_100520593 399
1521 3300025937 Ga0207669_10001009 Ga0207669_100010098 399
1522 3300025937 Ga0207669_10112237 Ga0207669_101122371 399
1523 3300025939 Ga0207665_10072945 Ga0207665_100729452 399
1524 3300025940 Ga0207691_10017667 Ga0207691_100176677 399
1525 3300025942 Ga0207689_10078978 Ga0207689_100789783 399
1526 3300025944 Ga0207661_10059469 Ga0207661_100594692 399
1527 3300025961 Ga0207712_10187605 Ga0207712_101876051 399
1528 3300025961 Ga0207712_10258624 Ga0207712_102586242 399
1529 3300025986 Ga0207658_10208037 Ga0207658_102080372 399
1530 3300026075 Ga0207708_10108175 Ga0207708_101081752 399
1531 3300026088 Ga0207641_10071264 Ga0207641_100712642 399
1532 3300026089 Ga0207648_10002342 Ga0207648_100023429 399
1533 3300026095 Ga0207676_10020653 Ga0207676_100206535 399
1534 3300026095 Ga0207676_10131641 Ga0207676_101316412 399
1535 3300026116 Ga0207674_10275333 Ga0207674_102753331 399
1536 3300026121 Ga0207683_10001554 Ga0207683_100015547 399
1537 3300026121 Ga0207683_10011567 Ga0207683_100115674 399
1538 3300028577 Ga0265318_10011887 Ga0265318_100118872 399
1539 3300031238 Ga0265332_10000302 Ga0265332_1000030221 399
1540 3300031238 Ga0265332_10054964 Ga0265332_100549642 399
1541 3300031240 Ga0265320_10048738 Ga0265320_100487382 399
1542 3300031241 Ga0265325_10044454 Ga0265325_100444542 399
1543 3300031247 Ga0265340_10002351 Ga0265340_100023511 399
1544 3300031247 Ga0265340_10007917 Ga0265340_100079175 399
1545 3300031249 Ga0265339_10003035 Ga0265339_100030359 399
1546 3300031249 Ga0265339_10082302 Ga0265339_100823022 399
1547 3300031250 Ga0265331_10019768 Ga0265331_100197682 399
1548 3300031250 Ga0265331_10036649 Ga0265331_100366491 399
1549 3300031344 Ga0265316_10198104 Ga0265316_101981041 399
1550 3300031456 Ga0307513_10265244 Ga0307513_102652442 399
1551 3300031711 Ga0265314_10027967 Ga0265314_100279672 399
1552 3300031711 Ga0265314_10113553 Ga0265314_101135531 399
1553 3300031712 Ga0265342_10000238 Ga0265342_1000023847 399
1554 3300031712 Ga0265342_10012970 Ga0265342_100129706 399
1555 3300031903 Ga0307407_10095764 Ga0307407_100957642 399
1556 3300031995 Ga0307409_100181482 Ga0307409_1001814822 399
1557 3300035119 Ga0373956_0021966 Ga0373956_0021966_616_1875 399
1558 3300035692 Ga0373935_0004782 Ga0373935_0004782_1603_2877 399
1559 3300035692 Ga0373935_0070877 Ga0373935_0070877_954_2162 399
1560 3300035695 Ga0373927_0003475 Ga0373927_0003475_7452_8726 399
1561 3300035695 Ga0373927_0055299 Ga0373927_0055299_303_1511 399
1562 3300035725 Ga0373947_0000405 Ga0373947_0000405_15629_16903 399
1563 3300035725 Ga0373947_0078911 Ga0373947_0078911_396_1604 399
1564 3300036401 Ga0373937_0013069 Ga0373937_0013069_3357_4616 399
1565 3300037068 Ga0373925_0005523 Ga0373925_0005523_643_1917 399
1566 3300037068 Ga0373925_0033385 Ga0373925_0033385_269_1477 399
1567 3300037418 Ga0395900_0076695 Ga0395900_0076695_853_2058 399
1568 3300039437 Ga0436365_1389173 Ga0436365_1389173_185_1393 399
1569 3300041408 Ga0439453_0000204 Ga0439453_0000204_776_1984 399
1570 3300042003 Ga0439443_000558 Ga0439443_000558_186_1394 399
1571 3300042461 Ga0439460_0016769 Ga0439460_0016769_290_1498 399
1572 3300046472 Ga0495580_0102687 Ga0495580_0102687_222_1496 399
1573 3300046474 Ga0495605_0025165 Ga0495605_0025165_650_1858 399
1574 3300046476 Ga0495662_0040341 Ga0495662_0040341_171_1445 399
1575 3300046477 Ga0495664_0048400 Ga0495664_0048400_406_1614 399
1576 3300046533 Ga0495640_0042069 Ga0495640_0042069_606_1814 399
1577 3300046539 Ga0495621_0022389 Ga0495621_0022389_526_1734 399
1578 3300046689 Ga0495613_0017619 Ga0495613_0017619_1442_2716 399
1579 3300047471 Ga0495684_0004953 Ga0495684_0004953_7634_8908 399
1580 3300047673 Ga0495593_0027880 Ga0495593_0027880_1421_2695 399
1581 3300048905 Ga0496102_0039644 Ga0496102_0039644_1995_3206 399
1582 3300048908 Ga0496105_0114438 Ga0496105_0114438_555_1766 399
