F496098

General Info

Members Datasets Scaffolds Average Seq Length
1936 538 1896 246

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10061999|Ga0207692_100619992
Length 285
Sequence MGMVKKARKCPPRFRILTPGFSIPSNIIMSTQNITSTNTHKLSGKVAIVTGASKGIGASIAKHLAAAGAAVVVNYSSSKEGADKVVADIXXXXGKAIAVQANVANKAEIERLFAESKEAFGQLDILVNNAGIYEIAPLGQITNEHFHRLFDLNVLGLILTTQEALNHFGPEGGSIINISSIVSASSPADQSVYNATKSAVDGLTRTFAKELGQRKIRVNSINPGPIETEGTHSTGFIDRFQTLIPTIPLGRIGQPQDIAPGVVFLASSDSEWMTGETLYVTGGLH

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2643221583 Caulobacter sp. Root655 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
7 2738541283 Pedobacter sp. OK701 Isolate Unclassified
8 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
9 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
10 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
11 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
12 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
13 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
14 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
15 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
16 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
17 2914759650 Rhizosphaericola mali Isolate Rhizosphere
18 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
19 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
20 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
21 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
22 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
23 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
24 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
25 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
26 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
27 2941471342 Luteibacter sp. 621 Isolate Unclassified
28 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
29 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
30 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
31 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
32 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
33 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
34 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
37 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
38 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
39 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
40 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
41 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
42 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
46 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
47 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
48 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
56 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
64 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
68 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
71 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
72 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
86 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
87 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
90 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
97 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
98 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
99 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
100 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
101 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
102 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
103 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
106 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
107 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
108 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
109 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
116 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
117 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
118 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
119 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
120 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
121 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
122 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
125 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
126 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
127 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
128 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
129 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
130 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
131 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
132 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
133 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
134 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
137 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
138 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
139 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
140 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
141 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
142 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
144 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
145 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
146 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
147 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
148 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
149 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
150 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
151 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
152 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
153 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
155 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
156 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
157 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
158 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
159 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
161 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
162 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
164 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
165 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
166 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
167 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
168 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
169 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
170 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
171 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
172 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
173 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
174 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
175 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
176 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
177 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
178 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
185 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
186 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
187 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
188 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
