F496160

General Info

Members Datasets Scaffolds Average Seq Length
1965 751 1786 90

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0078600|Ga0496101_0078600_501_773
Length 90
Sequence MTATVEIYTRPGCGYCSAAKSLLARKKAAFTEFDVAQDPTFRQQMFERAGARIFPQIFIGQTHVGGCNELYALDRAGKLDGLLAGEKVKL

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
10 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
11 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
12 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
13 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
14 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
15 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
16 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
17 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
18 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
19 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2791355199
22 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
23 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
24 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
25 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
26 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
27 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
28 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
29 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
30 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
31 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
32 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
33 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
34 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
35 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
36 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
37 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
38 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
39 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
40 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
41 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
42 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
43 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
44 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
45 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
46 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
47 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
48 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
49 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
50 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
51 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
52 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
53 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
54 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
55 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
56 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
57 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
58 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
59 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
60 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
61 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
62 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
63 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
64 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
65 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
66 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
67 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
68 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
69 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
70 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
71 2906610324
72 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
73 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
74 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
75 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
76 2922368715
77 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
78 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
79 2922425934
80 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
81 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
82 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
83 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
84 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
85 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
86 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
87 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
88 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
89 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
90 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
91 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
92 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
93 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
94 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
95 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
96 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
97 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
98 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
99 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
100 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
101 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
102 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
103 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
104 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
105 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
106 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
107 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
108 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
109 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
110 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
111 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
112 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
113 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
114 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
115 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
116 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
117 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
118 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
119 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
120 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
121 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
122 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
123 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
124 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
125 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
126 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
127 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
128 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
129 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
130 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
131 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
132 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
133 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
134 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
135 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
136 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
137 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
138 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
139 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
140 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
141 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
142 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
143 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
144 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
145 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
146 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
147 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
148 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
149 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
150 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
151 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
152 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
153 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
154 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
155 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
156 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
157 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
158 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
159 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
160 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
161 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
162 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
163 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
164 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
165 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
166 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
167 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
168 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
169 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
170 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
171 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
172 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
173 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
174 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
175 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
176 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
177 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
178 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
179 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
180 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
184 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
185 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
186 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
187 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
188 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
189 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
190 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
191 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
192 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
193 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
194 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
195 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
196 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
197 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
198 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
199 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
200 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
201 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
202 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
203 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
204 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
205 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
206 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
207 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
208 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
209 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
210 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
211 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
212 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
213 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
214 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
215 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
216 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
217 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
218 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
219 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
220 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
221 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
222 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
223 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
224 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
225 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
226 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
227 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
228 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
229 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
230 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
231 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
232 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
233 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
234 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
235 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
236 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
237 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
238 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
239 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
240 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
241 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
242 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
243 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
244 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
245 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
246 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
247 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
248 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
249 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
250 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
251 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
252 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
253 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
254 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
255 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
256 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
257 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
258 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
259 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
260 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
261 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
262 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
263 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
264 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
265 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
266 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
267 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
268 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
269 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
270 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
271 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
272 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
273 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
274 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
275 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
276 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
277 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
278 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
279 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
280 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
281 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
282 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
283 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
284 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
285 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
286 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
287 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
288 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
289 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
290 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
291 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
292 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
293 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
294 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
295 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
296 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
297 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
298 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
299 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
300 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
301 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
302 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
305 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
307 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
308 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
309 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
310 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
377 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
378 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
379 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
380 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
382 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
383 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
387 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
388 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
389 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
390 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
391 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
392 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
393 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
394 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
395 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
396 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
397 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
398 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
399 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
400 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
401 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
402 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
403 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
404 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
405 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
406 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
407 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
408 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
409 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
410 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
411 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
412 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
413 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
414 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
415 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
416 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
417 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
418 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
419 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
420 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
421 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
422 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
423 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
424 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
425 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
426 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
427 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
428 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
429 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
430 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
431 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
432 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
433 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
434 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
435 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
436 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
437 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
438 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
439 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
440 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
441 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
442 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
443 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
444 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
445 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
446 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
447 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
448 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
449 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
450 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
451 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
452 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
453 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
454 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
455 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
456 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
457 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
458 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
459 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
460 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
461 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
462 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
463 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
464 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
465 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
466 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
467 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
468 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
469 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
470 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
471 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
472 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
473 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
474 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
475 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
476 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
477 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
478 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
479 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
480 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
481 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
482 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
483 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
484 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
485 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
486 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
487 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
488 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
489 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
490 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
491 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
492 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
493 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
494 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
495 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
496 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
497 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
498 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
499 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
500 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
501 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
502 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
503 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
504 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
505 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
506 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
507 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
508 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
509 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
510 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
511 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
512 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
513 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
514 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
515 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
516 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
517 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
518 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
519 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
520 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
521 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
522 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
523 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
524 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
525 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
526 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
527 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
528 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
529 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
530 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
531 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
532 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
533 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
534 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
535 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
536 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
537 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
538 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
539 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
540 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
541 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
542 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
543 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
544 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
545 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
546 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
547 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
548 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
549 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
550 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
551 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
552 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
553 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
554 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
555 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
556 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
557 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
558 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
559 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
560 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
561 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
562 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
563 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
564 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
565 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
566 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
567 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
568 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
569 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
570 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
571 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
572 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
573 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
574 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
575 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
576 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
577 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
578 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
579 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
580 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
581 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
582 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
583 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
584 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
585 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
586 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
587 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
588 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
589 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
590 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
591 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
592 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
593 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
594 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
595 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
596 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
597 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
598 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
599 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
600 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
601 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
602 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
603 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
604 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
605 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
606 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