1583 3300048915 Ga0496112_0358090 Ga0496112_0358090_30_1241 399
1584 3300048925 Ga0496122_0003848 Ga0496122_0003848_17118_18326 399
1585 3300048926 Ga0496123_0002454 Ga0496123_0002454_15074_16282 399
1586 3300049568 Ga0501031_0073208 Ga0501031_0073208_146_1354 399
1587 3300049586 Ga0501070_0049366 Ga0501070_0049366_2070_3269 399
1588 3300049588 Ga0501072_0001354 Ga0501072_0001354_3334_4539 399
1589 3300049591 Ga0501075_0046711 Ga0501075_0046711_457_1665 399
1590 3300049741 Ga0501079_0047612 Ga0501079_0047612_1033_2250 399
1591 3300049744 Ga0501083_0006039 Ga0501083_0006039_5618_6889 399
1592 3300049744 Ga0501083_0043713 Ga0501083_0043713_1401_2600 399
1593 3300050507 nmdc:mga05p37_6511_c1 nmdc:mga05p37_6511_c1_8331_9608 399
1594 3300050514 nmdc:mga08x19_21_c1 nmdc:mga08x19_21_c1_232426_233802 399
1595 3300053077 Ga0495601_0042930 Ga0495601_0042930_1609_2826 399
1596 3300053104 Ga0500556_0000250 Ga0500556_0000250_6497_7705 399
1597 3300053730 Ga0500645_004871 Ga0500645_004871_1027_2235 399
1598 3300054114 Ga0501084_0087347 Ga0501084_0087347_857_2065 399
1599 3300060353 Ga0501082_0000555 Ga0501082_0000555_21897_23102 399
1600 3300001430 JGI24032J14994_100023 JGI24032J14994_1000234 400
1601 3300005330 Ga0070690_100101891 Ga0070690_1001018912 400
1602 3300005334 Ga0068869_100003148 Ga0068869_1000031489 400
1603 3300005335 Ga0070666_10079083 Ga0070666_100790832 400
1604 3300005336 Ga0070680_100038840 Ga0070680_1000388404 400
1605 3300005336 Ga0070680_100137744 Ga0070680_1001377441 400
1606 3300005340 Ga0070689_100010075 Ga0070689_1000100756 400
1607 3300005347 Ga0070668_100005625 Ga0070668_1000056258 400
1608 3300005355 Ga0070671_100076532 Ga0070671_1000765322 400
1609 3300005355 Ga0070671_100243239 Ga0070671_1002432392 400
1610 3300005356 Ga0070674_100121080 Ga0070674_1001210801 400
1611 3300005365 Ga0070688_100013108 Ga0070688_1000131084 400
1612 3300005365 Ga0070688_100088051 Ga0070688_1000880511 400
1613 3300005367 Ga0070667_100087949 Ga0070667_1000879492 400
1614 3300005434 Ga0070709_10128880 Ga0070709_101288801 400
1615 3300005434 Ga0070709_10142545 Ga0070709_101425451 400
1616 3300005435 Ga0070714_100020464 Ga0070714_1000204643 400
1617 3300005435 Ga0070714_100084431 Ga0070714_1000844312 400
1618 3300005435 Ga0070714_100250746 Ga0070714_1002507461 400
1619 3300005436 Ga0070713_100051304 Ga0070713_1000513043 400
1620 3300005436 Ga0070713_100090586 Ga0070713_1000905862 400
1621 3300005436 Ga0070713_100097153 Ga0070713_1000971532 400
1622 3300005437 Ga0070710_10073638 Ga0070710_100736381 400
1623 3300005456 Ga0070678_100135616 Ga0070678_1001356162 400
1624 3300005457 Ga0070662_100040755 Ga0070662_1000407552 400
1625 3300005459 Ga0068867_100057165 Ga0068867_1000571651 400
1626 3300005518 Ga0070699_100035205 Ga0070699_1000352055 400
1627 3300005530 Ga0070679_100041336 Ga0070679_1000413364 400
1628 3300005539 Ga0068853_100001956 Ga0068853_1000019567 400
1629 3300005539 Ga0068853_100029002 Ga0068853_1000290022 400
1630 3300005544 Ga0070686_100060993 Ga0070686_1000609932 400
1631 3300005548 Ga0070665_100075677 Ga0070665_1000756773 400
1632 3300005549 Ga0070704_100000828 Ga0070704_1000008288 400
1633 3300005549 Ga0070704_100104443 Ga0070704_1001044431 400
1634 3300005564 Ga0070664_100100430 Ga0070664_1001004301 400
1635 3300005578 Ga0068854_100048805 Ga0068854_1000488052 400
1636 3300005614 Ga0068856_100139768 Ga0068856_1001397682 400
1637 3300005616 Ga0068852_100060020 Ga0068852_1000600202 400
1638 3300005618 Ga0068864_100017053 Ga0068864_1000170535 400
1639 3300005719 Ga0068861_100042257 Ga0068861_1000422572 400
1640 3300005840 Ga0068870_10086192 Ga0068870_100861922 400
1641 3300005937 Ga0081455_10003030 Ga0081455_100030303 400
1642 3300005937 Ga0081455_10030564 Ga0081455_100305642 400
1643 3300006028 Ga0070717_10035443 Ga0070717_100354431 400