191 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
192 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
193 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
194 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
195 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
196 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
197 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
199 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
200 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
202 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
203 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
279 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
284 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
285 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
286 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
287 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
288 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
289 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
290 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
293 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
294 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
295 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
296 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
297 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
298 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
299 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
300 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
301 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
302 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
303 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
304 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
305 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
306 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
307 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
308 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
309 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
310 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
311 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
312 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
313 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
314 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
315 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
316 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
317 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
318 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
319 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
320 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
321 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
322 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
323 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
324 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
325 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
326 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
327 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
328 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
329 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
330 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
331 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
332 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
333 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
334 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
335 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
336 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
337 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
338 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
340 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
341 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
342 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
343 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
344 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
345 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
346 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
347 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
348 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
349 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
350 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
351 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
352 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
353 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
354 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
355 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
356 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
357 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
358 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
359 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
360 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
361 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
362 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
363 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
364 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
365 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
366 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
367 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
368 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
369 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
370 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
371 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
372 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
373 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
374 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
375 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
376 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
377 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
378 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
379 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
380 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
381 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
382 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
383 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
384 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
385 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
386 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
387 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
388 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
389 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
390 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
391 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
392 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
393 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
394 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
395 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
396 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
397 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
398 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
399 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
400 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
401 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
402 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
403 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
404 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
405 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
406 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
407 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
408 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
409 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
410 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
411 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
412 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
413 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
414 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
415 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
416 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
417 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
418 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
419 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
420 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
421 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
422 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
423 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
424 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
425 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
426 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
427 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
428 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
429 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
430 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
431 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
432 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
433 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
434 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
435 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
436 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
437 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
438 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
439 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
440 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
441 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
442 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
443 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
444 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
445 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
446 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
447 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
448 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
449 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
450 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
451 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
452 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
453 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
454 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
455 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
456 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
457 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
458 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
459 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
460 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
461 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
463 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
464 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
476 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
477 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
478 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
479 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
480 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
481 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
482 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
483 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
484 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
485 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
486 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
487 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
489 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
490 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
491 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
492 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
493 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
494 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
495 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
496 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
497 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
498 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
499 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
500 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
501 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
502 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
503 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
504 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
505 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
506 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
507 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
508 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
509 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
510 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
511 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
512 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
513 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
514 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
515 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
516 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
517 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
518 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
519 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
520 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
521 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
522 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
523 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
524 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
525 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
526 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
527 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
528 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
529 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
530 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
531 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
532 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
533 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
534 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
535 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
536 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
537 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