607 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
608 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
609 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
610 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
611 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
612 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
613 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
614 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
615 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
616 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
617 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
618 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
619 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
620 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
621 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
622 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
623 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
624 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
625 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
626 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
627 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
628 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
629 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
630 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
631 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
632 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
633 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
635 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
636 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
637 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
638 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
639 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
640 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
641 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
642 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
643 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
644 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
645 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
646 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
647 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
648 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
649 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
650 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
651 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
652 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
653 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
654 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
655 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
656 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
657 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
658 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
659 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
660 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
661 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
662 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
663 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
664 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
665 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
666 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
667 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
668 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
669 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
670 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
671 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
672 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
673 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
674 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
675 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
676 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
677 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
678 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
679 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
680 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
681 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
682 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
683 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
684 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
685 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
686 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
687 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
688 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
689 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
690 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
691 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
692 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
693 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
694 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
695 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
696 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
697 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
698 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
699 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
700 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
701 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
702 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
703 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
704 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
705 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
706 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
707 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
708 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
709 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
710 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
711 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
712 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
713 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
714 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
715 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
716 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
717 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
718 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
719 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
720 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
721 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
722 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
723 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
724 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
725 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
726 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
727 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
728 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
729 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
730 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
731 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
732 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
733 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
734 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
735 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
736 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
737 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
738 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
739 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
740 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
741 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
742 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
743 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
744 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
745 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
746 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
747 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
748 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
749 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
750 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
751 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.08
Metatranscriptomes 0
Isolates 8.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.08
Nodule 7.58
Rhizoplane 6.67
Rhizosphere 64.89
Stem 0
Stem Tuber 0
Unclassified 7.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1010017 3300000532 Bacteria 632
2 JGI24739J22299_10049881 3300001989 Bacteria 1355
3 JGI24737J22298_10157681 3300001990 Bacteria 670
4 JGI24743J22301_10063579 3300001991 Bacteria 763
5 JGI24744J21845_10047710 3300002077 Bacteria 793
6 JGI24742J22300_10068797 3300002244 Bacteria 658
7 JGI25165J46597_1026270 3300003214 Bacteria 754
8 JGI25153J46596_10000591 3300003215 Bacteria 22150
9 JGI25153J46596_10004570 3300003215 Bacteria 7426
10 JGI25160J50197_1001574 3300003354 Bacteria 11262
11 JGI25404J52841_10013166 3300003659 Bacteria 1794
12 Ga0055539_1004555 3300003752 Bacteria 1841
13 Ga0055542_1006221 3300003762 Bacteria 2578
14 Ga0055531_10005617 3300003794 Bacteria 7297
15 Ga0055543_1002362 3300004625 Bacteria 6306
16 Ga0065165_1004274 3300005262 Bacteria 9020
17 Ga0065165_1007132 3300005262 Bacteria 5599
18 Ga0065165_1010207 3300005262 Bacteria 4094
19 Ga0070658_10085417 3300005327 Bacteria 2595
20 Ga0070658_10125998 3300005327 Bacteria 2132
21 Ga0070658_11848480 3300005327 Bacteria 522
22 Ga0070676_10599044 3300005328 Bacteria 794
23 Ga0070676_10664363 3300005328 Bacteria 758
24 Ga0070676_11165147 3300005328 Bacteria 584
25 Ga0070683_100194147 3300005329 Bacteria 1928
26 Ga0070683_100852593 3300005329 Bacteria 874
27 Ga0070690_100102671 3300005330 Bacteria 1897
28 Ga0070690_100599969 3300005330 Bacteria 836
29 Ga0070690_100661884 3300005330 Bacteria 799
30 Ga0070690_100704555 3300005330 Bacteria 776
31 Ga0070670_100162962 3300005331 Bacteria 1933
32 Ga0070670_100746492 3300005331 Bacteria 882
33 Ga0070670_100919310 3300005331 Bacteria 794
34 Ga0070670_101544837 3300005331 Bacteria 610
35 Ga0070677_10239779 3300005333 Bacteria 895
36 Ga0068869_100061214 3300005334 Bacteria 2760
37 Ga0068869_100171445 3300005334 Bacteria 1695
38 Ga0068869_100501352 3300005334 Bacteria 1013
39 Ga0068869_100792055 3300005334 Bacteria 814
40 Ga0068869_101786086 3300005334 Bacteria 550
41 Ga0070666_10350927 3300005335 Bacteria 1056
42 Ga0070666_10368740 3300005335 Bacteria 1029
43 Ga0070666_10430015 3300005335 Bacteria 952
44 Ga0070666_10462681 3300005335 Bacteria 917
45 Ga0070666_11289707 3300005335 Bacteria 545
46 Ga0070666_11372899 3300005335 Bacteria 528
47 Ga0070680_100013669 3300005336 Bacteria 6328
48 Ga0070680_100159935 3300005336 Bacteria 1892
49 Ga0070682_100061312 3300005337 Bacteria 2380
50 Ga0070682_100252144 3300005337 Bacteria 1273
51 Ga0068868_100023606 3300005338 Bacteria 4656
52 Ga0068868_100098967 3300005338 Bacteria 2358
53 Ga0070660_100063948 3300005339 Bacteria 2861
54 Ga0070660_100307878 3300005339 Bacteria 1300
55 Ga0070660_100374642 3300005339 Bacteria 1175
56 Ga0070660_100542515 3300005339 Bacteria 970
57 Ga0070660_100693413 3300005339 Bacteria 854
58 Ga0070660_101391073 3300005339 Bacteria 596
59 Ga0070660_101428265 3300005339 Bacteria 588
60 Ga0070660_101443855 3300005339 Bacteria 585
61 Ga0070689_100474571 3300005340 Bacteria 1068
62 Ga0070691_10337237 3300005341 Bacteria 834
63 Ga0070691_10386113 3300005341 Bacteria 786
64 Ga0070687_100138819 3300005343 Bacteria 1413
65 Ga0070661_100320373 3300005344 Bacteria 1211
66 Ga0070661_100460755 3300005344 Bacteria 1013
67 Ga0070661_100606127 3300005344 Bacteria 886
68 Ga0070661_100644368 3300005344 Bacteria 860
69 Ga0070661_101619095 3300005344 Bacteria 548
70 Ga0070692_10091303 3300005345 Bacteria 1656
71 Ga0070692_10582604 3300005345 Bacteria 737
72 Ga0070668_100030308 3300005347 Bacteria 4112
73 Ga0070668_100034627 3300005347 Bacteria 3849
74 Ga0070668_100128957 3300005347 Bacteria 2028
75 Ga0070668_100341800 3300005347 Bacteria 1264
76 Ga0070668_100587968 3300005347 Bacteria 973
77 Ga0070668_100729751 3300005347 Bacteria 875
78 Ga0070669_100172602 3300005353 Bacteria 1687
79 Ga0070669_100419104 3300005353 Bacteria 1099
80 Ga0070669_100856445 3300005353 Bacteria 775
81 Ga0070669_100935048 3300005353 Bacteria 742
82 Ga0070669_101502443 3300005353 Bacteria 585
83 Ga0070675_100241631 3300005354 Bacteria 1578
84 Ga0070675_100432863 3300005354 Bacteria 1178
85 Ga0070675_100663086 3300005354 Bacteria 949
86 Ga0070675_100692523 3300005354 Bacteria 928
87 Ga0070671_100088263 3300005355 Bacteria 2595
88 Ga0070671_100242406 3300005355 Bacteria 1530
89 Ga0070671_100337717 3300005355 Bacteria 1285
90 Ga0070671_100447901 3300005355 Bacteria 1107
91 Ga0070671_100852753 3300005355 Bacteria 795
92 Ga0070671_101056084 3300005355 Bacteria 713
93 Ga0070674_100088132 3300005356 Bacteria 2233
94 Ga0070674_100118359 3300005356 Bacteria 1957
95 Ga0070674_100136137 3300005356 Bacteria 1837
96 Ga0070674_100591015 3300005356 Bacteria 937
97 Ga0070673_100089572 3300005364 Bacteria 2512
98 Ga0070673_100348439 3300005364 Bacteria 1314
99 Ga0070673_100500018 3300005364 Bacteria 1099
100 Ga0070673_100668792 3300005364 Bacteria 952
101 Ga0070673_101234378 3300005364 Bacteria 701
102 Ga0070688_101246943 3300005365 Bacteria 599
103 Ga0070688_101589611 3300005365 Bacteria 534
104 Ga0070659_100431421 3300005366 Bacteria 1115
105 Ga0070659_100646238 3300005366 Bacteria 912
106 Ga0070659_100677290 3300005366 Bacteria 891
107 Ga0070667_100385399 3300005367 Bacteria 1274
108 Ga0070667_100539348 3300005367 Bacteria 1072
109 Ga0070667_100617233 3300005367 Bacteria 1000
110 Ga0070667_100839964 3300005367 Bacteria 854
111 Ga0070667_101126508 3300005367 Bacteria 734
112 Ga0070667_101129709 3300005367 Bacteria 733
113 Ga0070667_101210405 3300005367 Bacteria 707
114 Ga0070709_10501654 3300005434 Bacteria 922
115 Ga0070714_100045997 3300005435 Bacteria 3700
116 Ga0070714_100274949 3300005435 Bacteria 1563
117 Ga0070714_100912573 3300005435 Bacteria 853
118 Ga0070714_102048301 3300005435 Bacteria 558
119 Ga0070713_100014537 3300005436 Bacteria 5852
120 Ga0070713_100018727 3300005436 Bacteria 5267
121 Ga0070713_100323459 3300005436 Bacteria 1425
122 Ga0070713_100745148 3300005436 Bacteria 937
123 Ga0070710_10085355 3300005437 Bacteria 1852
124 Ga0070710_10107141 3300005437 Bacteria 1673
125 Ga0070710_10810101 3300005437 Bacteria 670
126 Ga0070701_10349185 3300005438 Bacteria 924
127 Ga0070701_10405848 3300005438 Bacteria 864
128 Ga0070711_100036810 3300005439 Bacteria 3280
129 Ga0070711_100069956 3300005439 Bacteria 2470
130 Ga0070711_100694249 3300005439 Bacteria 856
131 Ga0070705_101940551 3300005440 Bacteria 502
132 Ga0070700_101651795 3300005441 Bacteria 549
133 Ga0070700_101776670 3300005441 Bacteria 531
134 Ga0070694_100263251 3300005444 Bacteria 1309
135 Ga0070694_100936352 3300005444 Bacteria 717
136 Ga0070663_100006147 3300005455 Bacteria 7191
137 Ga0070663_100052956 3300005455 Bacteria 2896
138 Ga0070663_100164445 3300005455 Bacteria 1710
139 Ga0070663_100171144 3300005455 Bacteria 1679
140 Ga0070663_100282803 3300005455 Bacteria 1322
141 Ga0070663_100372900 3300005455 Bacteria 1160
142 Ga0070663_100402161 3300005455 Bacteria 1120
143 Ga0070663_100638089 3300005455 Bacteria 899
144 Ga0070678_100037879 3300005456 Bacteria 3390
145 Ga0070678_100161098 3300005456 Bacteria 1818
146 Ga0070678_100222161 3300005456 Bacteria 1571
147 Ga0070678_100471966 3300005456 Bacteria 1102
148 Ga0070678_100486603 3300005456 Bacteria 1087
149 Ga0070678_100544302 3300005456 Bacteria 1030
150 Ga0070678_101239881 3300005456 Bacteria 692
151 Ga0070678_101479475 3300005456 Bacteria 635
152 Ga0070662_100148538 3300005457 Bacteria 1822
153 Ga0070662_100212944 3300005457 Bacteria 1538
154 Ga0070662_101444385 3300005457 Bacteria 593
155 Ga0070681_10084452 3300005458 Bacteria 3127
156 Ga0070681_10115679 3300005458 Bacteria 2620
157 Ga0068867_100201214 3300005459 Bacteria 1594
158 Ga0068867_102084977 3300005459 Bacteria 537
159 Ga0070685_10832079 3300005466 Bacteria 683
160 Ga0070685_10842817 3300005466 Bacteria 679
161 Ga0070685_11191103 3300005466 Bacteria 579
162 Ga0070698_100144666 3300005471 Bacteria 2327
163 Ga0070698_101006717 3300005471 Bacteria 781
164 Ga0070699_101980495 3300005518 Bacteria 533
165 Ga0070679_100011418 3300005530 Bacteria 8464
166 Ga0070679_101740189 3300005530 Bacteria 571
167 Ga0070684_101074967 3300005535 Bacteria 756
168 Ga0068853_100163053 3300005539 Bacteria 2012
169 Ga0068853_100243311 3300005539 Bacteria 1649
170 Ga0068853_100392583 3300005539 Bacteria 1297
171 Ga0068853_100644934 3300005539 Bacteria 1008
172 Ga0070672_100012411 3300005543 Bacteria 5979
173 Ga0070672_101053439 3300005543 Bacteria 722
174 Ga0070672_101631555 3300005543 Bacteria 579
175 Ga0070696_100101469 3300005546 Bacteria 2062
176 Ga0070693_100279973 3300005547 Bacteria 1117
177 Ga0070693_100403308 3300005547 Bacteria 949
178 Ga0070693_101533462 3300005547 Bacteria 522
179 Ga0070665_100022438 3300005548 Bacteria 6352
180 Ga0070665_100072156 3300005548 Bacteria 3460
181 Ga0070665_100093197 3300005548 Bacteria 3016
182 Ga0070665_100107411 3300005548 Bacteria 2793
183 Ga0070665_100111541 3300005548 Bacteria 2737
184 Ga0070665_100140122 3300005548 Bacteria 2422
185 Ga0070665_100204646 3300005548 Bacteria 1974
186 Ga0070665_100266706 3300005548 Bacteria 1713
187 Ga0070665_100468237 3300005548 Bacteria 1270
188 Ga0070665_100838428 3300005548 Bacteria 932
189 Ga0070665_102205192 3300005548 Bacteria 555
190 Ga0070665_102272782 3300005548 Bacteria 545
191 Ga0070704_100598655 3300005549 Bacteria 969
192 Ga0068855_100025627 3300005563 Bacteria 7054
193 Ga0068855_100102183 3300005563 Bacteria 3299
194 Ga0068855_100197760 3300005563 Bacteria 2264
195 Ga0068855_100230759 3300005563 Bacteria 2073
196 Ga0068855_100372445 3300005563 Bacteria 1569
197 Ga0068855_101773481 3300005563 Bacteria 628
198 Ga0068855_102543438 3300005563 Bacteria 509
199 Ga0070664_100207369 3300005564 Bacteria 1751
200 Ga0070664_100893967 3300005564 Bacteria 833
201 Ga0070664_102024282 3300005564 Bacteria 546
202 Ga0070664_102278877 3300005564 Bacteria 514
203 Ga0068857_100881225 3300005577 Bacteria 857
204 Ga0068857_101149855 3300005577 Bacteria 750
205 Ga0068857_101271794 3300005577 Bacteria 714
206 Ga0068857_101878130 3300005577 Bacteria 587
207 Ga0068854_100622776 3300005578 Bacteria 924
208 Ga0068856_100053715 3300005614 Bacteria 3972
209 Ga0068856_100354164 3300005614 Bacteria 1486
210 Ga0068856_100753536 3300005614 Bacteria 994
211 Ga0068856_101364063 3300005614 Bacteria 724
212 Ga0070702_101328497 3300005615 Bacteria 585
213 Ga0068852_100025239 3300005616 Bacteria 4813
214 Ga0068852_100226690 3300005616 Bacteria 1780
215 Ga0068852_100257456 3300005616 Bacteria 1674
216 Ga0068852_100612513 3300005616 Bacteria 1094
217 Ga0068852_100991703 3300005616 Bacteria 859
218 Ga0068852_101066518 3300005616 Bacteria 828
219 Ga0068852_101334881 3300005616 Bacteria 739
220 Ga0068852_101905203 3300005616 Bacteria 617
221 Ga0068859_100097876 3300005617 Bacteria 2987
222 Ga0068859_100267387 3300005617 Bacteria 1802
223 Ga0068859_100491251 3300005617 Bacteria 1323
224 Ga0068859_102576261 3300005617 Bacteria 560
225 Ga0068859_102885755 3300005617 Bacteria 527
226 Ga0068864_100023369 3300005618 Bacteria 5190
227 Ga0068864_100069630 3300005618 Bacteria 3060
228 Ga0068864_100288422 3300005618 Bacteria 1534
229 Ga0068864_100473879 3300005618 Bacteria 1201
230 Ga0068864_102604051 3300005618 Bacteria 512
231 Ga0068866_10030405 3300005718 Bacteria 2592
232 Ga0068866_10201366 3300005718 Bacteria 1190
233 Ga0068866_10256322 3300005718 Bacteria 1073
234 Ga0068861_100020519 3300005719 Bacteria 4736
235 Ga0068861_100688563 3300005719 Bacteria 948
236 Ga0068861_100696571 3300005719 Bacteria 943
237 Ga0068861_100934405 3300005719 Bacteria 824
238 Ga0068861_100982661 3300005719 Bacteria 805
239 Ga0068861_101302064 3300005719 Bacteria 707
240 Ga0068851_10861471 3300005834 Bacteria 566
241 Ga0068870_10087211 3300005840 Bacteria 1737
242 Ga0068870_10657166 3300005840 Bacteria 719
243 Ga0068863_100390092 3300005841 Bacteria 1360
244 Ga0068863_100506994 3300005841 Bacteria 1188
245 Ga0068863_100703149 3300005841 Bacteria 1005
246 Ga0068863_100735770 3300005841 Bacteria 982
247 Ga0068858_100109449 3300005842 Bacteria 2579
248 Ga0068858_100339942 3300005842 Bacteria 1437
249 Ga0068858_100414167 3300005842 Bacteria 1295
250 Ga0068858_100470179 3300005842 Bacteria 1213
251 Ga0068858_101255612 3300005842 Bacteria 729
252 Ga0068858_101279923 3300005842 Bacteria 721
253 Ga0068860_100191633 3300005843 Bacteria 1978
254 Ga0068860_100236923 3300005843 Bacteria 1774
255 Ga0068860_100277662 3300005843 Bacteria 1636
256 Ga0068860_100344465 3300005843 Bacteria 1466
257 Ga0068860_102617323 3300005843 Bacteria 524
258 Ga0068862_100175212 3300005844 Bacteria 1922
259 Ga0068862_100257681 3300005844 Bacteria 1591
260 Ga0068862_100274979 3300005844 Bacteria 1542
261 Ga0068862_100300185 3300005844 Bacteria 1477
262 Ga0068862_100370303 3300005844 Bacteria 1333
263 Ga0068862_100688105 3300005844 Bacteria 990
264 Ga0068862_100996249 3300005844 Bacteria 828
265 Ga0068862_101092453 3300005844 Bacteria 792
266 Ga0068862_101735247 3300005844 Unclassified 633
267 Ga0081455_10005919 3300005937 Bacteria 13272
268 Ga0081455_10024690 3300005937 Bacteria 5561
269 Ga0081455_10063407 3300005937 Bacteria 3102
270 Ga0081455_10368984 3300005937 Bacteria 1007
271 Ga0081455_10825196 3300005937 Bacteria 580
272 Ga0081540_1004312 3300005983 Bacteria 10899
273 Ga0081540_1007028 3300005983 Bacteria 8095
274 Ga0081540_1015422 3300005983 Bacteria 4840
275 Ga0081540_1015982 3300005983 Bacteria 4727
276 Ga0081540_1018244 3300005983 Bacteria 4313
277 Ga0081540_1025146 3300005983 Bacteria 3436
278 Ga0081540_1044261 3300005983 Bacteria 2274
279 Ga0081540_1047963 3300005983 Bacteria 2143
280 Ga0081540_1274359 3300005983 Bacteria 583
281 Ga0081540_1346707 3300005983 Bacteria 508
282 Ga0081539_10001014 3300005985 Bacteria 51820
283 Ga0081539_10029861 3300005985 Bacteria 3397
284 Ga0081539_10066584 3300005985 Bacteria 1952
285 Ga0070717_10153068 3300006028 Bacteria 1996
286 Ga0070717_11198356 3300006028 Bacteria 691
287 Ga0075365_10021867 3300006038 Bacteria 3996
288 Ga0075365_10040963 3300006038 Bacteria 3023
289 Ga0075365_10060433 3300006038 Bacteria 2528
290 Ga0075365_10176577 3300006038 Bacteria 1492
291 Ga0075365_10218361 3300006038 Bacteria 1337
292 Ga0075365_10245631 3300006038 Bacteria 1257
293 Ga0075365_10303700 3300006038 Bacteria 1123
294 Ga0075365_10398449 3300006038 Bacteria 971
295 Ga0075365_10838117 3300006038 Bacteria 649
296 Ga0075368_10007821 3300006042 Bacteria 3788
297 Ga0075368_10045459 3300006042 Bacteria 1735
298 Ga0075368_10062685 3300006042 Bacteria 1490
299 Ga0075368_10087727 3300006042 Bacteria 1271
300 Ga0075368_10181728 3300006042 Bacteria 887
301 Ga0075368_10412112 3300006042 Bacteria 595
302 Ga0075363_100026218 3300006048 Bacteria 2979
303 Ga0075363_100064878 3300006048 Bacteria 1973
304 Ga0075363_100148054 3300006048 Bacteria 1324
305 Ga0075363_100259364 3300006048 Bacteria 1002
306 Ga0075363_100360194 3300006048 Bacteria 851
307 Ga0075363_100383396 3300006048 Bacteria 824
308 Ga0075363_100510489 3300006048 Bacteria 715
309 Ga0075363_100565938 3300006048 Bacteria 679
310 Ga0075363_100587550 3300006048 Bacteria 666
311 Ga0075364_10087713 3300006051 Bacteria 2062
312 Ga0075364_10123083 3300006051 Bacteria 1737
313 Ga0075364_10191331 3300006051 Bacteria 1386
314 Ga0075364_10415216 3300006051 Bacteria 918
315 Ga0075364_10437905 3300006051 Bacteria 893
316 Ga0075364_10470927 3300006051 Bacteria 858
317 Ga0075364_10474152 3300006051 Bacteria 855
318 Ga0070715_10002760 3300006163 Bacteria 5455
319 Ga0070716_100026589 3300006173 Bacteria 3100
320 Ga0070716_101415471 3300006173 Bacteria 566
321 Ga0070712_100029284 3300006175 Bacteria 3690
322 Ga0070712_100247222 3300006175 Bacteria 1423
323 Ga0070712_100612403 3300006175 Bacteria 923
324 Ga0075362_10032878 3300006177 Bacteria 2254
325 Ga0075362_10129391 3300006177 Bacteria 1199
326 Ga0075362_10165492 3300006177 Bacteria 1066
327 Ga0075362_10209879 3300006177 Bacteria 950
328 Ga0075362_10312231 3300006177 Bacteria 782
329 Ga0075362_10333917 3300006177 Bacteria 757
330 Ga0075362_10431477 3300006177 Bacteria 668
331 Ga0075367_10018278 3300006178 Bacteria 3865
332 Ga0075367_10025365 3300006178 Bacteria 3352
333 Ga0075367_10033336 3300006178 Bacteria 2967
334 Ga0075367_10188882 3300006178 Bacteria 1285
335 Ga0075367_10215595 3300006178 Bacteria 1201
336 Ga0075367_10302139 3300006178 Bacteria 1007
337 Ga0075367_10346915 3300006178 Bacteria 937
338 Ga0075367_10742037 3300006178 Bacteria 625
339 Ga0075369_10064576 3300006186 Bacteria 1603
340 Ga0075369_10077396 3300006186 Bacteria 1471
341 Ga0075369_10149412 3300006186 Bacteria 1068
342 Ga0075369_10157650 3300006186 Bacteria 1039
343 Ga0075369_10202369 3300006186 Bacteria 916
344 Ga0075369_10295070 3300006186 Bacteria 756
345 Ga0075369_10471120 3300006186 Bacteria 596
346 Ga0075369_10527148 3300006186 Bacteria 563
347 Ga0075427_10025493 3300006194 Bacteria 954
348 Ga0075366_10002600 3300006195 Bacteria 9280
349 Ga0075366_10022790 3300006195 Bacteria 3645
350 Ga0075366_10142287 3300006195 Bacteria 1450
351 Ga0075366_10166020 3300006195 Bacteria 1339
352 Ga0075366_10319826 3300006195 Bacteria 950
353 Ga0075366_10595147 3300006195 Bacteria 685
354 Ga0075366_11066440 3300006195 Bacteria 505
355 Ga0097621_100033379 3300006237 Bacteria 4098
356 Ga0097621_100508825 3300006237 Bacteria 1092
357 Ga0097621_100991488 3300006237 Bacteria 785
358 Ga0097621_101086467 3300006237 Bacteria 751
359 Ga0097621_101138180 3300006237 Bacteria 734
360 Ga0075370_10007477 3300006353 Bacteria 5566
361 Ga0075370_10054435 3300006353 Bacteria 2272
362 Ga0075370_10076945 3300006353 Bacteria 1914
363 Ga0075370_10155546 3300006353 Bacteria 1341
364 Ga0075370_10160023 3300006353 Bacteria 1321
365 Ga0075370_10185570 3300006353 Bacteria 1225
366 Ga0075370_10246389 3300006353 Bacteria 1058
367 Ga0075370_10501427 3300006353 Bacteria 733
368 Ga0075370_10510998 3300006353 Bacteria 725
369 Ga0075370_10746821 3300006353 Bacteria 596
370 Ga0068871_100250437 3300006358 Bacteria 1543
371 Ga0068871_100264625 3300006358 Bacteria 1501
372 Ga0068871_100868780 3300006358 Bacteria 835
373 Ga0068871_101005786 3300006358 Bacteria 776
374 Ga0068871_101962941 3300006358 Bacteria 557
375 Ga0068871_102096694 3300006358 Bacteria 538
376 Ga0075430_101199873 3300006846 Bacteria 625
377 Ga0075431_101859086 3300006847 Bacteria 558
378 Ga0075433_10317789 3300006852 Bacteria 1378
379 Ga0075434_100384881 3300006871 Bacteria 1424
380 Ga0075434_100466664 3300006871 Bacteria 1284
381 Ga0075434_102176271 3300006871 Bacteria 559
382 Ga0075429_101392915 3300006880 Bacteria 611
383 Ga0068865_100392449 3300006881 Bacteria 1135
384 Ga0068865_100536479 3300006881 Bacteria 981
385 Ga0068865_101476240 3300006881 Bacteria 609
386 Ga0075436_101161527 3300006914 Bacteria 582
387 Ga0097620_100097872 3300006931 Bacteria 2987
388 Ga0097620_100267389 3300006931 Bacteria 1802
389 Ga0097620_100491232 3300006931 Bacteria 1323
390 Ga0097620_102576281 3300006931 Bacteria 560
391 Ga0097620_102885492 3300006931 Bacteria 527
392 Ga0099825_1049937 3300006941 Bacteria 923
393 Ga0099824_1012187 3300006942 Bacteria 9468
394 Ga0099823_1032421 3300006944 Bacteria 4253
395 Ga0099823_1094769 3300006944 Bacteria 974
396 Ga0099794_10088918 3300007265 Bacteria 1531
397 Ga0105251_10176229 3300009011 Bacteria 963
398 Ga0105244_10244773 3300009036 Bacteria 837
399 Ga0105240_10005129 3300009093 Bacteria 19597
400 Ga0105240_10180668 3300009093 Bacteria 2490
401 Ga0111539_10099026 3300009094 Bacteria 3424
402 Ga0111539_10255735 3300009094 Bacteria 2039
403 Ga0111539_10613637 3300009094 Bacteria 1267
404 Ga0111539_11194434 3300009094 Bacteria 883
405 Ga0111539_11425700 3300009094 Bacteria 803
406 Ga0105245_10098878 3300009098 Bacteria 2697
407 Ga0105245_10288417 3300009098 Bacteria 1607
408 Ga0105245_10569210 3300009098 Bacteria 1156
409 Ga0105245_11154911 3300009098 Bacteria 821
410 Ga0105245_11564531 3300009098 Bacteria 711
411 Ga0105245_11926375 3300009098 Bacteria 644
412 Ga0105245_12699492 3300009098 Bacteria 550
413 Ga0105245_13204609 3300009098 Bacteria 507
414 Ga0105247_10100542 3300009101 Bacteria 1848
415 Ga0105247_10188812 3300009101 Bacteria 1379
416 Ga0105247_10250160 3300009101 Bacteria 1211
417 Ga0105247_10429767 3300009101 Bacteria 947
418 Ga0105247_10508067 3300009101 Bacteria 879
419 Ga0105247_11566563 3300009101 Bacteria 540
420 Ga0114129_10270068 3300009147 Bacteria 2276
421 Ga0114129_10897562 3300009147 Bacteria 1123
422 Ga0105243_10054913 3300009148 Bacteria 3164
423 Ga0105243_10076583 3300009148 Bacteria 2719
424 Ga0105243_10201155 3300009148 Bacteria 1747
425 Ga0105243_10234234 3300009148 Bacteria 1631
426 Ga0105243_10466021 3300009148 Bacteria 1189
427 Ga0105243_10486231 3300009148 Bacteria 1166
428 Ga0105243_10796458 3300009148 Bacteria 931
429 Ga0105243_11294592 3300009148 Bacteria 746
430 Ga0105241_10014074 3300009174 Bacteria 5862
431 Ga0105241_10026870 3300009174 Bacteria 4284
432 Ga0105241_10325222 3300009174 Bacteria 1327
433 Ga0105241_10434358 3300009174 Bacteria 1158
434 Ga0105241_10604965 3300009174 Bacteria 991
435 Ga0105241_10626896 3300009174 Bacteria 974
436 Ga0105241_10750351 3300009174 Bacteria 895
437 Ga0105241_11331133 3300009174 Bacteria 685
438 Ga0105241_11965013 3300009174 Bacteria 575
439 Ga0105241_12115623 3300009174 Bacteria 556
440 Ga0105242_10057054 3300009176 Bacteria 3197
441 Ga0105242_10376127 3300009176 Bacteria 1319
442 Ga0105242_10670030 3300009176 Bacteria 1011
443 Ga0105242_11232800 3300009176 Bacteria 769
444 Ga0105242_13045283 3300009176 Bacteria 519
445 Ga0105248_10026773 3300009177 Bacteria 6413
446 Ga0105248_10189413 3300009177 Bacteria 2318
447 Ga0105248_10613050 3300009177 Bacteria 1228
448 Ga0105248_10885328 3300009177 Bacteria 1008
449 Ga0105248_11257753 3300009177 Bacteria 837
450 Ga0105248_11281078 3300009177 Bacteria 829
451 Ga0105248_11710633 3300009177 Bacteria 713
452 Ga0105237_10022489 3300009545 Bacteria 6469
453 Ga0105237_10132980 3300009545 Bacteria 2482