1644 3300006028 Ga0070717_10122060 Ga0070717_101220601 400
1645 3300006038 Ga0075365_10019530 Ga0075365_100195305 400
1646 3300006048 Ga0075363_100014598 Ga0075363_1000145982 400
1647 3300006051 Ga0075364_10007635 Ga0075364_100076354 400
1648 3300006058 Ga0075432_10009380 Ga0075432_100093802 400
1649 3300006163 Ga0070715_10002559 Ga0070715_100025593 400
1650 3300006177 Ga0075362_10001295 Ga0075362_100012958 400
1651 3300006194 Ga0075427_10002056 Ga0075427_100020563 400
1652 3300006195 Ga0075366_10002180 Ga0075366_100021809 400
1653 3300006358 Ga0068871_100086991 Ga0068871_1000869911 400
1654 3300006844 Ga0075428_100003602 Ga0075428_10000360214 400
1655 3300006844 Ga0075428_100040840 Ga0075428_1000408402 400
1656 3300006846 Ga0075430_100000367 Ga0075430_10000036712 400
1657 3300006846 Ga0075430_100001911 Ga0075430_1000019118 400
1658 3300006847 Ga0075431_100005940 Ga0075431_10000594011 400
1659 3300006847 Ga0075431_100040876 Ga0075431_1000408765 400
1660 3300006852 Ga0075433_10000501 Ga0075433_100005015 400
1661 3300006871 Ga0075434_100038727 Ga0075434_1000387272 400
1662 3300006871 Ga0075434_100082585 Ga0075434_1000825852 400
1663 3300006871 Ga0075434_100083774 Ga0075434_1000837743 400
1664 3300006871 Ga0075434_100095046 Ga0075434_1000950461 400
1665 3300006871 Ga0075434_100277705 Ga0075434_1002777051 400
1666 3300006880 Ga0075429_100001022 Ga0075429_10000102214 400
1667 3300006880 Ga0075429_100230943 Ga0075429_1002309432 400
1668 3300006914 Ga0075436_100005140 Ga0075436_1000051403 400
1669 3300007076 Ga0075435_100002541 Ga0075435_10000254112 400
1670 3300007076 Ga0075435_100102539 Ga0075435_1001025392 400
1671 3300007265 Ga0099794_10050861 Ga0099794_100508612 400
1672 3300009093 Ga0105240_10129286 Ga0105240_101292863 400
1673 3300009094 Ga0111539_10013322 Ga0111539_100133221 400
1674 3300009098 Ga0105245_10033872 Ga0105245_100338722 400
1675 3300009098 Ga0105245_10217890 Ga0105245_102178902 400
1676 3300009147 Ga0114129_10017061 Ga0114129_1001706110 400
1677 3300009147 Ga0114129_10059988 Ga0114129_100599882 400
1678 3300009147 Ga0114129_10073532 Ga0114129_100735325 400
1679 3300009147 Ga0114129_10093159 Ga0114129_100931595 400
1680 3300009147 Ga0114129_10242070 Ga0114129_102420701 400
1681 3300009174 Ga0105241_10142137 Ga0105241_101421372 400
1682 3300009176 Ga0105242_10044548 Ga0105242_100445482 400
1683 3300009177 Ga0105248_10031915 Ga0105248_100319151 400
1684 3300009177 Ga0105248_10112475 Ga0105248_101124752 400
1685 3300010159 Ga0099796_10046085 Ga0099796_100460852 400
1686 3300010375 Ga0105239_10086707 Ga0105239_100867072 400
1687 3300013100 Ga0157373_10099736 Ga0157373_100997362 400
1688 3300013104 Ga0157370_10092499 Ga0157370_100924991 400
1689 3300013296 Ga0157374_10219437 Ga0157374_102194372 400
1690 3300013296 Ga0157374_10401111 Ga0157374_104011111 400
1691 3300014325 Ga0163163_10011126 Ga0163163_100111261 400
1692 3300014325 Ga0163163_10032611 Ga0163163_100326116 400
1693 3300014968 Ga0157379_10012482 Ga0157379_100124828 400
1694 3300025885 Ga0207653_10003313 Ga0207653_100033131 400
1695 3300025898 Ga0207692_10005503 Ga0207692_100055033 400
1696 3300025901 Ga0207688_10009201 Ga0207688_100092013 400
1697 3300025905 Ga0207685_10035003 Ga0207685_100350031 400
1698 3300025905 Ga0207685_10043393 Ga0207685_100433932 400
1699 3300025907 Ga0207645_10013862 Ga0207645_100138623 400
1700 3300025908 Ga0207643_10003382 Ga0207643_100033822 400
1701 3300025910 Ga0207684_10018439 Ga0207684_100184392 400
1702 3300025915 Ga0207693_10022492 Ga0207693_100224922 400
1703 3300025916 Ga0207663_10008388 Ga0207663_100083881 400
1704 3300025916 Ga0207663_10080460 Ga0207663_100804602 400
1705 3300025917 Ga0207660_10042399 Ga0207660_100423992 400
1706 3300025917 Ga0207660_10071960 Ga0207660_100719602 400
1707 3300025925 Ga0207650_10010230 Ga0207650_100102305 400