538 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 0.21
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.04
Nodule 0.36
Rhizoplane 4.55
Rhizosphere 84.97
Stem 0
Stem Tuber 0
Unclassified 4.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_594252 2162886006 Bacteria 1480
2 SwRhRL2b_contig_1167519 2162886007 Bacteria 1141
3 CNXas_1000634 3300000545 Bacteria 2292
4 JGI24740J21852_10004991 3300001979 Bacteria 5638
5 JGI24740J21852_10005842 3300001979 Bacteria 5161
6 JGI24739J22299_10015576 3300001989 Bacteria 2762
7 JGI24739J22299_10021139 3300001989 Bacteria 2319
8 JGI24735J21928_10000020 3300002067 Bacteria 108706
9 JGI24735J21928_10068841 3300002067 Bacteria 1015
10 JGI24035J26624_1013038 3300002126 Bacteria 841
11 JGI25162J39368_1000055 3300002737 Bacteria 147236
12 JGI25154J39366_1000008 3300002738 Bacteria 315375
13 JGI25154J39366_1000044 3300002738 Bacteria 136516
14 JGI25157J39369_1002913 3300002741 Bacteria 3801
15 JGI25157J39369_1003689 3300002741 Bacteria 3028
16 JGI25164J39214_1002336 3300002772 Unclassified 3007
17 JGI25165J46597_1001525 3300003214 Bacteria 11618
18 JGI25165J46597_1009608 3300003214 Bacteria 1447
19 JGI25153J46596_10001539 3300003215 Bacteria 13682
20 rootH2_10011305 3300003320 Bacteria 11968
21 rootH2_10037706 3300003320 Archaea 6285
22 rootH2_10044342 3300003320 Bacteria 10375
23 rootH2_10140174 3300003320 Bacteria 1219
24 rootL2_10014743 3300003322 Bacteria 2114
25 rootL2_10103814 3300003322 Bacteria 2616
26 rootL2_10175248 3300003322 Bacteria 3160
27 rootL2_10380150 3300003322 Bacteria 1547
28 rootH1_10000508 3300003323 Bacteria 29027
29 rootH1_10005847 3300003323 Bacteria 32644
30 rootH1_10056276 3300003323 Bacteria 17464
31 rootH1_10096655 3300003323 Bacteria 10857
32 rootH1_10209705 3300003323 Bacteria 2658
33 Ga0055535_1001727 3300003761 Bacteria 9814
34 Ga0055542_1002429 3300003762 Bacteria 6179
35 Ga0055526_1024774 3300003771 Bacteria 1949
36 Ga0055530_10006278 3300003791 Bacteria 5350
37 Ga0055531_10000189 3300003794 Bacteria 68668
38 Ga0065165_1001201 3300005262 Bacteria 29928
39 Ga0065165_1006211 3300005262 Bacteria 6368
40 Ga0065165_1045272 3300005262 Bacteria 1282
41 Ga0065714_10002586 3300005288 Bacteria 26138
42 Ga0065704_10000252 3300005289 Bacteria 51507
43 Ga0065704_10005884 3300005289 Bacteria 4466
44 Ga0065704_10007270 3300005289 Bacteria 3312
45 Ga0065704_10079873 3300005289 Bacteria 4059
46 Ga0065704_10195315 3300005289 Bacteria 1134
47 Ga0065712_10015861 3300005290 Bacteria 1722
48 Ga0065712_10078440 3300005290 Bacteria 3336
49 Ga0065712_10087055 3300005290 Unclassified 2600
50 Ga0065712_10115891 3300005290 Bacteria 1732
51 Ga0065715_10000833 3300005293 Bacteria 8165
52 Ga0065715_10011047 3300005293 Bacteria 4024
53 Ga0065715_10147683 3300005293 Unclassified 1768
54 Ga0065715_10194871 3300005293 Bacteria 1393
55 Ga0065707_10005509 3300005295 Bacteria 5146
56 Ga0065707_10182530 3300005295 Bacteria 1409
57 Ga0065707_10265725 3300005295 Bacteria 1085
58 Ga0070658_10003508 3300005327 Bacteria 12887
59 Ga0070658_10009602 3300005327 Bacteria 7766
60 Ga0070658_10014699 3300005327 Bacteria 6278
61 Ga0070658_10023827 3300005327 Unclassified 4909
62 Ga0070658_10127589 3300005327 Bacteria 2118
63 Ga0070676_10003745 3300005328 Bacteria 7971
64 Ga0070676_10005906 3300005328 Bacteria 6535
65 Ga0070676_10009622 3300005328 Bacteria 5224
66 Ga0070676_10010263 3300005328 Bacteria 5080
67 Ga0070676_10014088 3300005328 Bacteria 4389
68 Ga0070676_10065295 3300005328 Bacteria 2173
69 Ga0070676_10161914 3300005328 Unclassified 1441
70 Ga0070683_100030301 3300005329 Bacteria 4909
71 Ga0070683_100038652 3300005329 Bacteria 4375
72 Ga0070683_100251076 3300005329 Bacteria 1682
73 Ga0070683_100543508 3300005329 Bacteria 1111
74 Ga0070690_100002114 3300005330 Bacteria 10610
75 Ga0070670_100024906 3300005331 Bacteria 5148
76 Ga0070670_100165946 3300005331 Bacteria 1914
77 Ga0070670_100610015 3300005331 Bacteria 977
78 Ga0070677_10023374 3300005333 Bacteria 2288
79 Ga0068869_100002026 3300005334 Bacteria 12183
80 Ga0068869_100015189 3300005334 Bacteria 5159
81 Ga0068869_100030385 3300005334 Unclassified 3793
82 Ga0068869_100284018 3300005334 Bacteria 1332
83 Ga0068869_100338840 3300005334 Bacteria 1223
84 Ga0068869_100517359 3300005334 Bacteria 998
85 Ga0070666_10000227 3300005335 Bacteria 38376
86 Ga0070666_10002624 3300005335 Bacteria 10856
87 Ga0070666_10010872 3300005335 Bacteria 5702
88 Ga0070666_10027658 3300005335 Bacteria 3716
89 Ga0070666_10117514 3300005335 Bacteria 1842
90 Ga0070680_100015710 3300005336 Bacteria 5943
91 Ga0070680_100042412 3300005336 Bacteria 3692
92 Ga0070680_100218769 3300005336 Bacteria 1607
93 Ga0070682_100030349 3300005337 Bacteria 3262
94 Ga0070682_100030858 3300005337 Bacteria 3239
95 Ga0070682_100277017 3300005337 Bacteria 1221
96 Ga0068868_100005587 3300005338 Bacteria 8842
97 Ga0068868_100029206 3300005338 Bacteria 4222
98 Ga0068868_100031275 3300005338 Bacteria 4087
99 Ga0068868_100035641 3300005338 Unclassified 3847
100 Ga0068868_100077785 3300005338 Bacteria 2655
101 Ga0068868_100217797 3300005338 Bacteria 1597
102 Ga0070660_100019730 3300005339 Bacteria 4944
103 Ga0070660_100142216 3300005339 Bacteria 1925
104 Ga0070660_100142614 3300005339 Bacteria 1923
105 Ga0070660_100356774 3300005339 Bacteria 1204
106 Ga0070660_100585485 3300005339 Bacteria 932
107 Ga0070689_100255780 3300005340 Unclassified 1446
108 Ga0070661_100000247 3300005344 Bacteria 44372
109 Ga0070661_100065765 3300005344 Unclassified 2664
110 Ga0070661_100137095 3300005344 Bacteria 1842
111 Ga0070661_100242612 3300005344 Bacteria 1388
112 Ga0070692_10102739 3300005345 Bacteria 1569
113 Ga0070692_10322040 3300005345 Bacteria 951
114 Ga0070668_100005473 3300005347 Bacteria 9427
115 Ga0070668_100015720 3300005347 Bacteria 5661
116 Ga0070668_100016166 3300005347 Bacteria 5583
117 Ga0070668_100053794 3300005347 Bacteria 3104
118 Ga0070668_100383644 3300005347 Bacteria 1196
119 Ga0070668_100469492 3300005347 Unclassified 1085
120 Ga0070668_100561798 3300005347 Bacteria 994
121 Ga0070668_100809750 3300005347 Bacteria 833
122 Ga0070669_100009291 3300005353 Bacteria 7000
123 Ga0070669_100028186 3300005353 Bacteria 4043
124 Ga0070669_100043379 3300005353 Bacteria 3276
125 Ga0070669_100081084 3300005353 Bacteria 2416
126 Ga0070669_100083335 3300005353 Bacteria 2384
127 Ga0070669_100269148 3300005353 Unclassified 1362
128 Ga0070675_100010994 3300005354 Bacteria 7087
129 Ga0070675_100049260 3300005354 Bacteria 3457
130 Ga0070675_100094083 3300005354 Bacteria 2514
131 Ga0070675_100221586 3300005354 Viruses 1647
132 Ga0070675_100541491 3300005354 Bacteria 1052
133 Ga0070675_100590334 3300005354 Bacteria 1007
134 Ga0070671_100011236 3300005355 Bacteria 7192
135 Ga0070671_100017645 3300005355 Bacteria 5784
136 Ga0070671_100033111 3300005355 Bacteria 4273
137 Ga0070671_100079001 3300005355 Bacteria 2750
138 Ga0070671_100153809 3300005355 Bacteria 1943
139 Ga0070671_100443511 3300005355 Unclassified 1113
140 Ga0070671_100486301 3300005355 Bacteria 1061
141 Ga0070674_100008195 3300005356 Bacteria 6205
142 Ga0070674_100019247 3300005356 Bacteria 4334
143 Ga0070674_100051526 3300005356 Bacteria 2837
144 Ga0070674_100108310 3300005356 Bacteria 2036
145 Ga0070674_100579503 3300005356 Bacteria 945
146 Ga0070673_100058915 3300005364 Bacteria 3038