454 Ga0105237_10252951 3300009545 Bacteria 1764
455 Ga0105237_10565423 3300009545 Bacteria 1144
456 Ga0105237_11152833 3300009545 Bacteria 782
457 Ga0105237_11153225 3300009545 Bacteria 782
458 Ga0105237_11225916 3300009545 Bacteria 757
459 Ga0105237_11836122 3300009545 Bacteria 614
460 Ga0105237_11895198 3300009545 Bacteria 604
461 Ga0105238_10204076 3300009551 Bacteria 1953
462 Ga0105238_10506669 3300009551 Bacteria 1208
463 Ga0105238_10787077 3300009551 Bacteria 966
464 Ga0105238_11037214 3300009551 Bacteria 842
465 Ga0105238_11344644 3300009551 Bacteria 741
466 Ga0105249_10117532 3300009553 Bacteria 2522
467 Ga0105249_10321021 3300009553 Bacteria 1560
468 Ga0105249_10438350 3300009553 Bacteria 1343
469 Ga0105249_10647406 3300009553 Bacteria 1114
470 Ga0105249_11873594 3300009553 Bacteria 672
471 Ga0105249_11965744 3300009553 Bacteria 657
472 Ga0099796_10101010 3300010159 Bacteria 1085
473 Ga0099796_10248914 3300010159 Bacteria 737
474 Ga0105239_10024829 3300010375 Bacteria 6603
475 Ga0105239_10054122 3300010375 Bacteria 4401
476 Ga0105239_10262639 3300010375 Bacteria 1941
477 Ga0105239_10444613 3300010375 Bacteria 1470
478 Ga0105239_10472716 3300010375 Bacteria 1424
479 Ga0105239_10916787 3300010375 Bacteria 1006
480 Ga0105239_11005937 3300010375 Bacteria 958
481 Ga0105239_11054285 3300010375 Bacteria 935
482 Ga0105239_11142083 3300010375 Bacteria 897
483 Ga0105239_11327192 3300010375 Bacteria 830
484 Ga0105239_11574303 3300010375 Bacteria 760
485 Ga0105239_12268873 3300010375 Bacteria 631
486 Ga0105246_10142896 3300011119 Bacteria 1802
487 Ga0105246_10147427 3300011119 Bacteria 1777
488 Ga0105246_10151187 3300011119 Bacteria 1757
489 Ga0105246_10273820 3300011119 Bacteria 1351
490 Ga0105246_10733602 3300011119 Bacteria 869
491 Ga0105246_12032575 3300011119 Bacteria 555
492 Ga0157317_1007755 3300012475 Bacteria 776
493 Ga0157335_1012157 3300012492 Bacteria 717
494 Ga0157316_1038527 3300012510 Bacteria 613
495 Ga0157338_1023987 3300012515 Bacteria 732
496 Ga0157373_10258053 3300013100 Bacteria 1233
497 Ga0157373_10358359 3300013100 Bacteria 1041
498 Ga0157373_11204978 3300013100 Bacteria 571
499 Ga0157371_10307577 3300013102 Bacteria 1148
500 Ga0157371_10885451 3300013102 Bacteria 676
501 Ga0157370_10353691 3300013104 Bacteria 1354
502 Ga0157370_10632589 3300013104 Bacteria 979
503 Ga0157370_10669770 3300013104 Bacteria 948
504 Ga0157369_11240524 3300013105 Bacteria 760
505 Ga0157374_10097080 3300013296 Bacteria 2819
506 Ga0157374_10222359 3300013296 Bacteria 1853
507 Ga0157374_10399636 3300013296 Bacteria 1371
508 Ga0157374_11089363 3300013296 Bacteria 819
509 Ga0157374_11614945 3300013296 Bacteria 672
510 Ga0157374_12392028 3300013296 Bacteria 556
511 Ga0157378_10012413 3300013297 Bacteria 7459
512 Ga0157378_10209172 3300013297 Bacteria 1849
513 Ga0157378_10295599 3300013297 Bacteria 1566
514 Ga0157378_10534902 3300013297 Bacteria 1175
515 Ga0157378_11092753 3300013297 Bacteria 834
516 Ga0163162_10243792 3300013306 Bacteria 1928
517 Ga0163162_10472754 3300013306 Bacteria 1385
518 Ga0163162_10586720 3300013306 Bacteria 1241
519 Ga0163162_10654863 3300013306 Bacteria 1174
520 Ga0163162_10779157 3300013306 Bacteria 1075
521 Ga0163162_11244585 3300013306 Bacteria 845
522 Ga0163162_11286156 3300013306 Bacteria 831
523 Ga0163162_11431752 3300013306 Bacteria 786
524 Ga0163162_13126152 3300013306 Bacteria 531
525 Ga0157372_10297185 3300013307 Bacteria 1878
526 Ga0157372_10839566 3300013307 Bacteria 1067
527 Ga0157372_12018047 3300013307 Bacteria 663
528 Ga0157375_10025269 3300013308 Bacteria 5515
529 Ga0157375_10165233 3300013308 Bacteria 2358
530 Ga0157375_10218421 3300013308 Bacteria 2064
531 Ga0157375_10272113 3300013308 Bacteria 1856
532 Ga0157375_11604187 3300013308 Bacteria 769
533 Ga0157375_12271154 3300013308 Bacteria 647
534 Ga0163163_10052116 3300014325 Bacteria 4036
535 Ga0163163_10133233 3300014325 Bacteria 2525
536 Ga0163163_10169035 3300014325 Bacteria 2233
537 Ga0163163_10321233 3300014325 Bacteria 1602
538 Ga0163163_10494330 3300014325 Bacteria 1285
539 Ga0163163_10890232 3300014325 Bacteria 954
540 Ga0157380_10144369 3300014326 Bacteria 2049
541 Ga0157380_12103428 3300014326 Bacteria 627
542 Ga0157380_12512107 3300014326 Bacteria 581
543 Ga0157380_13050573 3300014326 Bacteria 534
544 Ga0182008_10096708 3300014497 Bacteria 1457
545 Ga0157377_10336699 3300014745 Bacteria 1008
546 Ga0157377_10890112 3300014745 Bacteria 664
547 Ga0157377_10967617 3300014745 Bacteria 642
548 Ga0157377_10985110 3300014745 Bacteria 637
549 Ga0157377_11425536 3300014745 Bacteria 547
550 Ga0157379_10246860 3300014968 Bacteria 1620
551 Ga0157379_10506271 3300014968 Bacteria 1120
552 Ga0157379_10598906 3300014968 Bacteria 1029
553 Ga0157379_10778881 3300014968 Bacteria 902
554 Ga0157379_11086448 3300014968 Bacteria 766
555 Ga0157376_10044498 3300014969 Bacteria 3650
556 Ga0157376_10614844 3300014969 Bacteria 1083
557 Ga0157376_11920223 3300014969 Bacteria 629
558 Ga0157376_12674144 3300014969 Bacteria 539
559 Ga0182006_1139191 3300015261 Bacteria 830
560 Ga0182007_10314892 3300015262 Bacteria 578
561 Ga0163161_10189290 3300017792 Bacteria 1581
562 Ga0163161_10235211 3300017792 Bacteria 1423
563 Ga0163161_10334614 3300017792 Bacteria 1200
564 Ga0163161_10397807 3300017792 Bacteria 1104
565 Ga0163161_10655898 3300017792 Bacteria 870
566 Ga0163161_11078760 3300017792 Bacteria 689
567 Ga0163161_11204217 3300017792 Bacteria 655
568 Ga0163161_11363687 3300017792 Bacteria 618
569 Ga0214544_1000087 3300021320 Bacteria 119600
570 Ga0214544_1031151 3300021320 Bacteria 1783
571 Ga0214542_1000018 3300021321 Bacteria 202226
572 Ga0214545_1000009 3300021324 Bacteria 202915
573 Ga0214543_1000037 3300021327 Bacteria 182113
574 Ga0213873_10002059 3300021358 Bacteria 3442
575 Ga0213874_10014111 3300021377 Bacteria 2083
576 Ga0213876_10059215 3300021384 Bacteria 2021
577 Ga0213876_10097724 3300021384 Bacteria 1556
578 Ga0209677_101272 3300025253 Bacteria 11319
579 Ga0209148_1003487 3300025254 Bacteria 4321
580 Ga0209233_1003722 3300025261 Bacteria 5327
581 Ga0209233_1010790 3300025261 Bacteria 2717
582 Ga0209233_1024188 3300025261 Bacteria 1524
583 Ga0209455_1013168 3300025272 Bacteria 1935
584 Ga0209455_1028795 3300025272 Bacteria 966
585 Ga0209564_1033426 3300025295 Bacteria 1529
586 Ga0209758_1000030 3300025297 Bacteria 509217
587 Ga0209758_1000884 3300025297 Bacteria 41143
588 Ga0209758_1000949 3300025297 Bacteria 39098
589 Ga0209758_1005183 3300025297 Bacteria 10249
590 Ga0209758_1017944 3300025297 Bacteria 3494
591 Ga0209758_1061349 3300025297 Bacteria 1239
592 Ga0209256_1023598 3300025299 Bacteria 1830
593 Ga0207426_1001522 3300025302 Bacteria 18884
594 Ga0209257_1003355 3300025304 Bacteria 13856
595 Ga0209257_1007964 3300025304 Bacteria 6203
596 Ga0207697_10077409 3300025315 Bacteria 1398
597 Ga0207697_10362960 3300025315 Bacteria 643
598 Ga0207656_10674112 3300025321 Bacteria 529
599 Ga0207656_10718212 3300025321 Bacteria 512
600 Ga0207653_10059960 3300025885 Bacteria 1281
601 Ga0207682_10237733 3300025893 Bacteria 846
602 Ga0207692_10008712 3300025898 Bacteria 4211
603 Ga0207692_10087835 3300025898 Bacteria 1679
604 Ga0207692_10505206 3300025898 Bacteria 768
605 Ga0207692_10840203 3300025898 Bacteria 602
606 Ga0207692_11152895 3300025898 Bacteria 514
607 Ga0207642_10022593 3300025899 Bacteria 2498
608 Ga0207642_10086927 3300025899 Bacteria 1534
609 Ga0207642_10120571 3300025899 Bacteria 1352
610 Ga0207642_10894336 3300025899 Bacteria 569
611 Ga0207642_11125754 3300025899 Bacteria 508
612 Ga0207710_10058227 3300025900 Bacteria 1747
613 Ga0207710_10229173 3300025900 Bacteria 924
614 Ga0207710_10314688 3300025900 Bacteria 793
615 Ga0207710_10572863 3300025900 Bacteria 589
616 Ga0207688_10057975 3300025901 Bacteria 2178
617 Ga0207688_10136772 3300025901 Bacteria 1439
618 Ga0207688_10169865 3300025901 Bacteria 1296
619 Ga0207688_10419377 3300025901 Bacteria 832
620 Ga0207688_10467064 3300025901 Bacteria 788
621 Ga0207688_10616045 3300025901 Bacteria 684
622 Ga0207680_10467864 3300025903 Bacteria 896
623 Ga0207680_10515587 3300025903 Bacteria 852
624 Ga0207680_10849215 3300025903 Bacteria 655
625 Ga0207647_10019817 3300025904 Bacteria 4517
626 Ga0207647_10417913 3300025904 Bacteria 754
627 Ga0207685_10118958 3300025905 Bacteria 1157
628 Ga0207685_10544128 3300025905 Bacteria 617
629 Ga0207699_10007899 3300025906 Bacteria 5219
630 Ga0207699_10137624 3300025906 Bacteria 1601
631 Ga0207645_10084088 3300025907 Bacteria 2042
632 Ga0207645_10259099 3300025907 Bacteria 1152
633 Ga0207645_10347515 3300025907 Bacteria 992
634 Ga0207645_10934494 3300025907 Bacteria 589
635 Ga0207643_10063346 3300025908 Bacteria 2114
636 Ga0207643_10095563 3300025908 Bacteria 1737
637 Ga0207643_10155142 3300025908 Bacteria 1375
638 Ga0207705_10089780 3300025909 Bacteria 2249
639 Ga0207705_10225240 3300025909 Bacteria 1425
640 Ga0207705_11529199 3300025909 Bacteria 505
641 Ga0207654_10044200 3300025911 Bacteria 2529
642 Ga0207654_10251238 3300025911 Bacteria 1185
643 Ga0207654_10302362 3300025911 Bacteria 1088
644 Ga0207654_10581473 3300025911 Bacteria 798
645 Ga0207654_10603172 3300025911 Bacteria 783
646 Ga0207654_10882951 3300025911 Bacteria 648
647 Ga0207654_11159927 3300025911 Bacteria 563
648 Ga0207707_10374213 3300025912 Bacteria 1225
649 Ga0207707_10466420 3300025912 Bacteria 1079
650 Ga0207695_10000059 3300025913 Bacteria 363920
651 Ga0207695_10324452 3300025913 Bacteria 1429
652 Ga0207671_10012029 3300025914 Bacteria 6990
653 Ga0207671_10082197 3300025914 Bacteria 2417
654 Ga0207671_10505279 3300025914 Bacteria 964
655 Ga0207671_10616654 3300025914 Bacteria 864
656 Ga0207671_10681154 3300025914 Bacteria 818
657 Ga0207671_10797920 3300025914 Bacteria 749
658 Ga0207671_10895891 3300025914 Bacteria 701
659 Ga0207671_11002576 3300025914 Bacteria 658
660 Ga0207693_10000073 3300025915 Bacteria 89380
661 Ga0207693_10037685 3300025915 Bacteria 3810
662 Ga0207693_10138394 3300025915 Bacteria 1914
663 Ga0207693_10250212 3300025915 Bacteria 1391
664 Ga0207663_10000861 3300025916 Bacteria 13793
665 Ga0207663_10256120 3300025916 Bacteria 1290
666 Ga0207663_10346249 3300025916 Bacteria 1124
667 Ga0207663_11492252 3300025916 Bacteria 544
668 Ga0207660_10145827 3300025917 Bacteria 1814
669 Ga0207662_10209012 3300025918 Bacteria 1266
670 Ga0207662_10333638 3300025918 Bacteria 1015
671 Ga0207657_10008532 3300025919 Bacteria 10390
672 Ga0207657_10069862 3300025919 Bacteria 2978
673 Ga0207657_10146254 3300025919 Bacteria 1927
674 Ga0207657_10168010 3300025919 Bacteria 1778
675 Ga0207657_10241016 3300025919 Bacteria 1444
676 Ga0207657_10246447 3300025919 Bacteria 1425
677 Ga0207657_10306455 3300025919 Bacteria 1257
678 Ga0207657_10327117 3300025919 Bacteria 1211
679 Ga0207649_10043961 3300025920 Bacteria 2734
680 Ga0207649_10091698 3300025920 Bacteria 1991
681 Ga0207649_10389294 3300025920 Bacteria 1041
682 Ga0207649_10467038 3300025920 Bacteria 955
683 Ga0207649_10516100 3300025920 Bacteria 910
684 Ga0207649_11200608 3300025920 Bacteria 599
685 Ga0207652_10038542 3300025921 Bacteria 4053
686 Ga0207652_10372188 3300025921 Bacteria 1289
687 Ga0207652_10612144 3300025921 Bacteria 976
688 Ga0207652_10823858 3300025921 Bacteria 823
689 Ga0207681_10187422 3300025923 Bacteria 1580
690 Ga0207681_11078311 3300025923 Bacteria 674
691 Ga0207694_10387668 3300025924 Bacteria 1160
692 Ga0207694_11226439 3300025924 Bacteria 634
693 Ga0207694_11314463 3300025924 Bacteria 611
694 Ga0207650_10227234 3300025925 Bacteria 1504
695 Ga0207650_10284290 3300025925 Bacteria 1348
696 Ga0207650_10430867 3300025925 Bacteria 1095
697 Ga0207659_10162773 3300025926 Bacteria 1753
698 Ga0207659_10995182 3300025926 Bacteria 721
699 Ga0207687_10235411 3300025927 Bacteria 1449
700 Ga0207687_10282908 3300025927 Bacteria 1330
701 Ga0207687_10515161 3300025927 Bacteria 1000
702 Ga0207687_11882164 3300025927 Bacteria 511
703 Ga0207700_10040878 3300025928 Bacteria 3388
704 Ga0207700_10443359 3300025928 Bacteria 1143
705 Ga0207700_10792735 3300025928 Bacteria 847
706 Ga0207664_10171885 3300025929 Bacteria 1855
707 Ga0207664_10486003 3300025929 Bacteria 1105
708 Ga0207644_10027415 3300025931 Bacteria 3935
709 Ga0207644_10103948 3300025931 Bacteria 2138
710 Ga0207644_10119860 3300025931 Bacteria 2002
711 Ga0207644_10310955 3300025931 Bacteria 1272
712 Ga0207644_10565863 3300025931 Bacteria 942
713 Ga0207644_10628917 3300025931 Bacteria 892
714 Ga0207644_11327727 3300025931 Bacteria 604
715 Ga0207690_10205321 3300025932 Bacteria 1499
716 Ga0207690_10568409 3300025932 Bacteria 923
717 Ga0207690_11351035 3300025932 Bacteria 596
718 Ga0207690_11649734 3300025932 Bacteria 536
719 Ga0207690_11754784 3300025932 Bacteria 518
720 Ga0207706_10132711 3300025933 Bacteria 2190
721 Ga0207706_10274579 3300025933 Bacteria 1471
722 Ga0207706_10357272 3300025933 Bacteria 1270
723 Ga0207706_10693552 3300025933 Bacteria 870
724 Ga0207706_10751539 3300025933 Bacteria 831
725 Ga0207706_10993631 3300025933 Bacteria 705
726 Ga0207686_10200014 3300025934 Bacteria 1430
727 Ga0207686_10213599 3300025934 Bacteria 1388
728 Ga0207686_10488060 3300025934 Bacteria 954
729 Ga0207686_11749234 3300025934 Bacteria 514
730 Ga0207709_10093261 3300025935 Bacteria 1973
731 Ga0207709_10329465 3300025935 Bacteria 1146
732 Ga0207709_10483856 3300025935 Bacteria 963
733 Ga0207709_10683713 3300025935 Bacteria 820
734 Ga0207709_11112139 3300025935 Bacteria 649
735 Ga0207709_11636664 3300025935 Bacteria 535
736 Ga0207670_10257537 3300025936 Bacteria 1351
737 Ga0207670_10275416 3300025936 Bacteria 1310
738 Ga0207670_11787811 3300025936 Bacteria 523
739 Ga0207669_10193706 3300025937 Bacteria 1469
740 Ga0207669_10291146 3300025937 Bacteria 1236
741 Ga0207669_10556802 3300025937 Bacteria 926
742 Ga0207704_10040130 3300025938 Bacteria 2733
743 Ga0207704_10058678 3300025938 Bacteria 2371
744 Ga0207704_10510943 3300025938 Bacteria 970
745 Ga0207704_11101761 3300025938 Bacteria 675
746 Ga0207704_11163524 3300025938 Bacteria 657
747 Ga0207665_10000629 3300025939 Bacteria 23661
748 Ga0207665_10045899 3300025939 Bacteria 2926
749 Ga0207665_10085332 3300025939 Bacteria 2180
750 Ga0207691_10267953 3300025940 Bacteria 1471
751 Ga0207691_10292539 3300025940 Bacteria 1400
752 Ga0207691_10359556 3300025940 Bacteria 1245
753 Ga0207711_10088299 3300025941 Bacteria 2722
754 Ga0207711_10090078 3300025941 Bacteria 2696
755 Ga0207711_10474605 3300025941 Bacteria 1165
756 Ga0207711_10833098 3300025941 Bacteria 859
757 Ga0207711_10928218 3300025941 Bacteria 809
758 Ga0207711_11275474 3300025941 Bacteria 677
759 Ga0207689_10026821 3300025942 Bacteria 4824
760 Ga0207689_10061122 3300025942 Bacteria 3098
761 Ga0207689_10975787 3300025942 Bacteria 715
762 Ga0207689_11651776 3300025942 Bacteria 532
763 Ga0207679_10041467 3300025945 Bacteria 3300
764 Ga0207679_10116724 3300025945 Bacteria 2117
765 Ga0207679_10155767 3300025945 Bacteria 1865
766 Ga0207679_10391440 3300025945 Bacteria 1221
767 Ga0207679_10860977 3300025945 Bacteria 828
768 Ga0207667_10010745 3300025949 Bacteria 10678
769 Ga0207667_10079342 3300025949 Bacteria 3402
770 Ga0207667_10184475 3300025949 Bacteria 2142
771 Ga0207667_10325037 3300025949 Bacteria 1571
772 Ga0207667_10521084 3300025949 Bacteria 1204
773 Ga0207667_10568385 3300025949 Bacteria 1146
774 Ga0207667_10590340 3300025949 Bacteria 1121
775 Ga0207667_12069127 3300025949 Bacteria 528
776 Ga0207651_10132441 3300025960 Bacteria 1911
777 Ga0207651_10163180 3300025960 Bacteria 1749
778 Ga0207651_10209802 3300025960 Bacteria 1567
779 Ga0207651_11673613 3300025960 Bacteria 573
780 Ga0207712_10052003 3300025961 Bacteria 2868
781 Ga0207712_10241794 3300025961 Bacteria 1454
782 Ga0207712_10273030 3300025961 Bacteria 1376
783 Ga0207712_11040744 3300025961 Bacteria 727
784 Ga0207712_11130235 3300025961 Bacteria 698
785 Ga0207712_11225728 3300025961 Bacteria 670
786 Ga0207668_10015065 3300025972 Bacteria 4798
787 Ga0207668_10034118 3300025972 Bacteria 3377
788 Ga0207668_10112762 3300025972 Bacteria 2043
789 Ga0207668_10540123 3300025972 Bacteria 1008
790 Ga0207668_10764057 3300025972 Bacteria 853
791 Ga0207668_11017347 3300025972 Bacteria 741
792 Ga0207668_11266335 3300025972 Bacteria 663
793 Ga0207668_11807307 3300025972 Bacteria 551
794 Ga0207668_11985024 3300025972 Bacteria 524
795 Ga0207640_10432609 3300025981 Bacteria 1080
796 Ga0207640_10665773 3300025981 Bacteria 889
797 Ga0207640_10752345 3300025981 Bacteria 840
798 Ga0207640_11210983 3300025981 Bacteria 672
799 Ga0207658_10336915 3300025986 Bacteria 1310
800 Ga0207658_10374358 3300025986 Bacteria 1246
801 Ga0207658_10685635 3300025986 Bacteria 925
802 Ga0207658_11092816 3300025986 Bacteria 728
803 Ga0207677_10028452 3300026023 Bacteria 3535
804 Ga0207677_10814872 3300026023 Bacteria 836
805 Ga0207677_10926119 3300026023 Bacteria 787
806 Ga0207677_12153739 3300026023 Bacteria 519
807 Ga0207703_10167231 3300026035 Bacteria 1931
808 Ga0207703_10206390 3300026035 Bacteria 1749
809 Ga0207703_10405540 3300026035 Bacteria 1265
810 Ga0207703_10819204 3300026035 Bacteria 889
811 Ga0207639_10117242 3300026041 Bacteria 2182
812 Ga0207639_10198367 3300026041 Bacteria 1719
813 Ga0207639_10454833 3300026041 Bacteria 1163
814 Ga0207639_11958491 3300026041 Bacteria 547
815 Ga0207678_10013470 3300026067 Bacteria 7180
816 Ga0207678_10029495 3300026067 Bacteria 4788
817 Ga0207678_10041959 3300026067 Bacteria 3966
818 Ga0207678_10048018 3300026067 Bacteria 3691
819 Ga0207678_10151281 3300026067 Bacteria 1982
820 Ga0207678_10175048 3300026067 Bacteria 1832
821 Ga0207678_10308082 3300026067 Bacteria 1361
822 Ga0207678_10681749 3300026067 Bacteria 904
823 Ga0207678_10849431 3300026067 Bacteria 807
824 Ga0207678_10920785 3300026067 Bacteria 773
825 Ga0207678_11041024 3300026067 Bacteria 725
826 Ga0207678_11821227 3300026067 Bacteria 532
827 Ga0207708_10038351 3300026075 Bacteria 3650
828 Ga0207708_11577856 3300026075 Bacteria 577
829 Ga0207702_10073591 3300026078 Bacteria 2947
830 Ga0207702_10239848 3300026078 Bacteria 1698
831 Ga0207702_10659695 3300026078 Bacteria 1029
832 Ga0207641_10406992 3300026088 Bacteria 1307
833 Ga0207641_10725978 3300026088 Bacteria 980
834 Ga0207641_10816952 3300026088 Bacteria 923
835 Ga0207641_11428083 3300026088 Bacteria 693
836 Ga0207641_12433211 3300026088 Bacteria 522
837 Ga0207648_10063416 3300026089 Bacteria 3221
838 Ga0207648_10188474 3300026089 Bacteria 1827
839 Ga0207648_10324071 3300026089 Bacteria 1385
840 Ga0207676_10347002 3300026095 Bacteria 1371
841 Ga0207676_10453973 3300026095 Bacteria 1209
842 Ga0207676_10475560 3300026095 Bacteria 1182
843 Ga0207676_10495715 3300026095 Bacteria 1159
844 Ga0207676_10601516 3300026095 Bacteria 1056
845 Ga0207676_11436321 3300026095 Bacteria 686
846 Ga0207674_10032777 3300026116 Bacteria 5446
847 Ga0207674_10386500 3300026116 Bacteria 1353
848 Ga0207674_11195304 3300026116 Bacteria 730
849 Ga0207674_11315707 3300026116 Bacteria 692
850 Ga0207675_100024363 3300026118 Bacteria 5628
851 Ga0207675_100038345 3300026118 Bacteria 4471
852 Ga0207675_100060324 3300026118 Bacteria 3541
853 Ga0207675_100316303 3300026118 Bacteria 1523
854 Ga0207675_100359125 3300026118 Bacteria 1429
855 Ga0207675_100538293 3300026118 Bacteria 1166
856 Ga0207675_101523161 3300026118 Bacteria 689
857 Ga0207675_102063451 3300026118 Bacteria 587
858 Ga0207683_10159634 3300026121 Bacteria 2037
859 Ga0207683_10255498 3300026121 Bacteria 1599
860 Ga0207683_10297292 3300026121 Bacteria 1477
861 Ga0207683_10393388 3300026121 Bacteria 1275
862 Ga0207683_10438070 3300026121 Bacteria 1204
863 Ga0207683_10658458 3300026121 Bacteria 970
864 Ga0207683_10925630 3300026121 Bacteria 809
865 Ga0207683_12174647 3300026121 Bacteria 503
866 Ga0207698_10093752 3300026142 Bacteria 2466
867 Ga0207698_10114105 3300026142 Bacteria 2272
868 Ga0207698_10960043 3300026142 Bacteria 864
869 Ga0207698_11020451 3300026142 Bacteria 838
870 Ga0207698_11243058 3300026142 Bacteria 759
871 Ga0207698_11409582 3300026142 Bacteria 712
872 Ga0207698_12184697 3300026142 Bacteria 566
873 Ga0207698_12579149 3300026142 Bacteria 518
874 Ga0209389_1000110 3300027296 Bacteria 72586
875 Ga0209389_1000161 3300027296 Bacteria 55526
876 Ga0209589_1000103 3300027357 Bacteria 86516
877 Ga0209489_100304 3300027361 Bacteria 86516
878 Ga0209489_100524 3300027361 Bacteria 72457
879 Ga0209700_100334 3300027363 Bacteria 84979
880 Ga0209588_1043231 3300027671 Bacteria 1455
881 Ga0209813_10042224 3300027866 Bacteria 1393
882 Ga0209813_10047760 3300027866 Bacteria 1327
883 Ga0209813_10049632 3300027866 Bacteria 1307
884 Ga0209813_10176526 3300027866 Bacteria 779
885 Ga0209813_10228600 3300027866 Bacteria 699
886 Ga0207428_10165726 3300027907 Bacteria 1676
887 Ga0207428_10823148 3300027907 Bacteria 659
888 Ga0268266_10001416 3300028379 Bacteria 28634
889 Ga0268266_10011749 3300028379 Bacteria 7594
890 Ga0268266_10020841 3300028379 Bacteria 5590
891 Ga0268266_10027183 3300028379 Bacteria 4866
892 Ga0268266_10044293 3300028379 Bacteria 3804
893 Ga0268266_10113895 3300028379 Bacteria 2399
894 Ga0268266_10309677 3300028379 Bacteria 1475
895 Ga0268266_10860673 3300028379 Bacteria 876
896 Ga0268266_11088134 3300028379 Bacteria 773
897 Ga0268266_11216124 3300028379 Bacteria 728
898 Ga0268265_10375184 3300028380 Bacteria 1306
899 Ga0268265_10407186 3300028380 Bacteria 1259
900 Ga0268265_10500420 3300028380 Bacteria 1145
901 Ga0268265_10594833 3300028380 Bacteria 1056
902 Ga0268265_10941133 3300028380 Bacteria 850
903 Ga0268265_11209005 3300028380 Bacteria 753
904 Ga0268264_10031002 3300028381 Bacteria 4384
905 Ga0268264_10164525 3300028381 Bacteria 2001
906 Ga0268264_10170996 3300028381 Bacteria 1965
907 Ga0268264_10670884 3300028381 Bacteria 1027
908 Ga0268264_10838485 3300028381 Bacteria 920
909 Ga0268264_11129943 3300028381 Bacteria 792
910 Ga0265337_1024491 3300028556 Bacteria 1846
911 Ga0265326_10009229 3300028558 Bacteria 2949
912 Ga0265319_1012511 3300028563 Bacteria 3428
913 Ga0265318_10024721 3300028577 Bacteria 2380
914 Ga0265323_10001795 3300028653 Bacteria 10187
915 Ga0265322_10015165 3300028654 Bacteria 2228
916 Ga0265336_10002399 3300028666 Bacteria 7759
917 Ga0307517_10001290 3300028786 Bacteria 42017
918 Ga0307517_10133889 3300028786 Bacteria 1771
919 Ga0307515_10012007 3300028794 Bacteria 16357
920 Ga0307515_10574603 3300028794 Bacteria 737
921 Ga0307515_10783345 3300028794 Bacteria 575
922 Ga0265338_10000621 3300028800 Bacteria 61786
923 Ga0265324_10005519 3300029957 Bacteria 5450
924 Ga0307512_10144502 3300030522 Bacteria 1444
925 Ga0307512_10434286 3300030522 Bacteria 537
926 Ga0265339_10020628 3300031249 Bacteria 3846
927 Ga0265339_10020997 3300031249 Bacteria 3807
928 Ga0265331_10112715 3300031250 Bacteria 1246
929 Ga0265331_10139152 3300031250 Bacteria 1105
930 Ga0307513_10314063 3300031456 Bacteria 1328
931 Ga0307513_10336320 3300031456 Bacteria 1262
932 Ga0307513_10677842 3300031456 Bacteria 737
933 Ga0307509_10027988 3300031507 Bacteria 6268
934 Ga0307509_10629575 3300031507 Bacteria 743
935 Ga0307509_10958931 3300031507 Bacteria 521
936 Ga0307408_100178307 3300031548 Bacteria 1702
937 Ga0307408_100605490 3300031548 Bacteria 974
938 Ga0307408_101037691 3300031548 Bacteria 757
939 Ga0307408_101785822 3300031548 Bacteria 588
940 Ga0307408_102279168 3300031548 Bacteria 524
941 Ga0307508_10223155 3300031616 Bacteria 1484
942 Ga0307508_10525449 3300031616 Bacteria 780
943 Ga0307508_10778152 3300031616 Bacteria 572
944 Ga0265314_10220309 3300031711 Bacteria 1108
945 Ga0265342_10003812 3300031712 Bacteria 12140
946 Ga0307516_10113998 3300031730 Bacteria 2501
947 Ga0307516_10174381 3300031730 Bacteria 1888
948 Ga0307516_10443361 3300031730 Bacteria 955
949 Ga0307405_10298342 3300031731 Bacteria 1221
950 Ga0307405_10478197 3300031731 Bacteria 994
951 Ga0307413_11427903 3300031824 Bacteria 609
952 Ga0307410_10112141 3300031852 Bacteria 1975
953 Ga0307410_10246384 3300031852 Bacteria 1387
954 Ga0307410_10313405 3300031852 Bacteria 1242
955 Ga0326468_10005887 3300031889 Bacteria 1118
956 Ga0307406_10226438 3300031901 Bacteria 1393
957 Ga0307406_10391842 3300031901 Bacteria 1098
958 Ga0307406_10417281 3300031901 Bacteria 1068
959 Ga0307406_11427060 3300031901 Bacteria 607
960 Ga0307406_11597610 3300031901 Bacteria 576
961 Ga0307407_10574601 3300031903 Bacteria 836
962 Ga0307407_11646444 3300031903 Bacteria 510
963 Ga0307412_11472133 3300031911 Bacteria 618
964 Ga0307412_11974047 3300031911 Bacteria 540
965 Ga0307412_12015348 3300031911 Bacteria 534
966 Ga0307409_101075861 3300031995 Bacteria 825
967 Ga0307409_101663285 3300031995 Bacteria 667
968 Ga0307416_100138310 3300032002 Bacteria 2208
969 Ga0307416_101445213 3300032002 Bacteria 793
970 Ga0307416_101552107 3300032002 Bacteria 768
971 Ga0307416_101706913 3300032002 Bacteria 734
972 Ga0307416_101987675 3300032002 Bacteria 684
973 Ga0307414_10440057 3300032004 Bacteria 1141
974 Ga0307414_10571533 3300032004 Bacteria 1010
975 Ga0307414_11908826 3300032004 Bacteria 554
976 Ga0307411_10132522 3300032005 Bacteria 1824
977 Ga0307411_10618577 3300032005 Bacteria 933
978 Ga0307415_101062555 3300032126 Bacteria 756
979 Ga0307415_101139567 3300032126 Bacteria 732
980 Ga0307415_101429136 3300032126 Bacteria 659
981 Ga0307507_10261091 3300033179 Bacteria 1106
982 Ga0307510_10035286 3300033180 Bacteria 5588
983 Ga0307510_10120886 3300033180 Bacteria 2324
984 Ga0307510_10121624 3300033180 Bacteria 2313
985 Ga0307510_10159972 3300033180 Bacteria 1851
986 Ga0307510_10534733 3300033180 Bacteria 617
987 Ga0315911_1000035 3300033442 Bacteria 66589
988 Ga0373930_0017784 3300034816 Bacteria 1359
989 Ga0373948_0083600 3300034817 Bacteria 732
990 Ga0373928_0125013 3300035084 Bacteria 693
991 Ga0373929_0016853 3300035085 Bacteria 1437
992 Ga0373929_0212058 3300035085 Bacteria 547
993 Ga0373940_0058342 3300035088 Bacteria 1099
994 Ga0373944_0054765 3300035089 Bacteria 1266
995 Ga0373949_0050729 3300035090 Bacteria 1045
996 Ga0373951_0045748 3300035091 Bacteria 1066
997 Ga0373932_0134638 3300035112 Bacteria 835
998 Ga0373936_0077269 3300035113 Bacteria 1381
999 Ga0373939_0416817 3300035114 Bacteria 559
1000 Ga0373941_0054234 3300035115 Bacteria 1284
1001 Ga0373941_0142501 3300035115 Bacteria 873
1002 Ga0373943_0758720 3300035170 Bacteria 576
1003 Ga0373942_0046167 3300035207 Bacteria 1206
1004 Ga0373961_0069898 3300035241 Bacteria 1084
1005 Ga0373962_0145816 3300035242 Bacteria 772
1006 Ga0373931_0021849 3300035691 Bacteria 3214
1007 Ga0373931_0849698 3300035691 Bacteria 611
1008 Ga0373931_1160223 3300035691 Bacteria 528
1009 Ga0373935_0668799 3300035692 Bacteria 762
1010 Ga0373927_0017691 3300035695 Bacteria 4689
1011 Ga0373927_0067814 3300035695 Bacteria 2308
1012 Ga0373927_0189311 3300035695 Bacteria 1350
1013 Ga0373933_0599377 3300035724 Bacteria 723
1014 Ga0373947_0055888 3300035725 Bacteria 2385
1015 Ga0373947_0272138 3300035725 Bacteria 1125
1016 Ga0373937_0434311 3300036401 Bacteria 1246
1017 Ga0373925_0019700 3300037068 Bacteria 4910
1018 Ga0373925_0121495 3300037068 Bacteria 2028
1019 Ga0373925_0238311 3300037068 Bacteria 1456
1020 Ga0373925_1197053 3300037068 Bacteria 624
1021 Ga0373925_1614930 3300037068 Bacteria 530
1022 Ga0395900_0044414 3300037418 Bacteria 4579
1023 Ga0395900_1172753 3300037418 Bacteria 684
1024 Ga0395898_1250851 3300037466 Bacteria 672
1025 Ga0395905_0027349 3300037471 Bacteria 5378
1026 Ga0395905_0648432 3300037471 Bacteria 958
1027 Ga0395905_0868518 3300037471 Bacteria 805
1028 Ga0395905_1582263 3300037471 Bacteria 560
1029 Ga0395905_1744097 3300037471 Bacteria 528
1030 Ga0436364_0906824 3300037853 Bacteria 520
1031 Ga0395901_1199825 3300038443 Bacteria 725
1032 Ga0436365_0041738 3300039437 Bacteria 2541
1033 Ga0436365_1091064 3300039437 Bacteria 30337
1034 Ga0436360_0425420 3300039438 Bacteria 705
1035 Ga0436360_0902180 3300039438 Bacteria 1289
1036 Ga0436363_0006129 3300039450 Bacteria 1022
1037 Ga0436363_1051465 3300039450 Bacteria 2402
1038 Ga0436363_1070729 3300039450 Bacteria 1183
1039 Ga0436363_1572509 3300039450 Bacteria 4714
1040 Ga0436362_1040324 3300039453 Bacteria 3583
1041 Ga0439465_0012265 3300041413 Bacteria 2682
1042 Ga0439465_0033745 3300041413 Bacteria 1637
1043 Ga0439465_0049927 3300041413 Bacteria 1368
1044 Ga0451789_0958322 3300041443 Bacteria 580
1045 Ga0451789_1151987 3300041443 Bacteria 565
1046 Ga0451789_1315201 3300041443 Bacteria 688
1047 Ga0451791_1263840 3300041451 Bacteria 893
1048 Ga0451791_1563015 3300041451 Bacteria 1379
1049 Ga0451793_1172282 3300041452 Bacteria 509
1050 Ga0451793_1748933 3300041452 Bacteria 607
1051 Ga0451797_0120348 3300041453 Bacteria 1261
1052 Ga0451795_1055014 3300041456 Bacteria 545
1053 Ga0451800_1656248 3300041459 Bacteria 525
1054 Ga0451807_0909276 3300041486 Bacteria 762
1055 Ga0451807_1310864 3300041486 Bacteria 795
1056 Ga0451807_1679627 3300041486 Bacteria 636
1057 Ga0451833_1287547 3300041491 Bacteria 789
1058 Ga0451837_1110975 3300041494 Bacteria 704
1059 Ga0451841_1429845 3300041498 Bacteria 528
1060 Ga0451845_0376909 3300041501 Bacteria 1006
1061 Ga0451851_0922706 3300041507 Bacteria 564
1062 Ga0451843_0316530 3300041509 Bacteria 695
1063 Ga0451855_0317668 3300041511 Bacteria 503
1064 Ga0439448_0241738 3300042005 Bacteria 636
1065 Ga0439432_186830 3300042006 Bacteria 603
1066 Ga0439458_0006118 3300042157 Bacteria 2686
1067 Ga0439459_0209796 3300042438 Bacteria 535
1068 Ga0466969_0015502 3300044656 Bacteria 3995
1069 Ga0466972_0001053 3300044658 Bacteria 13231
1070 Ga0466972_0083895 3300044658 Bacteria 1515
1071 Ga0466972_0186293 3300044658 Bacteria 973
1072 Ga0466972_0580344 3300044658 Bacteria 529
1073 Ga0466965_0059400 3300044683 Bacteria 1908
1074 Ga0466965_0087015 3300044683 Bacteria 1585
1075 Ga0466966_0000137 3300044684 Bacteria 46695
1076 Ga0466961_0000039 3300044693 Bacteria 79787
1077 Ga0466961_0106820 3300044693 Bacteria 1762
1078 Ga0466963_0001672 3300044694 Bacteria 12090
1079 Ga0466963_0138599 3300044694 Bacteria 1684
1080 Ga0466964_0038114 3300044706 Bacteria 1932
1081 Ga0466964_0119622 3300044706 Bacteria 1186
1082 Ga0466964_0849238 3300044706 Bacteria 519
1083 Ga0466971_0124618 3300044719 Bacteria 1194
1084 Ga0466971_0241250 3300044719 Bacteria 860
1085 Ga0466968_0005199 3300044735 Bacteria 4872
1086 Ga0466968_0462305 3300044735 Bacteria 628
1087 Ga0466968_0494395 3300044735 Bacteria 609
1088 Ga0466970_0125906 3300044765 Bacteria 1405