1708 3300025927 Ga0207687_10034405 Ga0207687_100344052 400
1709 3300025928 Ga0207700_10005253 Ga0207700_100052535 400
1710 3300025928 Ga0207700_10200387 Ga0207700_102003871 400
1711 3300025931 Ga0207644_10022357 Ga0207644_100223574 400
1712 3300025931 Ga0207644_10252961 Ga0207644_102529611 400
1713 3300025932 Ga0207690_10229066 Ga0207690_102290661 400
1714 3300025933 Ga0207706_10009539 Ga0207706_100095398 400
1715 3300025933 Ga0207706_10013202 Ga0207706_100132023 400
1716 3300025933 Ga0207706_10065007 Ga0207706_100650072 400
1717 3300025934 Ga0207686_10055332 Ga0207686_100553321 400
1718 3300025939 Ga0207665_10005893 Ga0207665_100058934 400
1719 3300025942 Ga0207689_10005044 Ga0207689_1000504410 400
1720 3300025945 Ga0207679_10077483 Ga0207679_100774832 400
1721 3300025945 Ga0207679_10092055 Ga0207679_100920552 400
1722 3300025960 Ga0207651_10004616 Ga0207651_100046162 400
1723 3300026067 Ga0207678_10017602 Ga0207678_100176025 400
1724 3300026088 Ga0207641_10190873 Ga0207641_101908732 400
1725 3300026089 Ga0207648_10049557 Ga0207648_100495572 400
1726 3300026116 Ga0207674_10014338 Ga0207674_100143384 400
1727 3300026118 Ga0207675_100004192 Ga0207675_1000041929 400
1728 3300026118 Ga0207675_100195727 Ga0207675_1001957272 400
1729 3300026121 Ga0207683_10007469 Ga0207683_100074697 400
1730 3300026121 Ga0207683_10028691 Ga0207683_100286915 400
1731 3300027907 Ga0207428_10000141 Ga0207428_1000014149 400
1732 3300028379 Ga0268266_10087021 Ga0268266_100870211 400
1733 3300031090 Ga0265760_10033378 Ga0265760_100333781 400
1734 3300031241 Ga0265325_10000119 Ga0265325_1000011935 400
1735 3300031241 Ga0265325_10002411 Ga0265325_1000241111 400
1736 3300031241 Ga0265325_10003262 Ga0265325_1000326211 400
1737 3300031241 Ga0265325_10016461 Ga0265325_100164613 400
1738 3300031241 Ga0265325_10021861 Ga0265325_100218613 400
1739 3300031249 Ga0265339_10015581 Ga0265339_100155813 400
1740 3300031595 Ga0265313_10000510 Ga0265313_1000051027 400
1741 3300031595 Ga0265313_10008081 Ga0265313_100080819 400
1742 3300031595 Ga0265313_10022122 Ga0265313_100221224 400
1743 3300031595 Ga0265313_10035759 Ga0265313_100357592 400
1744 3300035086 Ga0373934_0010262 Ga0373934_0010262_2213_3415 400
1745 3300035117 Ga0373953_0004086 Ga0373953_0004086_2323_3531 400
1746 3300035117 Ga0373953_0011455 Ga0373953_0011455_234_1436 400
1747 3300035117 Ga0373953_0029646 Ga0373953_0029646_599_1804 400
1748 3300035118 Ga0373954_0007132 Ga0373954_0007132_1848_3053 400
1749 3300035118 Ga0373954_0007220 Ga0373954_0007220_2525_3727 400
1750 3300035118 Ga0373954_0036360 Ga0373954_0036360_627_1835 400
1751 3300035119 Ga0373956_0015967 Ga0373956_0015967_936_2144 400
1752 3300035119 Ga0373956_0033082 Ga0373956_0033082_901_2106 400
1753 3300035120 Ga0373957_0001896 Ga0373957_0001896_1426_2631 400
1754 3300035120 Ga0373957_0019419 Ga0373957_0019419_947_2155 400
1755 3300035170 Ga0373943_0013873 Ga0373943_0013873_701_1924 400
1756 3300035170 Ga0373943_0042327 Ga0373943_0042327_960_2168 400
1757 3300035172 Ga0373955_0011209 Ga0373955_0011209_869_2071 400
1758 3300035691 Ga0373931_0010986 Ga0373931_0010986_1967_3193 400
1759 3300035692 Ga0373935_0010217 Ga0373935_0010217_2144_3367 400
1760 3300035692 Ga0373935_0020994 Ga0373935_0020994_1807_3015 400
1761 3300035695 Ga0373927_0011315 Ga0373927_0011315_3339_4565 400
1762 3300035695 Ga0373927_0058472 Ga0373927_0058472_1042_2265 400
1763 3300035695 Ga0373927_0067363 Ga0373927_0067363_948_2156 400
1764 3300035724 Ga0373933_0001277 Ga0373933_0001277_463_1671 400
1765 3300035724 Ga0373933_0017405 Ga0373933_0017405_1072_2274 400
1766 3300036401 Ga0373937_0000454 Ga0373937_0000454_982_2190 400
1767 3300036401 Ga0373937_0025582 Ga0373937_0025582_1148_2356 400
1768 3300036401 Ga0373937_0142418 Ga0373937_0142418_738_1943 400
1769 3300036401 Ga0373937_0339234 Ga0373937_0339234_122_1366 400