147 Ga0070673_100070859 3300005364 Bacteria 2799
148 Ga0070688_100153159 3300005365 Unclassified 1577
149 Ga0070688_100574907 3300005365 Unclassified 859
150 Ga0070659_100010031 3300005366 Bacteria 6971
151 Ga0070659_100011268 3300005366 Bacteria 6606
152 Ga0070659_100021695 3300005366 Bacteria 4897
153 Ga0070659_100047801 3300005366 Bacteria 3359
154 Ga0070659_100146114 3300005366 Bacteria 1926
155 Ga0070667_100007324 3300005367 Bacteria 9170
156 Ga0070667_100025068 3300005367 Bacteria 4958
157 Ga0070667_100075388 3300005367 Unclassified 2880
158 Ga0070667_100172428 3300005367 Bacteria 1910
159 Ga0070667_100178478 3300005367 Bacteria 1877
160 Ga0070667_100211702 3300005367 Unclassified 1723
161 Ga0070667_100259528 3300005367 Bacteria 1555
162 Ga0070667_100261214 3300005367 Bacteria 1550
163 Ga0070667_100269328 3300005367 Bacteria 1527
164 Ga0070709_10011492 3300005434 Bacteria 4938
165 Ga0070709_10018964 3300005434 Bacteria 3970
166 Ga0070709_10036884 3300005434 Bacteria 2982
167 Ga0070709_10186006 3300005434 Bacteria 1462
168 Ga0070709_10209651 3300005434 Bacteria 1384
169 Ga0070709_10553072 3300005434 Bacteria 881
170 Ga0070714_100006646 3300005435 Bacteria 8949
171 Ga0070714_100050767 3300005435 Bacteria 3535
172 Ga0070714_100062325 3300005435 Bacteria 3205
173 Ga0070714_100110247 3300005435 Unclassified 2436
174 Ga0070714_100253080 3300005435 Bacteria 1629
175 Ga0070714_100272064 3300005435 Bacteria 1571
176 Ga0070714_100820863 3300005435 Bacteria 901
177 Ga0070714_100993542 3300005435 Bacteria 816
178 Ga0070713_100013655 3300005436 Bacteria 6003
179 Ga0070713_100022470 3300005436 Bacteria 4876
180 Ga0070713_100057867 3300005436 Bacteria 3230
181 Ga0070713_100071421 3300005436 Bacteria 2933
182 Ga0070713_100075165 3300005436 Bacteria 2865
183 Ga0070713_100111263 3300005436 Bacteria 2388
184 Ga0070713_100371393 3300005436 Bacteria 1331
185 Ga0070713_100375562 3300005436 Bacteria 1323
186 Ga0070710_10113403 3300005437 Bacteria 1631
187 Ga0070710_10230748 3300005437 Bacteria 1182
188 Ga0070710_10286440 3300005437 Bacteria 1071
189 Ga0070711_100008600 3300005439 Bacteria 6260
190 Ga0070711_100172012 3300005439 Bacteria 1652
191 Ga0070711_100177761 3300005439 Bacteria 1627
192 Ga0070711_100210818 3300005439 Bacteria 1504
193 Ga0070711_100257919 3300005439 Bacteria 1370
194 Ga0070711_100366625 3300005439 Bacteria 1161
195 Ga0070711_100399312 3300005439 Bacteria 1116
196 Ga0070711_100417994 3300005439 Bacteria 1092
197 Ga0070711_100429938 3300005439 Bacteria 1077
198 Ga0070711_100470542 3300005439 Unclassified 1031
199 Ga0070705_100087329 3300005440 Bacteria 1933
200 Ga0070700_100132463 3300005441 Bacteria 1684
201 Ga0070700_100134242 3300005441 Bacteria 1674
202 Ga0070700_100171379 3300005441 Bacteria 1503
203 Ga0070700_100201380 3300005441 Bacteria 1399
204 Ga0070694_100170958 3300005444 Bacteria 1601
205 Ga0070694_100258936 3300005444 Bacteria 1319
206 Ga0070694_100347366 3300005444 Bacteria 1148
207 Ga0070694_100524219 3300005444 Bacteria 946
208 Ga0070708_100007408 3300005445 Bacteria 8780
209 Ga0070708_100034939 3300005445 Bacteria 4377
210 Ga0070708_100107555 3300005445 Unclassified 2560
211 Ga0070708_100152747 3300005445 Bacteria 2148
212 Ga0070708_100213318 3300005445 Bacteria 1809
213 Ga0070708_100235214 3300005445 Bacteria 1719
214 Ga0070708_100318265 3300005445 Bacteria 1465
215 Ga0070708_100352369 3300005445 Bacteria 1387
216 Ga0070708_100358321 3300005445 Bacteria 1375
217 Ga0070708_100412077 3300005445 Bacteria 1274
218 Ga0070708_100573089 3300005445 Bacteria 1064
219 Ga0070708_100711501 3300005445 Bacteria 945
220 Ga0070663_100076702 3300005455 Bacteria 2445
221 Ga0070663_100191091 3300005455 Bacteria 1593
222 Ga0070678_100003501 3300005456 Bacteria 8752
223 Ga0070678_100121952 3300005456 Bacteria 2057
224 Ga0070678_100133195 3300005456 Bacteria 1978
225 Ga0070678_100211814 3300005456 Archaea 1606
226 Ga0070678_100594439 3300005456 Bacteria 987
227 Ga0070662_100013141 3300005457 Bacteria 5502
228 Ga0070662_100045091 3300005457 Bacteria 3162
229 Ga0070662_100143947 3300005457 Bacteria 1850
230 Ga0070662_100233829 3300005457 Bacteria 1471
231 Ga0070681_10164729 3300005458 Bacteria 2140
232 Ga0070681_10210569 3300005458 Bacteria 1860
233 Ga0070681_10452918 3300005458 Bacteria 1195
234 Ga0068867_100040700 3300005459 Bacteria 3394
235 Ga0068867_100055382 3300005459 Bacteria 2932
236 Ga0068867_100109262 3300005459 Unclassified 2122
237 Ga0068867_100803296 3300005459 Bacteria 839
238 Ga0070685_10007257 3300005466 Bacteria 5666
239 Ga0070685_10014417 3300005466 Bacteria 4185
240 Ga0070685_10022127 3300005466 Unclassified 3462
241 Ga0070706_100000380 3300005467 Bacteria 53196
242 Ga0070706_100003785 3300005467 Bacteria 14769
243 Ga0070706_100010077 3300005467 Bacteria 8781
244 Ga0070706_100043281 3300005467 Bacteria 4161
245 Ga0070706_100047830 3300005467 Bacteria 3948
246 Ga0070706_100049239 3300005467 Bacteria 3889
247 Ga0070706_100052666 3300005467 Unclassified 3756
248 Ga0070706_100056553 3300005467 Bacteria 3620
249 Ga0070706_100102346 3300005467 Bacteria 2663
250 Ga0070706_100134661 3300005467 Bacteria 2306
251 Ga0070706_100141608 3300005467 Unclassified 2245
252 Ga0070706_100177270 3300005467 Bacteria 1990
253 Ga0070706_100199842 3300005467 Bacteria 1867
254 Ga0070706_100216541 3300005467 Bacteria 1788
255 Ga0070706_100262307 3300005467 Bacteria 1612
256 Ga0070706_100366219 3300005467 Bacteria 1343
257 Ga0070706_100412957 3300005467 Bacteria 1256
258 Ga0070706_100494185 3300005467 Bacteria 1139
259 Ga0070707_100000335 3300005468 Bacteria 46110
260 Ga0070707_100003103 3300005468 Bacteria 15730
261 Ga0070707_100021000 3300005468 Bacteria 6166
262 Ga0070707_100065557 3300005468 Bacteria 3489
263 Ga0070707_100081499 3300005468 Bacteria 3124
264 Ga0070707_100084002 3300005468 Bacteria 3076
265 Ga0070707_100134558 3300005468 Bacteria 2404
266 Ga0070707_100163615 3300005468 Bacteria 2168
267 Ga0070707_100181526 3300005468 Bacteria 2051
268 Ga0070707_100221720 3300005468 Bacteria 1841
269 Ga0070707_100490709 3300005468 Bacteria 1190
270 Ga0070698_100007734 3300005471 Bacteria 11628
271 Ga0070698_100010723 3300005471 Bacteria 9757
272 Ga0070698_100026358 3300005471 Bacteria 6050
273 Ga0070698_100036143 3300005471 Bacteria 5106
274 Ga0070698_100049971 3300005471 Bacteria 4266
275 Ga0070698_100122006 3300005471 Bacteria 2565
276 Ga0070698_100187601 3300005471 Bacteria 2005
277 Ga0070698_100250348 3300005471 Bacteria 1704
278 Ga0070698_100303759 3300005471 Bacteria 1526
279 Ga0070699_100000016 3300005518 Bacteria 206838
280 Ga0070699_100000081 3300005518 Bacteria 92126
281 Ga0070699_100035456 3300005518 Bacteria 4312
282 Ga0070699_100041592 3300005518 Bacteria 3978
283 Ga0070699_100152133 3300005518 Bacteria 2047
284 Ga0070699_100212182 3300005518 Bacteria 1724
285 Ga0070699_100245318 3300005518 Bacteria 1600
286 Ga0070699_100394175 3300005518 Bacteria 1251
287 Ga0070699_100482206 3300005518 Bacteria 1125
288 Ga0070679_100089011 3300005530 Bacteria 3074
289 Ga0070679_100126080 3300005530 Bacteria 2542
290 Ga0070679_100133018 3300005530 Bacteria 2468
291 Ga0070679_100134821 3300005530 Bacteria 2450
292 Ga0070679_100314635 3300005530 Bacteria 1515
293 Ga0070684_100316807 3300005535 Bacteria 1432