1089 Ga0466957_0035960 3300044842 Bacteria 2975
1090 Ga0466957_0140097 3300044842 Bacteria 1557
1091 Ga0466957_0410526 3300044842 Bacteria 927
1092 Ga0466957_0486050 3300044842 Bacteria 854
1093 Ga0466957_1318150 3300044842 Bacteria 524
1094 Ga0466960_0003772 3300044901 Bacteria 5865
1095 Ga0466960_0050304 3300044901 Bacteria 2009
1096 Ga0466960_0475400 3300044901 Bacteria 729
1097 Ga0466960_0636448 3300044901 Bacteria 636
1098 Ga0466960_0662421 3300044901 Bacteria 624
1099 Ga0466959_0001594 3300045049 Bacteria 13987
1100 Ga0466959_0771306 3300045049 Bacteria 643
1101 Ga0451576_0987163 3300045051 Bacteria 883
1102 Ga0466967_0107113 3300045976 Bacteria 2563
1103 Ga0466967_0158757 3300045976 Bacteria 2121
1104 Ga0466967_1362670 3300045976 Bacteria 706
1105 Ga0495617_004942 3300046452 Bacteria 4794
1106 Ga0495617_041534 3300046452 Bacteria 1537
1107 Ga0495617_063658 3300046452 Bacteria 1218
1108 Ga0495617_271406 3300046452 Bacteria 520
1109 Ga0495603_0023359 3300046455 Bacteria 3742
1110 Ga0495603_0034570 3300046455 Bacteria 3038
1111 Ga0495603_0053051 3300046455 Bacteria 2406
1112 Ga0495603_0121811 3300046455 Bacteria 1520
1113 Ga0495590_0062667 3300046457 Bacteria 1301
1114 Ga0495590_0405110 3300046457 Bacteria 523
1115 Ga0495591_089105 3300046458 Bacteria 777
1116 Ga0495629_0127080 3300046459 Bacteria 1776
1117 Ga0495629_0274475 3300046459 Bacteria 1158
1118 Ga0495629_0334342 3300046459 Bacteria 1035
1119 Ga0495638_0013239 3300046460 Bacteria 5625
1120 Ga0495638_0102367 3300046460 Bacteria 1711
1121 Ga0495638_0166754 3300046460 Bacteria 1266
1122 Ga0495638_0285753 3300046460 Bacteria 894
1123 Ga0495638_0414707 3300046460 Bacteria 695
1124 Ga0495638_0551965 3300046460 Bacteria 572
1125 Ga0495638_0585937 3300046460 Bacteria 550
1126 Ga0495641_0025455 3300046461 Bacteria 2905
1127 Ga0495651_0028449 3300046462 Bacteria 4355
1128 Ga0495650_0034400 3300046471 Bacteria 2244
1129 Ga0495650_0109732 3300046471 Bacteria 1026
1130 Ga0495580_0257986 3300046472 Bacteria 1192
1131 Ga0495582_0394265 3300046473 Bacteria 798
1132 Ga0495605_0035458 3300046474 Bacteria 2521
1133 Ga0495605_0057623 3300046474 Bacteria 1869
1134 Ga0495605_0433871 3300046474 Bacteria 543
1135 Ga0495639_0176553 3300046475 Bacteria 1039
1136 Ga0495662_0383298 3300046476 Bacteria 690
1137 Ga0495664_0221269 3300046477 Bacteria 1146
1138 Ga0495664_0400851 3300046477 Bacteria 824
1139 Ga0495584_0160004 3300046491 Bacteria 1144
1140 Ga0495584_0314147 3300046491 Bacteria 796
1141 Ga0495584_0484948 3300046491 Bacteria 629
1142 Ga0495584_0563700 3300046491 Bacteria 580
1143 Ga0495584_0685421 3300046491 Bacteria 522
1144 Ga0495585_0023802 3300046492 Bacteria 3514
1145 Ga0495585_0125960 3300046492 Bacteria 1351
1146 Ga0495585_0287166 3300046492 Bacteria 812
1147 Ga0495594_0039396 3300046499 Bacteria 2584
1148 Ga0495594_0349644 3300046499 Bacteria 842
1149 Ga0495594_0749570 3300046499 Bacteria 551
1150 Ga0495596_0141561 3300046500 Bacteria 934
1151 Ga0495596_0236630 3300046500 Bacteria 709
1152 Ga0495596_0267962 3300046500 Bacteria 663
1153 Ga0495596_0324142 3300046500 Bacteria 599
1154 Ga0495607_0124426 3300046501 Bacteria 1350
1155 Ga0495607_0191240 3300046501 Bacteria 1019
1156 Ga0495607_0342569 3300046501 Bacteria 692
1157 Ga0495607_0395664 3300046501 Bacteria 629
1158 Ga0495583_0127881 3300046506 Bacteria 1065
1159 Ga0495583_0156435 3300046506 Bacteria 942
1160 Ga0495606_0067487 3300046507 Bacteria 2264
1161 Ga0495606_0087925 3300046507 Bacteria 1917
1162 Ga0495606_0238831 3300046507 Bacteria 1014
1163 Ga0495606_0546593 3300046507 Bacteria 577
1164 Ga0495608_0731763 3300046511 Bacteria 587
1165 Ga0495610_0139581 3300046512 Bacteria 1044
1166 Ga0495610_0159713 3300046512 Bacteria 954
1167 Ga0495616_0060076 3300046513 Bacteria 1868
1168 Ga0495616_0179793 3300046513 Bacteria 941
1169 Ga0495616_0243351 3300046513 Bacteria 775
1170 Ga0495620_0067816 3300046515 Bacteria 1467
1171 Ga0495620_0218278 3300046515 Bacteria 730
1172 Ga0495620_0230164 3300046515 Bacteria 708
1173 Ga0495620_0269544 3300046515 Bacteria 648
1174 Ga0495631_0027561 3300046518 Bacteria 2598
1175 Ga0495631_0120360 3300046518 Bacteria 1129
1176 Ga0495631_0171647 3300046518 Bacteria 930
1177 Ga0495631_0252204 3300046518 Bacteria 752
1178 Ga0495631_0501380 3300046518 Bacteria 517
1179 Ga0495632_0029324 3300046519 Bacteria 2866
1180 Ga0495632_0290384 3300046519 Bacteria 727
1181 Ga0495632_0482606 3300046519 Bacteria 536
1182 Ga0495637_0141707 3300046520 Bacteria 912
1183 Ga0495643_0006089 3300046522 Bacteria 8027
1184 Ga0495643_0071282 3300046522 Bacteria 1824
1185 Ga0495643_0072874 3300046522 Bacteria 1800
1186 Ga0495643_0177057 3300046522 Bacteria 1039
1187 Ga0495643_0219200 3300046522 Bacteria 903
1188 Ga0495643_0307228 3300046522 Bacteria 721
1189 Ga0495643_0333316 3300046522 Bacteria 683
1190 Ga0495644_0067813 3300046523 Bacteria 1340
1191 Ga0495644_0119151 3300046523 Bacteria 1003
1192 Ga0495644_0209528 3300046523 Bacteria 752
1193 Ga0495644_0372650 3300046523 Bacteria 563
1194 Ga0495648_0000382 3300046524 Bacteria 48626
1195 Ga0495648_0143113 3300046524 Bacteria 1256
1196 Ga0495648_0253026 3300046524 Bacteria 849
1197 Ga0495648_0301613 3300046524 Bacteria 750
1198 Ga0495648_0303286 3300046524 Bacteria 747
1199 Ga0495663_0038891 3300046525 Bacteria 1440
1200 Ga0495663_0136713 3300046525 Bacteria 830
1201 Ga0495663_0315268 3300046525 Bacteria 565
1202 Ga0495666_0330227 3300046526 Bacteria 688
1203 Ga0495642_0117560 3300046528 Bacteria 1139
1204 Ga0495642_0226867 3300046528 Bacteria 816
1205 Ga0495652_0438138 3300046529 Bacteria 917
1206 Ga0495652_0938378 3300046529 Bacteria 569
1207 Ga0495654_0054158 3300046530 Bacteria 1947
1208 Ga0495654_0103717 3300046530 Bacteria 1306
1209 Ga0495654_0224414 3300046530 Bacteria 793
1210 Ga0495665_0652518 3300046531 Bacteria 524
1211 Ga0495640_0781376 3300046533 Bacteria 570
1212 Ga0495598_0008711 3300046537 Bacteria 2371
1213 Ga0495609_0088180 3300046538 Bacteria 1351
1214 Ga0495609_0090861 3300046538 Bacteria 1328
1215 Ga0495609_0156254 3300046538 Bacteria 968
1216 Ga0495621_0003636 3300046539 Bacteria 4258
1217 Ga0495621_0122490 3300046539 Bacteria 1006
1218 Ga0495597_0025361 3300046542 Bacteria 2729
1219 Ga0495597_0048346 3300046542 Bacteria 1882
1220 Ga0495597_0308209 3300046542 Bacteria 613
1221 Ga0495622_0025062 3300046557 Bacteria 2786
1222 Ga0495622_0066337 3300046557 Bacteria 1668
1223 Ga0495622_0141436 3300046557 Bacteria 1092
1224 Ga0495633_0119648 3300046558 Bacteria 1220
1225 Ga0495633_0256210 3300046558 Bacteria 798
1226 Ga0495667_0609693 3300046559 Bacteria 680
1227 Ga0495656_0036134 3300046615 Bacteria 2033
1228 Ga0495656_0117691 3300046615 Bacteria 1250
1229 Ga0495656_0220379 3300046615 Bacteria 948
1230 Ga0495656_0520128 3300046615 Bacteria 632
1231 Ga0495668_0014949 3300046616 Bacteria 4541
1232 Ga0495668_0122797 3300046616 Bacteria 1421
1233 Ga0495668_0125574 3300046616 Bacteria 1404
1234 Ga0495668_0126565 3300046616 Bacteria 1398
1235 Ga0495668_0129727 3300046616 Bacteria 1380
1236 Ga0495668_0130633 3300046616 Bacteria 1375
1237 Ga0495668_0177050 3300046616 Bacteria 1169
1238 Ga0495668_0198567 3300046616 Bacteria 1098
1239 Ga0495668_0243502 3300046616 Bacteria 985
1240 Ga0495668_0243655 3300046616 Bacteria 984
1241 Ga0495668_0342836 3300046616 Bacteria 820
1242 Ga0495668_0405452 3300046616 Bacteria 749
1243 Ga0495668_0481790 3300046616 Bacteria 683
1244 Ga0495611_0042236 3300046648 Bacteria 2035
1245 Ga0495611_0064648 3300046648 Bacteria 1666
1246 Ga0495611_0081160 3300046648 Bacteria 1491
1247 Ga0495611_0160161 3300046648 Bacteria 1051
1248 Ga0495611_0514149 3300046648 Bacteria 543
1249 Ga0495625_0181303 3300046660 Bacteria 1400
1250 Ga0495625_0236831 3300046660 Bacteria 1190
1251 Ga0495625_0501147 3300046660 Bacteria 742
1252 Ga0495625_0647254 3300046660 Bacteria 630
1253 Ga0495625_0780463 3300046660 Bacteria 557
1254 Ga0495635_0481622 3300046663 Bacteria 818
1255 Ga0495635_1047384 3300046663 Bacteria 518
1256 Ga0495659_0030409 3300046664 Bacteria 1879
1257 Ga0495659_0233936 3300046664 Bacteria 762
1258 Ga0495661_0089248 3300046665 Bacteria 1758
1259 Ga0495661_0417552 3300046665 Bacteria 650
1260 Ga0495661_0436237 3300046665 Bacteria 632
1261 Ga0495588_0002782 3300046674 Bacteria 7516
1262 Ga0495588_0170577 3300046674 Bacteria 1150
1263 Ga0495588_0203532 3300046674 Bacteria 1046
1264 Ga0495588_0254974 3300046674 Bacteria 925
1265 Ga0495657_0183016 3300046675 Bacteria 1285
1266 Ga0495623_0131065 3300046679 Bacteria 1501
1267 Ga0495646_0531423 3300046680 Bacteria 602
1268 Ga0495647_0631001 3300046681 Bacteria 504
1269 Ga0495658_0032247 3300046683 Bacteria 2860
1270 Ga0495658_0212628 3300046683 Bacteria 1209
1271 Ga0495669_0017393 3300046684 Bacteria 3086
1272 Ga0495669_0087696 3300046684 Bacteria 1434
1273 Ga0495669_0103592 3300046684 Bacteria 1323
1274 Ga0495669_0158465 3300046684 Bacteria 1074
1275 Ga0495613_0592755 3300046689 Bacteria 738
1276 Ga0495624_0136095 3300046690 Bacteria 1506
1277 Ga0495624_0253926 3300046690 Bacteria 1063
1278 Ga0495624_0617610 3300046690 Bacteria 646
1279 Ga0495670_0078015 3300046691 Bacteria 1684
1280 Ga0495670_0080267 3300046691 Bacteria 1661
1281 Ga0495670_0402689 3300046691 Bacteria 739
1282 Ga0495671_0089406 3300046692 Bacteria 1508
1283 Ga0495671_0220520 3300046692 Bacteria 918
1284 Ga0495671_0402237 3300046692 Bacteria 655
1285 Ga0495649_0098252 3300046694 Bacteria 1557
1286 Ga0495649_0152845 3300046694 Bacteria 1212
1287 Ga0495649_0350475 3300046694 Bacteria 746
1288 Ga0495589_0089341 3300046794 Bacteria 1496
1289 Ga0495600_0625129 3300046809 Bacteria 653
1290 Ga0495660_0256459 3300046810 Bacteria 809
1291 Ga0495660_0378394 3300046810 Bacteria 624
1292 Ga0495660_0479099 3300046810 Bacteria 534
1293 Ga0495581_0196979 3300047315 Bacteria 1178
1294 Ga0495581_0217518 3300047315 Bacteria 1117
1295 Ga0495581_0834973 3300047315 Bacteria 528
1296 Ga0495604_0343739 3300047317 Bacteria 993
1297 Ga0495636_0165315 3300047318 Bacteria 998
1298 Ga0495636_0259023 3300047318 Bacteria 806
1299 Ga0495636_0549527 3300047318 Bacteria 561
1300 Ga0495636_0570024 3300047318 Bacteria 552
1301 Ga0495674_0398879 3300047319 Bacteria 1111
1302 Ga0495674_0535334 3300047319 Bacteria 934
1303 Ga0495674_0769518 3300047319 Bacteria 751
1304 Ga0495672_0021500 3300047320 Bacteria 4207
1305 Ga0495672_0082802 3300047320 Bacteria 1783
1306 Ga0495672_0213608 3300047320 Bacteria 957
1307 Ga0495676_0076145 3300047321 Bacteria 2563
1308 Ga0495676_0166749 3300047321 Bacteria 1553
1309 Ga0495676_0241501 3300047321 Bacteria 1236
1310 Ga0495676_0299828 3300047321 Bacteria 1084
1311 Ga0495680_0880027 3300047322 Bacteria 580
1312 Ga0495683_0034016 3300047323 Bacteria 2593
1313 Ga0495683_0080180 3300047323 Bacteria 1593
1314 Ga0495683_0213532 3300047323 Bacteria 864
1315 Ga0495683_0288656 3300047323 Bacteria 708
1316 Ga0495687_024727 3300047443 Bacteria 2851
1317 Ga0495675_0250090 3300047444 Bacteria 1065
1318 Ga0495677_0349662 3300047445 Bacteria 583
1319 Ga0495679_118334 3300047446 Bacteria 726
1320 Ga0495685_064994 3300047447 Bacteria 1226
1321 Ga0495685_134677 3300047447 Bacteria 807
1322 Ga0495673_0066074 3300047469 Bacteria 1534
1323 Ga0495673_0111789 3300047469 Bacteria 1091
1324 Ga0495673_0125596 3300047469 Bacteria 1012
1325 Ga0495681_0216265 3300047470 Bacteria 770
1326 Ga0495681_0304026 3300047470 Bacteria 617
1327 Ga0495681_0350519 3300047470 Bacteria 561
1328 Ga0495686_0056439 3300047472 Bacteria 2454
1329 Ga0495686_0190559 3300047472 Bacteria 1182
1330 Ga0495686_0580045 3300047472 Bacteria 583
1331 Ga0495615_0226202 3300048090 Bacteria 585
1332 Ga0495615_0262433 3300048090 Bacteria 550
1333 Ga0495626_0195615 3300048091 Bacteria 832
1334 Ga0495626_0200261 3300048091 Bacteria 819
1335 Ga0496100_0028458 3300048903 Bacteria 3447
1336 Ga0496100_0044930 3300048903 Bacteria 2832
1337 Ga0496100_0159330 3300048903 Bacteria 1617
1338 Ga0496100_0227387 3300048903 Bacteria 1371
1339 Ga0496100_0262765 3300048903 Bacteria 1281
1340 Ga0496100_0323209 3300048903 Bacteria 1159
1341 Ga0496100_0426749 3300048903 Bacteria 1013
1342 Ga0496100_0993980 3300048903 Bacteria 660
1343 Ga0496101_0004551 3300048904 Bacteria 8756
1344 Ga0496101_0042331 3300048904 Bacteria 3251
1345 Ga0496101_0078600 3300048904 Bacteria 2434
1346 Ga0496101_0106516 3300048904 Bacteria 2105
1347 Ga0496101_0176398 3300048904 Bacteria 1644
1348 Ga0496101_0516338 3300048904 Bacteria 944
1349 Ga0496101_0697614 3300048904 Bacteria 801
1350 Ga0496101_0878553 3300048904 Bacteria 706
1351 Ga0496101_0894424 3300048904 Bacteria 699
1352 Ga0496101_1268934 3300048904 Bacteria 576
1353 Ga0496101_1458452 3300048904 Bacteria 533
1354 Ga0496102_0059510 3300048905 Bacteria 3493
1355 Ga0496102_0082212 3300048905 Bacteria 2970
1356 Ga0496102_0091984 3300048905 Bacteria 2808
1357 Ga0496102_0141472 3300048905 Bacteria 2256
1358 Ga0496102_0168592 3300048905 Bacteria 2061
1359 Ga0496102_0225269 3300048905 Bacteria 1768
1360 Ga0496102_0238524 3300048905 Bacteria 1715
1361 Ga0496102_0322153 3300048905 Bacteria 1456
1362 Ga0496102_0546680 3300048905 Bacteria 1081
1363 Ga0496102_1845612 3300048905 Bacteria 521
1364 Ga0496103_0005244 3300048906 Bacteria 7785
1365 Ga0496103_0034826 3300048906 Bacteria 3080
1366 Ga0496103_0158823 3300048906 Bacteria 1450
1367 Ga0496103_0315374 3300048906 Bacteria 1006
1368 Ga0496103_0692884 3300048906 Bacteria 646
1369 Ga0496104_0010015 3300048907 Bacteria 8460
1370 Ga0496104_0022858 3300048907 Bacteria 5745
1371 Ga0496104_0059163 3300048907 Bacteria 3627
1372 Ga0496104_0071679 3300048907 Bacteria 3294
1373 Ga0496104_0136213 3300048907 Bacteria 2359
1374 Ga0496104_0322214 3300048907 Bacteria 1458
1375 Ga0496104_1318138 3300048907 Bacteria 625
1376 Ga0496105_0031760 3300048908 Bacteria 4330
1377 Ga0496105_0200828 3300048908 Bacteria 1627
1378 Ga0496105_0573571 3300048908 Bacteria 878
1379 Ga0496105_0898634 3300048908 Bacteria 668
1380 Ga0496105_1149268 3300048908 Bacteria 574
1381 Ga0496106_0000810 3300048909 Bacteria 22635
1382 Ga0496106_0005291 3300048909 Bacteria 9565
1383 Ga0496106_0056220 3300048909 Bacteria 2974
1384 Ga0496106_0146073 3300048909 Bacteria 1863
1385 Ga0496106_0186598 3300048909 Bacteria 1647
1386 Ga0496106_0186639 3300048909 Bacteria 1647
1387 Ga0496106_0303694 3300048909 Bacteria 1280
1388 Ga0496106_0812407 3300048909 Bacteria 741
1389 Ga0496106_1083165 3300048909 Bacteria 628
1390 Ga0496106_1444643 3300048909 Bacteria 530
1391 Ga0496107_0088718 3300048910 Bacteria 2257
1392 Ga0496107_0089242 3300048910 Bacteria 2251
1393 Ga0496107_0112403 3300048910 Bacteria 2002
1394 Ga0496107_0294936 3300048910 Bacteria 1207
1395 Ga0496107_0326745 3300048910 Bacteria 1141
1396 Ga0496107_0333619 3300048910 Bacteria 1128
1397 Ga0496107_0399832 3300048910 Bacteria 1022
1398 Ga0496107_0480149 3300048910 Bacteria 922
1399 Ga0496107_0560603 3300048910 Bacteria 846
1400 Ga0496107_0781166 3300048910 Bacteria 700
1401 Ga0496108_0000553 3300048911 Bacteria 29302
1402 Ga0496108_0030230 3300048911 Bacteria 4489
1403 Ga0496108_0036900 3300048911 Bacteria 4068
1404 Ga0496108_0085617 3300048911 Bacteria 2676
1405 Ga0496108_0135163 3300048911 Bacteria 2121
1406 Ga0496108_0734501 3300048911 Bacteria 855
1407 Ga0496109_0000574 3300048912 Bacteria 30746
1408 Ga0496109_0039394 3300048912 Bacteria 4277
1409 Ga0496109_0067828 3300048912 Bacteria 3269
1410 Ga0496109_0224121 3300048912 Bacteria 1768
1411 Ga0496109_0236850 3300048912 Bacteria 1717
1412 Ga0496109_1243443 3300048912 Bacteria 681
1413 Ga0496109_1545385 3300048912 Bacteria 598
1414 Ga0496109_1982723 3300048912 Bacteria 514
1415 Ga0496110_0029231 3300048913 Bacteria 4741
1416 Ga0496110_0137677 3300048913 Bacteria 2207
1417 Ga0496110_0145638 3300048913 Bacteria 2142
1418 Ga0496110_0237494 3300048913 Bacteria 1658
1419 Ga0496111_0039981 3300048914 Bacteria 3364
1420 Ga0496111_0051658 3300048914 Bacteria 2967
1421 Ga0496111_0059186 3300048914 Bacteria 2775
1422 Ga0496111_0188258 3300048914 Bacteria 1534
1423 Ga0496111_0309188 3300048914 Bacteria 1171
1424 Ga0496111_0375335 3300048914 Bacteria 1052
1425 Ga0496112_0063136 3300048915 Bacteria 3653
1426 Ga0496112_0115214 3300048915 Bacteria 2658
1427 Ga0496112_0208816 3300048915 Bacteria 1910
1428 Ga0496112_0247986 3300048915 Bacteria 1732
1429 Ga0496112_0556081 3300048915 Bacteria 1081
1430 Ga0496112_0855713 3300048915 Bacteria 832
1431 Ga0496112_0972987 3300048915 Bacteria 769
1432 Ga0496112_0988614 3300048915 Bacteria 761
1433 Ga0496112_1735164 3300048915 Bacteria 537
1434 Ga0496113_0009302 3300048916 Bacteria 6444
1435 Ga0496113_0063812 3300048916 Bacteria 2784
1436 Ga0496113_0355424 3300048916 Bacteria 1175
1437 Ga0496114_0013002 3300048917 Bacteria 6670
1438 Ga0496114_0016363 3300048917 Bacteria 5974
1439 Ga0496114_0132921 3300048917 Bacteria 2150
1440 Ga0496114_0370091 3300048917 Bacteria 1268
1441 Ga0496114_0728916 3300048917 Bacteria 868
1442 Ga0496114_1210652 3300048917 Bacteria 641
1443 Ga0496114_1448451 3300048917 Bacteria 574
1444 Ga0496115_0024599 3300048918 Bacteria 4683
1445 Ga0496115_0234041 3300048918 Bacteria 1514
1446 Ga0496115_0243702 3300048918 Bacteria 1481
1447 Ga0496115_0300627 3300048918 Bacteria 1315
1448 Ga0496115_0378839 3300048918 Bacteria 1151
1449 Ga0496115_0400874 3300048918 Bacteria 1113
1450 Ga0496115_0478173 3300048918 Bacteria 1003
1451 Ga0496115_0496849 3300048918 Bacteria 981
1452 Ga0496115_0586758 3300048918 Bacteria 887
1453 Ga0496116_0011726 3300048919 Bacteria 7222
1454 Ga0496116_0244067 3300048919 Bacteria 900
1455 Ga0496116_0452127 3300048919 Bacteria 550
1456 Ga0496117_0139893 3300048920 Bacteria 1452
1457 Ga0496117_0146296 3300048920 Bacteria 1406
1458 Ga0496117_0376522 3300048920 Bacteria 724
1459 Ga0496117_0490352 3300048920 Bacteria 598
1460 Ga0496118_0021615 3300048921 Bacteria 5656
1461 Ga0496118_0025856 3300048921 Bacteria 5020
1462 Ga0496118_0063550 3300048921 Bacteria 2715
1463 Ga0496118_0374402 3300048921 Bacteria 750
1464 Ga0496118_0637411 3300048921 Bacteria 503
1465 Ga0496119_0022737 3300048922 Bacteria 4477
1466 Ga0496119_0143594 3300048922 Bacteria 1286
1467 Ga0496119_0246872 3300048922 Bacteria 902
1468 Ga0496119_0271475 3300048922 Bacteria 847
1469 Ga0496119_0285588 3300048922 Bacteria 819
1470 Ga0496119_0311897 3300048922 Bacteria 772
1471 Ga0496119_0462697 3300048922 Bacteria 596
1472 Ga0496120_0023248 3300048923 Bacteria 3882
1473 Ga0496121_0021056 3300048924 Bacteria 6411
1474 Ga0496121_0030260 3300048924 Bacteria 4975
1475 Ga0496121_0033524 3300048924 Bacteria 4645
1476 Ga0496121_0065818 3300048924 Bacteria 2946
1477 Ga0496121_0082471 3300048924 Bacteria 2542
1478 Ga0496121_0123319 3300048924 Bacteria 1953
1479 Ga0496121_0276496 3300048924 Bacteria 1151
1480 Ga0496121_0312809 3300048924 Bacteria 1061
1481 Ga0496121_0335962 3300048924 Bacteria 1011
1482 Ga0496121_0345241 3300048924 Bacteria 993
1483 Ga0496121_0492287 3300048924 Bacteria 780
1484 Ga0496121_0497705 3300048924 Bacteria 774
1485 Ga0496121_0507153 3300048924 Bacteria 764
1486 Ga0496121_0510385 3300048924 Bacteria 761
1487 Ga0496122_0242325 3300048925 Bacteria 1015
1488 Ga0496122_0381572 3300048925 Bacteria 723
1489 Ga0496122_0473277 3300048925 Bacteria 615
1490 Ga0496123_0238765 3300048926 Bacteria 904
1491 Ga0496124_0166292 3300048927 Bacteria 1714
1492 Ga0496124_0378317 3300048927 Bacteria 991
1493 Ga0496124_0388167 3300048927 Bacteria 973
1494 Ga0496124_0777951 3300048927 Bacteria 596
1495 Ga0496125_0085989 3300048928 Bacteria 2380
1496 Ga0496125_0093476 3300048928 Bacteria 2244
1497 Ga0496125_0105381 3300048928 Bacteria 2061
1498 Ga0496125_0124120 3300048928 Bacteria 1834
1499 Ga0496125_0310865 3300048928 Bacteria 960
1500 Ga0496125_0493998 3300048928 Bacteria 690
1501 Ga0496126_0017707 3300048929 Bacteria 7095
1502 Ga0496126_0019226 3300048929 Bacteria 6732
1503 Ga0496126_0036538 3300048929 Bacteria 4592
1504 Ga0496126_0050013 3300048929 Bacteria 3812
1505 Ga0496126_0086648 3300048929 Bacteria 2760
1506 Ga0496126_0134174 3300048929 Bacteria 2137
1507 Ga0496126_0145610 3300048929 Bacteria 2035
1508 Ga0496126_0223010 3300048929 Bacteria 1582
1509 Ga0496126_0261637 3300048929 Bacteria 1438
1510 Ga0496126_0332316 3300048929 Bacteria 1247
1511 Ga0496126_0379230 3300048929 Bacteria 1151
1512 Ga0496126_0394383 3300048929 Bacteria 1124
1513 Ga0496126_0535357 3300048929 Bacteria 931
1514 Ga0496126_0542313 3300048929 Bacteria 924
1515 Ga0496126_0783602 3300048929 Bacteria 733
1516 Ga0496126_1016474 3300048929 Bacteria 621
1517 Ga0496126_1043616 3300048929 Bacteria 611
1518 Ga0496126_1277116 3300048929 Bacteria 536
1519 Ga0495678_070871 3300049459 Bacteria 1278
1520 Ga0495682_0166970 3300049460 Bacteria 783
1521 Ga0495682_0175353 3300049460 Bacteria 762
1522 Ga0495682_0263188 3300049460 Bacteria 609
1523 Ga0501291_141210 3300049514 Bacteria 538
1524 Ga0501031_0065487 3300049568 Bacteria 2367
1525 Ga0501032_0000309 3300049569 Bacteria 41024
1526 Ga0501032_0210658 3300049569 Bacteria 1267
1527 Ga0501032_0255663 3300049569 Bacteria 1136
1528 Ga0501032_0409328 3300049569 Bacteria 871
1529 Ga0501033_0001798 3300049570 Bacteria 18709
1530 Ga0501033_0140291 3300049570 Bacteria 1747
1531 Ga0501033_0192736 3300049570 Bacteria 1458
1532 Ga0501033_0332943 3300049570 Bacteria 1065
1533 Ga0501034_0000082 3300049571 Bacteria 170039
1534 Ga0501034_0037046 3300049571 Bacteria 4939
1535 Ga0501034_0071891 3300049571 Bacteria 3468
1536 Ga0501034_0975792 3300049571 Bacteria 732
1537 Ga0501036_0000121 3300049572 Bacteria 48901
1538 Ga0501036_0055283 3300049572 Bacteria 3362
1539 Ga0501036_0502016 3300049572 Bacteria 1009
1540 Ga0501037_0000346 3300049573 Bacteria 39162
1541 Ga0501037_0899999 3300049573 Bacteria 580
1542 Ga0501038_0002992 3300049574 Bacteria 15757
1543 Ga0501038_0050259 3300049574 Bacteria 3603
1544 Ga0501039_0009593 3300049575 Bacteria 7379
1545 Ga0501039_0104435 3300049575 Bacteria 2212
1546 Ga0501039_1537601 3300049575 Bacteria 511
1547 Ga0501040_0921461 3300049576 Bacteria 633
1548 Ga0501041_0213187 3300049577 Bacteria 1211
1549 Ga0501042_0232094 3300049578 Bacteria 1331
1550 Ga0501042_0565704 3300049578 Bacteria 826
1551 Ga0501042_0626113 3300049578 Bacteria 782
1552 Ga0501043_0000109 3300049579 Bacteria 77120
1553 Ga0501043_0035788 3300049579 Bacteria 3906
1554 Ga0501046_0000101 3300049580 Bacteria 91179
1555 Ga0501046_0025644 3300049580 Bacteria 4823
1556 Ga0501046_0035094 3300049580 Bacteria 4042
1557 Ga0501047_0000331 3300049581 Bacteria 54371
1558 Ga0501047_0131940 3300049581 Bacteria 2378
1559 Ga0501047_0185685 3300049581 Bacteria 1944
1560 Ga0501047_0334183 3300049581 Bacteria 1353
1561 Ga0501048_0002703 3300049582 Bacteria 13534
1562 Ga0501048_0039082 3300049582 Bacteria 3405
1563 Ga0501067_0000534 3300049583 Bacteria 20715
1564 Ga0501067_0022379 3300049583 Bacteria 3498
1565 Ga0501067_0453728 3300049583 Bacteria 716
1566 Ga0501067_0688811 3300049583 Bacteria 574
1567 Ga0501067_0775237 3300049583 Bacteria 540
1568 Ga0501067_0820350 3300049583 Bacteria 524
1569 Ga0501068_0000276 3300049584 Bacteria 25409
1570 Ga0501069_0014951 3300049585 Bacteria 4157
1571 Ga0501069_0153812 3300049585 Bacteria 1323
1572 Ga0501069_0357812 3300049585 Bacteria 861
1573 Ga0501070_0024493 3300049586 Bacteria 5062
1574 Ga0501070_0127871 3300049586 Bacteria 2099
1575 Ga0501070_0131994 3300049586 Bacteria 2063
1576 Ga0501070_0286160 3300049586 Bacteria 1344
1577 Ga0501070_0338481 3300049586 Bacteria 1222
1578 Ga0501070_0488162 3300049586 Bacteria 990
1579 Ga0501070_0722352 3300049586 Bacteria 787
1580 Ga0501071_0120319 3300049587 Bacteria 1946
1581 Ga0501071_0427723 3300049587 Bacteria 1012
1582 Ga0501071_0545295 3300049587 Bacteria 891
1583 Ga0501072_0004822 3300049588 Bacteria 10270
1584 Ga0501073_0000101 3300049589 Bacteria 54365
1585 Ga0501073_0041906 3300049589 Bacteria 3233
1586 Ga0501073_0765475 3300049589 Bacteria 666
1587 Ga0501074_0000187 3300049590 Bacteria 33711
1588 Ga0501075_0316309 3300049591 Bacteria 1190
1589 Ga0501076_0074021 3300049592 Bacteria 2728
1590 Ga0501076_0274060 3300049592 Bacteria 1382
1591 Ga0501079_0001908 3300049741 Bacteria 14946
1592 Ga0501079_0330152 3300049741 Bacteria 1194
1593 Ga0501080_0000151 3300049742 Bacteria 49588
1594 Ga0501080_0021394 3300049742 Bacteria 5987
1595 Ga0501080_0593473 3300049742 Bacteria 984
1596 Ga0501083_0007235 3300049744 Bacteria 7881
1597 Ga0501083_0722716 3300049744 Bacteria 648
1598 Ga0501035_0000150 3300049822 Bacteria 85450
1599 Ga0501035_0687054 3300049822 Bacteria 826
1600 Ga0501035_1360459 3300049822 Bacteria 545
1601 Ga0501044_0000247 3300049823 Bacteria 68674
1602 Ga0501044_0011870 3300049823 Bacteria 9439
1603 Ga0501044_0114019 3300049823 Bacteria 2709
1604 Ga0501044_0413717 3300049823 Bacteria 1259
1605 Ga0501044_0678034 3300049823 Bacteria 918
1606 Ga0501045_0074857 3300049824 Bacteria 2493
1607 nmdc:mga03683_128980_c1 3300050489 Bacteria 1130
1608 nmdc:mga03683_226971_c1 3300050489 Bacteria 863
1609 nmdc:mga03683_647996_c1 3300050489 Bacteria 520
1610 nmdc:mga03683_95798_c1 3300050489 Bacteria 1299
1611 nmdc:mga03n38_179764_c1 3300050490 Bacteria 1083
1612 nmdc:mga03n38_239641_c1 3300050490 Bacteria 954
1613 nmdc:mga03n38_398307_c1 3300050490 Bacteria 757
1614 nmdc:mga03n38_4436_c1 3300050490 Bacteria 4651
1615 nmdc:mga03n38_544515_c1 3300050490 Bacteria 656
1616 nmdc:mga03n38_586281_c1 3300050490 Bacteria 634
1617 nmdc:mga03n38_809050_c1 3300050490 Bacteria 546
1618 nmdc:mga03n38_88012_c1 3300050490 Bacteria 1473
1619 nmdc:mga00v17_123669_c1 3300050491 Bacteria 1649
1620 nmdc:mga00v17_162335_c1 3300050491 Bacteria 1439
1621 nmdc:mga00v17_21020_c1 3300050491 Bacteria 3747
1622 nmdc:mga00v17_490442_c1 3300050491 Bacteria 797
1623 nmdc:mga00v17_494837_c1 3300050491 Bacteria 793
1624 nmdc:mga00v17_553349_c1 3300050491 Bacteria 744
1625 nmdc:mga00v17_834740_c1 3300050491 Bacteria 586
1626 nmdc:mga00v17_84510_c1 3300050491 Bacteria 1987
1627 nmdc:mga0yw44_104317_c1 3300050492 Bacteria 1810
1628 nmdc:mga0yw44_1043848_c1 3300050492 Bacteria 553
1629 nmdc:mga0yw44_1124070_c1 3300050492 Bacteria 531
1630 nmdc:mga0yw44_1245409_c1 3300050492 Bacteria 502
1631 nmdc:mga0yw44_16029_c1 3300050492 Bacteria 4036
1632 nmdc:mga0yw44_18764_c1 3300050492 Bacteria 3797
1633 nmdc:mga0yw44_199947_c1 3300050492 Bacteria 1320
1634 nmdc:mga0yw44_214933_c1 3300050492 Bacteria 1273
1635 nmdc:mga0yw44_707388_c1 3300050492 Bacteria 684
1636 nmdc:mga0yw44_70819_c1 3300050492 Bacteria 2163
1637 nmdc:mga0k408_141057_c1 3300050493 Bacteria 1434
1638 nmdc:mga0k408_155121_c1 3300050493 Bacteria 1364
1639 nmdc:mga0k408_185362_c1 3300050493 Bacteria 1241
1640 nmdc:mga0k408_225480_c1 3300050493 Bacteria 1119
1641 nmdc:mga0k408_324926_c1 3300050493 Bacteria 918
1642 nmdc:mga0k408_403421_c1 3300050493 Bacteria 813
1643 nmdc:mga0k408_632380_c1 3300050493 Bacteria 630
1644 nmdc:mga0k408_71325_c1 3300050493 Bacteria 2028
1645 nmdc:mga06z11_146289_c1 3300050494 Bacteria 1340
1646 nmdc:mga06z11_282785_c1 3300050494 Bacteria 983
1647 nmdc:mga06z11_38926_c1 3300050494 Bacteria 2364
1648 nmdc:mga06z11_402374_c1 3300050494 Bacteria 824
1649 nmdc:mga06z11_4590_c1 3300050494 Bacteria 5446
1650 nmdc:mga06z11_584435_c1 3300050494 Bacteria 679
1651 nmdc:mga06z11_644975_c1 3300050494 Bacteria 644
1652 nmdc:mga06z11_7575_c1 3300050494 Bacteria 4478
1653 nmdc:mga06z11_797114_c1 3300050494 Bacteria 576
1654 nmdc:mga06z11_823611_c1 3300050494 Bacteria 566
1655 nmdc:mga06z11_973574_c1 3300050494 Bacteria 517
1656 nmdc:mga04h51_104619_c1 3300050495 Bacteria 1036
1657 nmdc:mga04h51_107326_c1 3300050495 Bacteria 1025
1658 nmdc:mga04h51_23324_c1 3300050495 Bacteria 1883
1659 nmdc:mga04h51_244161_c1 3300050495 Bacteria 718
1660 nmdc:mga04h51_327955_c1 3300050495 Bacteria 629
1661 nmdc:mga04h51_418427_c1 3300050495 Bacteria 563
1662 nmdc:mga04h51_68506_c1 3300050495 Bacteria 1233
1663 nmdc:mga07m45_12889_c2 3300050496 Bacteria 2315
1664 nmdc:mga07m45_187144_c1 3300050496 Bacteria 1204
1665 nmdc:mga07m45_307556_c1 3300050496 Bacteria 922
1666 nmdc:mga07m45_378627_c1 3300050496 Bacteria 822
1667 nmdc:mga07m45_398352_c1 3300050496 Bacteria 799
1668 nmdc:mga07m45_78473_c1 3300050496 Bacteria 1884
1669 nmdc:mga07m45_9923_c1 3300050496 Bacteria 2151
1670 nmdc:mga05p37_433340_c1 3300050507 Bacteria 1527
1671 nmdc:mga05p37_491695_c1 3300050507 Bacteria 1410
1672 nmdc:mga09592_942145_c1 3300050508 Bacteria 724
1673 nmdc:mga0qj67_937081_c1 3300050509 Bacteria 681
1674 nmdc:mga08y16_1777197_c1 3300050511 Bacteria 570
1675 nmdc:mga08y16_30607_c1 3300050511 Bacteria 5663
1676 nmdc:mga0n895_1131459_c1 3300050512 Bacteria 759
1677 nmdc:mga0n895_1422924_c1 3300050512 Bacteria 661
1678 nmdc:mga0n895_170346_c1 3300050512 Bacteria 2209
1679 nmdc:mga0n895_559089_c1 3300050512 Bacteria 1149
1680 nmdc:mga0rr50_1571726_c1 3300050513 Bacteria 555
1681 nmdc:mga08x19_930215_c1 3300050514 Bacteria 618
1682 nmdc:mga0a205_569210_c1 3300050515 Bacteria 987
1683 nmdc:mga0a205_608522_c1 3300050515 Bacteria 945
1684 nmdc:mga0sz30_20012_c2 3300050516 Bacteria 2289
1685 nmdc:mga0sz30_214927_c1 3300050516 Bacteria 855
1686 nmdc:mga0sz30_224818_c1 3300050516 Bacteria 835
1687 nmdc:mga0sz30_240505_c1 3300050516 Bacteria 806
1688 nmdc:mga0sz30_345641_c1 3300050516 Bacteria 665
1689 nmdc:mga0sz30_365865_c1 3300050516 Bacteria 645
1690 nmdc:mga0sz30_504376_c1 3300050516 Bacteria 544
1691 nmdc:mga0sz30_52809_c1 3300050516 Bacteria 1726
1692 nmdc:mga0sz30_7570_c1 3300050516 Bacteria 4077
1693 Ga0495601_0173473 3300053077 Bacteria 1410
1694 Ga0495612_0197189 3300053078 Bacteria 888
1695 Ga0495655_0031694 3300053083 Bacteria 1288
1696 Ga0495655_0047211 3300053083 Bacteria 1126
1697 Ga0495655_0088694 3300053083 Bacteria 898
1698 Ga0495655_0205017 3300053083 Bacteria 646
1699 Ga0495655_0301157 3300053083 Bacteria 551
1700 Ga0495595_0019945 3300053084 Bacteria 2913
1701 Ga0495595_0036132 3300053084 Bacteria 2241
1702 Ga0495619_0996963 3300053085 Bacteria 560
1703 Ga0500578_0076055 3300053086 Bacteria 2138
1704 Ga0500578_0174654 3300053086 Bacteria 1327
1705 Ga0500578_0191088 3300053086 Bacteria 1257
1706 Ga0500643_006068 3300053087 Bacteria 5105
1707 Ga0500644_0229872 3300053088 Bacteria 776
1708 Ga0500581_123599 3300053089 Bacteria 1247
1709 Ga0500646_0060067 3300053090 Bacteria 1117
1710 Ga0500646_0147104 3300053090 Bacteria 777
1711 Ga0500647_0304313 3300053091 Bacteria 680
1712 Ga0500583_0015473 3300053092 Bacteria 3018
1713 Ga0500583_0151438 3300053092 Bacteria 1154
1714 Ga0500583_0601273 3300053092 Bacteria 505