1770 3300037418 Ga0395900_0077119 Ga0395900_0077119_2095_3315 400
1771 3300037466 Ga0395898_0124069 Ga0395898_0124069_968_2188 400
1772 3300038443 Ga0395901_0090562 Ga0395901_0090562_833_2053 400
1773 3300039437 Ga0436365_1537089 Ga0436365_1537089_49_1254 400
1774 3300039447 Ga0436361_0200318 Ga0436361_0200318_9281_10501 400
1775 3300039450 Ga0436363_0416230 Ga0436363_0416230_323_1543 400
1776 3300046454 Ga0495592_0004304 Ga0495592_0004304_1958_3160 400
1777 3300046454 Ga0495592_0025633 Ga0495592_0025633_1079_2287 400
1778 3300046454 Ga0495592_0086693 Ga0495592_0086693_899_2104 400
1779 3300046455 Ga0495603_0066175 Ga0495603_0066175_259_1479 400
1780 3300046459 Ga0495629_0017702 Ga0495629_0017702_2904_4112 400
1781 3300046459 Ga0495629_0060405 Ga0495629_0060405_1385_2587 400
1782 3300046462 Ga0495651_0001660 Ga0495651_0001660_7687_8889 400
1783 3300046462 Ga0495651_0011255 Ga0495651_0011255_992_2200 400
1784 3300046462 Ga0495651_0075404 Ga0495651_0075404_183_1388 400
1785 3300046463 Ga0495653_0001162 Ga0495653_0001162_1178_2380 400
1786 3300046463 Ga0495653_0003920 Ga0495653_0003920_1016_2224 400
1787 3300046472 Ga0495580_0060064 Ga0495580_0060064_235_1437 400
1788 3300046473 Ga0495582_0043732 Ga0495582_0043732_1020_2222 400
1789 3300046475 Ga0495639_0026983 Ga0495639_0026983_813_2015 400
1790 3300046477 Ga0495664_0021717 Ga0495664_0021717_1306_2514 400
1791 3300046477 Ga0495664_0045911 Ga0495664_0045911_765_1967 400
1792 3300046491 Ga0495584_0024343 Ga0495584_0024343_766_1986 400
1793 3300046499 Ga0495594_0017473 Ga0495594_0017473_1745_2965 400
1794 3300046511 Ga0495608_0001846 Ga0495608_0001846_12921_14129 400
1795 3300046511 Ga0495608_0017778 Ga0495608_0017778_2583_3785 400
1796 3300046514 Ga0495618_0004373 Ga0495618_0004373_5917_7179 400
1797 3300046514 Ga0495618_0004744 Ga0495618_0004744_995_2203 400
1798 3300046514 Ga0495618_0034137 Ga0495618_0034137_839_2041 400
1799 3300046516 Ga0495628_0006552 Ga0495628_0006552_918_2120 400
1800 3300046516 Ga0495628_0047408 Ga0495628_0047408_961_2223 400
1801 3300046529 Ga0495652_0006629 Ga0495652_0006629_4609_5817 400
1802 3300046529 Ga0495652_0009321 Ga0495652_0009321_6803_8005 400
1803 3300046529 Ga0495652_0111015 Ga0495652_0111015_377_1579 400
1804 3300046533 Ga0495640_0029214 Ga0495640_0029214_2066_3268 400
1805 3300046533 Ga0495640_0049273 Ga0495640_0049273_701_1909 400
1806 3300046535 Ga0495586_0042791 Ga0495586_0042791_919_2121 400
1807 3300046536 Ga0495587_0001888 Ga0495587_0001888_11566_12768 400
1808 3300046536 Ga0495587_0005079 Ga0495587_0005079_2858_4066 400
1809 3300046536 Ga0495587_0014102 Ga0495587_0014102_2760_3965 400
1810 3300046557 Ga0495622_0040468 Ga0495622_0040468_754_1956 400
1811 3300046559 Ga0495667_0001608 Ga0495667_0001608_12856_14058 400
1812 3300046559 Ga0495667_0038813 Ga0495667_0038813_996_2204 400
1813 3300046642 Ga0495634_0015273 Ga0495634_0015273_3369_4577 400
1814 3300046663 Ga0495635_0023909 Ga0495635_0023909_2079_3287 400
1815 3300046663 Ga0495635_0025287 Ga0495635_0025287_1918_3120 400
1816 3300046663 Ga0495635_0136801 Ga0495635_0136801_387_1631 400
1817 3300046675 Ga0495657_0001743 Ga0495657_0001743_2888_4090 400
1818 3300046675 Ga0495657_0002950 Ga0495657_0002950_11694_12902 400
1819 3300046675 Ga0495657_0030234 Ga0495657_0030234_1657_2862 400
1820 3300046678 Ga0495599_0024055 Ga0495599_0024055_1637_2845 400
1821 3300046678 Ga0495599_0029589 Ga0495599_0029589_2059_3261 400
1822 3300046679 Ga0495623_0003313 Ga0495623_0003313_1131_2333 400
1823 3300046679 Ga0495623_0109422 Ga0495623_0109422_277_1482 400
1824 3300046680 Ga0495646_0012826 Ga0495646_0012826_2996_4198 400
1825 3300046680 Ga0495646_0020360 Ga0495646_0020360_1224_2486 400
1826 3300046683 Ga0495658_0047517 Ga0495658_0047517_244_1470 400
1827 3300046689 Ga0495613_0110945 Ga0495613_0110945_125_1333 400