294 Ga0070697_100000252 3300005536 Bacteria 43292
295 Ga0070697_100007271 3300005536 Bacteria 8612
296 Ga0070697_100040764 3300005536 Bacteria 3757
297 Ga0070697_100098651 3300005536 Bacteria 2424
298 Ga0070697_100100320 3300005536 Bacteria 2404
299 Ga0070697_100101722 3300005536 Bacteria 2387
300 Ga0070697_100121460 3300005536 Bacteria 2185
301 Ga0070697_100127563 3300005536 Bacteria 2131
302 Ga0070697_100234294 3300005536 Bacteria 1566
303 Ga0070697_100269229 3300005536 Bacteria 1460
304 Ga0070697_100283579 3300005536 Bacteria 1421
305 Ga0070697_100297742 3300005536 Bacteria 1386
306 Ga0070697_100455655 3300005536 Bacteria 1115
307 Ga0070697_100479329 3300005536 Bacteria 1086
308 Ga0070697_100582450 3300005536 Bacteria 983
309 Ga0068853_100028133 3300005539 Bacteria 4727
310 Ga0068853_100035441 3300005539 Bacteria 4238
311 Ga0068853_100059711 3300005539 Bacteria 3295
312 Ga0068853_100096031 3300005539 Bacteria 2615
313 Ga0068853_100255950 3300005539 Bacteria 1608
314 Ga0068853_100375875 3300005539 Bacteria 1326
315 Ga0068853_100978456 3300005539 Bacteria 814
316 Ga0070672_100076750 3300005543 Bacteria 2670
317 Ga0070672_100183965 3300005543 Bacteria 1742
318 Ga0070672_100687565 3300005543 Bacteria 895
319 Ga0070686_100037633 3300005544 Bacteria 3002
320 Ga0070686_100062590 3300005544 Unclassified 2408
321 Ga0070686_100140871 3300005544 Bacteria 1679
322 Ga0070686_100173903 3300005544 Bacteria 1525
323 Ga0070695_100021165 3300005545 Bacteria 3976
324 Ga0070695_100312646 3300005545 Unclassified 1165
325 Ga0070696_100195875 3300005546 Bacteria 1506
326 Ga0070696_100345529 3300005546 Bacteria 1151
327 Ga0070693_100029869 3300005547 Bacteria 2976
328 Ga0070693_100038541 3300005547 Bacteria 2671
329 Ga0070693_100079752 3300005547 Bacteria 1949
330 Ga0070693_100109582 3300005547 Bacteria 1696
331 Ga0070693_100115109 3300005547 Unclassified 1660
332 Ga0070693_100229325 3300005547 Bacteria 1221
333 Ga0070665_100110880 3300005548 Bacteria 2746
334 Ga0070665_100244771 3300005548 Bacteria 1794
335 Ga0070665_100386477 3300005548 Bacteria 1407
336 Ga0070665_100451264 3300005548 Bacteria 1295
337 Ga0070704_100008813 3300005549 Bacteria 6070
338 Ga0070704_100086630 3300005549 Bacteria 2322
339 Ga0070704_100199408 3300005549 Bacteria 1614
340 Ga0070704_100207639 3300005549 Bacteria 1585
341 Ga0070704_100230094 3300005549 Bacteria 1512
342 Ga0070704_100759015 3300005549 Bacteria 864
343 Ga0068855_100000982 3300005563 Bacteria 35526
344 Ga0068855_100001481 3300005563 Bacteria 29367
345 Ga0068855_100003069 3300005563 Bacteria 20428
346 Ga0068855_100004117 3300005563 Bacteria 17725
347 Ga0068855_100071970 3300005563 Bacteria 4019
348 Ga0068855_100073694 3300005563 Bacteria 3966
349 Ga0068855_100142587 3300005563 Bacteria 2729
350 Ga0068855_100149138 3300005563 Unclassified 2660
351 Ga0068855_100163438 3300005563 Bacteria 2525
352 Ga0068855_100177752 3300005563 Bacteria 2407
353 Ga0068855_100434033 3300005563 Bacteria 1435
354 Ga0068855_100505886 3300005563 Bacteria 1312
355 Ga0068855_101041134 3300005563 Bacteria 858
356 Ga0070664_100041394 3300005564 Bacteria 3887
357 Ga0070664_100065111 3300005564 Bacteria 3109
358 Ga0070664_100143351 3300005564 Bacteria 2105
359 Ga0070664_100173995 3300005564 Bacteria 1911
360 Ga0068857_100007043 3300005577 Bacteria 9681
361 Ga0068857_100044996 3300005577 Bacteria 3915
362 Ga0068857_100059990 3300005577 Bacteria 3380
363 Ga0068857_100188875 3300005577 Unclassified 1876
364 Ga0068857_100240449 3300005577 Bacteria 1657
365 Ga0068857_100487763 3300005577 Bacteria 1155
366 Ga0068854_100000042 3300005578 Bacteria 93095
367 Ga0068854_100056154 3300005578 Bacteria 2837
368 Ga0068854_100226516 3300005578 Archaea 1482
369 Ga0068854_100563648 3300005578 Unclassified 968
370 Ga0068856_100113872 3300005614 Bacteria 2704
371 Ga0068856_100153658 3300005614 Bacteria 2311
372 Ga0068856_100220137 3300005614 Unclassified 1914
373 Ga0070702_100037631 3300005615 Unclassified 2688
374 Ga0070702_100105824 3300005615 Bacteria 1734
375 Ga0070702_100452103 3300005615 Bacteria 932
376 Ga0068852_100057378 3300005616 Bacteria 3369
377 Ga0068852_100092321 3300005616 Bacteria 2711
378 Ga0068852_100263141 3300005616 Bacteria 1657
379 Ga0068852_100281736 3300005616 Bacteria 1603
380 Ga0068852_100331533 3300005616 Viruses 1481
381 Ga0068852_100524690 3300005616 Bacteria 1182
382 Ga0068852_100620363 3300005616 Unclassified 1087
383 Ga0068852_100629214 3300005616 Unclassified 1079
384 Ga0068859_100000025 3300005617 Bacteria 191679
385 Ga0068859_100000208 3300005617 Bacteria 58155
386 Ga0068859_100048359 3300005617 Bacteria 4273
387 Ga0068859_100157980 3300005617 Unclassified 2346
388 Ga0068859_100512565 3300005617 Bacteria 1294
389 Ga0068859_100572158 3300005617 Unclassified 1224
390 Ga0068864_100023718 3300005618 Bacteria 5154
391 Ga0068864_100025453 3300005618 Unclassified 4983
392 Ga0068864_100078641 3300005618 Bacteria 2887
393 Ga0068866_10008266 3300005718 Bacteria 4378
394 Ga0068866_10049965 3300005718 Bacteria 2122
395 Ga0068866_10077209 3300005718 Unclassified 1778
396 Ga0068866_10124084 3300005718 Bacteria 1459
397 Ga0068861_100036613 3300005719 Unclassified 3644
398 Ga0068861_100037038 3300005719 Bacteria 3625
399 Ga0068851_10223188 3300005834 Bacteria 1060
400 Ga0068870_10090861 3300005840 Bacteria 1707
401 Ga0068863_100002521 3300005841 Bacteria 18175
402 Ga0068863_100012988 3300005841 Bacteria 8030
403 Ga0068863_100030187 3300005841 Bacteria 5178
404 Ga0068863_100048980 3300005841 Unclassified 4007
405 Ga0068863_100488647 3300005841 Bacteria 1211
406 Ga0068863_100815462 3300005841 Bacteria 931
407 Ga0068858_100014256 3300005842 Bacteria 7493
408 Ga0068858_100029020 3300005842 Bacteria 5137
409 Ga0068858_100065122 3300005842 Bacteria 3372
410 Ga0068858_100115195 3300005842 Bacteria 2511
411 Ga0068858_100238208 3300005842 Bacteria 1726
412 Ga0068858_100279002 3300005842 Bacteria 1591
413 Ga0068858_100339095 3300005842 Bacteria 1438
414 Ga0068858_100452040 3300005842 Unclassified 1238
415 Ga0068858_100488973 3300005842 Bacteria 1188
416 Ga0068858_100636916 3300005842 Bacteria 1036
417 Ga0068860_100001782 3300005843 Bacteria 22920
418 Ga0068860_100013670 3300005843 Bacteria 7957
419 Ga0068860_100015605 3300005843 Bacteria 7418
420 Ga0068860_100063516 3300005843 Bacteria 3507
421 Ga0068860_100064419 3300005843 Bacteria 3481
422 Ga0068860_100086795 3300005843 Bacteria 2978
423 Ga0068860_100102326 3300005843 Bacteria 2733
424 Ga0068860_100153793 3300005843 Bacteria 2216
425 Ga0068860_100206859 3300005843 Unclassified 1903
426 Ga0068862_100000404 3300005844 Bacteria 46607
427 Ga0068862_100704314 3300005844 Bacteria 979
428 Ga0081455_10322309 3300005937 Bacteria 1100
429 Ga0081538_10026558 3300005981 Bacteria 4045
430 Ga0081540_1001169 3300005983 Bacteria 23052
431 Ga0081540_1009888 3300005983 Bacteria 6514
432 Ga0081540_1013318 3300005983 Bacteria 5353
433 Ga0081540_1059959 3300005983 Bacteria 1823
434 Ga0081539_10007502 3300005985 Bacteria 9908
435 Ga0070717_10038829 3300006028 Bacteria 3871
436 Ga0070717_10050436 3300006028 Bacteria 3420
437 Ga0070717_10063866 3300006028 Bacteria 3057
438 Ga0070717_10099917 3300006028 Bacteria 2462
439 Ga0070717_10101786 3300006028 Bacteria 2440
440 Ga0070717_10200761 3300006028 Bacteria 1747