1715 Ga0500651_0284683 3300053093 Bacteria 952
1716 Ga0500651_0381504 3300053093 Bacteria 795
1717 Ga0500566_0000029 3300053094 Bacteria 75384
1718 Ga0500566_0036505 3300053094 Bacteria 2850
1719 Ga0500566_0417257 3300053094 Bacteria 596
1720 Ga0500566_0451497 3300053094 Bacteria 563
1721 Ga0500640_280931 3300053095 Bacteria 510
1722 Ga0500641_0010979 3300053096 Bacteria 3284
1723 Ga0500641_0307600 3300053096 Bacteria 649
1724 Ga0500650_0327915 3300053098 Bacteria 673
1725 Ga0500554_099820 3300053102 Bacteria 971
1726 Ga0500555_003871 3300053103 Bacteria 4258
1727 Ga0500556_0051083 3300053104 Bacteria 1496
1728 Ga0500557_000066 3300053105 Bacteria 41202
1729 Ga0500562_020119 3300053108 Bacteria 1732
1730 Ga0500562_100008 3300053108 Bacteria 789
1731 Ga0500569_128589 3300053109 Bacteria 847
1732 Ga0500582_039924 3300053114 Bacteria 1492
1733 Ga0500592_086135 3300053116 Bacteria 525
1734 Ga0500594_0346619 3300053118 Bacteria 500
1735 Ga0500595_002381 3300053119 Bacteria 9399
1736 Ga0500595_029527 3300053119 Bacteria 1859
1737 Ga0500597_128206 3300053120 Bacteria 1097
1738 Ga0500614_205670 3300053123 Bacteria 608
1739 Ga0500617_093516 3300053124 Bacteria 1282
1740 Ga0500621_193079 3300053126 Bacteria 728
1741 Ga0500626_228450 3300053128 Bacteria 711
1742 Ga0500626_231676 3300053128 Bacteria 703
1743 Ga0500642_0243575 3300053130 Bacteria 827
1744 Ga0500642_0470664 3300053130 Bacteria 536
1745 Ga0500658_0164723 3300053134 Bacteria 1005
1746 Ga0500658_0244122 3300053134 Bacteria 825
1747 Ga0500658_0528298 3300053134 Bacteria 532
1748 Ga0500658_0549781 3300053134 Bacteria 520
1749 Ga0500561_0159771 3300053137 Bacteria 704
1750 Ga0500561_0240818 3300053137 Bacteria 575
1751 Ga0500568_0010187 3300053139 Bacteria 4417
1752 Ga0500568_0304026 3300053139 Bacteria 579
1753 Ga0500577_0207514 3300053142 Bacteria 846
1754 Ga0500579_241243 3300053143 Bacteria 599
1755 Ga0500588_0209223 3300053146 Bacteria 724
1756 Ga0500589_059839 3300053147 Bacteria 1748
1757 Ga0500589_118817 3300053147 Bacteria 1122
1758 Ga0500589_146714 3300053147 Bacteria 965
1759 Ga0500603_011207 3300053150 Bacteria 2036
1760 Ga0500603_055507 3300053150 Bacteria 1095
1761 Ga0500604_0099735 3300053151 Bacteria 956
1762 Ga0500616_0217852 3300053153 Bacteria 834
1763 Ga0500622_0020016 3300053156 Bacteria 3553
1764 Ga0500622_0299741 3300053156 Bacteria 685
1765 Ga0500624_129007 3300053157 Bacteria 535
1766 Ga0500627_0067831 3300053158 Bacteria 1576
1767 Ga0500633_0123238 3300053160 Bacteria 965
1768 Ga0500634_0346555 3300053161 Bacteria 568
1769 Ga0500638_007496 3300053162 Bacteria 4572
1770 Ga0500636_0152869 3300053177 Bacteria 1266
1771 Ga0500636_0355719 3300053177 Bacteria 697
1772 Ga0500637_0139482 3300053178 Bacteria 1403
1773 Ga0500649_175023 3300053722 Bacteria 734
1774 Ga0500611_023183 3300053727 Bacteria 1206
1775 Ga0500625_091780 3300053729 Bacteria 1297
1776 Ga0500645_015281 3300053730 Bacteria 2434
1777 Ga0500645_035636 3300053730 Bacteria 1481
1778 Ga0500609_037907 3300053731 Bacteria 665
1779 Ga0500656_002762 3300053732 Bacteria 1605
1780 Ga0500601_006119 3300053737 Bacteria 1326
1781 Ga0500587_086400 3300053739 Bacteria 512
1782 Ga0501084_0034045 3300054114 Bacteria 4260
1783 Ga0501084_0512799 3300054114 Bacteria 1014
1784 Ga0500661_001073 3300055283 Bacteria 5159
1785 Ga0501082_0000706 3300060353 Bacteria 29338
1786 Ga0530510_0284935 3300061734 Bacteria 1235

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100852593 Ga0070683_1008525932 85
2 3300012475 Ga0157317_1007755 Ga0157317_10077552 85
3 3300025920 Ga0207649_10389294 Ga0207649_103892942 85
4 iso_pu_bacteria 2524023210 2524468371 85
5 iso_pu_bacteria 2728368998 2728752041 85
6 iso_pu_bacteria 2906610324 2906614183 85
7 iso_pu_bacteria 2908739725 2908746985 85
8 iso_pu_bacteria 2922425934 2922426005 85
9 iso_pu_bacteria 8006933436 8006936710 85
10 iso_pu_bacteria 8006973647 8006976680 85
11 iso_pu_bacteria 8019555841 8019562000 85
12 iso_pu_bacteria 8019565922 8019572063 85
13 3300048928 Ga0496125_0310865 Ga0496125_0310865_506_769 86
14 iso_pu_bacteria 2513237101 2513694043 86
15 iso_pu_bacteria 2721755755 2723849343 86
16 iso_pu_bacteria 2791355199 2793077094 86
17 iso_pu_bacteria 2874604998 2874608425 86
18 iso_pu_bacteria 2876808645 2876815949 86
19 iso_pu_bacteria 2879110137 2879112807 86
20 iso_pu_bacteria 2889033259 2889035869 86
21 iso_pu_bacteria 2922361189 2922364347 86
22 iso_pu_bacteria 8006964411 8006970217 86
23 iso_pu_bacteria 8006984368 8006992445 86
24 iso_pu_bacteria 8006994254 8006999095 86
25 3300003659 JGI25404J52841_10013166 JGI25404J52841_100131663 87
26 3300005937 Ga0081455_10063407 Ga0081455_100634074 87
27 3300005983 Ga0081540_1015422 Ga0081540_10154222 87
28 3300005985 Ga0081539_10001014 Ga0081539_1000101441 87
29 3300005985 Ga0081539_10029861 Ga0081539_100298613 87
30 3300006871 Ga0075434_102176271 Ga0075434_1021762711 87
31 3300009147 Ga0114129_10897562 Ga0114129_108975622 87
32 3300035242 Ga0373962_0145816 Ga0373962_0145816_26_295 87
33 3300041413 Ga0439465_0012265 Ga0439465_0012265_2012_2278 87
34 3300042006 Ga0439432_186830 Ga0439432_186830_70_336 87
35 3300045051 Ga0451576_0987163 Ga0451576_0987163_107_376 87
36 3300046616 Ga0495668_0481790 Ga0495668_0481790_111_380 87
37 3300049569 Ga0501032_0210658 Ga0501032_0210658_776_1042 87
38 3300049575 Ga0501039_1537601 Ga0501039_1537601_31_297 87
39 3300049576 Ga0501040_0921461 Ga0501040_0921461_19_285 87
40 3300049578 Ga0501042_0232094 Ga0501042_0232094_93_359 87
41 3300049583 Ga0501067_0022379 Ga0501067_0022379_237_506 87
42 3300049583 Ga0501067_0775237 Ga0501067_0775237_147_416 87
43 3300049586 Ga0501070_0286160 Ga0501070_0286160_549_812 87
44 3300049586 Ga0501070_0722352 Ga0501070_0722352_222_488 87
45 3300049587 Ga0501071_0427723 Ga0501071_0427723_332_598 87
46 3300049592 Ga0501076_0074021 Ga0501076_0074021_1066_1332 87
47 3300049742 Ga0501080_0593473 Ga0501080_0593473_70_336 87
48 3300049744 Ga0501083_0722716 Ga0501083_0722716_16_285 87
49 3300049823 Ga0501044_0678034 Ga0501044_0678034_207_473 87
50 3300050507 nmdc:mga05p37_491695_c1 nmdc:mga05p37_491695_c1_972_1241 87
51 3300050512 nmdc:mga0n895_170346_c1 nmdc:mga0n895_170346_c1_1503_1772 87
52 iso_pu_bacteria 2508501009 2508539498 87
53 iso_pu_bacteria 2511231028 2511401128 87
54 iso_pu_bacteria 2513237092 2513624733 87
55 iso_pu_bacteria 2513237094 2513642281 87
56 iso_pu_bacteria 2513237095 2513652782 87
57 iso_pu_bacteria 2513237102 2513700408 87
58 iso_pu_bacteria 2513237139 2513876954 87
59 iso_pu_bacteria 2513237161 2514016070 87
60 iso_pu_bacteria 2515154112 2515624003 87
61 iso_pu_bacteria 2524023205 2524440058 87
62 iso_pu_bacteria 2528768022 2528852094 87
63 iso_pu_bacteria 2617270735 2617353227 87
64 iso_pu_bacteria 2617270741 2617377274 87
65 iso_pu_bacteria 2744054633 2745077830 87
66 iso_pu_bacteria 2791355196 2793065618 87
67 iso_pu_bacteria 2802429603 2805921251 87
68 iso_pu_bacteria 2816332527 2818239234 87
69 iso_pu_bacteria 2824600985 2824607479 87
70 iso_pu_bacteria 2824609381 2824615628 87
71 iso_pu_bacteria 2824617872 2824625621 87
72 iso_pu_bacteria 2824626560 2824631756 87
73 iso_pu_bacteria 2824644064 2824651016 87
74 iso_pu_bacteria 2824661429 2824670781 87
75 iso_pu_bacteria 2824671348 2824677922 87
76 iso_pu_bacteria 2824687955 2824694347 87
77 iso_pu_bacteria 2824696289 2824702535 87
78 iso_pu_bacteria 2824714736 2824723576 87
79 iso_pu_bacteria 2824723954 2824731172 87
80 iso_pu_bacteria 2824732956 2824736274 87
81 iso_pu_bacteria 2824746037 2824750310 87
82 iso_pu_bacteria 2824773399 2824777501 87
83 iso_pu_bacteria 2838122688 2838125735 87
84 iso_pu_bacteria 2841941048 2841947946 87
85 iso_pu_bacteria 2841949485 2841957043 87
86 iso_pu_bacteria 2841966195 2841972774 87
87 iso_pu_bacteria 2841974524 2841977552 87
88 iso_pu_bacteria 2841983080 2841984891 87
89 iso_pu_bacteria 2842038055 2842041343 87
90 iso_pu_bacteria 2842045827 2842049385 87
91 iso_pu_bacteria 2844315083 2844315840 87
92 iso_pu_bacteria 2847939898 2847942653 87
93 iso_pu_bacteria 2849076700 2849083407 87
94 iso_pu_bacteria 2857509624 2857515614 87
95 iso_pu_bacteria 2874645413 2874647750 87
96 iso_pu_bacteria 2879099564 2879106720 87
97 iso_pu_bacteria 2888388044 2888390310 87
98 iso_pu_bacteria 2903727486 2903730860 87
99 iso_pu_bacteria 2906602504 2906603683 87
100 iso_pu_bacteria 2908775508 2908775788 87
101 iso_pu_bacteria 2922368715 2922369135 87
102 iso_pu_bacteria 2922386360 2922389044 87
103 iso_pu_bacteria 2922393267 2922400746 87
104 iso_pu_bacteria 2929615660 2929618989 87
105 iso_pu_bacteria 2929624759 2929631066 87
106 iso_pu_bacteria 2932784394 2932789031 87
107 iso_pu_bacteria 2932809354 2932814332 87
108 iso_pu_bacteria 2932818245 2932820458 87
109 iso_pu_bacteria 2932828146 2932834490 87
110 iso_pu_bacteria 2933577622 2933580301 87
111 iso_pu_bacteria 2935616580 2935624473 87
112 iso_pu_bacteria 2935638405 2935645863 87
113 iso_pu_bacteria 2935665750 2935673430 87
114 iso_pu_bacteria 2935675223 2935682607 87
115 iso_pu_bacteria 2935684952 2935686779 87
116 iso_pu_bacteria 2935694250 2935701541 87
117 iso_pu_bacteria 2935703347 2935710484 87
118 iso_pu_bacteria 2935713505 2935716467 87
119 iso_pu_bacteria 2935722832 2935723408 87
120 iso_pu_bacteria 2935732158 2935734964 87
121 iso_pu_bacteria 2935741537 2935744245 87
122 iso_pu_bacteria 2935750917 2935752745 87
123 iso_pu_bacteria 2935760218 2935764708 87
124 iso_pu_bacteria 2935769743 2935774128 87
125 iso_pu_bacteria 2935777560 2935783738 87
126 iso_pu_bacteria 2935785616 2935789155 87
127 iso_pu_bacteria 2935793552 2935796904 87
128 iso_pu_bacteria 2935801545 2935806181 87
129 iso_pu_bacteria 2935810662 2935816947 87
130 iso_pu_bacteria 2935827899 2935835236 87
131 iso_pu_bacteria 2935837841 2935841382 87
132 iso_pu_bacteria 2935855204 2935863050 87
133 iso_pu_bacteria 2935864058 2935871860 87
134 iso_pu_bacteria 2935873716 2935882249 87
135 iso_pu_bacteria 2935992306 2936000180 87
136 iso_pu_bacteria 2936002035 2936010094 87
137 iso_pu_bacteria 2936037263 2936043938 87
138 iso_pu_bacteria 2940556831 2940558658 87
139 iso_pu_bacteria 2941538514 2941543608 87
140 iso_pu_bacteria 3005483717 3005486393 87
141 iso_pu_bacteria 3005506211 3005506265 87
142 iso_pu_bacteria 3005587118 3005589046 87
143 iso_pu_bacteria 3005594810 3005595424 87
144 iso_pu_bacteria 3005710791 3005711384 87
145 iso_pu_bacteria 8006926726 8006931165 87
146 iso_pu_bacteria 8016511872 8016517771 87
147 iso_pu_bacteria 8016522445 8016525832 87
148 iso_pu_bacteria 8016548790 8016549570 87
149 iso_pu_bacteria 8016557553 8016557990 87
150 iso_pu_bacteria 8016566248 8016569125 87
151 iso_pu_bacteria 8016575299 8016581762 87
152 iso_pu_bacteria 8016583857 8016585944 87
153 iso_pu_bacteria 8016595262 8016596006 87
154 iso_pu_bacteria 8016622563 8016622747 87
155 iso_pu_bacteria 8017057580 8017058859 87
156 iso_pu_bacteria 8019530166 8019530715 87
157 iso_pu_bacteria 8019538911 8019540870 87
158 iso_pu_bacteria 8019547302 8019549745 87
159 iso_pu_bacteria 8019576017 8019576792 87
160 iso_pu_bacteria 8019586578 8019594848 87
161 iso_pu_bacteria 8019597564 8019606891 87
162 iso_pu_bacteria 8019608314 8019611617 87
163 iso_pu_bacteria 8019619141 8019623343 87
164 iso_pu_bacteria 8019648815 8019652961 87
165 iso_pu_bacteria 8055742211 8055742838 87
166 iso_pu_bacteria 8056673599 8056676301 87
167 3300003214 JGI25165J46597_1026270 JGI25165J46597_10262701 88
168 3300005436 Ga0070713_100323459 Ga0070713_1003234592 88
169 3300005466 Ga0070685_10842817 Ga0070685_108428171 88
170 3300005937 Ga0081455_10024690 Ga0081455_100246908 88
171 3300005983 Ga0081540_1044261 Ga0081540_10442612 88
172 3300006177 Ga0075362_10431477 Ga0075362_104314772 88
173 3300006871 Ga0075434_100466664 Ga0075434_1004666642 88
174 3300010375 Ga0105239_11327192 Ga0105239_113271922 88
175 3300012510 Ga0157316_1038527 Ga0157316_10385272 88
176 3300013307 Ga0157372_10297185 Ga0157372_102971853 88
177 3300025261 Ga0209233_1010790 Ga0209233_10107904 88
178 3300033442 Ga0315911_1000035 Ga0315911_10000355 88
179 3300046477 Ga0495664_0221269 Ga0495664_0221269_156_422 88
180 3300047317 Ga0495604_0343739 Ga0495604_0343739_291_560 88
181 3300047319 Ga0495674_0398879 Ga0495674_0398879_482_748 88
182 3300048925 Ga0496122_0473277 Ga0496122_0473277_40_312 88
183 3300048926 Ga0496123_0238765 Ga0496123_0238765_463_738 88
184 3300048929 Ga0496126_1016474 Ga0496126_1016474_154_426 88
185 3300049577 Ga0501041_0213187 Ga0501041_0213187_651_920 88
186 3300050493 nmdc:mga0k408_185362_c1 nmdc:mga0k408_185362_c1_214_483 88
187 3300050512 nmdc:mga0n895_1131459_c1 nmdc:mga0n895_1131459_c1_218_490 88
188 3300054114 Ga0501084_0512799 Ga0501084_0512799_72_341 88
189 3300005336 Ga0070680_100013669 Ga0070680_1000136697 89
190 3300005353 Ga0070669_101502443 Ga0070669_1015024431 89
191 3300005354 Ga0070675_100692523 Ga0070675_1006925232 89
192 3300005356 Ga0070674_100591015 Ga0070674_1005910152 89
193 3300005364 Ga0070673_100089572 Ga0070673_1000895724 89
194 3300005367 Ga0070667_101210405 Ga0070667_1012104052 89
195 3300005456 Ga0070678_100161098 Ga0070678_1001610982 89
196 3300005471 Ga0070698_101006717 Ga0070698_1010067172 89
197 3300005530 Ga0070679_101740189 Ga0070679_1017401891 89
198 3300005539 Ga0068853_100163053 Ga0068853_1001630533 89
199 3300005543 Ga0070672_101631555 Ga0070672_1016315552 89
200 3300005564 Ga0070664_102278877 Ga0070664_1022788772 89
201 3300005840 Ga0068870_10657166 Ga0068870_106571662 89
202 3300006038 Ga0075365_10176577 Ga0075365_101765772 89
203 3300006048 Ga0075363_100565938 Ga0075363_1005659381 89
204 3300006847 Ga0075431_101859086 Ga0075431_1018590862 89
205 3300009094 Ga0111539_11194434 Ga0111539_111944342 89
206 3300009148 Ga0105243_11294592 Ga0105243_112945922 89
207 3300009176 Ga0105242_13045283 Ga0105242_130452831 89
208 3300014745 Ga0157377_11425536 Ga0157377_114255362 89
209 3300017792 Ga0163161_10334614 Ga0163161_103346142 89
210 3300021377 Ga0213874_10014111 Ga0213874_100141113 89
211 3300021384 Ga0213876_10097724 Ga0213876_100977242 89
212 3300025315 Ga0207697_10077409 Ga0207697_100774093 89
213 3300025921 Ga0207652_10612144 Ga0207652_106121442 89
214 3300025926 Ga0207659_10995182 Ga0207659_109951822 89
215 3300025937 Ga0207669_10193706 Ga0207669_101937062 89
216 3300025940 Ga0207691_10267953 Ga0207691_102679533 89
217 3300025960 Ga0207651_10132441 Ga0207651_101324412 89
218 3300026121 Ga0207683_10393388 Ga0207683_103933882 89
219 3300028556 Ga0265337_1024491 Ga0265337_10244912 89
220 3300028558 Ga0265326_10009229 Ga0265326_100092293 89
221 3300028563 Ga0265319_1012511 Ga0265319_10125115 89
222 3300028577 Ga0265318_10024721 Ga0265318_100247213 89
223 3300028653 Ga0265323_10001795 Ga0265323_100017956 89
224 3300028654 Ga0265322_10015165 Ga0265322_100151652 89
225 3300028666 Ga0265336_10002399 Ga0265336_100023996 89
226 3300028800 Ga0265338_10000621 Ga0265338_1000062124 89
227 3300029957 Ga0265324_10005519 Ga0265324_100055192 89
228 3300031548 Ga0307408_100178307 Ga0307408_1001783072 89
229 3300031901 Ga0307406_10417281 Ga0307406_104172812 89
230 3300032002 Ga0307416_101445213 Ga0307416_1014452132 89
231 3300039437 Ga0436365_0041738 Ga0436365_0041738_1157_1429 89
232 3300039450 Ga0436363_1051465 Ga0436363_1051465_1437_1709 89
233 3300041413 Ga0439465_0033745 Ga0439465_0033745_79_351 89
234 3300041459 Ga0451800_1656248 Ga0451800_1656248_64_336 89
235 3300044901 Ga0466960_0662421 Ga0466960_0662421_166_438 89
236 3300046529 Ga0495652_0938378 Ga0495652_0938378_198_470 89
237 3300046674 Ga0495588_0254974 Ga0495588_0254974_88_360 89
238 3300048904 Ga0496101_0078600 Ga0496101_0078600_501_773 89
239 3300048904 Ga0496101_0878553 Ga0496101_0878553_161_433 89
240 3300048907 Ga0496104_0022858 Ga0496104_0022858_3429_3701 89
241 3300048909 Ga0496106_0000810 Ga0496106_0000810_12221_12493 89
242 3300048910 Ga0496107_0088718 Ga0496107_0088718_947_1219 89
243 3300048911 Ga0496108_0000553 Ga0496108_0000553_12728_13000 89
244 3300048912 Ga0496109_0000574 Ga0496109_0000574_17644_17916 89
245 3300048913 Ga0496110_0029231 Ga0496110_0029231_2956_3228 89
246 3300048914 Ga0496111_0039981 Ga0496111_0039981_2235_2507 89
247 3300048915 Ga0496112_0247986 Ga0496112_0247986_1247_1519 89
248 3300048917 Ga0496114_0728916 Ga0496114_0728916_320_592 89
249 3300048918 Ga0496115_0300627 Ga0496115_0300627_774_1046 89
250 3300049586 Ga0501070_0488162 Ga0501070_0488162_148_423 89
251 3300050490 nmdc:mga03n38_398307_c1 nmdc:mga03n38_398307_c1_380_652 89
252 3300050492 nmdc:mga0yw44_1043848_c1 nmdc:mga0yw44_1043848_c1_230_502 89
253 3300050492 nmdc:mga0yw44_214933_c1 nmdc:mga0yw44_214933_c1_520_792 89
254 3300053077 Ga0495601_0173473 Ga0495601_0173473_608_880 89
255 3300053084 Ga0495595_0036132 Ga0495595_0036132_562_834 89
256 3300000532 CNAas_1010017 CNAas_10100171 90
257 3300001989 JGI24739J22299_10049881 JGI24739J22299_100498813 90
258 3300001990 JGI24737J22298_10157681 JGI24737J22298_101576812 90
259 3300001991 JGI24743J22301_10063579 JGI24743J22301_100635792 90
260 3300002077 JGI24744J21845_10047710 JGI24744J21845_100477102 90
261 3300002244 JGI24742J22300_10068797 JGI24742J22300_100687972 90
262 3300003215 JGI25153J46596_10000591 JGI25153J46596_100005916 90
263 3300003215 JGI25153J46596_10004570 JGI25153J46596_100045706 90
264 3300003354 JGI25160J50197_1001574 JGI25160J50197_10015746 90
265 3300003752 Ga0055539_1004555 Ga0055539_10045553 90
266 3300003762 Ga0055542_1006221 Ga0055542_10062212 90
267 3300003794 Ga0055531_10005617 Ga0055531_100056176 90
268 3300004625 Ga0055543_1002362 Ga0055543_10023627 90
269 3300005262 Ga0065165_1004274 Ga0065165_10042747 90
270 3300005262 Ga0065165_1007132 Ga0065165_10071323 90
271 3300005262 Ga0065165_1010207 Ga0065165_10102074 90
272 3300005327 Ga0070658_10085417 Ga0070658_100854172 90
273 3300005327 Ga0070658_10125998 Ga0070658_101259983 90
274 3300005327 Ga0070658_11848480 Ga0070658_118484802 90
275 3300005328 Ga0070676_10599044 Ga0070676_105990442 90
276 3300005328 Ga0070676_10664363 Ga0070676_106643632 90
277 3300005328 Ga0070676_11165147 Ga0070676_111651472 90
278 3300005329 Ga0070683_100194147 Ga0070683_1001941473 90
279 3300005330 Ga0070690_100102671 Ga0070690_1001026714 90
280 3300005330 Ga0070690_100599969 Ga0070690_1005999692 90
281 3300005330 Ga0070690_100661884 Ga0070690_1006618842 90
282 3300005330 Ga0070690_100704555 Ga0070690_1007045552 90
283 3300005331 Ga0070670_100162962 Ga0070670_1001629623 90
284 3300005331 Ga0070670_100746492 Ga0070670_1007464921 90
285 3300005331 Ga0070670_100919310 Ga0070670_1009193102 90
286 3300005331 Ga0070670_101544837 Ga0070670_1015448372 90
287 3300005333 Ga0070677_10239779 Ga0070677_102397792 90
288 3300005334 Ga0068869_100061214 Ga0068869_1000612144 90
289 3300005334 Ga0068869_100171445 Ga0068869_1001714452 90
290 3300005334 Ga0068869_100501352 Ga0068869_1005013522 90
291 3300005334 Ga0068869_100792055 Ga0068869_1007920552 90
292 3300005334 Ga0068869_101786086 Ga0068869_1017860861 90
293 3300005335 Ga0070666_10350927 Ga0070666_103509272 90
294 3300005335 Ga0070666_10368740 Ga0070666_103687402 90
295 3300005335 Ga0070666_10430015 Ga0070666_104300151 90
296 3300005335 Ga0070666_10462681 Ga0070666_104626811 90
297 3300005335 Ga0070666_11289707 Ga0070666_112897071 90
298 3300005335 Ga0070666_11372899 Ga0070666_113728992 90
299 3300005336 Ga0070680_100159935 Ga0070680_1001599353 90
300 3300005337 Ga0070682_100061312 Ga0070682_1000613124 90
301 3300005337 Ga0070682_100252144 Ga0070682_1002521442 90
302 3300005338 Ga0068868_100023606 Ga0068868_1000236063 90
303 3300005338 Ga0068868_100098967 Ga0068868_1000989673 90
304 3300005339 Ga0070660_100063948 Ga0070660_1000639482 90
305 3300005339 Ga0070660_100307878 Ga0070660_1003078781 90
306 3300005339 Ga0070660_100374642 Ga0070660_1003746422 90
307 3300005339 Ga0070660_100542515 Ga0070660_1005425152 90
308 3300005339 Ga0070660_100693413 Ga0070660_1006934132 90
309 3300005339 Ga0070660_101391073 Ga0070660_1013910732 90
310 3300005339 Ga0070660_101428265 Ga0070660_1014282652 90
311 3300005339 Ga0070660_101443855 Ga0070660_1014438552 90
312 3300005340 Ga0070689_100474571 Ga0070689_1004745712 90
313 3300005341 Ga0070691_10337237 Ga0070691_103372372 90
314 3300005341 Ga0070691_10386113 Ga0070691_103861132 90
315 3300005343 Ga0070687_100138819 Ga0070687_1001388191 90
316 3300005344 Ga0070661_100320373 Ga0070661_1003203732 90
317 3300005344 Ga0070661_100460755 Ga0070661_1004607552 90
318 3300005344 Ga0070661_100606127 Ga0070661_1006061272 90
319 3300005344 Ga0070661_100644368 Ga0070661_1006443682 90
320 3300005344 Ga0070661_101619095 Ga0070661_1016190952 90
321 3300005345 Ga0070692_10091303 Ga0070692_100913031 90
322 3300005345 Ga0070692_10582604 Ga0070692_105826042 90
323 3300005347 Ga0070668_100030308 Ga0070668_1000303082 90
324 3300005347 Ga0070668_100034627 Ga0070668_1000346272 90
325 3300005347 Ga0070668_100128957 Ga0070668_1001289573 90
326 3300005347 Ga0070668_100341800 Ga0070668_1003418002 90
327 3300005347 Ga0070668_100587968 Ga0070668_1005879682 90
328 3300005347 Ga0070668_100729751 Ga0070668_1007297511 90
329 3300005353 Ga0070669_100172602 Ga0070669_1001726023 90
330 3300005353 Ga0070669_100419104 Ga0070669_1004191042 90
331 3300005353 Ga0070669_100856445 Ga0070669_1008564452 90
332 3300005353 Ga0070669_100935048 Ga0070669_1009350482 90
333 3300005354 Ga0070675_100241631 Ga0070675_1002416311 90
334 3300005354 Ga0070675_100432863 Ga0070675_1004328632 90
335 3300005354 Ga0070675_100663086 Ga0070675_1006630862 90
336 3300005355 Ga0070671_100088263 Ga0070671_1000882632 90
337 3300005355 Ga0070671_100242406 Ga0070671_1002424062 90
338 3300005355 Ga0070671_100337717 Ga0070671_1003377171 90
339 3300005355 Ga0070671_100447901 Ga0070671_1004479011 90
340 3300005355 Ga0070671_100852753 Ga0070671_1008527531 90
341 3300005355 Ga0070671_101056084 Ga0070671_1010560842 90
342 3300005356 Ga0070674_100088132 Ga0070674_1000881323 90
343 3300005356 Ga0070674_100118359 Ga0070674_1001183593 90
344 3300005356 Ga0070674_100136137 Ga0070674_1001361372 90
345 3300005364 Ga0070673_100348439 Ga0070673_1003484392 90
346 3300005364 Ga0070673_100500018 Ga0070673_1005000182 90
347 3300005364 Ga0070673_100668792 Ga0070673_1006687922 90
348 3300005364 Ga0070673_101234378 Ga0070673_1012343782 90
349 3300005365 Ga0070688_101246943 Ga0070688_1012469432 90
350 3300005365 Ga0070688_101589611 Ga0070688_1015896112 90
351 3300005366 Ga0070659_100431421 Ga0070659_1004314212 90
352 3300005366 Ga0070659_100646238 Ga0070659_1006462382 90
353 3300005366 Ga0070659_100677290 Ga0070659_1006772902 90
354 3300005367 Ga0070667_100385399 Ga0070667_1003853992 90
355 3300005367 Ga0070667_100539348 Ga0070667_1005393482 90
356 3300005367 Ga0070667_100617233 Ga0070667_1006172331 90
357 3300005367 Ga0070667_100839964 Ga0070667_1008399642 90
358 3300005367 Ga0070667_101126508 Ga0070667_1011265081 90
359 3300005367 Ga0070667_101129709 Ga0070667_1011297091 90
360 3300005434 Ga0070709_10501654 Ga0070709_105016541 90
361 3300005435 Ga0070714_100045997 Ga0070714_1000459972 90
362 3300005435 Ga0070714_100274949 Ga0070714_1002749493 90
363 3300005435 Ga0070714_100912573 Ga0070714_1009125731 90
364 3300005435 Ga0070714_102048301 Ga0070714_1020483011 90
365 3300005436 Ga0070713_100014537 Ga0070713_1000145372 90
366 3300005436 Ga0070713_100018727 Ga0070713_1000187273 90
367 3300005436 Ga0070713_100745148 Ga0070713_1007451482 90
368 3300005437 Ga0070710_10085355 Ga0070710_100853551 90
369 3300005437 Ga0070710_10107141 Ga0070710_101071411 90
370 3300005437 Ga0070710_10810101 Ga0070710_108101011 90
371 3300005438 Ga0070701_10349185 Ga0070701_103491852 90
372 3300005438 Ga0070701_10405848 Ga0070701_104058482 90
373 3300005439 Ga0070711_100036810 Ga0070711_1000368102 90
374 3300005439 Ga0070711_100069956 Ga0070711_1000699563 90
375 3300005439 Ga0070711_100694249 Ga0070711_1006942492 90
376 3300005440 Ga0070705_101940551 Ga0070705_1019405511 90
377 3300005441 Ga0070700_101651795 Ga0070700_1016517951 90
378 3300005441 Ga0070700_101776670 Ga0070700_1017766702 90
379 3300005444 Ga0070694_100263251 Ga0070694_1002632511 90
380 3300005444 Ga0070694_100936352 Ga0070694_1009363522 90
381 3300005455 Ga0070663_100006147 Ga0070663_1000061477 90
382 3300005455 Ga0070663_100052956 Ga0070663_1000529562 90
383 3300005455 Ga0070663_100164445 Ga0070663_1001644452 90
384 3300005455 Ga0070663_100171144 Ga0070663_1001711442 90
385 3300005455 Ga0070663_100282803 Ga0070663_1002828032 90
386 3300005455 Ga0070663_100372900 Ga0070663_1003729002 90
387 3300005455 Ga0070663_100402161 Ga0070663_1004021612 90
388 3300005455 Ga0070663_100638089 Ga0070663_1006380892 90
389 3300005456 Ga0070678_100037879 Ga0070678_1000378792 90
390 3300005456 Ga0070678_100222161 Ga0070678_1002221612 90
391 3300005456 Ga0070678_100471966 Ga0070678_1004719662 90
392 3300005456 Ga0070678_100486603 Ga0070678_1004866033 90
393 3300005456 Ga0070678_100544302 Ga0070678_1005443022 90
394 3300005456 Ga0070678_101239881 Ga0070678_1012398811 90
395 3300005456 Ga0070678_101479475 Ga0070678_1014794751 90
396 3300005457 Ga0070662_100148538 Ga0070662_1001485383 90
397 3300005457 Ga0070662_100212944 Ga0070662_1002129443 90
398 3300005457 Ga0070662_101444385 Ga0070662_1014443852 90
399 3300005458 Ga0070681_10084452 Ga0070681_100844523 90
400 3300005458 Ga0070681_10115679 Ga0070681_101156792 90
401 3300005459 Ga0068867_100201214 Ga0068867_1002012142 90
402 3300005459 Ga0068867_102084977 Ga0068867_1020849771 90
403 3300005466 Ga0070685_10832079 Ga0070685_108320792 90
404 3300005466 Ga0070685_11191103 Ga0070685_111911032 90
405 3300005471 Ga0070698_100144666 Ga0070698_1001446663 90
406 3300005518 Ga0070699_101980495 Ga0070699_1019804952 90
407 3300005530 Ga0070679_100011418 Ga0070679_1000114188 90
408 3300005535 Ga0070684_101074967 Ga0070684_1010749671 90
409 3300005539 Ga0068853_100243311 Ga0068853_1002433112 90
410 3300005539 Ga0068853_100392583 Ga0068853_1003925832 90
411 3300005539 Ga0068853_100644934 Ga0068853_1006449342 90
412 3300005543 Ga0070672_100012411 Ga0070672_1000124116 90
413 3300005543 Ga0070672_101053439 Ga0070672_1010534392 90
414 3300005546 Ga0070696_100101469 Ga0070696_1001014693 90
415 3300005547 Ga0070693_100279973 Ga0070693_1002799732 90
416 3300005547 Ga0070693_100403308 Ga0070693_1004033081 90
417 3300005547 Ga0070693_101533462 Ga0070693_1015334622 90
418 3300005548 Ga0070665_100022438 Ga0070665_1000224384 90
419 3300005548 Ga0070665_100072156 Ga0070665_1000721563 90
420 3300005548 Ga0070665_100093197 Ga0070665_1000931973 90
421 3300005548 Ga0070665_100107411 Ga0070665_1001074114 90
422 3300005548 Ga0070665_100111541 Ga0070665_1001115412 90
423 3300005548 Ga0070665_100140122 Ga0070665_1001401223 90
424 3300005548 Ga0070665_100204646 Ga0070665_1002046462 90
425 3300005548 Ga0070665_100266706 Ga0070665_1002667062 90
426 3300005548 Ga0070665_100468237 Ga0070665_1004682372 90
427 3300005548 Ga0070665_100838428 Ga0070665_1008384282 90
428 3300005548 Ga0070665_102205192 Ga0070665_1022051922 90
429 3300005548 Ga0070665_102272782 Ga0070665_1022727822 90
430 3300005549 Ga0070704_100598655 Ga0070704_1005986551 90
431 3300005563 Ga0068855_100025627 Ga0068855_1000256274 90
432 3300005563 Ga0068855_100102183 Ga0068855_1001021832 90
433 3300005563 Ga0068855_100197760 Ga0068855_1001977603 90
434 3300005563 Ga0068855_100230759 Ga0068855_1002307592 90
435 3300005563 Ga0068855_100372445 Ga0068855_1003724452 90
436 3300005563 Ga0068855_101773481 Ga0068855_1017734812 90
437 3300005563 Ga0068855_102543438 Ga0068855_1025434382 90
438 3300005564 Ga0070664_100207369 Ga0070664_1002073692 90
439 3300005564 Ga0070664_100893967 Ga0070664_1008939672 90
440 3300005564 Ga0070664_102024282 Ga0070664_1020242822 90
441 3300005577 Ga0068857_100881225 Ga0068857_1008812252 90
442 3300005577 Ga0068857_101149855 Ga0068857_1011498552 90
443 3300005577 Ga0068857_101271794 Ga0068857_1012717942 90
444 3300005577 Ga0068857_101878130 Ga0068857_1018781302 90
445 3300005578 Ga0068854_100622776 Ga0068854_1006227762 90
446 3300005614 Ga0068856_100053715 Ga0068856_1000537152 90
447 3300005614 Ga0068856_100354164 Ga0068856_1003541642 90
448 3300005614 Ga0068856_100753536 Ga0068856_1007535362 90
449 3300005614 Ga0068856_101364063 Ga0068856_1013640632 90
450 3300005615 Ga0070702_101328497 Ga0070702_1013284971 90
451 3300005616 Ga0068852_100025239 Ga0068852_1000252398 90
452 3300005616 Ga0068852_100226690 Ga0068852_1002266902 90
453 3300005616 Ga0068852_100257456 Ga0068852_1002574562 90
454 3300005616 Ga0068852_100612513 Ga0068852_1006125132 90
455 3300005616 Ga0068852_100991703 Ga0068852_1009917032 90
456 3300005616 Ga0068852_101066518 Ga0068852_1010665182 90
457 3300005616 Ga0068852_101334881 Ga0068852_1013348811 90
458 3300005616 Ga0068852_101905203 Ga0068852_1019052032 90
459 3300005617 Ga0068859_100097876 Ga0068859_1000978762 90
460 3300005617 Ga0068859_100267387 Ga0068859_1002673872 90
461 3300005617 Ga0068859_100491251 Ga0068859_1004912512 90
462 3300005617 Ga0068859_102576261 Ga0068859_1025762611 90
463 3300005617 Ga0068859_102885755 Ga0068859_1028857552 90
464 3300005618 Ga0068864_100023369 Ga0068864_1000233693 90
465 3300005618 Ga0068864_100069630 Ga0068864_1000696302 90
466 3300005618 Ga0068864_100288422 Ga0068864_1002884222 90
467 3300005618 Ga0068864_100473879 Ga0068864_1004738792 90
468 3300005618 Ga0068864_102604051 Ga0068864_1026040512 90
469 3300005718 Ga0068866_10030405 Ga0068866_100304052 90
470 3300005718 Ga0068866_10201366 Ga0068866_102013662 90
471 3300005718 Ga0068866_10256322 Ga0068866_102563222 90
472 3300005719 Ga0068861_100020519 Ga0068861_1000205196 90
473 3300005719 Ga0068861_100688563 Ga0068861_1006885632 90
474 3300005719 Ga0068861_100696571 Ga0068861_1006965712 90
475 3300005719 Ga0068861_100934405 Ga0068861_1009344052 90
476 3300005719 Ga0068861_100982661 Ga0068861_1009826611 90
477 3300005719 Ga0068861_101302064 Ga0068861_1013020642 90
478 3300005834 Ga0068851_10861471 Ga0068851_108614712 90
479 3300005840 Ga0068870_10087211 Ga0068870_100872112 90
480 3300005841 Ga0068863_100390092 Ga0068863_1003900922 90
481 3300005841 Ga0068863_100506994 Ga0068863_1005069942 90
482 3300005841 Ga0068863_100703149 Ga0068863_1007031492 90
483 3300005841 Ga0068863_100735770 Ga0068863_1007357702 90
484 3300005842 Ga0068858_100109449 Ga0068858_1001094494 90
485 3300005842 Ga0068858_100339942 Ga0068858_1003399422 90
486 3300005842 Ga0068858_100414167 Ga0068858_1004141672 90