1828 3300046691 Ga0495670_0006357 Ga0495670_0006357_3431_4651 400
1829 3300046691 Ga0495670_0035456 Ga0495670_0035456_356_1576 400
1830 3300046809 Ga0495600_0017437 Ga0495600_0017437_2187_3389 400
1831 3300047315 Ga0495581_0039669 Ga0495581_0039669_26_1252 400
1832 3300047315 Ga0495581_0150610 Ga0495581_0150610_102_1325 400
1833 3300047317 Ga0495604_0002321 Ga0495604_0002321_5605_6807 400
1834 3300047317 Ga0495604_0003737 Ga0495604_0003737_9940_11148 400
1835 3300047317 Ga0495604_0087512 Ga0495604_0087512_174_1379 400
1836 3300047319 Ga0495674_0037223 Ga0495674_0037223_985_2193 400
1837 3300047319 Ga0495674_0045603 Ga0495674_0045603_1560_2762 400
1838 3300047322 Ga0495680_0000961 Ga0495680_0000961_29793_31001 400
1839 3300047322 Ga0495680_0033763 Ga0495680_0033763_1287_2489 400
1840 3300047444 Ga0495675_0043669 Ga0495675_0043669_1072_2274 400
1841 3300047444 Ga0495675_0045207 Ga0495675_0045207_892_2097 400
1842 3300047444 Ga0495675_0050201 Ga0495675_0050201_902_2110 400
1843 3300047471 Ga0495684_0014496 Ga0495684_0014496_968_2176 400
1844 3300047471 Ga0495684_0190506 Ga0495684_0190506_59_1261 400
1845 3300047673 Ga0495593_0045391 Ga0495593_0045391_415_1617 400
1846 3300047673 Ga0495593_0091925 Ga0495593_0091925_172_1398 400
1847 3300048088 Ga0495602_0008058 Ga0495602_0008058_1202_2404 400
1848 3300048088 Ga0495602_0017570 Ga0495602_0017570_981_2189 400
1849 3300048088 Ga0495602_0103461 Ga0495602_0103461_51_1256 400
1850 3300048089 Ga0495614_0005613 Ga0495614_0005613_4192_5394 400
1851 3300048089 Ga0495614_0013126 Ga0495614_0013126_1173_2435 400
1852 3300048903 Ga0496100_0011196 Ga0496100_0011196_3583_4812 400
1853 3300048903 Ga0496100_0121175 Ga0496100_0121175_402_1622 400
1854 3300048904 Ga0496101_0004567 Ga0496101_0004567_4650_5879 400
1855 3300048905 Ga0496102_0055179 Ga0496102_0055179_2210_3412 400
1856 3300048905 Ga0496102_0146619 Ga0496102_0146619_214_1443 400
1857 3300048905 Ga0496102_0239422 Ga0496102_0239422_167_1432 400
1858 3300048906 Ga0496103_0012833 Ga0496103_0012833_1138_2367 400
1859 3300048906 Ga0496103_0056694 Ga0496103_0056694_35_1279 400
1860 3300048907 Ga0496104_0001385 Ga0496104_0001385_4167_5387 400
1861 3300048907 Ga0496104_0003097 Ga0496104_0003097_96_1325 400
1862 3300048907 Ga0496104_0005851 Ga0496104_0005851_6493_7713 400
1863 3300048907 Ga0496104_0056813 Ga0496104_0056813_964_2166 400
1864 3300048907 Ga0496104_0060822 Ga0496104_0060822_981_2252 400
1865 3300048908 Ga0496105_0014056 Ga0496105_0014056_1755_2975 400
1866 3300048909 Ga0496106_0005608 Ga0496106_0005608_1030_2259 400
1867 3300048909 Ga0496106_0028107 Ga0496106_0028107_1749_2993 400
1868 3300048909 Ga0496106_0043614 Ga0496106_0043614_463_1728 400
1869 3300048909 Ga0496106_0051938 Ga0496106_0051938_774_1976 400
1870 3300048910 Ga0496107_0011187 Ga0496107_0011187_1926_3170 400
1871 3300048910 Ga0496107_0019686 Ga0496107_0019686_507_1778 400
1872 3300048910 Ga0496107_0041466 Ga0496107_0041466_1068_2333 400
1873 3300048910 Ga0496107_0044052 Ga0496107_0044052_654_1856 400
1874 3300048910 Ga0496107_0053648 Ga0496107_0053648_1595_2815 400
1875 3300048911 Ga0496108_0001956 Ga0496108_0001956_11599_12870 400
1876 3300048911 Ga0496108_0016333 Ga0496108_0016333_4130_5359 400
1877 3300048911 Ga0496108_0037967 Ga0496108_0037967_2317_3546 400
1878 3300048912 Ga0496109_0015645 Ga0496109_0015645_1031_2302 400
1879 3300048912 Ga0496109_0040371 Ga0496109_0040371_692_1921 400
1880 3300048912 Ga0496109_0124424 Ga0496109_0124424_683_1927 400
1881 3300048912 Ga0496109_0124874 Ga0496109_0124874_136_1356 400
1882 3300048913 Ga0496110_0019605 Ga0496110_0019605_3815_5035 400
1883 3300048913 Ga0496110_0020370 Ga0496110_0020370_2081_3310 400
1884 3300048913 Ga0496110_0045194 Ga0496110_0045194_558_1787 400
1885 3300048913 Ga0496110_0084097 Ga0496110_0084097_772_1974 400
1886 3300048913 Ga0496110_0339871 Ga0496110_0339871_94_1338 400