441 Ga0070717_10342410 3300006028 Bacteria 1335
442 Ga0070717_10417289 3300006028 Bacteria 1207
443 Ga0075363_100073380 3300006048 Bacteria 1862
444 Ga0075364_10179029 3300006051 Bacteria 1434
445 Ga0070715_10000099 3300006163 Bacteria 21464
446 Ga0070715_10087480 3300006163 Bacteria 1427
447 Ga0070715_10153476 3300006163 Bacteria 1131
448 Ga0070715_10168508 3300006163 Bacteria 1088
449 Ga0070715_10293758 3300006163 Bacteria 866
450 Ga0070716_100055914 3300006173 Bacteria 2260
451 Ga0070716_100089233 3300006173 Bacteria 1862
452 Ga0070716_100143688 3300006173 Bacteria 1525
453 Ga0070716_100229832 3300006173 Bacteria 1251
454 Ga0070716_100265407 3300006173 Bacteria 1177
455 Ga0070716_100351347 3300006173 Unclassified 1044
456 Ga0070712_100003626 3300006175 Bacteria 9522
457 Ga0070712_100104111 3300006175 Bacteria 2105
458 Ga0070712_100166475 3300006175 Bacteria 1707
459 Ga0070712_100166686 3300006175 Bacteria 1706
460 Ga0070712_100190589 3300006175 Bacteria 1604
461 Ga0070712_100199206 3300006175 Bacteria 1572
462 Ga0070712_100215143 3300006175 Bacteria 1518
463 Ga0070712_100341253 3300006175 Bacteria 1223
464 Ga0070712_100410041 3300006175 Bacteria 1121
465 Ga0070712_100543175 3300006175 Bacteria 978
466 Ga0070712_100770036 3300006175 Bacteria 824
467 Ga0075362_10088742 3300006177 Bacteria 1433
468 Ga0075367_10120258 3300006178 Bacteria 1618
469 Ga0075366_10000275 3300006195 Bacteria 22900
470 Ga0075366_10011506 3300006195 Bacteria 4997
471 Ga0075366_10036816 3300006195 Bacteria 2885
472 Ga0097621_100002700 3300006237 Bacteria 12139
473 Ga0097621_100011575 3300006237 Bacteria 6502
474 Ga0097621_100047933 3300006237 Unclassified 3464
475 Ga0097621_100057906 3300006237 Bacteria 3171
476 Ga0097621_100065377 3300006237 Bacteria 2993
477 Ga0097621_100066713 3300006237 Bacteria 2964
478 Ga0097621_100131999 3300006237 Bacteria 2127
479 Ga0097621_100154495 3300006237 Bacteria 1969
480 Ga0097621_100304925 3300006237 Archaea 1407
481 Ga0097621_100305393 3300006237 Unclassified 1406
482 Ga0097621_100356933 3300006237 Unclassified 1301
483 Ga0097621_100412046 3300006237 Bacteria 1212
484 Ga0097621_100656287 3300006237 Bacteria 963
485 Ga0075370_10014841 3300006353 Bacteria 4161
486 Ga0068871_100001480 3300006358 Bacteria 15743
487 Ga0068871_100026828 3300006358 Bacteria 4499
488 Ga0068871_100029182 3300006358 Bacteria 4331
489 Ga0068871_100050501 3300006358 Unclassified 3364
490 Ga0068871_100093596 3300006358 Unclassified 2507
491 Ga0068871_100095800 3300006358 Bacteria 2479
492 Ga0068871_100124553 3300006358 Bacteria 2180
493 Ga0068871_100193049 3300006358 Bacteria 1755
494 Ga0068871_100299793 3300006358 Bacteria 1410
495 Ga0075428_100028555 3300006844 Bacteria 6171
496 Ga0075428_100038091 3300006844 Bacteria 5292
497 Ga0075428_100091878 3300006844 Bacteria 3309
498 Ga0075428_100096731 3300006844 Bacteria 3218
499 Ga0075428_100149286 3300006844 Bacteria 2539
500 Ga0075428_100208738 3300006844 Bacteria 2111
501 Ga0075428_100244670 3300006844 Bacteria 1935
502 Ga0075428_100291296 3300006844 Bacteria 1756
503 Ga0075428_100299543 3300006844 Bacteria 1729
504 Ga0075428_100373634 3300006844 Bacteria 1528
505 Ga0075428_100748057 3300006844 Bacteria 1040
506 Ga0075428_100972974 3300006844 Bacteria 899
507 Ga0075430_100088860 3300006846 Bacteria 2585
508 Ga0075430_100346398 3300006846 Bacteria 1227
509 Ga0075430_100359096 3300006846 Bacteria 1203
510 Ga0075431_100076353 3300006847 Bacteria 3457
511 Ga0075431_100108798 3300006847 Bacteria 2860
512 Ga0075431_100317799 3300006847 Bacteria 1571
513 Ga0075433_10006176 3300006852 Bacteria 9449
514 Ga0075433_10055348 3300006852 Bacteria 3462
515 Ga0075433_10094826 3300006852 Bacteria 2641
516 Ga0075433_10161145 3300006852 Bacteria 1997
517 Ga0075433_10162474 3300006852 Bacteria 1988
518 Ga0075433_10196485 3300006852 Bacteria 1794
519 Ga0075433_10313570 3300006852 Bacteria 1388
520 Ga0075434_100015501 3300006871 Bacteria 7311
521 Ga0075434_100047848 3300006871 Bacteria 4243
522 Ga0075434_100088675 3300006871 Bacteria 3095
523 Ga0075434_100122092 3300006871 Bacteria 2621
524 Ga0075434_100254204 3300006871 Bacteria 1776
525 Ga0075434_100293908 3300006871 Bacteria 1644
526 Ga0075434_100363425 3300006871 Bacteria 1468
527 Ga0075434_100448641 3300006871 Bacteria 1311
528 Ga0075434_100456149 3300006871 Bacteria 1299
529 Ga0075434_100494735 3300006871 Bacteria 1244
530 Ga0075434_100830442 3300006871 Bacteria 940
531 Ga0075429_100123886 3300006880 Bacteria 2260
532 Ga0075429_100393429 3300006880 Bacteria 1213
533 Ga0068865_100058986 3300006881 Bacteria 2683
534 Ga0068865_100095460 3300006881 Bacteria 2166
535 Ga0068865_100121396 3300006881 Bacteria 1944
536 Ga0068865_100197928 3300006881 Unclassified 1558
537 Ga0068865_100330052 3300006881 Bacteria 1230
538 Ga0068865_100412591 3300006881 Bacteria 1108
539 Ga0075436_100000737 3300006914 Bacteria 21698
540 Ga0075436_100003057 3300006914 Bacteria 11459
541 Ga0075436_100135679 3300006914 Bacteria 1728
542 Ga0075436_100161610 3300006914 Bacteria 1579
543 Ga0097620_100000025 3300006931 Bacteria 191679
544 Ga0097620_100000208 3300006931 Bacteria 58155
545 Ga0097620_100048359 3300006931 Bacteria 4273
546 Ga0097620_100157981 3300006931 Unclassified 2346
547 Ga0097620_100512577 3300006931 Bacteria 1294
548 Ga0097620_100572156 3300006931 Unclassified 1224
549 Ga0075435_100078789 3300007076 Bacteria 2703
550 Ga0075435_100302347 3300007076 Unclassified 1368
551 Ga0075435_100837133 3300007076 Bacteria 801
552 Ga0099795_10056102 3300007788 Bacteria 1448
553 Ga0105244_10098353 3300009036 Bacteria 1433
554 Ga0105250_10199714 3300009092 Bacteria 843
555 Ga0105240_10000039 3300009093 Bacteria 270117
556 Ga0105240_10000576 3300009093 Bacteria 68032
557 Ga0105240_10001685 3300009093 Bacteria 37448
558 Ga0105240_10001714 3300009093 Bacteria 37013
559 Ga0105240_10006298 3300009093 Bacteria 17466
560 Ga0105240_10007231 3300009093 Bacteria 16160
561 Ga0105240_10007855 3300009093 Bacteria 15393
562 Ga0105240_10012336 3300009093 Bacteria 11803
563 Ga0105240_10013125 3300009093 Bacteria 11399
564 Ga0105240_10018484 3300009093 Bacteria 9356
565 Ga0105240_10021607 3300009093 Bacteria 8559
566 Ga0105240_10024223 3300009093 Bacteria 8009
567 Ga0105240_10025526 3300009093 Bacteria 7763
568 Ga0105240_10053556 3300009093 Bacteria 5064
569 Ga0105240_10109476 3300009093 Bacteria 3345
570 Ga0105240_10263333 3300009093 Unclassified 1988
571 Ga0105240_10279159 3300009093 Bacteria 1920
572 Ga0105240_10447402 3300009093 Unclassified 1446
573 Ga0105240_10588786 3300009093 Bacteria 1226
574 Ga0111539_10009211 3300009094 Bacteria 12478
575 Ga0111539_10026194 3300009094 Bacteria 7135
576 Ga0111539_10164624 3300009094 Bacteria 2593
577 Ga0111539_10165920 3300009094 Bacteria 2582
578 Ga0111539_10350803 3300009094 Bacteria 1717
579 Ga0111539_10420800 3300009094 Bacteria 1556
580 Ga0105245_10008717 3300009098 Bacteria 8843
581 Ga0105245_10031925 3300009098 Bacteria 4662
582 Ga0105245_10087081 3300009098 Bacteria 2866
583 Ga0105245_10087640 3300009098 Bacteria 2857
584 Ga0105245_10104451 3300009098 Bacteria 2627
585 Ga0105245_10185869 3300009098 Bacteria 1988
586 Ga0105245_10196458 3300009098 Bacteria 1935
587 Ga0105245_10319633 3300009098 Bacteria 1529
588 Ga0105245_10319830 3300009098 Unclassified 1528