487 3300005842 Ga0068858_100470179 Ga0068858_1004701792 90
488 3300005842 Ga0068858_101255612 Ga0068858_1012556121 90
489 3300005842 Ga0068858_101279923 Ga0068858_1012799232 90
490 3300005843 Ga0068860_100191633 Ga0068860_1001916332 90
491 3300005843 Ga0068860_100236923 Ga0068860_1002369232 90
492 3300005843 Ga0068860_100277662 Ga0068860_1002776623 90
493 3300005843 Ga0068860_100344465 Ga0068860_1003444652 90
494 3300005843 Ga0068860_102617323 Ga0068860_1026173232 90
495 3300005844 Ga0068862_100175212 Ga0068862_1001752123 90
496 3300005844 Ga0068862_100257681 Ga0068862_1002576813 90
497 3300005844 Ga0068862_100274979 Ga0068862_1002749792 90
498 3300005844 Ga0068862_100300185 Ga0068862_1003001852 90
499 3300005844 Ga0068862_100370303 Ga0068862_1003703032 90
500 3300005844 Ga0068862_100688105 Ga0068862_1006881052 90
501 3300005844 Ga0068862_100996249 Ga0068862_1009962492 90
502 3300005844 Ga0068862_101092453 Ga0068862_1010924532 90
503 3300005844 Ga0068862_101735247 Ga0068862_1017352472 90
504 3300005937 Ga0081455_10005919 Ga0081455_1000591910 90
505 3300005937 Ga0081455_10368984 Ga0081455_103689842 90
506 3300005937 Ga0081455_10825196 Ga0081455_108251961 90
507 3300005983 Ga0081540_1004312 Ga0081540_10043128 90
508 3300005983 Ga0081540_1007028 Ga0081540_100702810 90
509 3300005983 Ga0081540_1015982 Ga0081540_10159824 90
510 3300005983 Ga0081540_1018244 Ga0081540_10182445 90
511 3300005983 Ga0081540_1025146 Ga0081540_10251462 90
512 3300005983 Ga0081540_1047963 Ga0081540_10479633 90
513 3300005983 Ga0081540_1274359 Ga0081540_12743591 90
514 3300005983 Ga0081540_1346707 Ga0081540_13467072 90
515 3300005985 Ga0081539_10066584 Ga0081539_100665842 90
516 3300006028 Ga0070717_10153068 Ga0070717_101530682 90
517 3300006028 Ga0070717_11198356 Ga0070717_111983562 90
518 3300006038 Ga0075365_10021867 Ga0075365_100218676 90
519 3300006038 Ga0075365_10040963 Ga0075365_100409632 90
520 3300006038 Ga0075365_10060433 Ga0075365_100604334 90
521 3300006038 Ga0075365_10218361 Ga0075365_102183612 90
522 3300006038 Ga0075365_10245631 Ga0075365_102456312 90
523 3300006038 Ga0075365_10303700 Ga0075365_103037002 90
524 3300006038 Ga0075365_10398449 Ga0075365_103984492 90
525 3300006038 Ga0075365_10838117 Ga0075365_108381172 90
526 3300006042 Ga0075368_10007821 Ga0075368_100078214 90
527 3300006042 Ga0075368_10045459 Ga0075368_100454592 90
528 3300006042 Ga0075368_10062685 Ga0075368_100626852 90
529 3300006042 Ga0075368_10087727 Ga0075368_100877272 90
530 3300006042 Ga0075368_10181728 Ga0075368_101817282 90
531 3300006042 Ga0075368_10412112 Ga0075368_104121121 90
532 3300006048 Ga0075363_100026218 Ga0075363_1000262182 90
533 3300006048 Ga0075363_100064878 Ga0075363_1000648782 90
534 3300006048 Ga0075363_100148054 Ga0075363_1001480542 90
535 3300006048 Ga0075363_100259364 Ga0075363_1002593642 90
536 3300006048 Ga0075363_100360194 Ga0075363_1003601942 90
537 3300006048 Ga0075363_100383396 Ga0075363_1003833962 90
538 3300006048 Ga0075363_100510489 Ga0075363_1005104892 90
539 3300006048 Ga0075363_100587550 Ga0075363_1005875501 90
540 3300006051 Ga0075364_10087713 Ga0075364_100877134 90
541 3300006051 Ga0075364_10123083 Ga0075364_101230832 90
542 3300006051 Ga0075364_10191331 Ga0075364_101913312 90
543 3300006051 Ga0075364_10415216 Ga0075364_104152162 90
544 3300006051 Ga0075364_10437905 Ga0075364_104379052 90
545 3300006051 Ga0075364_10470927 Ga0075364_104709272 90
546 3300006051 Ga0075364_10474152 Ga0075364_104741522 90
547 3300006163 Ga0070715_10002760 Ga0070715_100027604 90
548 3300006173 Ga0070716_100026589 Ga0070716_1000265894 90
549 3300006173 Ga0070716_101415471 Ga0070716_1014154711 90
550 3300006175 Ga0070712_100029284 Ga0070712_1000292842 90
551 3300006175 Ga0070712_100247222 Ga0070712_1002472222 90
552 3300006175 Ga0070712_100612403 Ga0070712_1006124032 90
553 3300006177 Ga0075362_10032878 Ga0075362_100328783 90
554 3300006177 Ga0075362_10129391 Ga0075362_101293912 90
555 3300006177 Ga0075362_10165492 Ga0075362_101654922 90
556 3300006177 Ga0075362_10209879 Ga0075362_102098792 90
557 3300006177 Ga0075362_10312231 Ga0075362_103122312 90
558 3300006177 Ga0075362_10333917 Ga0075362_103339172 90
559 3300006178 Ga0075367_10018278 Ga0075367_100182785 90
560 3300006178 Ga0075367_10025365 Ga0075367_100253655 90
561 3300006178 Ga0075367_10033336 Ga0075367_100333363 90
562 3300006178 Ga0075367_10188882 Ga0075367_101888823 90
563 3300006178 Ga0075367_10215595 Ga0075367_102155952 90
564 3300006178 Ga0075367_10302139 Ga0075367_103021392 90
565 3300006178 Ga0075367_10346915 Ga0075367_103469152 90
566 3300006178 Ga0075367_10742037 Ga0075367_107420372 90
567 3300006186 Ga0075369_10064576 Ga0075369_100645762 90
568 3300006186 Ga0075369_10077396 Ga0075369_100773962 90
569 3300006186 Ga0075369_10149412 Ga0075369_101494121 90
570 3300006186 Ga0075369_10157650 Ga0075369_101576502 90
571 3300006186 Ga0075369_10202369 Ga0075369_102023692 90
572 3300006186 Ga0075369_10295070 Ga0075369_102950702 90
573 3300006186 Ga0075369_10471120 Ga0075369_104711202 90
574 3300006186 Ga0075369_10527148 Ga0075369_105271482 90
575 3300006194 Ga0075427_10025493 Ga0075427_100254932 90
576 3300006195 Ga0075366_10002600 Ga0075366_100026005 90
577 3300006195 Ga0075366_10022790 Ga0075366_100227902 90
578 3300006195 Ga0075366_10142287 Ga0075366_101422872 90
579 3300006195 Ga0075366_10166020 Ga0075366_101660202 90
580 3300006195 Ga0075366_10319826 Ga0075366_103198261 90
581 3300006195 Ga0075366_10595147 Ga0075366_105951472 90
582 3300006195 Ga0075366_11066440 Ga0075366_110664402 90
583 3300006237 Ga0097621_100033379 Ga0097621_1000333792 90
584 3300006237 Ga0097621_100508825 Ga0097621_1005088252 90
585 3300006237 Ga0097621_100991488 Ga0097621_1009914882 90
586 3300006237 Ga0097621_101086467 Ga0097621_1010864672 90
587 3300006237 Ga0097621_101138180 Ga0097621_1011381802 90
588 3300006353 Ga0075370_10007477 Ga0075370_100074772 90
589 3300006353 Ga0075370_10054435 Ga0075370_100544352 90
590 3300006353 Ga0075370_10076945 Ga0075370_100769452 90
591 3300006353 Ga0075370_10155546 Ga0075370_101555462 90
592 3300006353 Ga0075370_10160023 Ga0075370_101600232 90
593 3300006353 Ga0075370_10185570 Ga0075370_101855702 90
594 3300006353 Ga0075370_10246389 Ga0075370_102463892 90
595 3300006353 Ga0075370_10501427 Ga0075370_105014272 90
596 3300006353 Ga0075370_10510998 Ga0075370_105109982 90
597 3300006353 Ga0075370_10746821 Ga0075370_107468212 90
598 3300006358 Ga0068871_100250437 Ga0068871_1002504372 90
599 3300006358 Ga0068871_100264625 Ga0068871_1002646252 90
600 3300006358 Ga0068871_100868780 Ga0068871_1008687802 90
601 3300006358 Ga0068871_101005786 Ga0068871_1010057862 90
602 3300006358 Ga0068871_101962941 Ga0068871_1019629412 90
603 3300006358 Ga0068871_102096694 Ga0068871_1020966942 90
604 3300006846 Ga0075430_101199873 Ga0075430_1011998732 90
605 3300006852 Ga0075433_10317789 Ga0075433_103177892 90
606 3300006871 Ga0075434_100384881 Ga0075434_1003848812 90
607 3300006880 Ga0075429_101392915 Ga0075429_1013929151 90
608 3300006881 Ga0068865_100392449 Ga0068865_1003924492 90
609 3300006881 Ga0068865_100536479 Ga0068865_1005364791 90
610 3300006881 Ga0068865_101476240 Ga0068865_1014762402 90
611 3300006914 Ga0075436_101161527 Ga0075436_1011615271 90
612 3300006931 Ga0097620_100097872 Ga0097620_1000978722 90
613 3300006931 Ga0097620_100267389 Ga0097620_1002673893 90
614 3300006931 Ga0097620_100491232 Ga0097620_1004912322 90
615 3300006931 Ga0097620_102576281 Ga0097620_1025762811 90
616 3300006931 Ga0097620_102885492 Ga0097620_1028854922 90
617 3300006941 Ga0099825_1049937 Ga0099825_10499372 90
618 3300006942 Ga0099824_1012187 Ga0099824_10121877 90
619 3300006944 Ga0099823_1032421 Ga0099823_10324216 90
620 3300006944 Ga0099823_1094769 Ga0099823_10947692 90
621 3300007265 Ga0099794_10088918 Ga0099794_100889182 90
622 3300009011 Ga0105251_10176229 Ga0105251_101762292 90
623 3300009036 Ga0105244_10244773 Ga0105244_102447731 90
624 3300009093 Ga0105240_10005129 Ga0105240_100051298 90
625 3300009093 Ga0105240_10180668 Ga0105240_101806682 90
626 3300009094 Ga0111539_10099026 Ga0111539_100990265 90
627 3300009094 Ga0111539_10255735 Ga0111539_102557352 90
628 3300009094 Ga0111539_10613637 Ga0111539_106136372 90
629 3300009094 Ga0111539_11425700 Ga0111539_114257002 90
630 3300009098 Ga0105245_10098878 Ga0105245_100988782 90
631 3300009098 Ga0105245_10288417 Ga0105245_102884173 90
632 3300009098 Ga0105245_10569210 Ga0105245_105692102 90
633 3300009098 Ga0105245_11154911 Ga0105245_111549111 90
634 3300009098 Ga0105245_11564531 Ga0105245_115645312 90
635 3300009098 Ga0105245_11926375 Ga0105245_119263751 90
636 3300009098 Ga0105245_12699492 Ga0105245_126994921 90
637 3300009098 Ga0105245_13204609 Ga0105245_132046092 90
638 3300009101 Ga0105247_10100542 Ga0105247_101005423 90
639 3300009101 Ga0105247_10188812 Ga0105247_101888122 90
640 3300009101 Ga0105247_10250160 Ga0105247_102501602 90
641 3300009101 Ga0105247_10429767 Ga0105247_104297672 90
642 3300009101 Ga0105247_10508067 Ga0105247_105080672 90
643 3300009101 Ga0105247_11566563 Ga0105247_115665632 90
644 3300009147 Ga0114129_10270068 Ga0114129_102700684 90
645 3300009148 Ga0105243_10054913 Ga0105243_100549133 90
646 3300009148 Ga0105243_10076583 Ga0105243_100765832 90
647 3300009148 Ga0105243_10201155 Ga0105243_102011553 90
648 3300009148 Ga0105243_10234234 Ga0105243_102342343 90
649 3300009148 Ga0105243_10466021 Ga0105243_104660212 90
650 3300009148 Ga0105243_10486231 Ga0105243_104862312 90
651 3300009148 Ga0105243_10796458 Ga0105243_107964582 90
652 3300009174 Ga0105241_10014074 Ga0105241_100140746 90
653 3300009174 Ga0105241_10026870 Ga0105241_100268703 90
654 3300009174 Ga0105241_10325222 Ga0105241_103252222 90
655 3300009174 Ga0105241_10434358 Ga0105241_104343582 90
656 3300009174 Ga0105241_10604965 Ga0105241_106049652 90
657 3300009174 Ga0105241_10626896 Ga0105241_106268962 90
658 3300009174 Ga0105241_10750351 Ga0105241_107503512 90
659 3300009174 Ga0105241_11331133 Ga0105241_113311331 90
660 3300009174 Ga0105241_11965013 Ga0105241_119650132 90
661 3300009174 Ga0105241_12115623 Ga0105241_121156232 90
662 3300009176 Ga0105242_10057054 Ga0105242_100570543 90
663 3300009176 Ga0105242_10376127 Ga0105242_103761272 90
664 3300009176 Ga0105242_10670030 Ga0105242_106700302 90
665 3300009176 Ga0105242_11232800 Ga0105242_112328002 90
666 3300009177 Ga0105248_10026773 Ga0105248_100267736 90
667 3300009177 Ga0105248_10189413 Ga0105248_101894133 90
668 3300009177 Ga0105248_10613050 Ga0105248_106130502 90
669 3300009177 Ga0105248_10885328 Ga0105248_108853282 90
670 3300009177 Ga0105248_11257753 Ga0105248_112577531 90
671 3300009177 Ga0105248_11281078 Ga0105248_112810781 90
672 3300009177 Ga0105248_11710633 Ga0105248_117106332 90
673 3300009545 Ga0105237_10022489 Ga0105237_100224893 90
674 3300009545 Ga0105237_10132980 Ga0105237_101329803 90
675 3300009545 Ga0105237_10252951 Ga0105237_102529512 90
676 3300009545 Ga0105237_10565423 Ga0105237_105654232 90
677 3300009545 Ga0105237_11152833 Ga0105237_111528332 90
678 3300009545 Ga0105237_11153225 Ga0105237_111532252 90
679 3300009545 Ga0105237_11225916 Ga0105237_112259162 90
680 3300009545 Ga0105237_11836122 Ga0105237_118361221 90
681 3300009545 Ga0105237_11895198 Ga0105237_118951982 90
682 3300009551 Ga0105238_10204076 Ga0105238_102040764 90
683 3300009551 Ga0105238_10506669 Ga0105238_105066692 90
684 3300009551 Ga0105238_10787077 Ga0105238_107870772 90
685 3300009551 Ga0105238_11037214 Ga0105238_110372142 90
686 3300009551 Ga0105238_11344644 Ga0105238_113446442 90
687 3300009553 Ga0105249_10117532 Ga0105249_101175324 90
688 3300009553 Ga0105249_10321021 Ga0105249_103210211 90
689 3300009553 Ga0105249_10438350 Ga0105249_104383502 90
690 3300009553 Ga0105249_10647406 Ga0105249_106474062 90
691 3300009553 Ga0105249_11873594 Ga0105249_118735942 90
692 3300009553 Ga0105249_11965744 Ga0105249_119657442 90
693 3300010159 Ga0099796_10101010 Ga0099796_101010102 90
694 3300010159 Ga0099796_10248914 Ga0099796_102489142 90
695 3300010375 Ga0105239_10024829 Ga0105239_100248295 90
696 3300010375 Ga0105239_10054122 Ga0105239_100541223 90
697 3300010375 Ga0105239_10262639 Ga0105239_102626392 90
698 3300010375 Ga0105239_10444613 Ga0105239_104446132 90
699 3300010375 Ga0105239_10472716 Ga0105239_104727162 90
700 3300010375 Ga0105239_10916787 Ga0105239_109167872 90
701 3300010375 Ga0105239_11005937 Ga0105239_110059372 90
702 3300010375 Ga0105239_11054285 Ga0105239_110542852 90
703 3300010375 Ga0105239_11142083 Ga0105239_111420832 90
704 3300010375 Ga0105239_11574303 Ga0105239_115743032 90
705 3300010375 Ga0105239_12268873 Ga0105239_122688732 90
706 3300011119 Ga0105246_10142896 Ga0105246_101428963 90
707 3300011119 Ga0105246_10147427 Ga0105246_101474272 90
708 3300011119 Ga0105246_10151187 Ga0105246_101511872 90
709 3300011119 Ga0105246_10273820 Ga0105246_102738202 90
710 3300011119 Ga0105246_10733602 Ga0105246_107336022 90
711 3300011119 Ga0105246_12032575 Ga0105246_120325752 90
712 3300012492 Ga0157335_1012157 Ga0157335_10121571 90
713 3300012515 Ga0157338_1023987 Ga0157338_10239872 90
714 3300013100 Ga0157373_10258053 Ga0157373_102580532 90
715 3300013100 Ga0157373_10358359 Ga0157373_103583592 90
716 3300013100 Ga0157373_11204978 Ga0157373_112049782 90
717 3300013102 Ga0157371_10307577 Ga0157371_103075772 90
718 3300013102 Ga0157371_10885451 Ga0157371_108854512 90
719 3300013104 Ga0157370_10353691 Ga0157370_103536912 90
720 3300013104 Ga0157370_10632589 Ga0157370_106325892 90
721 3300013104 Ga0157370_10669770 Ga0157370_106697701 90
722 3300013105 Ga0157369_11240524 Ga0157369_112405242 90
723 3300013296 Ga0157374_10097080 Ga0157374_100970804 90
724 3300013296 Ga0157374_10222359 Ga0157374_102223593 90
725 3300013296 Ga0157374_10399636 Ga0157374_103996362 90
726 3300013296 Ga0157374_11089363 Ga0157374_110893632 90
727 3300013296 Ga0157374_11614945 Ga0157374_116149451 90
728 3300013296 Ga0157374_12392028 Ga0157374_123920281 90
729 3300013297 Ga0157378_10012413 Ga0157378_100124132 90
730 3300013297 Ga0157378_10209172 Ga0157378_102091724 90
731 3300013297 Ga0157378_10295599 Ga0157378_102955992 90
732 3300013297 Ga0157378_10534902 Ga0157378_105349023 90
733 3300013297 Ga0157378_11092753 Ga0157378_110927531 90
734 3300013306 Ga0163162_10243792 Ga0163162_102437922 90
735 3300013306 Ga0163162_10472754 Ga0163162_104727542 90
736 3300013306 Ga0163162_10586720 Ga0163162_105867202 90
737 3300013306 Ga0163162_10654863 Ga0163162_106548631 90
738 3300013306 Ga0163162_10779157 Ga0163162_107791572 90
739 3300013306 Ga0163162_11244585 Ga0163162_112445852 90
740 3300013306 Ga0163162_11286156 Ga0163162_112861562 90
741 3300013306 Ga0163162_11431752 Ga0163162_114317521 90
742 3300013306 Ga0163162_13126152 Ga0163162_131261522 90
743 3300013307 Ga0157372_10839566 Ga0157372_108395662 90
744 3300013307 Ga0157372_12018047 Ga0157372_120180472 90
745 3300013308 Ga0157375_10025269 Ga0157375_100252694 90
746 3300013308 Ga0157375_10165233 Ga0157375_101652332 90
747 3300013308 Ga0157375_10218421 Ga0157375_102184211 90
748 3300013308 Ga0157375_10272113 Ga0157375_102721132 90
749 3300013308 Ga0157375_11604187 Ga0157375_116041872 90
750 3300013308 Ga0157375_12271154 Ga0157375_122711542 90
751 3300014325 Ga0163163_10052116 Ga0163163_100521165 90
752 3300014325 Ga0163163_10133233 Ga0163163_101332333 90
753 3300014325 Ga0163163_10169035 Ga0163163_101690353 90
754 3300014325 Ga0163163_10321233 Ga0163163_103212332 90
755 3300014325 Ga0163163_10494330 Ga0163163_104943302 90
756 3300014325 Ga0163163_10890232 Ga0163163_108902322 90
757 3300014326 Ga0157380_10144369 Ga0157380_101443693 90
758 3300014326 Ga0157380_12103428 Ga0157380_121034282 90
759 3300014326 Ga0157380_12512107 Ga0157380_125121071 90
760 3300014326 Ga0157380_13050573 Ga0157380_130505731 90
761 3300014497 Ga0182008_10096708 Ga0182008_100967081 90
762 3300014745 Ga0157377_10336699 Ga0157377_103366992 90
763 3300014745 Ga0157377_10890112 Ga0157377_108901122 90
764 3300014745 Ga0157377_10967617 Ga0157377_109676172 90
765 3300014745 Ga0157377_10985110 Ga0157377_109851101 90
766 3300014968 Ga0157379_10246860 Ga0157379_102468602 90
767 3300014968 Ga0157379_10506271 Ga0157379_105062712 90
768 3300014968 Ga0157379_10598906 Ga0157379_105989062 90
769 3300014968 Ga0157379_10778881 Ga0157379_107788812 90
770 3300014968 Ga0157379_11086448 Ga0157379_110864482 90
771 3300014969 Ga0157376_10044498 Ga0157376_100444982 90
772 3300014969 Ga0157376_10614844 Ga0157376_106148442 90
773 3300014969 Ga0157376_11920223 Ga0157376_119202232 90
774 3300014969 Ga0157376_12674144 Ga0157376_126741442 90
775 3300015261 Ga0182006_1139191 Ga0182006_11391912 90
776 3300015262 Ga0182007_10314892 Ga0182007_103148922 90
777 3300017792 Ga0163161_10189290 Ga0163161_101892903 90
778 3300017792 Ga0163161_10235211 Ga0163161_102352112 90
779 3300017792 Ga0163161_10397807 Ga0163161_103978072 90
780 3300017792 Ga0163161_10655898 Ga0163161_106558982 90
781 3300017792 Ga0163161_11078760 Ga0163161_110787601 90
782 3300017792 Ga0163161_11204217 Ga0163161_112042172 90
783 3300017792 Ga0163161_11363687 Ga0163161_113636872 90
784 3300021320 Ga0214544_1000087 Ga0214544_100008774 90
785 3300021320 Ga0214544_1031151 Ga0214544_10311512 90
786 3300021321 Ga0214542_1000018 Ga0214542_1000018145 90
787 3300021324 Ga0214545_1000009 Ga0214545_100000937 90
788 3300021327 Ga0214543_1000037 Ga0214543_1000037137 90
789 3300021358 Ga0213873_10002059 Ga0213873_100020592 90
790 3300021384 Ga0213876_10059215 Ga0213876_100592152 90
791 3300025253 Ga0209677_101272 Ga0209677_10127210 90
792 3300025254 Ga0209148_1003487 Ga0209148_10034875 90
793 3300025261 Ga0209233_1003722 Ga0209233_10037225 90
794 3300025261 Ga0209233_1024188 Ga0209233_10241882 90
795 3300025272 Ga0209455_1013168 Ga0209455_10131683 90
796 3300025272 Ga0209455_1028795 Ga0209455_10287952 90
797 3300025295 Ga0209564_1033426 Ga0209564_10334263 90
798 3300025297 Ga0209758_1000030 Ga0209758_1000030151 90
799 3300025297 Ga0209758_1000884 Ga0209758_10008848 90
800 3300025297 Ga0209758_1000949 Ga0209758_10009498 90
801 3300025297 Ga0209758_1005183 Ga0209758_10051839 90
802 3300025297 Ga0209758_1017944 Ga0209758_10179443 90
803 3300025297 Ga0209758_1061349 Ga0209758_10613492 90
804 3300025299 Ga0209256_1023598 Ga0209256_10235982 90
805 3300025302 Ga0207426_1001522 Ga0207426_10015227 90
806 3300025304 Ga0209257_1003355 Ga0209257_10033557 90
807 3300025304 Ga0209257_1007964 Ga0209257_10079643 90
808 3300025315 Ga0207697_10362960 Ga0207697_103629602 90
809 3300025321 Ga0207656_10674112 Ga0207656_106741122 90
810 3300025321 Ga0207656_10718212 Ga0207656_107182122 90
811 3300025885 Ga0207653_10059960 Ga0207653_100599602 90
812 3300025893 Ga0207682_10237733 Ga0207682_102377332 90
813 3300025898 Ga0207692_10008712 Ga0207692_100087122 90
814 3300025898 Ga0207692_10087835 Ga0207692_100878352 90
815 3300025898 Ga0207692_10505206 Ga0207692_105052061 90
816 3300025898 Ga0207692_10840203 Ga0207692_108402031 90
817 3300025898 Ga0207692_11152895 Ga0207692_111528951 90
818 3300025899 Ga0207642_10022593 Ga0207642_100225933 90
819 3300025899 Ga0207642_10086927 Ga0207642_100869272 90
820 3300025899 Ga0207642_10120571 Ga0207642_101205712 90
821 3300025899 Ga0207642_10894336 Ga0207642_108943361 90
822 3300025899 Ga0207642_11125754 Ga0207642_111257542 90
823 3300025900 Ga0207710_10058227 Ga0207710_100582272 90
824 3300025900 Ga0207710_10229173 Ga0207710_102291732 90
825 3300025900 Ga0207710_10314688 Ga0207710_103146882 90
826 3300025900 Ga0207710_10572863 Ga0207710_105728632 90
827 3300025901 Ga0207688_10057975 Ga0207688_100579752 90
828 3300025901 Ga0207688_10136772 Ga0207688_101367722 90
829 3300025901 Ga0207688_10169865 Ga0207688_101698652 90
830 3300025901 Ga0207688_10419377 Ga0207688_104193772 90
831 3300025901 Ga0207688_10467064 Ga0207688_104670642 90
832 3300025901 Ga0207688_10616045 Ga0207688_106160452 90
833 3300025903 Ga0207680_10467864 Ga0207680_104678642 90
834 3300025903 Ga0207680_10515587 Ga0207680_105155872 90
835 3300025903 Ga0207680_10849215 Ga0207680_108492152 90
836 3300025904 Ga0207647_10019817 Ga0207647_100198174 90
837 3300025904 Ga0207647_10417913 Ga0207647_104179132 90
838 3300025905 Ga0207685_10118958 Ga0207685_101189582 90
839 3300025905 Ga0207685_10544128 Ga0207685_105441282 90
840 3300025906 Ga0207699_10007899 Ga0207699_100078995 90
841 3300025906 Ga0207699_10137624 Ga0207699_101376243 90
842 3300025907 Ga0207645_10084088 Ga0207645_100840883 90
843 3300025907 Ga0207645_10259099 Ga0207645_102590992 90
844 3300025907 Ga0207645_10347515 Ga0207645_103475152 90
845 3300025907 Ga0207645_10934494 Ga0207645_109344942 90
846 3300025908 Ga0207643_10063346 Ga0207643_100633463 90
847 3300025908 Ga0207643_10095563 Ga0207643_100955632 90
848 3300025908 Ga0207643_10155142 Ga0207643_101551422 90
849 3300025909 Ga0207705_10089780 Ga0207705_100897802 90
850 3300025909 Ga0207705_10225240 Ga0207705_102252402 90
851 3300025909 Ga0207705_11529199 Ga0207705_115291991 90
852 3300025911 Ga0207654_10044200 Ga0207654_100442004 90
853 3300025911 Ga0207654_10251238 Ga0207654_102512382 90
854 3300025911 Ga0207654_10302362 Ga0207654_103023622 90
855 3300025911 Ga0207654_10581473 Ga0207654_105814732 90
856 3300025911 Ga0207654_10603172 Ga0207654_106031722 90
857 3300025911 Ga0207654_10882951 Ga0207654_108829512 90
858 3300025911 Ga0207654_11159927 Ga0207654_111599272 90
859 3300025912 Ga0207707_10374213 Ga0207707_103742132 90
860 3300025912 Ga0207707_10466420 Ga0207707_104664202 90
861 3300025913 Ga0207695_10000059 Ga0207695_10000059273 90
862 3300025913 Ga0207695_10324452 Ga0207695_103244522 90
863 3300025914 Ga0207671_10012029 Ga0207671_100120293 90
864 3300025914 Ga0207671_10082197 Ga0207671_100821973 90
865 3300025914 Ga0207671_10505279 Ga0207671_105052792 90
866 3300025914 Ga0207671_10616654 Ga0207671_106166542 90
867 3300025914 Ga0207671_10681154 Ga0207671_106811542 90
868 3300025914 Ga0207671_10797920 Ga0207671_107979202 90
869 3300025914 Ga0207671_10895891 Ga0207671_108958912 90
870 3300025914 Ga0207671_11002576 Ga0207671_110025762 90
871 3300025915 Ga0207693_10000073 Ga0207693_1000007334 90
872 3300025915 Ga0207693_10037685 Ga0207693_100376852 90
873 3300025915 Ga0207693_10138394 Ga0207693_101383941 90
874 3300025915 Ga0207693_10250212 Ga0207693_102502122 90
875 3300025916 Ga0207663_10000861 Ga0207663_100008612 90
876 3300025916 Ga0207663_10256120 Ga0207663_102561202 90
877 3300025916 Ga0207663_10346249 Ga0207663_103462492 90
878 3300025916 Ga0207663_11492252 Ga0207663_114922521 90
879 3300025917 Ga0207660_10145827 Ga0207660_101458272 90
880 3300025918 Ga0207662_10209012 Ga0207662_102090122 90
881 3300025918 Ga0207662_10333638 Ga0207662_103336382 90
882 3300025919 Ga0207657_10008532 Ga0207657_1000853210 90
883 3300025919 Ga0207657_10069862 Ga0207657_100698623 90
884 3300025919 Ga0207657_10146254 Ga0207657_101462542 90
885 3300025919 Ga0207657_10168010 Ga0207657_101680102 90
886 3300025919 Ga0207657_10241016 Ga0207657_102410162 90
887 3300025919 Ga0207657_10246447 Ga0207657_102464473 90
888 3300025919 Ga0207657_10306455 Ga0207657_103064551 90
889 3300025919 Ga0207657_10327117 Ga0207657_103271172 90
890 3300025920 Ga0207649_10043961 Ga0207649_100439614 90
891 3300025920 Ga0207649_10091698 Ga0207649_100916982 90
892 3300025920 Ga0207649_10467038 Ga0207649_104670382 90
893 3300025920 Ga0207649_10516100 Ga0207649_105161002 90
894 3300025920 Ga0207649_11200608 Ga0207649_112006081 90
895 3300025921 Ga0207652_10038542 Ga0207652_100385425 90
896 3300025921 Ga0207652_10372188 Ga0207652_103721882 90
897 3300025921 Ga0207652_10823858 Ga0207652_108238582 90
898 3300025923 Ga0207681_10187422 Ga0207681_101874223 90
899 3300025923 Ga0207681_11078311 Ga0207681_110783112 90
900 3300025924 Ga0207694_10387668 Ga0207694_103876682 90
901 3300025924 Ga0207694_11226439 Ga0207694_112264392 90
902 3300025924 Ga0207694_11314463 Ga0207694_113144632 90
903 3300025925 Ga0207650_10227234 Ga0207650_102272343 90
904 3300025925 Ga0207650_10284290 Ga0207650_102842902 90
905 3300025925 Ga0207650_10430867 Ga0207650_104308672 90
906 3300025926 Ga0207659_10162773 Ga0207659_101627732 90
907 3300025927 Ga0207687_10235411 Ga0207687_102354112 90
908 3300025927 Ga0207687_10282908 Ga0207687_102829082 90
909 3300025927 Ga0207687_10515161 Ga0207687_105151612 90
910 3300025927 Ga0207687_11882164 Ga0207687_118821641 90
911 3300025928 Ga0207700_10040878 Ga0207700_100408783 90
912 3300025928 Ga0207700_10443359 Ga0207700_104433592 90
913 3300025928 Ga0207700_10792735 Ga0207700_107927352 90
914 3300025929 Ga0207664_10171885 Ga0207664_101718852 90
915 3300025929 Ga0207664_10486003 Ga0207664_104860032 90
916 3300025931 Ga0207644_10027415 Ga0207644_100274152 90
917 3300025931 Ga0207644_10103948 Ga0207644_101039483 90
918 3300025931 Ga0207644_10119860 Ga0207644_101198602 90
919 3300025931 Ga0207644_10310955 Ga0207644_103109552 90
920 3300025931 Ga0207644_10565863 Ga0207644_105658632 90
921 3300025931 Ga0207644_10628917 Ga0207644_106289172 90
922 3300025931 Ga0207644_11327727 Ga0207644_113277272 90
923 3300025932 Ga0207690_10205321 Ga0207690_102053212 90
924 3300025932 Ga0207690_10568409 Ga0207690_105684092 90
925 3300025932 Ga0207690_11351035 Ga0207690_113510351 90
926 3300025932 Ga0207690_11649734 Ga0207690_116497342 90
927 3300025932 Ga0207690_11754784 Ga0207690_117547842 90
928 3300025933 Ga0207706_10132711 Ga0207706_101327113 90
929 3300025933 Ga0207706_10274579 Ga0207706_102745792 90
930 3300025933 Ga0207706_10357272 Ga0207706_103572722 90
931 3300025933 Ga0207706_10693552 Ga0207706_106935522 90
932 3300025933 Ga0207706_10751539 Ga0207706_107515392 90
933 3300025933 Ga0207706_10993631 Ga0207706_109936312 90
934 3300025934 Ga0207686_10200014 Ga0207686_102000142 90
935 3300025934 Ga0207686_10213599 Ga0207686_102135992 90
936 3300025934 Ga0207686_10488060 Ga0207686_104880602 90
937 3300025934 Ga0207686_11749234 Ga0207686_117492342 90
938 3300025935 Ga0207709_10093261 Ga0207709_100932613 90
939 3300025935 Ga0207709_10329465 Ga0207709_103294652 90
940 3300025935 Ga0207709_10483856 Ga0207709_104838562 90
941 3300025935 Ga0207709_10683713 Ga0207709_106837132 90
942 3300025935 Ga0207709_11112139 Ga0207709_111121392 90
943 3300025935 Ga0207709_11636664 Ga0207709_116366642 90
944 3300025936 Ga0207670_10257537 Ga0207670_102575372 90
945 3300025936 Ga0207670_10275416 Ga0207670_102754162 90
946 3300025936 Ga0207670_11787811 Ga0207670_117878112 90
947 3300025937 Ga0207669_10291146 Ga0207669_102911462 90
948 3300025937 Ga0207669_10556802 Ga0207669_105568022 90
949 3300025938 Ga0207704_10040130 Ga0207704_100401302 90
950 3300025938 Ga0207704_10058678 Ga0207704_100586782 90
951 3300025938 Ga0207704_10510943 Ga0207704_105109432 90
952 3300025938 Ga0207704_11101761 Ga0207704_111017612 90
953 3300025938 Ga0207704_11163524 Ga0207704_111635241 90
954 3300025939 Ga0207665_10000629 Ga0207665_100006298 90
955 3300025939 Ga0207665_10045899 Ga0207665_100458993 90
956 3300025939 Ga0207665_10085332 Ga0207665_100853321 90
957 3300025940 Ga0207691_10292539 Ga0207691_102925392 90
958 3300025940 Ga0207691_10359556 Ga0207691_103595562 90
959 3300025941 Ga0207711_10088299 Ga0207711_100882992 90
960 3300025941 Ga0207711_10090078 Ga0207711_100900785 90
961 3300025941 Ga0207711_10474605 Ga0207711_104746052 90
962 3300025941 Ga0207711_10833098 Ga0207711_108330981 90
963 3300025941 Ga0207711_10928218 Ga0207711_109282182 90
964 3300025941 Ga0207711_11275474 Ga0207711_112754742 90
965 3300025942 Ga0207689_10026821 Ga0207689_100268215 90
966 3300025942 Ga0207689_10061122 Ga0207689_100611222 90
967 3300025942 Ga0207689_10975787 Ga0207689_109757871 90
968 3300025942 Ga0207689_11651776 Ga0207689_116517762 90
969 3300025945 Ga0207679_10041467 Ga0207679_100414672 90
970 3300025945 Ga0207679_10116724 Ga0207679_101167242 90
971 3300025945 Ga0207679_10155767 Ga0207679_101557673 90
972 3300025945 Ga0207679_10391440 Ga0207679_103914402 90
973 3300025945 Ga0207679_10860977 Ga0207679_108609772 90
974 3300025949 Ga0207667_10010745 Ga0207667_100107452 90
975 3300025949 Ga0207667_10079342 Ga0207667_100793425 90
976 3300025949 Ga0207667_10184475 Ga0207667_101844753 90
977 3300025949 Ga0207667_10325037 Ga0207667_103250372 90
978 3300025949 Ga0207667_10521084 Ga0207667_105210842 90
979 3300025949 Ga0207667_10568385 Ga0207667_105683852 90
980 3300025949 Ga0207667_10590340 Ga0207667_105903402 90
981 3300025949 Ga0207667_12069127 Ga0207667_120691272 90
982 3300025960 Ga0207651_10163180 Ga0207651_101631803 90
983 3300025960 Ga0207651_10209802 Ga0207651_102098022 90
984 3300025960 Ga0207651_11673613 Ga0207651_116736132 90
985 3300025961 Ga0207712_10052003 Ga0207712_100520032 90
986 3300025961 Ga0207712_10241794 Ga0207712_102417943 90
987 3300025961 Ga0207712_10273030 Ga0207712_102730302 90
988 3300025961 Ga0207712_11040744 Ga0207712_110407442 90
989 3300025961 Ga0207712_11130235 Ga0207712_111302351 90
990 3300025961 Ga0207712_11225728 Ga0207712_112257282 90
991 3300025972 Ga0207668_10015065 Ga0207668_100150652 90
992 3300025972 Ga0207668_10034118 Ga0207668_100341183 90
993 3300025972 Ga0207668_10112762 Ga0207668_101127623 90
994 3300025972 Ga0207668_10540123 Ga0207668_105401232 90
995 3300025972 Ga0207668_10764057 Ga0207668_107640572 90
996 3300025972 Ga0207668_11017347 Ga0207668_110173472 90
997 3300025972 Ga0207668_11266335 Ga0207668_112663351 90
998 3300025972 Ga0207668_11807307 Ga0207668_118073072 90
999 3300025972 Ga0207668_11985024 Ga0207668_119850242 90
1000 3300025981 Ga0207640_10432609 Ga0207640_104326092 90
1001 3300025981 Ga0207640_10665773 Ga0207640_106657732 90
1002 3300025981 Ga0207640_10752345 Ga0207640_107523452 90
1003 3300025981 Ga0207640_11210983 Ga0207640_112109832 90
1004 3300025986 Ga0207658_10336915 Ga0207658_103369152 90
1005 3300025986 Ga0207658_10374358 Ga0207658_103743582 90
1006 3300025986 Ga0207658_10685635 Ga0207658_106856351 90
1007 3300025986 Ga0207658_11092816 Ga0207658_110928162 90
1008 3300026023 Ga0207677_10028452 Ga0207677_100284522 90
1009 3300026023 Ga0207677_10814872 Ga0207677_108148722 90
1010 3300026023 Ga0207677_10926119 Ga0207677_109261192 90
1011 3300026023 Ga0207677_12153739 Ga0207677_121537391 90
1012 3300026035 Ga0207703_10167231 Ga0207703_101672312 90
1013 3300026035 Ga0207703_10206390 Ga0207703_102063903 90
1014 3300026035 Ga0207703_10405540 Ga0207703_104055402 90
1015 3300026035 Ga0207703_10819204 Ga0207703_108192042 90
1016 3300026041 Ga0207639_10117242 Ga0207639_101172423 90