1887 3300048914 Ga0496111_0080724 Ga0496111_0080724_593_1813 400
1888 3300048915 Ga0496112_0045180 Ga0496112_0045180_695_1924 400
1889 3300048916 Ga0496113_0000507 Ga0496113_0000507_5919_7190 400
1890 3300048916 Ga0496113_0123955 Ga0496113_0123955_125_1354 400
1891 3300048917 Ga0496114_0029297 Ga0496114_0029297_551_1795 400
1892 3300048917 Ga0496114_0062416 Ga0496114_0062416_707_1927 400
1893 3300048918 Ga0496115_0014328 Ga0496115_0014328_3245_4474 400
1894 3300048918 Ga0496115_0030055 Ga0496115_0030055_618_1883 400
1895 3300048918 Ga0496115_0080864 Ga0496115_0080864_149_1369 400
1896 3300049569 Ga0501032_0067777 Ga0501032_0067777_282_1490 400
1897 3300049570 Ga0501033_0006434 Ga0501033_0006434_7733_8941 400
1898 3300049570 Ga0501033_0014240 Ga0501033_0014240_128_1333 400
1899 3300049571 Ga0501034_0025924 Ga0501034_0025924_2472_3677 400
1900 3300049571 Ga0501034_0091982 Ga0501034_0091982_1362_2627 400
1901 3300049571 Ga0501034_0143974 Ga0501034_0143974_259_1467 400
1902 3300049572 Ga0501036_0021764 Ga0501036_0021764_2458_3663 400
1903 3300049572 Ga0501036_0119515 Ga0501036_0119515_437_1645 400
1904 3300049573 Ga0501037_0025673 Ga0501037_0025673_1269_2474 400
1905 3300049574 Ga0501038_0005137 Ga0501038_0005137_2276_3481 400
1906 3300049574 Ga0501038_0048289 Ga0501038_0048289_1084_2292 400
1907 3300049575 Ga0501039_0008309 Ga0501039_0008309_790_1998 400
1908 3300049575 Ga0501039_0048689 Ga0501039_0048689_1245_2450 400
1909 3300049578 Ga0501042_0053866 Ga0501042_0053866_493_1713 400
1910 3300049581 Ga0501047_0175542 Ga0501047_0175542_212_1426 400
1911 3300049582 Ga0501048_0001241 Ga0501048_0001241_17918_19126 400
1912 3300049583 Ga0501067_0003745 Ga0501067_0003745_594_1802 400
1913 3300049584 Ga0501068_0010011 Ga0501068_0010011_267_1475 400
1914 3300049585 Ga0501069_0000569 Ga0501069_0000569_15569_16777 400
1915 3300049585 Ga0501069_0023608 Ga0501069_0023608_709_1911 400
1916 3300049586 Ga0501070_0047081 Ga0501070_0047081_2126_3331 400
1917 3300049586 Ga0501070_0121622 Ga0501070_0121622_345_1553 400
1918 3300049588 Ga0501072_0030467 Ga0501072_0030467_2210_3412 400
1919 3300049589 Ga0501073_0005896 Ga0501073_0005896_7733_8941 400
1920 3300049590 Ga0501074_0070320 Ga0501074_0070320_225_1433 400
1921 3300049593 Ga0501077_0101266 Ga0501077_0101266_354_1628 400
1922 3300049742 Ga0501080_0029348 Ga0501080_0029348_1619_2821 400
1923 3300049742 Ga0501080_0101038 Ga0501080_0101038_1260_2525 400
1924 3300049742 Ga0501080_0114052 Ga0501080_0114052_214_1422 400
1925 3300049822 Ga0501035_0070318 Ga0501035_0070318_1451_2659 400
1926 3300049823 Ga0501044_0000332 Ga0501044_0000332_56669_57877 400
1927 3300049823 Ga0501044_0087367 Ga0501044_0087367_1817_3022 400
1928 3300049823 Ga0501044_0127202 Ga0501044_0127202_895_2103 400
1929 3300049823 Ga0501044_0128755 Ga0501044_0128755_1242_2456 400
1930 3300049824 Ga0501045_0002048 Ga0501045_0002048_6458_7666 400
1931 3300050492 nmdc:mga0yw44_133910_c1 nmdc:mga0yw44_133910_c1_234_1478 400
1932 3300050493 nmdc:mga0k408_17957_c1 nmdc:mga0k408_17957_c1_2257_3522 400
1933 3300050493 nmdc:mga0k408_71060_c1 nmdc:mga0k408_71060_c1_390_1634 400
1934 3300050494 nmdc:mga06z11_9073_c2 nmdc:mga06z11_9073_c2_768_2033 400
1935 3300050507 nmdc:mga05p37_1104_c1 nmdc:mga05p37_1104_c1_8615_9853 400
1936 3300050507 nmdc:mga05p37_22613_c1 nmdc:mga05p37_22613_c1_803_2023 400
1937 3300050507 nmdc:mga05p37_50587_c1 nmdc:mga05p37_50587_c1_1254_2474 400
1938 3300050507 nmdc:mga05p37_6767_c1 nmdc:mga05p37_6767_c1_9944_11266 400
1939 3300050508 nmdc:mga09592_121334_c1 nmdc:mga09592_121334_c1_70_1314 400
1940 3300050508 nmdc:mga09592_5959_c1 nmdc:mga09592_5959_c1_430_1668 400
1941 3300050509 nmdc:mga0qj67_2775_c1 nmdc:mga0qj67_2775_c1_9098_10336 400
1942 3300050509 nmdc:mga0qj67_28_c1 nmdc:mga0qj67_28_c1_101150_102370 400