1017 3300026041 Ga0207639_10198367 Ga0207639_101983672 90
1018 3300026041 Ga0207639_10454833 Ga0207639_104548332 90
1019 3300026041 Ga0207639_11958491 Ga0207639_119584912 90
1020 3300026067 Ga0207678_10013470 Ga0207678_100134705 90
1021 3300026067 Ga0207678_10029495 Ga0207678_100294955 90
1022 3300026067 Ga0207678_10041959 Ga0207678_100419593 90
1023 3300026067 Ga0207678_10048018 Ga0207678_100480184 90
1024 3300026067 Ga0207678_10151281 Ga0207678_101512812 90
1025 3300026067 Ga0207678_10175048 Ga0207678_101750482 90
1026 3300026067 Ga0207678_10308082 Ga0207678_103080822 90
1027 3300026067 Ga0207678_10681749 Ga0207678_106817491 90
1028 3300026067 Ga0207678_10849431 Ga0207678_108494312 90
1029 3300026067 Ga0207678_10920785 Ga0207678_109207851 90
1030 3300026067 Ga0207678_11041024 Ga0207678_110410241 90
1031 3300026067 Ga0207678_11821227 Ga0207678_118212272 90
1032 3300026075 Ga0207708_10038351 Ga0207708_100383513 90
1033 3300026075 Ga0207708_11577856 Ga0207708_115778562 90
1034 3300026078 Ga0207702_10073591 Ga0207702_100735912 90
1035 3300026078 Ga0207702_10239848 Ga0207702_102398483 90
1036 3300026078 Ga0207702_10659695 Ga0207702_106596952 90
1037 3300026088 Ga0207641_10406992 Ga0207641_104069922 90
1038 3300026088 Ga0207641_10725978 Ga0207641_107259782 90
1039 3300026088 Ga0207641_10816952 Ga0207641_108169522 90
1040 3300026088 Ga0207641_11428083 Ga0207641_114280832 90
1041 3300026088 Ga0207641_12433211 Ga0207641_124332112 90
1042 3300026089 Ga0207648_10063416 Ga0207648_100634165 90
1043 3300026089 Ga0207648_10188474 Ga0207648_101884743 90
1044 3300026089 Ga0207648_10324071 Ga0207648_103240712 90
1045 3300026095 Ga0207676_10347002 Ga0207676_103470021 90
1046 3300026095 Ga0207676_10453973 Ga0207676_104539732 90
1047 3300026095 Ga0207676_10475560 Ga0207676_104755602 90
1048 3300026095 Ga0207676_10495715 Ga0207676_104957152 90
1049 3300026095 Ga0207676_10601516 Ga0207676_106015162 90
1050 3300026095 Ga0207676_11436321 Ga0207676_114363212 90
1051 3300026116 Ga0207674_10032777 Ga0207674_100327773 90
1052 3300026116 Ga0207674_10386500 Ga0207674_103865001 90
1053 3300026116 Ga0207674_11195304 Ga0207674_111953042 90
1054 3300026116 Ga0207674_11315707 Ga0207674_113157072 90
1055 3300026118 Ga0207675_100024363 Ga0207675_1000243635 90
1056 3300026118 Ga0207675_100038345 Ga0207675_1000383457 90
1057 3300026118 Ga0207675_100060324 Ga0207675_1000603242 90
1058 3300026118 Ga0207675_100316303 Ga0207675_1003163032 90
1059 3300026118 Ga0207675_100359125 Ga0207675_1003591252 90
1060 3300026118 Ga0207675_100538293 Ga0207675_1005382932 90
1061 3300026118 Ga0207675_101523161 Ga0207675_1015231612 90
1062 3300026118 Ga0207675_102063451 Ga0207675_1020634511 90
1063 3300026121 Ga0207683_10159634 Ga0207683_101596342 90
1064 3300026121 Ga0207683_10255498 Ga0207683_102554982 90
1065 3300026121 Ga0207683_10297292 Ga0207683_102972922 90
1066 3300026121 Ga0207683_10438070 Ga0207683_104380702 90
1067 3300026121 Ga0207683_10658458 Ga0207683_106584582 90
1068 3300026121 Ga0207683_10925630 Ga0207683_109256302 90
1069 3300026121 Ga0207683_12174647 Ga0207683_121746471 90
1070 3300026142 Ga0207698_10093752 Ga0207698_100937523 90
1071 3300026142 Ga0207698_10114105 Ga0207698_101141052 90
1072 3300026142 Ga0207698_10960043 Ga0207698_109600431 90
1073 3300026142 Ga0207698_11020451 Ga0207698_110204512 90
1074 3300026142 Ga0207698_11243058 Ga0207698_112430582 90
1075 3300026142 Ga0207698_11409582 Ga0207698_114095822 90
1076 3300026142 Ga0207698_12184697 Ga0207698_121846971 90
1077 3300026142 Ga0207698_12579149 Ga0207698_125791492 90
1078 3300027296 Ga0209389_1000110 Ga0209389_100011063 90
1079 3300027296 Ga0209389_1000161 Ga0209389_10001617 90
1080 3300027357 Ga0209589_1000103 Ga0209589_100010339 90
1081 3300027361 Ga0209489_100304 Ga0209489_10030439 90
1082 3300027361 Ga0209489_100524 Ga0209489_10052463 90
1083 3300027363 Ga0209700_100334 Ga0209700_10033416 90
1084 3300027671 Ga0209588_1043231 Ga0209588_10432312 90
1085 3300027866 Ga0209813_10042224 Ga0209813_100422242 90
1086 3300027866 Ga0209813_10047760 Ga0209813_100477602 90
1087 3300027866 Ga0209813_10049632 Ga0209813_100496322 90
1088 3300027866 Ga0209813_10176526 Ga0209813_101765262 90
1089 3300027866 Ga0209813_10228600 Ga0209813_102286002 90
1090 3300027907 Ga0207428_10165726 Ga0207428_101657262 90
1091 3300027907 Ga0207428_10823148 Ga0207428_108231482 90
1092 3300028379 Ga0268266_10001416 Ga0268266_100014166 90
1093 3300028379 Ga0268266_10011749 Ga0268266_100117493 90
1094 3300028379 Ga0268266_10020841 Ga0268266_100208413 90
1095 3300028379 Ga0268266_10027183 Ga0268266_100271836 90
1096 3300028379 Ga0268266_10044293 Ga0268266_100442934 90
1097 3300028379 Ga0268266_10113895 Ga0268266_101138954 90
1098 3300028379 Ga0268266_10309677 Ga0268266_103096772 90
1099 3300028379 Ga0268266_10860673 Ga0268266_108606732 90
1100 3300028379 Ga0268266_11088134 Ga0268266_110881341 90
1101 3300028379 Ga0268266_11216124 Ga0268266_112161241 90
1102 3300028380 Ga0268265_10375184 Ga0268265_103751842 90
1103 3300028380 Ga0268265_10407186 Ga0268265_104071862 90
1104 3300028380 Ga0268265_10500420 Ga0268265_105004202 90
1105 3300028380 Ga0268265_10594833 Ga0268265_105948332 90
1106 3300028380 Ga0268265_10941133 Ga0268265_109411332 90
1107 3300028380 Ga0268265_11209005 Ga0268265_112090052 90
1108 3300028381 Ga0268264_10031002 Ga0268264_100310025 90
1109 3300028381 Ga0268264_10164525 Ga0268264_101645252 90
1110 3300028381 Ga0268264_10170996 Ga0268264_101709963 90
1111 3300028381 Ga0268264_10670884 Ga0268264_106708842 90
1112 3300028381 Ga0268264_10838485 Ga0268264_108384852 90
1113 3300028381 Ga0268264_11129943 Ga0268264_111299432 90
1114 3300028786 Ga0307517_10001290 Ga0307517_1000129024 90
1115 3300028786 Ga0307517_10133889 Ga0307517_101338893 90
1116 3300028794 Ga0307515_10012007 Ga0307515_100120079 90
1117 3300028794 Ga0307515_10574603 Ga0307515_105746032 90
1118 3300028794 Ga0307515_10783345 Ga0307515_107833451 90
1119 3300030522 Ga0307512_10144502 Ga0307512_101445022 90
1120 3300030522 Ga0307512_10434286 Ga0307512_104342861 90
1121 3300031249 Ga0265339_10020628 Ga0265339_100206286 90
1122 3300031249 Ga0265339_10020997 Ga0265339_100209975 90
1123 3300031250 Ga0265331_10112715 Ga0265331_101127152 90
1124 3300031250 Ga0265331_10139152 Ga0265331_101391522 90
1125 3300031456 Ga0307513_10314063 Ga0307513_103140632 90
1126 3300031456 Ga0307513_10336320 Ga0307513_103363202 90
1127 3300031456 Ga0307513_10677842 Ga0307513_106778422 90
1128 3300031507 Ga0307509_10027988 Ga0307509_100279884 90
1129 3300031507 Ga0307509_10629575 Ga0307509_106295752 90
1130 3300031507 Ga0307509_10958931 Ga0307509_109589312 90
1131 3300031548 Ga0307408_100605490 Ga0307408_1006054902 90
1132 3300031548 Ga0307408_101037691 Ga0307408_1010376912 90
1133 3300031548 Ga0307408_101785822 Ga0307408_1017858222 90
1134 3300031548 Ga0307408_102279168 Ga0307408_1022791681 90
1135 3300031616 Ga0307508_10223155 Ga0307508_102231552 90
1136 3300031616 Ga0307508_10525449 Ga0307508_105254492 90
1137 3300031616 Ga0307508_10778152 Ga0307508_107781522 90
1138 3300031711 Ga0265314_10220309 Ga0265314_102203091 90
1139 3300031712 Ga0265342_10003812 Ga0265342_1000381213 90
1140 3300031730 Ga0307516_10113998 Ga0307516_101139981 90
1141 3300031730 Ga0307516_10174381 Ga0307516_101743812 90
1142 3300031730 Ga0307516_10443361 Ga0307516_104433612 90
1143 3300031731 Ga0307405_10298342 Ga0307405_102983422 90
1144 3300031731 Ga0307405_10478197 Ga0307405_104781972 90
1145 3300031824 Ga0307413_11427903 Ga0307413_114279032 90
1146 3300031852 Ga0307410_10112141 Ga0307410_101121413 90
1147 3300031852 Ga0307410_10246384 Ga0307410_102463842 90
1148 3300031852 Ga0307410_10313405 Ga0307410_103134052 90
1149 3300031889 Ga0326468_10005887 Ga0326468_100058872 90
1150 3300031901 Ga0307406_10226438 Ga0307406_102264382 90
1151 3300031901 Ga0307406_10391842 Ga0307406_103918422 90
1152 3300031901 Ga0307406_11427060 Ga0307406_114270602 90
1153 3300031901 Ga0307406_11597610 Ga0307406_115976101 90
1154 3300031903 Ga0307407_10574601 Ga0307407_105746011 90
1155 3300031903 Ga0307407_11646444 Ga0307407_116464442 90
1156 3300031911 Ga0307412_11472133 Ga0307412_114721332 90
1157 3300031911 Ga0307412_11974047 Ga0307412_119740472 90
1158 3300031911 Ga0307412_12015348 Ga0307412_120153482 90
1159 3300031995 Ga0307409_101075861 Ga0307409_1010758612 90
1160 3300031995 Ga0307409_101663285 Ga0307409_1016632852 90
1161 3300032002 Ga0307416_100138310 Ga0307416_1001383103 90
1162 3300032002 Ga0307416_101552107 Ga0307416_1015521072 90
1163 3300032002 Ga0307416_101706913 Ga0307416_1017069131 90
1164 3300032002 Ga0307416_101987675 Ga0307416_1019876752 90
1165 3300032004 Ga0307414_10440057 Ga0307414_104400572 90
1166 3300032004 Ga0307414_10571533 Ga0307414_105715332 90
1167 3300032004 Ga0307414_11908826 Ga0307414_119088261 90
1168 3300032005 Ga0307411_10132522 Ga0307411_101325222 90
1169 3300032005 Ga0307411_10618577 Ga0307411_106185772 90
1170 3300032126 Ga0307415_101062555 Ga0307415_1010625552 90
1171 3300032126 Ga0307415_101139567 Ga0307415_1011395672 90
1172 3300032126 Ga0307415_101429136 Ga0307415_1014291362 90
1173 3300033179 Ga0307507_10261091 Ga0307507_102610912 90
1174 3300033180 Ga0307510_10035286 Ga0307510_100352865 90
1175 3300033180 Ga0307510_10120886 Ga0307510_101208863 90
1176 3300033180 Ga0307510_10121624 Ga0307510_101216242 90
1177 3300033180 Ga0307510_10159972 Ga0307510_101599723 90
1178 3300033180 Ga0307510_10534733 Ga0307510_105347332 90
1179 3300034816 Ga0373930_0017784 Ga0373930_0017784_849_1121 90
1180 3300034817 Ga0373948_0083600 Ga0373948_0083600_65_337 90
1181 3300035084 Ga0373928_0125013 Ga0373928_0125013_206_481 90
1182 3300035085 Ga0373929_0016853 Ga0373929_0016853_258_530 90
1183 3300035085 Ga0373929_0212058 Ga0373929_0212058_259_531 90
1184 3300035088 Ga0373940_0058342 Ga0373940_0058342_218_490 90
1185 3300035089 Ga0373944_0054765 Ga0373944_0054765_571_843 90
1186 3300035090 Ga0373949_0050729 Ga0373949_0050729_213_485 90
1187 3300035091 Ga0373951_0045748 Ga0373951_0045748_470_742 90
1188 3300035112 Ga0373932_0134638 Ga0373932_0134638_467_739 90
1189 3300035113 Ga0373936_0077269 Ga0373936_0077269_780_1055 90
1190 3300035114 Ga0373939_0416817 Ga0373939_0416817_72_344 90
1191 3300035115 Ga0373941_0054234 Ga0373941_0054234_683_955 90
1192 3300035115 Ga0373941_0142501 Ga0373941_0142501_368_640 90
1193 3300035170 Ga0373943_0758720 Ga0373943_0758720_25_297 90
1194 3300035207 Ga0373942_0046167 Ga0373942_0046167_37_309 90
1195 3300035241 Ga0373961_0069898 Ga0373961_0069898_35_307 90
1196 3300035691 Ga0373931_0021849 Ga0373931_0021849_2259_2531 90
1197 3300035691 Ga0373931_0849698 Ga0373931_0849698_12_284 90
1198 3300035691 Ga0373931_1160223 Ga0373931_1160223_30_302 90
1199 3300035692 Ga0373935_0668799 Ga0373935_0668799_261_533 90
1200 3300035695 Ga0373927_0017691 Ga0373927_0017691_3005_3280 90
1201 3300035695 Ga0373927_0067814 Ga0373927_0067814_1052_1324 90
1202 3300035695 Ga0373927_0189311 Ga0373927_0189311_362_634 90
1203 3300035724 Ga0373933_0599377 Ga0373933_0599377_123_398 90
1204 3300035725 Ga0373947_0055888 Ga0373947_0055888_1692_1964 90
1205 3300035725 Ga0373947_0272138 Ga0373947_0272138_829_1104 90
1206 3300036401 Ga0373937_0434311 Ga0373937_0434311_62_337 90
1207 3300037068 Ga0373925_0019700 Ga0373925_0019700_950_1225 90
1208 3300037068 Ga0373925_0121495 Ga0373925_0121495_1352_1624 90
1209 3300037068 Ga0373925_0238311 Ga0373925_0238311_130_402 90
1210 3300037068 Ga0373925_1197053 Ga0373925_1197053_19_294 90
1211 3300037068 Ga0373925_1614930 Ga0373925_1614930_140_415 90
1212 3300037418 Ga0395900_0044414 Ga0395900_0044414_933_1208 90
1213 3300037418 Ga0395900_1172753 Ga0395900_1172753_367_642 90
1214 3300037466 Ga0395898_1250851 Ga0395898_1250851_192_467 90
1215 3300037471 Ga0395905_0027349 Ga0395905_0027349_4826_5101 90
1216 3300037471 Ga0395905_0648432 Ga0395905_0648432_165_437 90
1217 3300037471 Ga0395905_0868518 Ga0395905_0868518_512_787 90
1218 3300037471 Ga0395905_1582263 Ga0395905_1582263_91_366 90
1219 3300037471 Ga0395905_1744097 Ga0395905_1744097_230_505 90
1220 3300037853 Ga0436364_0906824 Ga0436364_0906824_44_319 90
1221 3300038443 Ga0395901_1199825 Ga0395901_1199825_89_364 90
1222 3300039437 Ga0436365_1091064 Ga0436365_1091064_2261_2536 90
1223 3300039438 Ga0436360_0425420 Ga0436360_0425420_12_284 90
1224 3300039438 Ga0436360_0902180 Ga0436360_0902180_744_1019 90
1225 3300039450 Ga0436363_0006129 Ga0436363_0006129_148_423 90
1226 3300039450 Ga0436363_1070729 Ga0436363_1070729_667_942 90
1227 3300039450 Ga0436363_1572509 Ga0436363_1572509_2276_2551 90
1228 3300039453 Ga0436362_1040324 Ga0436362_1040324_781_1056 90
1229 3300041413 Ga0439465_0049927 Ga0439465_0049927_651_926 90
1230 3300041443 Ga0451789_0958322 Ga0451789_0958322_38_313 90
1231 3300041443 Ga0451789_1151987 Ga0451789_1151987_67_339 90
1232 3300041443 Ga0451789_1315201 Ga0451789_1315201_173_445 90
1233 3300041451 Ga0451791_1263840 Ga0451791_1263840_149_424 90
1234 3300041451 Ga0451791_1563015 Ga0451791_1563015_505_777 90
1235 3300041452 Ga0451793_1172282 Ga0451793_1172282_220_492 90
1236 3300041452 Ga0451793_1748933 Ga0451793_1748933_197_472 90
1237 3300041453 Ga0451797_0120348 Ga0451797_0120348_465_737 90
1238 3300041456 Ga0451795_1055014 Ga0451795_1055014_182_457 90
1239 3300041486 Ga0451807_0909276 Ga0451807_0909276_67_339 90
1240 3300041486 Ga0451807_1310864 Ga0451807_1310864_183_455 90
1241 3300041486 Ga0451807_1679627 Ga0451807_1679627_194_469 90
1242 3300041491 Ga0451833_1287547 Ga0451833_1287547_306_578 90
1243 3300041494 Ga0451837_1110975 Ga0451837_1110975_271_543 90
1244 3300041498 Ga0451841_1429845 Ga0451841_1429845_26_343 90
1245 3300041501 Ga0451845_0376909 Ga0451845_0376909_386_658 90
1246 3300041507 Ga0451851_0922706 Ga0451851_0922706_249_524 90
1247 3300041509 Ga0451843_0316530 Ga0451843_0316530_310_585 90
1248 3300041511 Ga0451855_0317668 Ga0451855_0317668_96_371 90
1249 3300042005 Ga0439448_0241738 Ga0439448_0241738_143_418 90
1250 3300042157 Ga0439458_0006118 Ga0439458_0006118_730_1005 90
1251 3300042438 Ga0439459_0209796 Ga0439459_0209796_179_454 90
1252 3300044656 Ga0466969_0015502 Ga0466969_0015502_208_501 90
1253 3300044658 Ga0466972_0001053 Ga0466972_0001053_3975_4268 90
1254 3300044658 Ga0466972_0083895 Ga0466972_0083895_1113_1406 90
1255 3300044658 Ga0466972_0186293 Ga0466972_0186293_209_484 90
1256 3300044658 Ga0466972_0580344 Ga0466972_0580344_75_350 90
1257 3300044683 Ga0466965_0059400 Ga0466965_0059400_1020_1313 90
1258 3300044683 Ga0466965_0087015 Ga0466965_0087015_387_680 90
1259 3300044684 Ga0466966_0000137 Ga0466966_0000137_25340_25633 90
1260 3300044693 Ga0466961_0000039 Ga0466961_0000039_29507_29800 90
1261 3300044693 Ga0466961_0106820 Ga0466961_0106820_225_500 90
1262 3300044694 Ga0466963_0001672 Ga0466963_0001672_7803_8078 90
1263 3300044694 Ga0466963_0138599 Ga0466963_0138599_430_705 90
1264 3300044706 Ga0466964_0038114 Ga0466964_0038114_148_423 90
1265 3300044706 Ga0466964_0119622 Ga0466964_0119622_468_743 90
1266 3300044706 Ga0466964_0849238 Ga0466964_0849238_159_452 90
1267 3300044719 Ga0466971_0124618 Ga0466971_0124618_906_1181 90
1268 3300044719 Ga0466971_0241250 Ga0466971_0241250_395_670 90
1269 3300044735 Ga0466968_0005199 Ga0466968_0005199_1039_1332 90
1270 3300044735 Ga0466968_0462305 Ga0466968_0462305_164_457 90
1271 3300044735 Ga0466968_0494395 Ga0466968_0494395_247_522 90
1272 3300044765 Ga0466970_0125906 Ga0466970_0125906_941_1216 90
1273 3300044842 Ga0466957_0035960 Ga0466957_0035960_1767_2042 90
1274 3300044842 Ga0466957_0140097 Ga0466957_0140097_146_421 90
1275 3300044842 Ga0466957_0410526 Ga0466957_0410526_126_401 90
1276 3300044842 Ga0466957_0486050 Ga0466957_0486050_322_597 90
1277 3300044842 Ga0466957_1318150 Ga0466957_1318150_225_500 90
1278 3300044901 Ga0466960_0003772 Ga0466960_0003772_443_736 90
1279 3300044901 Ga0466960_0050304 Ga0466960_0050304_1341_1634 90
1280 3300044901 Ga0466960_0475400 Ga0466960_0475400_167_442 90
1281 3300044901 Ga0466960_0636448 Ga0466960_0636448_44_319 90
1282 3300045049 Ga0466959_0001594 Ga0466959_0001594_8651_8944 90
1283 3300045049 Ga0466959_0771306 Ga0466959_0771306_274_549 90
1284 3300045976 Ga0466967_0107113 Ga0466967_0107113_370_645 90
1285 3300045976 Ga0466967_0158757 Ga0466967_0158757_243_518 90
1286 3300045976 Ga0466967_1362670 Ga0466967_1362670_172_447 90
1287 3300046452 Ga0495617_004942 Ga0495617_004942_1999_2271 90
1288 3300046452 Ga0495617_041534 Ga0495617_041534_1005_1277 90
1289 3300046452 Ga0495617_063658 Ga0495617_063658_723_998 90
1290 3300046452 Ga0495617_271406 Ga0495617_271406_77_349 90
1291 3300046455 Ga0495603_0023359 Ga0495603_0023359_2171_2443 90
1292 3300046455 Ga0495603_0034570 Ga0495603_0034570_2181_2453 90
1293 3300046455 Ga0495603_0053051 Ga0495603_0053051_1196_1468 90
1294 3300046455 Ga0495603_0121811 Ga0495603_0121811_744_1019 90
1295 3300046457 Ga0495590_0062667 Ga0495590_0062667_480_752 90
1296 3300046457 Ga0495590_0405110 Ga0495590_0405110_97_372 90
1297 3300046458 Ga0495591_089105 Ga0495591_089105_468_740 90
1298 3300046459 Ga0495629_0127080 Ga0495629_0127080_750_1022 90
1299 3300046459 Ga0495629_0274475 Ga0495629_0274475_329_601 90
1300 3300046459 Ga0495629_0334342 Ga0495629_0334342_195_470 90
1301 3300046460 Ga0495638_0013239 Ga0495638_0013239_5037_5312 90
1302 3300046460 Ga0495638_0102367 Ga0495638_0102367_123_395 90
1303 3300046460 Ga0495638_0166754 Ga0495638_0166754_648_920 90
1304 3300046460 Ga0495638_0285753 Ga0495638_0285753_275_547 90
1305 3300046460 Ga0495638_0414707 Ga0495638_0414707_16_288 90
1306 3300046460 Ga0495638_0551965 Ga0495638_0551965_19_291 90
1307 3300046460 Ga0495638_0585937 Ga0495638_0585937_49_324 90
1308 3300046461 Ga0495641_0025455 Ga0495641_0025455_1921_2193 90
1309 3300046462 Ga0495651_0028449 Ga0495651_0028449_3115_3390 90
1310 3300046471 Ga0495650_0034400 Ga0495650_0034400_394_666 90
1311 3300046471 Ga0495650_0109732 Ga0495650_0109732_594_866 90
1312 3300046472 Ga0495580_0257986 Ga0495580_0257986_361_633 90
1313 3300046473 Ga0495582_0394265 Ga0495582_0394265_447_719 90
1314 3300046474 Ga0495605_0035458 Ga0495605_0035458_2194_2466 90
1315 3300046474 Ga0495605_0057623 Ga0495605_0057623_415_690 90
1316 3300046474 Ga0495605_0433871 Ga0495605_0433871_145_420 90
1317 3300046475 Ga0495639_0176553 Ga0495639_0176553_128_403 90
1318 3300046476 Ga0495662_0383298 Ga0495662_0383298_235_510 90
1319 3300046477 Ga0495664_0400851 Ga0495664_0400851_105_380 90
1320 3300046491 Ga0495584_0160004 Ga0495584_0160004_333_605 90
1321 3300046491 Ga0495584_0314147 Ga0495584_0314147_504_776 90
1322 3300046491 Ga0495584_0484948 Ga0495584_0484948_92_364 90
1323 3300046491 Ga0495584_0563700 Ga0495584_0563700_87_359 90
1324 3300046491 Ga0495584_0685421 Ga0495584_0685421_35_307 90
1325 3300046492 Ga0495585_0023802 Ga0495585_0023802_809_1081 90
1326 3300046492 Ga0495585_0125960 Ga0495585_0125960_501_773 90
1327 3300046492 Ga0495585_0287166 Ga0495585_0287166_37_312 90
1328 3300046499 Ga0495594_0039396 Ga0495594_0039396_1205_1477 90
1329 3300046499 Ga0495594_0349644 Ga0495594_0349644_36_311 90
1330 3300046499 Ga0495594_0749570 Ga0495594_0749570_232_504 90
1331 3300046500 Ga0495596_0141561 Ga0495596_0141561_385_660 90
1332 3300046500 Ga0495596_0236630 Ga0495596_0236630_122_394 90
1333 3300046500 Ga0495596_0267962 Ga0495596_0267962_226_501 90
1334 3300046500 Ga0495596_0324142 Ga0495596_0324142_179_451 90
1335 3300046501 Ga0495607_0124426 Ga0495607_0124426_822_1097 90
1336 3300046501 Ga0495607_0191240 Ga0495607_0191240_598_870 90
1337 3300046501 Ga0495607_0342569 Ga0495607_0342569_374_646 90
1338 3300046501 Ga0495607_0395664 Ga0495607_0395664_91_363 90
1339 3300046506 Ga0495583_0127881 Ga0495583_0127881_291_566 90
1340 3300046506 Ga0495583_0156435 Ga0495583_0156435_74_346 90
1341 3300046507 Ga0495606_0067487 Ga0495606_0067487_1568_1843 90
1342 3300046507 Ga0495606_0087925 Ga0495606_0087925_1451_1726 90
1343 3300046507 Ga0495606_0238831 Ga0495606_0238831_419_694 90
1344 3300046507 Ga0495606_0546593 Ga0495606_0546593_213_485 90
1345 3300046511 Ga0495608_0731763 Ga0495608_0731763_49_324 90
1346 3300046512 Ga0495610_0139581 Ga0495610_0139581_516_791 90
1347 3300046512 Ga0495610_0159713 Ga0495610_0159713_35_307 90
1348 3300046513 Ga0495616_0060076 Ga0495616_0060076_946_1221 90
1349 3300046513 Ga0495616_0179793 Ga0495616_0179793_203_478 90
1350 3300046513 Ga0495616_0243351 Ga0495616_0243351_240_512 90
1351 3300046515 Ga0495620_0067816 Ga0495620_0067816_668_943 90
1352 3300046515 Ga0495620_0218278 Ga0495620_0218278_399_674 90
1353 3300046515 Ga0495620_0230164 Ga0495620_0230164_85_357 90
1354 3300046515 Ga0495620_0269544 Ga0495620_0269544_178_450 90
1355 3300046518 Ga0495631_0027561 Ga0495631_0027561_462_734 90
1356 3300046518 Ga0495631_0120360 Ga0495631_0120360_723_995 90
1357 3300046518 Ga0495631_0171647 Ga0495631_0171647_371_646 90
1358 3300046518 Ga0495631_0252204 Ga0495631_0252204_251_526 90
1359 3300046518 Ga0495631_0501380 Ga0495631_0501380_141_416 90
1360 3300046519 Ga0495632_0029324 Ga0495632_0029324_2376_2648 90
1361 3300046519 Ga0495632_0290384 Ga0495632_0290384_198_470 90
1362 3300046519 Ga0495632_0482606 Ga0495632_0482606_210_485 90
1363 3300046520 Ga0495637_0141707 Ga0495637_0141707_246_518 90
1364 3300046522 Ga0495643_0006089 Ga0495643_0006089_7106_7381 90
1365 3300046522 Ga0495643_0071282 Ga0495643_0071282_526_798 90
1366 3300046522 Ga0495643_0072874 Ga0495643_0072874_844_1116 90
1367 3300046522 Ga0495643_0177057 Ga0495643_0177057_715_990 90
1368 3300046522 Ga0495643_0219200 Ga0495643_0219200_537_812 90
1369 3300046522 Ga0495643_0307228 Ga0495643_0307228_169_441 90
1370 3300046522 Ga0495643_0333316 Ga0495643_0333316_127_399 90
1371 3300046523 Ga0495644_0067813 Ga0495644_0067813_573_845 90
1372 3300046523 Ga0495644_0119151 Ga0495644_0119151_129_401 90
1373 3300046523 Ga0495644_0209528 Ga0495644_0209528_64_336 90
1374 3300046523 Ga0495644_0372650 Ga0495644_0372650_91_366 90
1375 3300046524 Ga0495648_0000382 Ga0495648_0000382_9352_9627 90
1376 3300046524 Ga0495648_0143113 Ga0495648_0143113_621_896 90
1377 3300046524 Ga0495648_0253026 Ga0495648_0253026_373_648 90
1378 3300046524 Ga0495648_0301613 Ga0495648_0301613_341_613 90
1379 3300046524 Ga0495648_0303286 Ga0495648_0303286_132_407 90
1380 3300046525 Ga0495663_0038891 Ga0495663_0038891_278_550 90
1381 3300046525 Ga0495663_0136713 Ga0495663_0136713_375_647 90
1382 3300046525 Ga0495663_0315268 Ga0495663_0315268_108_380 90
1383 3300046526 Ga0495666_0330227 Ga0495666_0330227_48_323 90
1384 3300046528 Ga0495642_0117560 Ga0495642_0117560_291_563 90
1385 3300046528 Ga0495642_0226867 Ga0495642_0226867_231_503 90
1386 3300046529 Ga0495652_0438138 Ga0495652_0438138_323_598 90
1387 3300046530 Ga0495654_0054158 Ga0495654_0054158_1091_1363 90
1388 3300046530 Ga0495654_0103717 Ga0495654_0103717_447_719 90
1389 3300046530 Ga0495654_0224414 Ga0495654_0224414_142_417 90
1390 3300046531 Ga0495665_0652518 Ga0495665_0652518_171_443 90
1391 3300046533 Ga0495640_0781376 Ga0495640_0781376_218_493 90
1392 3300046537 Ga0495598_0008711 Ga0495598_0008711_1852_2124 90
1393 3300046538 Ga0495609_0088180 Ga0495609_0088180_107_379 90
1394 3300046538 Ga0495609_0090861 Ga0495609_0090861_330_605 90
1395 3300046538 Ga0495609_0156254 Ga0495609_0156254_234_506 90
1396 3300046539 Ga0495621_0003636 Ga0495621_0003636_2415_2687 90
1397 3300046539 Ga0495621_0122490 Ga0495621_0122490_644_916 90
1398 3300046542 Ga0495597_0025361 Ga0495597_0025361_1313_1588 90
1399 3300046542 Ga0495597_0048346 Ga0495597_0048346_1091_1363 90
1400 3300046542 Ga0495597_0308209 Ga0495597_0308209_235_507 90
1401 3300046557 Ga0495622_0025062 Ga0495622_0025062_1576_1851 90
1402 3300046557 Ga0495622_0066337 Ga0495622_0066337_513_785 90
1403 3300046557 Ga0495622_0141436 Ga0495622_0141436_654_926 90
1404 3300046558 Ga0495633_0119648 Ga0495633_0119648_786_1058 90
1405 3300046558 Ga0495633_0256210 Ga0495633_0256210_261_533 90
1406 3300046559 Ga0495667_0609693 Ga0495667_0609693_234_509 90
1407 3300046615 Ga0495656_0036134 Ga0495656_0036134_1531_1803 90
1408 3300046615 Ga0495656_0117691 Ga0495656_0117691_325_597 90
1409 3300046615 Ga0495656_0220379 Ga0495656_0220379_658_930 90
1410 3300046615 Ga0495656_0520128 Ga0495656_0520128_349_621 90
1411 3300046616 Ga0495668_0014949 Ga0495668_0014949_1680_1955 90
1412 3300046616 Ga0495668_0122797 Ga0495668_0122797_50_322 90
1413 3300046616 Ga0495668_0125574 Ga0495668_0125574_849_1124 90
1414 3300046616 Ga0495668_0126565 Ga0495668_0126565_929_1201 90
1415 3300046616 Ga0495668_0129727 Ga0495668_0129727_799_1071 90
1416 3300046616 Ga0495668_0130633 Ga0495668_0130633_200_475 90
1417 3300046616 Ga0495668_0177050 Ga0495668_0177050_399_671 90
1418 3300046616 Ga0495668_0198567 Ga0495668_0198567_593_865 90
1419 3300046616 Ga0495668_0243502 Ga0495668_0243502_274_549 90
1420 3300046616 Ga0495668_0243655 Ga0495668_0243655_506_781 90
1421 3300046616 Ga0495668_0342836 Ga0495668_0342836_452_727 90
1422 3300046616 Ga0495668_0405452 Ga0495668_0405452_267_542 90
1423 3300046648 Ga0495611_0042236 Ga0495611_0042236_1533_1805 90
1424 3300046648 Ga0495611_0064648 Ga0495611_0064648_1362_1634 90
1425 3300046648 Ga0495611_0081160 Ga0495611_0081160_436_708 90
1426 3300046648 Ga0495611_0160161 Ga0495611_0160161_20_292 90
1427 3300046648 Ga0495611_0514149 Ga0495611_0514149_247_522 90
1428 3300046660 Ga0495625_0181303 Ga0495625_0181303_778_1050 90
1429 3300046660 Ga0495625_0236831 Ga0495625_0236831_604_879 90
1430 3300046660 Ga0495625_0501147 Ga0495625_0501147_309_584 90
1431 3300046660 Ga0495625_0647254 Ga0495625_0647254_111_386 90
1432 3300046660 Ga0495625_0780463 Ga0495625_0780463_91_363 90
1433 3300046663 Ga0495635_0481622 Ga0495635_0481622_420_692 90
1434 3300046663 Ga0495635_1047384 Ga0495635_1047384_97_372 90
1435 3300046664 Ga0495659_0030409 Ga0495659_0030409_766_1038 90
1436 3300046664 Ga0495659_0233936 Ga0495659_0233936_71_343 90
1437 3300046665 Ga0495661_0089248 Ga0495661_0089248_762_1034 90
1438 3300046665 Ga0495661_0417552 Ga0495661_0417552_300_575 90
1439 3300046665 Ga0495661_0436237 Ga0495661_0436237_86_358 90
1440 3300046674 Ga0495588_0002782 Ga0495588_0002782_4345_4617 90
1441 3300046674 Ga0495588_0170577 Ga0495588_0170577_328_603 90
1442 3300046674 Ga0495588_0203532 Ga0495588_0203532_35_307 90
1443 3300046675 Ga0495657_0183016 Ga0495657_0183016_403_678 90
1444 3300046679 Ga0495623_0131065 Ga0495623_0131065_316_591 90
1445 3300046680 Ga0495646_0531423 Ga0495646_0531423_94_369 90
1446 3300046681 Ga0495647_0631001 Ga0495647_0631001_163_435 90
1447 3300046683 Ga0495658_0032247 Ga0495658_0032247_244_516 90
1448 3300046683 Ga0495658_0212628 Ga0495658_0212628_223_498 90
1449 3300046684 Ga0495669_0017393 Ga0495669_0017393_300_572 90
1450 3300046684 Ga0495669_0087696 Ga0495669_0087696_195_467 90
1451 3300046684 Ga0495669_0103592 Ga0495669_0103592_794_1066 90
1452 3300046684 Ga0495669_0158465 Ga0495669_0158465_503_778 90
1453 3300046689 Ga0495613_0592755 Ga0495613_0592755_270_542 90
1454 3300046690 Ga0495624_0136095 Ga0495624_0136095_13_288 90
1455 3300046690 Ga0495624_0253926 Ga0495624_0253926_118_390 90
1456 3300046690 Ga0495624_0617610 Ga0495624_0617610_85_360 90
1457 3300046691 Ga0495670_0078015 Ga0495670_0078015_442_714 90
1458 3300046691 Ga0495670_0080267 Ga0495670_0080267_992_1264 90
1459 3300046691 Ga0495670_0402689 Ga0495670_0402689_41_313 90
1460 3300046692 Ga0495671_0089406 Ga0495671_0089406_467_742 90
1461 3300046692 Ga0495671_0220520 Ga0495671_0220520_107_379 90
1462 3300046692 Ga0495671_0402237 Ga0495671_0402237_117_389 90
1463 3300046694 Ga0495649_0098252 Ga0495649_0098252_1248_1520 90
1464 3300046694 Ga0495649_0152845 Ga0495649_0152845_478_753 90
1465 3300046694 Ga0495649_0350475 Ga0495649_0350475_429_701 90
1466 3300046794 Ga0495589_0089341 Ga0495589_0089341_47_319 90
1467 3300046809 Ga0495600_0625129 Ga0495600_0625129_178_453 90
1468 3300046810 Ga0495660_0256459 Ga0495660_0256459_220_495 90
1469 3300046810 Ga0495660_0378394 Ga0495660_0378394_115_387 90
1470 3300046810 Ga0495660_0479099 Ga0495660_0479099_77_349 90
1471 3300047315 Ga0495581_0196979 Ga0495581_0196979_845_1117 90
1472 3300047315 Ga0495581_0217518 Ga0495581_0217518_367_639 90
1473 3300047315 Ga0495581_0834973 Ga0495581_0834973_51_326 90
1474 3300047318 Ga0495636_0165315 Ga0495636_0165315_172_444 90
1475 3300047318 Ga0495636_0259023 Ga0495636_0259023_342_614 90
1476 3300047318 Ga0495636_0549527 Ga0495636_0549527_147_419 90
1477 3300047318 Ga0495636_0570024 Ga0495636_0570024_221_493 90
1478 3300047319 Ga0495674_0535334 Ga0495674_0535334_288_563 90
1479 3300047319 Ga0495674_0769518 Ga0495674_0769518_153_425 90
1480 3300047320 Ga0495672_0021500 Ga0495672_0021500_2391_2666 90
1481 3300047320 Ga0495672_0082802 Ga0495672_0082802_770_1045 90
1482 3300047320 Ga0495672_0213608 Ga0495672_0213608_441_713 90
1483 3300047321 Ga0495676_0076145 Ga0495676_0076145_335_607 90
1484 3300047321 Ga0495676_0166749 Ga0495676_0166749_540_815 90
1485 3300047321 Ga0495676_0241501 Ga0495676_0241501_553_825 90
1486 3300047321 Ga0495676_0299828 Ga0495676_0299828_52_327 90
1487 3300047322 Ga0495680_0880027 Ga0495680_0880027_256_531 90
1488 3300047323 Ga0495683_0034016 Ga0495683_0034016_972_1247 90
1489 3300047323 Ga0495683_0080180 Ga0495683_0080180_854_1126 90
1490 3300047323 Ga0495683_0213532 Ga0495683_0213532_411_683 90
1491 3300047323 Ga0495683_0288656 Ga0495683_0288656_269_541 90
1492 3300047443 Ga0495687_024727 Ga0495687_024727_1606_1881 90
1493 3300047444 Ga0495675_0250090 Ga0495675_0250090_304_579 90
1494 3300047445 Ga0495677_0349662 Ga0495677_0349662_138_410 90
1495 3300047446 Ga0495679_118334 Ga0495679_118334_431_703 90
1496 3300047447 Ga0495685_064994 Ga0495685_064994_723_995 90
1497 3300047447 Ga0495685_134677 Ga0495685_134677_300_572 90
1498 3300047469 Ga0495673_0066074 Ga0495673_0066074_330_602 90
1499 3300047469 Ga0495673_0111789 Ga0495673_0111789_304_579 90
1500 3300047469 Ga0495673_0125596 Ga0495673_0125596_701_973 90
1501 3300047470 Ga0495681_0216265 Ga0495681_0216265_40_312 90
1502 3300047470 Ga0495681_0304026 Ga0495681_0304026_52_324 90
1503 3300047470 Ga0495681_0350519 Ga0495681_0350519_168_440 90
1504 3300047472 Ga0495686_0056439 Ga0495686_0056439_545_820 90
1505 3300047472 Ga0495686_0190559 Ga0495686_0190559_164_439 90
1506 3300047472 Ga0495686_0580045 Ga0495686_0580045_273_545 90
1507 3300048090 Ga0495615_0226202 Ga0495615_0226202_168_440 90