1943 3300050510 nmdc:mga06r32_736_c1 nmdc:mga06r32_736_c1_21714_22952 400
1944 3300050510 nmdc:mga06r32_95007_c1 nmdc:mga06r32_95007_c1_853_2073 400
1945 3300050512 nmdc:mga0n895_135227_c1 nmdc:mga0n895_135227_c1_753_2075 400
1946 3300050512 nmdc:mga0n895_18432_c1 nmdc:mga0n895_18432_c1_1372_2598 400
1947 3300050512 nmdc:mga0n895_1980_c1 nmdc:mga0n895_1980_c1_33_1271 400
1948 3300050512 nmdc:mga0n895_33594_c2 nmdc:mga0n895_33594_c2_1663_2871 400
1949 3300050513 nmdc:mga0rr50_137650_c1 nmdc:mga0rr50_137650_c1_654_1862 400
1950 3300050513 nmdc:mga0rr50_18315_c1 nmdc:mga0rr50_18315_c1_2631_3869 400
1951 3300050514 nmdc:mga08x19_67532_c1 nmdc:mga08x19_67532_c1_341_1603 400
1952 3300050515 nmdc:mga0a205_16697_c1 nmdc:mga0a205_16697_c1_5601_6839 400
1953 3300050515 nmdc:mga0a205_2279_c1 nmdc:mga0a205_2279_c1_12784_14022 400
1954 3300050515 nmdc:mga0a205_57124_c1 nmdc:mga0a205_57124_c1_395_1621 400
1955 3300053077 Ga0495601_0000735 Ga0495601_0000735_301_1506 400
1956 3300053077 Ga0495601_0008131 Ga0495601_0008131_964_2172 400
1957 3300053077 Ga0495601_0047541 Ga0495601_0047541_918_2120 400
1958 3300053077 Ga0495601_0075837 Ga0495601_0075837_217_1419 400
1959 3300053078 Ga0495612_0007834 Ga0495612_0007834_1071_2273 400
1960 3300053078 Ga0495612_0023110 Ga0495612_0023110_984_2189 400
1961 3300053083 Ga0495655_0017313 Ga0495655_0017313_66_1286 400
1962 3300053084 Ga0495595_0001971 Ga0495595_0001971_992_2200 400
1963 3300053084 Ga0495595_0002327 Ga0495595_0002327_3326_4528 400
1964 3300053085 Ga0495619_0004010 Ga0495619_0004010_995_2203 400
1965 3300053085 Ga0495619_0009064 Ga0495619_0009064_3582_4787 400
1966 3300053085 Ga0495619_0015609 Ga0495619_0015609_2081_3283 400
1967 3300053085 Ga0495619_0031766 Ga0495619_0031766_1732_2952 400
1968 3300053094 Ga0500566_0005897 Ga0500566_0005897_1246_2454 400
1969 3300053119 Ga0500595_001782 Ga0500595_001782_1326_2534 400
1970 3300053153 Ga0500616_0000001 Ga0500616_0000001_522388_523596 400
1971 3300060353 Ga0501082_0128227 Ga0501082_0128227_796_2070 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

97

463

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ord-assembly1.cif.gz_B crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution 0.981 5 386
2eh6-assembly1.cif.gz_B crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5 0.9796 3 384
4adb-assembly1.cif.gz_A structural and functional study of succinyl-ornithine transaminase from e. coli 0.9785 4 389
4jev-assembly1.cif.gz_B n-acetylornithine aminotransferase from s. typhimurium complexed with gabaculine 0.9776 5 388
2eh6-assembly1.cif.gz_B crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5 0.9745 3 384
ID Description Score Start End Superfamily
4addA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9825 48 293 3.40.640.10
2eh6A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.979 48 292 3.40.640.10
4addA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9785 48 293 3.40.640.10
4adeB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9764 48 293 3.40.640.10
2eh6A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.975 48 292 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A346A4S7-F1-model_v4 Acetylornithine aminotransferase (ACOAT) (EC 2.6.1.11) 0.9981 1 393 GO:0003992
GO:0005737
GO:0006526
GO:0030170
GO:0042802
AF-A0A8A8PLS6-F1-model_v4 deleted 0.9949 2 390
AF-A0A528B4G0-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9925 175 320 GO:0008483
GO:0030170
GO:0042802
AF-A0A2E6CB88-F1-model_v4 Acetylornithine aminotransferase (ACOAT) (EC 2.6.1.11) 0.9923 8 386 GO:0003992
GO:0005737
GO:0006526
GO:0030170
GO:0042802
AF-A0A017HLY4-F1-model_v4 Acetylornithine aminotransferase (ACOAT) (EC 2.6.1.11) 0.9921 3 387 GO:0003992
GO:0005737
GO:0006526
GO:0030170
GO:0042802

Feature Viewer

pLDDT pTM Quality
95.91 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map