1508 3300048090 Ga0495615_0262433 Ga0495615_0262433_184_456 90
1509 3300048091 Ga0495626_0195615 Ga0495626_0195615_545_817 90
1510 3300048091 Ga0495626_0200261 Ga0495626_0200261_237_512 90
1511 3300048903 Ga0496100_0028458 Ga0496100_0028458_3087_3362 90
1512 3300048903 Ga0496100_0044930 Ga0496100_0044930_972_1244 90
1513 3300048903 Ga0496100_0159330 Ga0496100_0159330_378_653 90
1514 3300048903 Ga0496100_0227387 Ga0496100_0227387_97_372 90
1515 3300048903 Ga0496100_0262765 Ga0496100_0262765_411_683 90
1516 3300048903 Ga0496100_0323209 Ga0496100_0323209_765_1040 90
1517 3300048903 Ga0496100_0426749 Ga0496100_0426749_712_987 90
1518 3300048903 Ga0496100_0993980 Ga0496100_0993980_359_631 90
1519 3300048904 Ga0496101_0004551 Ga0496101_0004551_6426_6698 90
1520 3300048904 Ga0496101_0042331 Ga0496101_0042331_2406_2681 90
1521 3300048904 Ga0496101_0106516 Ga0496101_0106516_433_708 90
1522 3300048904 Ga0496101_0176398 Ga0496101_0176398_976_1248 90
1523 3300048904 Ga0496101_0516338 Ga0496101_0516338_214_486 90
1524 3300048904 Ga0496101_0697614 Ga0496101_0697614_217_492 90
1525 3300048904 Ga0496101_0894424 Ga0496101_0894424_41_313 90
1526 3300048904 Ga0496101_1268934 Ga0496101_1268934_150_422 90
1527 3300048904 Ga0496101_1458452 Ga0496101_1458452_91_366 90
1528 3300048905 Ga0496102_0059510 Ga0496102_0059510_2279_2554 90
1529 3300048905 Ga0496102_0082212 Ga0496102_0082212_1578_1850 90
1530 3300048905 Ga0496102_0091984 Ga0496102_0091984_647_922 90
1531 3300048905 Ga0496102_0141472 Ga0496102_0141472_1612_1887 90
1532 3300048905 Ga0496102_0168592 Ga0496102_0168592_240_515 90
1533 3300048905 Ga0496102_0225269 Ga0496102_0225269_1031_1306 90
1534 3300048905 Ga0496102_0238524 Ga0496102_0238524_1031_1303 90
1535 3300048905 Ga0496102_0322153 Ga0496102_0322153_973_1248 90
1536 3300048905 Ga0496102_0546680 Ga0496102_0546680_511_786 90
1537 3300048905 Ga0496102_1845612 Ga0496102_1845612_155_430 90
1538 3300048906 Ga0496103_0005244 Ga0496103_0005244_1720_1992 90
1539 3300048906 Ga0496103_0034826 Ga0496103_0034826_519_794 90
1540 3300048906 Ga0496103_0158823 Ga0496103_0158823_1014_1289 90
1541 3300048906 Ga0496103_0315374 Ga0496103_0315374_319_591 90
1542 3300048906 Ga0496103_0692884 Ga0496103_0692884_80_352 90
1543 3300048907 Ga0496104_0010015 Ga0496104_0010015_2389_2661 90
1544 3300048907 Ga0496104_0059163 Ga0496104_0059163_2431_2706 90
1545 3300048907 Ga0496104_0071679 Ga0496104_0071679_2082_2357 90
1546 3300048907 Ga0496104_0136213 Ga0496104_0136213_1628_1903 90
1547 3300048907 Ga0496104_0322214 Ga0496104_0322214_37_312 90
1548 3300048907 Ga0496104_1318138 Ga0496104_1318138_122_394 90
1549 3300048908 Ga0496105_0031760 Ga0496105_0031760_1805_2077 90
1550 3300048908 Ga0496105_0200828 Ga0496105_0200828_907_1182 90
1551 3300048908 Ga0496105_0573571 Ga0496105_0573571_432_707 90
1552 3300048908 Ga0496105_0898634 Ga0496105_0898634_166_438 90
1553 3300048908 Ga0496105_1149268 Ga0496105_1149268_227_499 90
1554 3300048909 Ga0496106_0005291 Ga0496106_0005291_7589_7864 90
1555 3300048909 Ga0496106_0056220 Ga0496106_0056220_2451_2723 90
1556 3300048909 Ga0496106_0146073 Ga0496106_0146073_1128_1403 90
1557 3300048909 Ga0496106_0186598 Ga0496106_0186598_453_728 90
1558 3300048909 Ga0496106_0186639 Ga0496106_0186639_1187_1459 90
1559 3300048909 Ga0496106_0303694 Ga0496106_0303694_506_778 90
1560 3300048909 Ga0496106_0812407 Ga0496106_0812407_141_413 90
1561 3300048909 Ga0496106_1083165 Ga0496106_1083165_191_466 90
1562 3300048909 Ga0496106_1444643 Ga0496106_1444643_190_465 90
1563 3300048910 Ga0496107_0089242 Ga0496107_0089242_1733_2005 90
1564 3300048910 Ga0496107_0112403 Ga0496107_0112403_34_306 90
1565 3300048910 Ga0496107_0294936 Ga0496107_0294936_473_745 90
1566 3300048910 Ga0496107_0326745 Ga0496107_0326745_421_696 90
1567 3300048910 Ga0496107_0333619 Ga0496107_0333619_413_688 90
1568 3300048910 Ga0496107_0399832 Ga0496107_0399832_309_581 90
1569 3300048910 Ga0496107_0480149 Ga0496107_0480149_390_662 90
1570 3300048910 Ga0496107_0560603 Ga0496107_0560603_173_448 90
1571 3300048910 Ga0496107_0781166 Ga0496107_0781166_270_542 90
1572 3300048911 Ga0496108_0030230 Ga0496108_0030230_3246_3518 90
1573 3300048911 Ga0496108_0036900 Ga0496108_0036900_1729_2004 90
1574 3300048911 Ga0496108_0085617 Ga0496108_0085617_1461_1736 90
1575 3300048911 Ga0496108_0135163 Ga0496108_0135163_1085_1357 90
1576 3300048911 Ga0496108_0734501 Ga0496108_0734501_530_805 90
1577 3300048912 Ga0496109_0039394 Ga0496109_0039394_1897_2169 90
1578 3300048912 Ga0496109_0067828 Ga0496109_0067828_1002_1277 90
1579 3300048912 Ga0496109_0224121 Ga0496109_0224121_822_1097 90
1580 3300048912 Ga0496109_0236850 Ga0496109_0236850_439_711 90
1581 3300048912 Ga0496109_1243443 Ga0496109_1243443_114_386 90
1582 3300048912 Ga0496109_1545385 Ga0496109_1545385_92_367 90
1583 3300048912 Ga0496109_1982723 Ga0496109_1982723_127_402 90
1584 3300048913 Ga0496110_0137677 Ga0496110_0137677_1871_2143 90
1585 3300048913 Ga0496110_0145638 Ga0496110_0145638_1618_1893 90
1586 3300048913 Ga0496110_0237494 Ga0496110_0237494_964_1239 90
1587 3300048914 Ga0496111_0051658 Ga0496111_0051658_684_956 90
1588 3300048914 Ga0496111_0059186 Ga0496111_0059186_1209_1484 90
1589 3300048914 Ga0496111_0188258 Ga0496111_0188258_441_716 90
1590 3300048914 Ga0496111_0309188 Ga0496111_0309188_461_733 90
1591 3300048914 Ga0496111_0375335 Ga0496111_0375335_45_317 90
1592 3300048915 Ga0496112_0063136 Ga0496112_0063136_1991_2266 90
1593 3300048915 Ga0496112_0115214 Ga0496112_0115214_2166_2438 90
1594 3300048915 Ga0496112_0208816 Ga0496112_0208816_662_934 90
1595 3300048915 Ga0496112_0556081 Ga0496112_0556081_353_628 90
1596 3300048915 Ga0496112_0855713 Ga0496112_0855713_51_326 90
1597 3300048915 Ga0496112_0972987 Ga0496112_0972987_325_600 90
1598 3300048915 Ga0496112_0988614 Ga0496112_0988614_177_452 90
1599 3300048915 Ga0496112_1735164 Ga0496112_1735164_60_335 90
1600 3300048916 Ga0496113_0009302 Ga0496113_0009302_5977_6249 90
1601 3300048916 Ga0496113_0063812 Ga0496113_0063812_1545_1820 90
1602 3300048916 Ga0496113_0355424 Ga0496113_0355424_64_339 90
1603 3300048917 Ga0496114_0013002 Ga0496114_0013002_4706_4981 90
1604 3300048917 Ga0496114_0016363 Ga0496114_0016363_2703_2975 90
1605 3300048917 Ga0496114_0132921 Ga0496114_0132921_1027_1302 90
1606 3300048917 Ga0496114_0370091 Ga0496114_0370091_479_751 90
1607 3300048917 Ga0496114_1210652 Ga0496114_1210652_98_373 90
1608 3300048917 Ga0496114_1448451 Ga0496114_1448451_197_469 90
1609 3300048918 Ga0496115_0024599 Ga0496115_0024599_2451_2723 90
1610 3300048918 Ga0496115_0234041 Ga0496115_0234041_672_947 90
1611 3300048918 Ga0496115_0243702 Ga0496115_0243702_223_498 90
1612 3300048918 Ga0496115_0378839 Ga0496115_0378839_499_774 90
1613 3300048918 Ga0496115_0400874 Ga0496115_0400874_412_684 90
1614 3300048918 Ga0496115_0478173 Ga0496115_0478173_262_537 90
1615 3300048918 Ga0496115_0496849 Ga0496115_0496849_302_577 90
1616 3300048918 Ga0496115_0586758 Ga0496115_0586758_273_548 90
1617 3300048919 Ga0496116_0011726 Ga0496116_0011726_3143_3418 90
1618 3300048919 Ga0496116_0244067 Ga0496116_0244067_221_493 90
1619 3300048919 Ga0496116_0452127 Ga0496116_0452127_130_405 90
1620 3300048920 Ga0496117_0139893 Ga0496117_0139893_112_387 90
1621 3300048920 Ga0496117_0146296 Ga0496117_0146296_932_1207 90
1622 3300048920 Ga0496117_0376522 Ga0496117_0376522_60_332 90
1623 3300048920 Ga0496117_0490352 Ga0496117_0490352_35_307 90
1624 3300048921 Ga0496118_0021615 Ga0496118_0021615_4508_4783 90
1625 3300048921 Ga0496118_0025856 Ga0496118_0025856_1969_2244 90
1626 3300048921 Ga0496118_0063550 Ga0496118_0063550_532_807 90
1627 3300048921 Ga0496118_0374402 Ga0496118_0374402_168_440 90
1628 3300048921 Ga0496118_0637411 Ga0496118_0637411_136_411 90
1629 3300048922 Ga0496119_0022737 Ga0496119_0022737_2003_2278 90
1630 3300048922 Ga0496119_0143594 Ga0496119_0143594_628_903 90
1631 3300048922 Ga0496119_0246872 Ga0496119_0246872_316_591 90
1632 3300048922 Ga0496119_0271475 Ga0496119_0271475_278_550 90
1633 3300048922 Ga0496119_0285588 Ga0496119_0285588_406_681 90
1634 3300048922 Ga0496119_0311897 Ga0496119_0311897_342_614 90
1635 3300048922 Ga0496119_0462697 Ga0496119_0462697_150_425 90
1636 3300048923 Ga0496120_0023248 Ga0496120_0023248_3189_3464 90
1637 3300048924 Ga0496121_0021056 Ga0496121_0021056_5611_5883 90
1638 3300048924 Ga0496121_0030260 Ga0496121_0030260_84_359 90
1639 3300048924 Ga0496121_0033524 Ga0496121_0033524_946_1221 90
1640 3300048924 Ga0496121_0065818 Ga0496121_0065818_2046_2318 90
1641 3300048924 Ga0496121_0082471 Ga0496121_0082471_1731_2006 90
1642 3300048924 Ga0496121_0123319 Ga0496121_0123319_898_1173 90
1643 3300048924 Ga0496121_0276496 Ga0496121_0276496_789_1064 90
1644 3300048924 Ga0496121_0312809 Ga0496121_0312809_249_524 90
1645 3300048924 Ga0496121_0335962 Ga0496121_0335962_581_853 90
1646 3300048924 Ga0496121_0345241 Ga0496121_0345241_496_771 90
1647 3300048924 Ga0496121_0492287 Ga0496121_0492287_46_321 90
1648 3300048924 Ga0496121_0497705 Ga0496121_0497705_216_488 90
1649 3300048924 Ga0496121_0507153 Ga0496121_0507153_263_538 90
1650 3300048924 Ga0496121_0510385 Ga0496121_0510385_350_625 90
1651 3300048925 Ga0496122_0242325 Ga0496122_0242325_212_487 90
1652 3300048925 Ga0496122_0381572 Ga0496122_0381572_76_351 90
1653 3300048927 Ga0496124_0166292 Ga0496124_0166292_930_1223 90
1654 3300048927 Ga0496124_0378317 Ga0496124_0378317_68_343 90
1655 3300048927 Ga0496124_0388167 Ga0496124_0388167_271_543 90
1656 3300048927 Ga0496124_0777951 Ga0496124_0777951_118_393 90
1657 3300048928 Ga0496125_0085989 Ga0496125_0085989_459_734 90
1658 3300048928 Ga0496125_0093476 Ga0496125_0093476_1925_2215 90
1659 3300048928 Ga0496125_0105381 Ga0496125_0105381_1417_1689 90
1660 3300048928 Ga0496125_0124120 Ga0496125_0124120_165_437 90
1661 3300048928 Ga0496125_0493998 Ga0496125_0493998_155_430 90
1662 3300048929 Ga0496126_0017707 Ga0496126_0017707_1686_1961 90
1663 3300048929 Ga0496126_0019226 Ga0496126_0019226_5368_5640 90
1664 3300048929 Ga0496126_0036538 Ga0496126_0036538_1519_1794 90
1665 3300048929 Ga0496126_0050013 Ga0496126_0050013_2049_2324 90
1666 3300048929 Ga0496126_0086648 Ga0496126_0086648_507_782 90
1667 3300048929 Ga0496126_0134174 Ga0496126_0134174_763_1038 90
1668 3300048929 Ga0496126_0145610 Ga0496126_0145610_342_617 90
1669 3300048929 Ga0496126_0223010 Ga0496126_0223010_556_831 90
1670 3300048929 Ga0496126_0261637 Ga0496126_0261637_395_667 90
1671 3300048929 Ga0496126_0332316 Ga0496126_0332316_655_930 90
1672 3300048929 Ga0496126_0379230 Ga0496126_0379230_425_697 90
1673 3300048929 Ga0496126_0394383 Ga0496126_0394383_190_465 90
1674 3300048929 Ga0496126_0535357 Ga0496126_0535357_428_703 90
1675 3300048929 Ga0496126_0542313 Ga0496126_0542313_184_456 90
1676 3300048929 Ga0496126_0783602 Ga0496126_0783602_277_552 90
1677 3300048929 Ga0496126_1043616 Ga0496126_1043616_309_584 90
1678 3300048929 Ga0496126_1277116 Ga0496126_1277116_134_409 90
1679 3300049459 Ga0495678_070871 Ga0495678_070871_831_1103 90
1680 3300049460 Ga0495682_0166970 Ga0495682_0166970_174_446 90
1681 3300049460 Ga0495682_0175353 Ga0495682_0175353_418_693 90
1682 3300049460 Ga0495682_0263188 Ga0495682_0263188_244_519 90
1683 3300049514 Ga0501291_141210 Ga0501291_141210_136_408 90
1684 3300049568 Ga0501031_0065487 Ga0501031_0065487_13_288 90
1685 3300049569 Ga0501032_0000309 Ga0501032_0000309_9540_9815 90
1686 3300049569 Ga0501032_0255663 Ga0501032_0255663_747_1022 90
1687 3300049569 Ga0501032_0409328 Ga0501032_0409328_382_654 90
1688 3300049570 Ga0501033_0001798 Ga0501033_0001798_13920_14195 90
1689 3300049570 Ga0501033_0140291 Ga0501033_0140291_748_1023 90
1690 3300049570 Ga0501033_0192736 Ga0501033_0192736_449_721 90
1691 3300049570 Ga0501033_0332943 Ga0501033_0332943_494_769 90
1692 3300049571 Ga0501034_0000082 Ga0501034_0000082_125753_126028 90
1693 3300049571 Ga0501034_0037046 Ga0501034_0037046_3835_4110 90
1694 3300049571 Ga0501034_0071891 Ga0501034_0071891_410_685 90
1695 3300049571 Ga0501034_0975792 Ga0501034_0975792_267_539 90
1696 3300049572 Ga0501036_0000121 Ga0501036_0000121_11417_11692 90
1697 3300049572 Ga0501036_0055283 Ga0501036_0055283_653_928 90
1698 3300049572 Ga0501036_0502016 Ga0501036_0502016_592_867 90
1699 3300049573 Ga0501037_0000346 Ga0501037_0000346_32690_32965 90
1700 3300049573 Ga0501037_0899999 Ga0501037_0899999_41_316 90
1701 3300049574 Ga0501038_0002992 Ga0501038_0002992_1267_1542 90
1702 3300049574 Ga0501038_0050259 Ga0501038_0050259_985_1260 90
1703 3300049575 Ga0501039_0009593 Ga0501039_0009593_4705_4980 90
1704 3300049575 Ga0501039_0104435 Ga0501039_0104435_1266_1541 90
1705 3300049578 Ga0501042_0565704 Ga0501042_0565704_163_438 90
1706 3300049578 Ga0501042_0626113 Ga0501042_0626113_298_573 90
1707 3300049579 Ga0501043_0000109 Ga0501043_0000109_16125_16400 90
1708 3300049579 Ga0501043_0035788 Ga0501043_0035788_1193_1468 90
1709 3300049580 Ga0501046_0000101 Ga0501046_0000101_6997_7272 90
1710 3300049580 Ga0501046_0025644 Ga0501046_0025644_3505_3780 90
1711 3300049580 Ga0501046_0035094 Ga0501046_0035094_1742_2014 90
1712 3300049581 Ga0501047_0000331 Ga0501047_0000331_11380_11655 90
1713 3300049581 Ga0501047_0131940 Ga0501047_0131940_452_727 90
1714 3300049581 Ga0501047_0185685 Ga0501047_0185685_1443_1715 90
1715 3300049581 Ga0501047_0334183 Ga0501047_0334183_738_1013 90
1716 3300049582 Ga0501048_0002703 Ga0501048_0002703_6718_6993 90
1717 3300049582 Ga0501048_0039082 Ga0501048_0039082_2508_2783 90
1718 3300049583 Ga0501067_0000534 Ga0501067_0000534_14998_15273 90
1719 3300049583 Ga0501067_0453728 Ga0501067_0453728_385_660 90
1720 3300049583 Ga0501067_0688811 Ga0501067_0688811_103_378 90
1721 3300049583 Ga0501067_0820350 Ga0501067_0820350_137_412 90
1722 3300049584 Ga0501068_0000276 Ga0501068_0000276_5407_5682 90
1723 3300049585 Ga0501069_0014951 Ga0501069_0014951_2671_2946 90
1724 3300049585 Ga0501069_0153812 Ga0501069_0153812_571_846 90
1725 3300049585 Ga0501069_0357812 Ga0501069_0357812_544_819 90
1726 3300049586 Ga0501070_0024493 Ga0501070_0024493_2395_2667 90
1727 3300049586 Ga0501070_0127871 Ga0501070_0127871_755_1030 90
1728 3300049586 Ga0501070_0131994 Ga0501070_0131994_1367_1642 90
1729 3300049586 Ga0501070_0338481 Ga0501070_0338481_47_322 90
1730 3300049587 Ga0501071_0120319 Ga0501071_0120319_1489_1764 90
1731 3300049587 Ga0501071_0545295 Ga0501071_0545295_560_835 90
1732 3300049588 Ga0501072_0004822 Ga0501072_0004822_4692_4967 90
1733 3300049589 Ga0501073_0000101 Ga0501073_0000101_34848_35123 90
1734 3300049589 Ga0501073_0041906 Ga0501073_0041906_1737_2009 90
1735 3300049589 Ga0501073_0765475 Ga0501073_0765475_207_482 90
1736 3300049590 Ga0501074_0000187 Ga0501074_0000187_26820_27095 90
1737 3300049591 Ga0501075_0316309 Ga0501075_0316309_293_568 90
1738 3300049592 Ga0501076_0274060 Ga0501076_0274060_653_928 90
1739 3300049741 Ga0501079_0001908 Ga0501079_0001908_12194_12469 90
1740 3300049741 Ga0501079_0330152 Ga0501079_0330152_133_405 90
1741 3300049742 Ga0501080_0000151 Ga0501080_0000151_19033_19308 90
1742 3300049742 Ga0501080_0021394 Ga0501080_0021394_2197_2469 90
1743 3300049744 Ga0501083_0007235 Ga0501083_0007235_6852_7127 90
1744 3300049822 Ga0501035_0000150 Ga0501035_0000150_4092_4367 90
1745 3300049822 Ga0501035_0687054 Ga0501035_0687054_311_586 90
1746 3300049822 Ga0501035_1360459 Ga0501035_1360459_147_422 90
1747 3300049823 Ga0501044_0000247 Ga0501044_0000247_49868_50143 90
1748 3300049823 Ga0501044_0011870 Ga0501044_0011870_305_580 90
1749 3300049823 Ga0501044_0114019 Ga0501044_0114019_1421_1693 90
1750 3300049823 Ga0501044_0413717 Ga0501044_0413717_441_716 90
1751 3300049824 Ga0501045_0074857 Ga0501045_0074857_2047_2322 90
1752 3300050489 nmdc:mga03683_128980_c1 nmdc:mga03683_128980_c1_668_943 90
1753 3300050489 nmdc:mga03683_226971_c1 nmdc:mga03683_226971_c1_481_756 90
1754 3300050489 nmdc:mga03683_647996_c1 nmdc:mga03683_647996_c1_25_300 90
1755 3300050489 nmdc:mga03683_95798_c1 nmdc:mga03683_95798_c1_255_527 90
1756 3300050490 nmdc:mga03n38_179764_c1 nmdc:mga03n38_179764_c1_593_883 90
1757 3300050490 nmdc:mga03n38_239641_c1 nmdc:mga03n38_239641_c1_136_408 90
1758 3300050490 nmdc:mga03n38_4436_c1 nmdc:mga03n38_4436_c1_1518_1793 90
1759 3300050490 nmdc:mga03n38_544515_c1 nmdc:mga03n38_544515_c1_126_398 90
1760 3300050490 nmdc:mga03n38_586281_c1 nmdc:mga03n38_586281_c1_216_488 90
1761 3300050490 nmdc:mga03n38_809050_c1 nmdc:mga03n38_809050_c1_189_464 90
1762 3300050490 nmdc:mga03n38_88012_c1 nmdc:mga03n38_88012_c1_429_704 90
1763 3300050491 nmdc:mga00v17_123669_c1 nmdc:mga00v17_123669_c1_118_390 90
1764 3300050491 nmdc:mga00v17_162335_c1 nmdc:mga00v17_162335_c1_628_903 90
1765 3300050491 nmdc:mga00v17_21020_c1 nmdc:mga00v17_21020_c1_754_1026 90
1766 3300050491 nmdc:mga00v17_490442_c1 nmdc:mga00v17_490442_c1_126_401 90
1767 3300050491 nmdc:mga00v17_494837_c1 nmdc:mga00v17_494837_c1_266_556 90
1768 3300050491 nmdc:mga00v17_553349_c1 nmdc:mga00v17_553349_c1_245_520 90
1769 3300050491 nmdc:mga00v17_834740_c1 nmdc:mga00v17_834740_c1_192_467 90
1770 3300050491 nmdc:mga00v17_84510_c1 nmdc:mga00v17_84510_c1_174_446 90
1771 3300050492 nmdc:mga0yw44_104317_c1 nmdc:mga0yw44_104317_c1_343_615 90
1772 3300050492 nmdc:mga0yw44_1124070_c1 nmdc:mga0yw44_1124070_c1_39_329 90
1773 3300050492 nmdc:mga0yw44_1245409_c1 nmdc:mga0yw44_1245409_c1_79_396 90
1774 3300050492 nmdc:mga0yw44_16029_c1 nmdc:mga0yw44_16029_c1_299_592 90
1775 3300050492 nmdc:mga0yw44_18764_c1 nmdc:mga0yw44_18764_c1_483_758 90
1776 3300050492 nmdc:mga0yw44_199947_c1 nmdc:mga0yw44_199947_c1_549_824 90
1777 3300050492 nmdc:mga0yw44_707388_c1 nmdc:mga0yw44_707388_c1_102_377 90
1778 3300050492 nmdc:mga0yw44_70819_c1 nmdc:mga0yw44_70819_c1_893_1168 90
1779 3300050493 nmdc:mga0k408_141057_c1 nmdc:mga0k408_141057_c1_572_844 90
1780 3300050493 nmdc:mga0k408_155121_c1 nmdc:mga0k408_155121_c1_947_1219 90
1781 3300050493 nmdc:mga0k408_225480_c1 nmdc:mga0k408_225480_c1_670_942 90
1782 3300050493 nmdc:mga0k408_324926_c1 nmdc:mga0k408_324926_c1_473_745 90
1783 3300050493 nmdc:mga0k408_403421_c1 nmdc:mga0k408_403421_c1_330_605 90
1784 3300050493 nmdc:mga0k408_632380_c1 nmdc:mga0k408_632380_c1_47_322 90
1785 3300050493 nmdc:mga0k408_71325_c1 nmdc:mga0k408_71325_c1_1098_1373 90
1786 3300050494 nmdc:mga06z11_146289_c1 nmdc:mga06z11_146289_c1_561_836 90
1787 3300050494 nmdc:mga06z11_282785_c1 nmdc:mga06z11_282785_c1_231_503 90
1788 3300050494 nmdc:mga06z11_38926_c1 nmdc:mga06z11_38926_c1_1726_1998 90
1789 3300050494 nmdc:mga06z11_402374_c1 nmdc:mga06z11_402374_c1_506_781 90
1790 3300050494 nmdc:mga06z11_4590_c1 nmdc:mga06z11_4590_c1_2658_2933 90
1791 3300050494 nmdc:mga06z11_584435_c1 nmdc:mga06z11_584435_c1_302_595 90
1792 3300050494 nmdc:mga06z11_644975_c1 nmdc:mga06z11_644975_c1_73_348 90
1793 3300050494 nmdc:mga06z11_7575_c1 nmdc:mga06z11_7575_c1_1521_1793 90
1794 3300050494 nmdc:mga06z11_797114_c1 nmdc:mga06z11_797114_c1_98_370 90
1795 3300050494 nmdc:mga06z11_823611_c1 nmdc:mga06z11_823611_c1_152_424 90
1796 3300050494 nmdc:mga06z11_973574_c1 nmdc:mga06z11_973574_c1_136_408 90
1797 3300050495 nmdc:mga04h51_104619_c1 nmdc:mga04h51_104619_c1_720_992 90
1798 3300050495 nmdc:mga04h51_107326_c1 nmdc:mga04h51_107326_c1_511_786 90
1799 3300050495 nmdc:mga04h51_23324_c1 nmdc:mga04h51_23324_c1_791_1066 90
1800 3300050495 nmdc:mga04h51_244161_c1 nmdc:mga04h51_244161_c1_412_684 90
1801 3300050495 nmdc:mga04h51_327955_c1 nmdc:mga04h51_327955_c1_38_331 90
1802 3300050495 nmdc:mga04h51_418427_c1 nmdc:mga04h51_418427_c1_157_429 90
1803 3300050495 nmdc:mga04h51_68506_c1 nmdc:mga04h51_68506_c1_345_620 90
1804 3300050496 nmdc:mga07m45_12889_c2 nmdc:mga07m45_12889_c2_1250_1525 90
1805 3300050496 nmdc:mga07m45_187144_c1 nmdc:mga07m45_187144_c1_441_731 90
1806 3300050496 nmdc:mga07m45_307556_c1 nmdc:mga07m45_307556_c1_464_739 90
1807 3300050496 nmdc:mga07m45_378627_c1 nmdc:mga07m45_378627_c1_104_379 90
1808 3300050496 nmdc:mga07m45_398352_c1 nmdc:mga07m45_398352_c1_317_592 90
1809 3300050496 nmdc:mga07m45_78473_c1 nmdc:mga07m45_78473_c1_1354_1626 90
1810 3300050496 nmdc:mga07m45_9923_c1 nmdc:mga07m45_9923_c1_726_1001 90
1811 3300050507 nmdc:mga05p37_433340_c1 nmdc:mga05p37_433340_c1_738_1010 90
1812 3300050508 nmdc:mga09592_942145_c1 nmdc:mga09592_942145_c1_287_559 90
1813 3300050509 nmdc:mga0qj67_937081_c1 nmdc:mga0qj67_937081_c1_206_478 90
1814 3300050511 nmdc:mga08y16_1777197_c1 nmdc:mga08y16_1777197_c1_208_483 90
1815 3300050511 nmdc:mga08y16_30607_c1 nmdc:mga08y16_30607_c1_3360_3632 90
1816 3300050512 nmdc:mga0n895_1422924_c1 nmdc:mga0n895_1422924_c1_130_402 90
1817 3300050512 nmdc:mga0n895_559089_c1 nmdc:mga0n895_559089_c1_456_728 90
1818 3300050513 nmdc:mga0rr50_1571726_c1 nmdc:mga0rr50_1571726_c1_23_298 90
1819 3300050514 nmdc:mga08x19_930215_c1 nmdc:mga08x19_930215_c1_246_521 90
1820 3300050515 nmdc:mga0a205_569210_c1 nmdc:mga0a205_569210_c1_552_824 90
1821 3300050515 nmdc:mga0a205_608522_c1 nmdc:mga0a205_608522_c1_442_714 90
1822 3300050516 nmdc:mga0sz30_20012_c2 nmdc:mga0sz30_20012_c2_479_772 90
1823 3300050516 nmdc:mga0sz30_214927_c1 nmdc:mga0sz30_214927_c1_552_824 90
1824 3300050516 nmdc:mga0sz30_224818_c1 nmdc:mga0sz30_224818_c1_38_328 90
1825 3300050516 nmdc:mga0sz30_240505_c1 nmdc:mga0sz30_240505_c1_80_355 90
1826 3300050516 nmdc:mga0sz30_345641_c1 nmdc:mga0sz30_345641_c1_358_630 90
1827 3300050516 nmdc:mga0sz30_365865_c1 nmdc:mga0sz30_365865_c1_189_461 90
1828 3300050516 nmdc:mga0sz30_504376_c1 nmdc:mga0sz30_504376_c1_84_356 90
1829 3300050516 nmdc:mga0sz30_52809_c1 nmdc:mga0sz30_52809_c1_717_989 90
1830 3300050516 nmdc:mga0sz30_7570_c1 nmdc:mga0sz30_7570_c1_2717_2992 90
1831 3300053078 Ga0495612_0197189 Ga0495612_0197189_230_505 90
1832 3300053083 Ga0495655_0031694 Ga0495655_0031694_499_771 90
1833 3300053083 Ga0495655_0047211 Ga0495655_0047211_13_285 90
1834 3300053083 Ga0495655_0088694 Ga0495655_0088694_597_869 90
1835 3300053083 Ga0495655_0205017 Ga0495655_0205017_227_502 90
1836 3300053083 Ga0495655_0301157 Ga0495655_0301157_16_291 90
1837 3300053084 Ga0495595_0019945 Ga0495595_0019945_160_435 90
1838 3300053085 Ga0495619_0996963 Ga0495619_0996963_69_341 90
1839 3300053086 Ga0500578_0076055 Ga0500578_0076055_1218_1493 90
1840 3300053086 Ga0500578_0174654 Ga0500578_0174654_409_681 90
1841 3300053086 Ga0500578_0191088 Ga0500578_0191088_52_327 90
1842 3300053087 Ga0500643_006068 Ga0500643_006068_2500_2775 90
1843 3300053088 Ga0500644_0229872 Ga0500644_0229872_432_704 90
1844 3300053089 Ga0500581_123599 Ga0500581_123599_46_318 90
1845 3300053090 Ga0500646_0060067 Ga0500646_0060067_391_666 90
1846 3300053090 Ga0500646_0147104 Ga0500646_0147104_21_293 90
1847 3300053091 Ga0500647_0304313 Ga0500647_0304313_118_393 90
1848 3300053092 Ga0500583_0015473 Ga0500583_0015473_209_484 90
1849 3300053092 Ga0500583_0151438 Ga0500583_0151438_798_1070 90
1850 3300053092 Ga0500583_0601273 Ga0500583_0601273_116_388 90
1851 3300053093 Ga0500651_0284683 Ga0500651_0284683_501_773 90
1852 3300053093 Ga0500651_0381504 Ga0500651_0381504_413_688 90
1853 3300053094 Ga0500566_0000029 Ga0500566_0000029_4387_4662 90
1854 3300053094 Ga0500566_0036505 Ga0500566_0036505_2429_2704 90
1855 3300053094 Ga0500566_0417257 Ga0500566_0417257_180_452 90
1856 3300053094 Ga0500566_0451497 Ga0500566_0451497_125_400 90
1857 3300053095 Ga0500640_280931 Ga0500640_280931_46_318 90
1858 3300053096 Ga0500641_0010979 Ga0500641_0010979_2427_2699 90
1859 3300053096 Ga0500641_0307600 Ga0500641_0307600_296_571 90
1860 3300053098 Ga0500650_0327915 Ga0500650_0327915_265_537 90
1861 3300053102 Ga0500554_099820 Ga0500554_099820_85_357 90
1862 3300053103 Ga0500555_003871 Ga0500555_003871_2912_3187 90
1863 3300053104 Ga0500556_0051083 Ga0500556_0051083_940_1215 90
1864 3300053105 Ga0500557_000066 Ga0500557_000066_21341_21616 90
1865 3300053108 Ga0500562_020119 Ga0500562_020119_656_931 90
1866 3300053108 Ga0500562_100008 Ga0500562_100008_63_335 90
1867 3300053109 Ga0500569_128589 Ga0500569_128589_391_663 90
1868 3300053114 Ga0500582_039924 Ga0500582_039924_1018_1290 90
1869 3300053116 Ga0500592_086135 Ga0500592_086135_49_321 90
1870 3300053118 Ga0500594_0346619 Ga0500594_0346619_34_306 90
1871 3300053119 Ga0500595_002381 Ga0500595_002381_6609_6884 90
1872 3300053119 Ga0500595_029527 Ga0500595_029527_25_297 90
1873 3300053120 Ga0500597_128206 Ga0500597_128206_154_429 90
1874 3300053123 Ga0500614_205670 Ga0500614_205670_179_454 90
1875 3300053124 Ga0500617_093516 Ga0500617_093516_403_675 90
1876 3300053126 Ga0500621_193079 Ga0500621_193079_213_506 90
1877 3300053128 Ga0500626_228450 Ga0500626_228450_213_488 90
1878 3300053128 Ga0500626_231676 Ga0500626_231676_378_653 90
1879 3300053130 Ga0500642_0243575 Ga0500642_0243575_485_757 90
1880 3300053130 Ga0500642_0470664 Ga0500642_0470664_168_440 90
1881 3300053134 Ga0500658_0164723 Ga0500658_0164723_522_797 90
1882 3300053134 Ga0500658_0244122 Ga0500658_0244122_97_369 90
1883 3300053134 Ga0500658_0528298 Ga0500658_0528298_71_343 90
1884 3300053134 Ga0500658_0549781 Ga0500658_0549781_220_495 90
1885 3300053137 Ga0500561_0159771 Ga0500561_0159771_118_390 90
1886 3300053137 Ga0500561_0240818 Ga0500561_0240818_270_542 90
1887 3300053139 Ga0500568_0010187 Ga0500568_0010187_727_1002 90
1888 3300053139 Ga0500568_0304026 Ga0500568_0304026_162_434 90
1889 3300053142 Ga0500577_0207514 Ga0500577_0207514_491_763 90
1890 3300053143 Ga0500579_241243 Ga0500579_241243_313_585 90
1891 3300053146 Ga0500588_0209223 Ga0500588_0209223_367_639 90
1892 3300053147 Ga0500589_059839 Ga0500589_059839_1422_1697 90
1893 3300053147 Ga0500589_118817 Ga0500589_118817_555_827 90
1894 3300053147 Ga0500589_146714 Ga0500589_146714_334_606 90
1895 3300053150 Ga0500603_011207 Ga0500603_011207_494_769 90
1896 3300053150 Ga0500603_055507 Ga0500603_055507_766_1041 90
1897 3300053151 Ga0500604_0099735 Ga0500604_0099735_396_671 90
1898 3300053153 Ga0500616_0217852 Ga0500616_0217852_399_674 90
1899 3300053156 Ga0500622_0020016 Ga0500622_0020016_1307_1582 90
1900 3300053156 Ga0500622_0299741 Ga0500622_0299741_23_295 90
1901 3300053157 Ga0500624_129007 Ga0500624_129007_174_449 90
1902 3300053158 Ga0500627_0067831 Ga0500627_0067831_498_773 90
1903 3300053160 Ga0500633_0123238 Ga0500633_0123238_376_651 90
1904 3300053161 Ga0500634_0346555 Ga0500634_0346555_117_389 90
1905 3300053162 Ga0500638_007496 Ga0500638_007496_742_1017 90
1906 3300053177 Ga0500636_0152869 Ga0500636_0152869_537_812 90
1907 3300053177 Ga0500636_0355719 Ga0500636_0355719_88_363 90
1908 3300053178 Ga0500637_0139482 Ga0500637_0139482_1109_1384 90
1909 3300053722 Ga0500649_175023 Ga0500649_175023_273_548 90
1910 3300053727 Ga0500611_023183 Ga0500611_023183_755_1027 90
1911 3300053729 Ga0500625_091780 Ga0500625_091780_503_778 90
1912 3300053730 Ga0500645_015281 Ga0500645_015281_131_406 90
1913 3300053730 Ga0500645_035636 Ga0500645_035636_552_824 90
1914 3300053731 Ga0500609_037907 Ga0500609_037907_60_332 90
1915 3300053732 Ga0500656_002762 Ga0500656_002762_435_707 90
1916 3300053737 Ga0500601_006119 Ga0500601_006119_488_763 90
1917 3300053739 Ga0500587_086400 Ga0500587_086400_90_362 90
1918 3300054114 Ga0501084_0034045 Ga0501084_0034045_937_1212 90
1919 3300055283 Ga0500661_001073 Ga0500661_001073_1218_1493 90
1920 3300060353 Ga0501082_0000706 Ga0501082_0000706_4472_4747 90
1921 3300061734 Ga0530510_0284935 Ga0530510_0284935_718_993 90
1922 iso_pu_bacteria 2517093001 2517105905 90
1923 iso_pu_bacteria 2824753945 2824763284 90
1924 iso_pu_bacteria 2824763712 2824772414 90
1925 iso_pu_bacteria 2874590934 2874591113 90
1926 iso_pu_bacteria 2876771140 2876772046 90
1927 iso_pu_bacteria 2876818435 2876819297 90
1928 iso_pu_bacteria 2879074833 2879074963 90
1929 iso_pu_bacteria 2879083081 2879089877 90
1930 iso_pu_bacteria 2885366525 2885368698 90
1931 iso_pu_bacteria 2885409591 2885411200 90
1932 iso_pu_bacteria 2888378607 2888379132 90
1933 iso_pu_bacteria 2888419890 2888419893 90
1934 iso_pu_bacteria 2888419890 2888427530 90
1935 iso_pu_bacteria 2904711408 2904714161 90
1936 iso_pu_bacteria 2906643746 2906648056 90
1937 iso_pu_bacteria 2932801729 2932808852 90
1938 iso_pu_bacteria 2935608549 2935614660 90
1939 iso_pu_bacteria 2935648319 2935649050 90
1940 iso_pu_bacteria 2935656913 2935658178 90
1941 iso_pu_bacteria 2935819856 2935826299 90
1942 iso_pu_bacteria 2935847175 2935853795 90
1943 iso_pu_bacteria 2935883170 2935883277 90
1944 iso_pu_bacteria 2935908558 2935911016 90
1945 iso_pu_bacteria 2935916978 2935924177 90
1946 iso_pu_bacteria 2935926038 2935932770 90
1947 iso_pu_bacteria 2935934488 2935937333 90
1948 iso_pu_bacteria 2935942939 2935949466 90
1949 iso_pu_bacteria 2935951376 2935958135 90
1950 iso_pu_bacteria 2935967501 2935971210 90
1951 iso_pu_bacteria 2935975950 2935982195 90
1952 iso_pu_bacteria 2936011229 2936012397 90
1953 iso_pu_bacteria 2936019824 2936020522 90
1954 iso_pu_bacteria 2936028420 2936029690 90
1955 iso_pu_bacteria 2936046547 2936051845 90
1956 iso_pu_bacteria 2941531003 2941535691 90
1957 iso_pu_bacteria 3005718088 3005718658 90
1958 iso_pu_bacteria 8016530956 8016539435 90
1959 iso_pu_bacteria 8016539877 8016543724 90
1960 iso_pu_bacteria 8016613128 8016618787 90
1961 iso_pu_bacteria 8016630954 8016635239 90
1962 iso_pu_bacteria 8019629233 8019629752 90
1963 iso_pu_bacteria 8019638758 8019640864 90
1964 iso_pu_bacteria 8019668869 8019676334 90
1965 iso_pu_bacteria 8019687851 8019695803 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

5

64

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gho-assembly1.cif.gz_A crystal structure of spx in complex with yjbh 0.9291 4 37
4mje-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-r27l 0.9284 4 84
3qmx-assembly1.cif.gz_A x-ray crystal structure of synechocystis sp. pcc 6803 glutaredoxin a 0.9269 4 83
4mja-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-a75i 0.9258 4 83
4mjc-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a - p84r 0.9256 4 83
ID Description Score Start End Superfamily
4jedA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.96 4 33 3.40.30.10
af_A0A1D6KSR1_221_307_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9591 4 84 3.40.30.10
af_P0ACA1_1_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9429 5 33 3.40.30.10
af_A0A1D6GDU0_1_74_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.922 14 83 3.40.30.10
af_A0A1D6LVM4_243_327_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.921 4 84 3.40.30.10

Feature Viewer

pLDDT pTM Quality
94.32 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map