589 Ga0105247_10031084 3300009101 Unclassified 3239
590 Ga0105247_10039932 3300009101 Bacteria 2868
591 Ga0105247_10056991 3300009101 Bacteria 2415
592 Ga0105247_10084731 3300009101 Bacteria 2003
593 Ga0105247_10131122 3300009101 Unclassified 1634
594 Ga0114129_10004405 3300009147 Bacteria 19861
595 Ga0114129_10007513 3300009147 Bacteria 15525
596 Ga0114129_10009005 3300009147 Bacteria 14235
597 Ga0114129_10034146 3300009147 Bacteria 7184
598 Ga0114129_10115725 3300009147 Bacteria 3695
599 Ga0114129_10116170 3300009147 Bacteria 3687
600 Ga0114129_10130169 3300009147 Bacteria 3457
601 Ga0114129_10302434 3300009147 Bacteria 2131
602 Ga0114129_10339647 3300009147 Bacteria 1992
603 Ga0114129_10380804 3300009147 Bacteria 1863
604 Ga0114129_10520608 3300009147 Bacteria 1551
605 Ga0114129_11092915 3300009147 Bacteria 999
606 Ga0114129_11111206 3300009147 Bacteria 989
607 Ga0105243_10003268 3300009148 Bacteria 13199
608 Ga0105243_10022464 3300009148 Bacteria 4795
609 Ga0105243_10428058 3300009148 Bacteria 1236
610 Ga0105243_10448560 3300009148 Bacteria 1210
611 Ga0105241_10002757 3300009174 Bacteria 13163
612 Ga0105241_10006768 3300009174 Bacteria 8433
613 Ga0105241_10030734 3300009174 Bacteria 4017
614 Ga0105241_10030744 3300009174 Bacteria 4016
615 Ga0105241_10041817 3300009174 Bacteria 3464
616 Ga0105241_10049211 3300009174 Bacteria 3209
617 Ga0105241_10084671 3300009174 Bacteria 2490
618 Ga0105241_10109053 3300009174 Bacteria 2214
619 Ga0105241_10198702 3300009174 Bacteria 1673
620 Ga0105241_10220904 3300009174 Bacteria 1592
621 Ga0105241_10230748 3300009174 Bacteria 1560
622 Ga0105241_10277315 3300009174 Bacteria 1430
623 Ga0105241_10758463 3300009174 Bacteria 890
624 Ga0105242_10007558 3300009176 Bacteria 8366
625 Ga0105242_10015518 3300009176 Bacteria 5917
626 Ga0105242_10026577 3300009176 Bacteria 4588
627 Ga0105242_10031668 3300009176 Bacteria 4227
628 Ga0105242_10036873 3300009176 Bacteria 3925
629 Ga0105242_10073254 3300009176 Bacteria 2847
630 Ga0105242_10086226 3300009176 Bacteria 2634
631 Ga0105242_10247377 3300009176 Bacteria 1605
632 Ga0105242_10258969 3300009176 Bacteria 1571
633 Ga0105242_10262883 3300009176 Bacteria 1560
634 Ga0105242_10392210 3300009176 Bacteria 1293
635 Ga0105248_10005758 3300009177 Bacteria 13613
636 Ga0105248_10009429 3300009177 Bacteria 10748
637 Ga0105248_10031676 3300009177 Bacteria 5907
638 Ga0105248_10171116 3300009177 Bacteria 2448
639 Ga0105248_10278280 3300009177 Bacteria 1884
640 Ga0105248_10349312 3300009177 Bacteria 1665
641 Ga0105248_10518471 3300009177 Unclassified 1344
642 Ga0105248_10679859 3300009177 Bacteria 1161
643 Ga0105237_10000462 3300009545 Bacteria 57603
644 Ga0105237_10000833 3300009545 Bacteria 42120
645 Ga0105237_10001758 3300009545 Bacteria 28022
646 Ga0105237_10001824 3300009545 Bacteria 27466
647 Ga0105237_10002198 3300009545 Bacteria 24432
648 Ga0105237_10004275 3300009545 Bacteria 16584
649 Ga0105237_10005576 3300009545 Bacteria 14197
650 Ga0105237_10006605 3300009545 Bacteria 12821
651 Ga0105237_10008327 3300009545 Bacteria 11252
652 Ga0105237_10014737 3300009545 Bacteria 8160
653 Ga0105237_10038402 3300009545 Unclassified 4834
654 Ga0105237_10047687 3300009545 Bacteria 4306
655 Ga0105237_10098218 3300009545 Bacteria 2919
656 Ga0105237_10131491 3300009545 Bacteria 2497
657 Ga0105237_10275101 3300009545 Bacteria 1686
658 Ga0105237_10477868 3300009545 Bacteria 1252
659 Ga0105238_10005207 3300009551 Bacteria 12852
660 Ga0105238_10016901 3300009551 Bacteria 7403
661 Ga0105238_10016959 3300009551 Bacteria 7391
662 Ga0105238_10017652 3300009551 Bacteria 7254
663 Ga0105238_10047826 3300009551 Bacteria 4312
664 Ga0105238_10051780 3300009551 Bacteria 4128
665 Ga0105238_10106154 3300009551 Bacteria 2790
666 Ga0105238_10112330 3300009551 Bacteria 2704
667 Ga0105238_10163836 3300009551 Bacteria 2199
668 Ga0105238_10174334 3300009551 Bacteria 2127
669 Ga0105238_10235085 3300009551 Bacteria 1810
670 Ga0105238_10262223 3300009551 Bacteria 1708
671 Ga0105238_10484908 3300009551 Bacteria 1236
672 Ga0105238_10571369 3300009551 Bacteria 1136
673 Ga0105238_10761223 3300009551 Bacteria 983
674 Ga0105238_10825171 3300009551 Bacteria 943
675 Ga0105249_10009712 3300009553 Bacteria 8432
676 Ga0105249_10033849 3300009553 Bacteria 4628
677 Ga0105249_10036891 3300009553 Bacteria 4435
678 Ga0105249_10172037 3300009553 Unclassified 2101
679 Ga0105249_10547733 3300009553 Bacteria 1207
680 Ga0105249_10780358 3300009553 Bacteria 1019
681 Ga0105249_10928593 3300009553 Bacteria 938
682 Ga0105249_10977013 3300009553 Unclassified 915
683 Ga0099796_10006175 3300010159 Bacteria 3049
684 Ga0099796_10097617 3300010159 Bacteria 1101
685 Ga0105239_10000068 3300010375 Bacteria 144666
686 Ga0105239_10000327 3300010375 Bacteria 70423
687 Ga0105239_10000748 3300010375 Bacteria 46087
688 Ga0105239_10001588 3300010375 Bacteria 30008
689 Ga0105239_10009662 3300010375 Bacteria 10847
690 Ga0105239_10012058 3300010375 Bacteria 9639
691 Ga0105239_10105566 3300010375 Bacteria 3120
692 Ga0105239_10119152 3300010375 Bacteria 2929
693 Ga0105239_10171291 3300010375 Bacteria 2428
694 Ga0105239_10228182 3300010375 Bacteria 2089
695 Ga0105239_10480012 3300010375 Bacteria 1412
696 Ga0105239_10538090 3300010375 Unclassified 1330
697 Ga0105239_10582193 3300010375 Bacteria 1276
698 Ga0105239_10591419 3300010375 Unclassified 1265
699 Ga0105239_10603247 3300010375 Bacteria 1252
700 Ga0105239_10644431 3300010375 Unclassified 1210
701 Ga0105239_10808200 3300010375 Bacteria 1074
702 Ga0105246_10021367 3300011119 Bacteria 4165
703 Ga0105246_10060061 3300011119 Bacteria 2640
704 Ga0105246_10206202 3300011119 Bacteria 1532
705 Ga0105246_10260512 3300011119 Bacteria 1381
706 Ga0105246_10462088 3300011119 Bacteria 1069
707 Ga0157373_10000366 3300013100 Bacteria 36257
708 Ga0157373_10001171 3300013100 Bacteria 20075
709 Ga0157373_10002574 3300013100 Bacteria 13782
710 Ga0157373_10008118 3300013100 Bacteria 7805
711 Ga0157373_10041231 3300013100 Bacteria 3302
712 Ga0157373_10069050 3300013100 Bacteria 2498
713 Ga0157371_10000657 3300013102 Bacteria 40996
714 Ga0157371_10005691 3300013102 Bacteria 10450
715 Ga0157371_10016381 3300013102 Bacteria 5533
716 Ga0157371_10026500 3300013102 Bacteria 4213
717 Ga0157371_10092471 3300013102 Unclassified 2143
718 Ga0157371_10368135 3300013102 Bacteria 1048
719 Ga0157370_10000018 3300013104 Bacteria 169223
720 Ga0157370_10002843 3300013104 Bacteria 20679
721 Ga0157370_10010024 3300013104 Bacteria 10024
722 Ga0157370_10013404 3300013104 Bacteria 8445
723 Ga0157370_10034091 3300013104 Bacteria 4960
724 Ga0157370_10070866 3300013104 Bacteria 3290
725 Ga0157370_10091491 3300013104 Bacteria 2856
726 Ga0157370_10122116 3300013104 Bacteria 2432
727 Ga0157370_10125871 3300013104 Bacteria 2391
728 Ga0157370_10251713 3300013104 Bacteria 1634
729 Ga0157369_10070994 3300013105 Bacteria 3740
730 Ga0157369_10079819 3300013105 Bacteria 3504
731 Ga0157369_10109789 3300013105 Bacteria 2932
732 Ga0157369_10113226 3300013105 Bacteria 2882
733 Ga0157369_10163835 3300013105 Bacteria 2345
734 Ga0157369_10181703 3300013105 Bacteria 2213
735 Ga0157369_10493202 3300013105 Bacteria 1267
736 Ga0157374_10000024 3300013296 Bacteria 265166
737 Ga0157374_10000045 3300013296 Bacteria 143116
738 Ga0157374_10004978 3300013296 Bacteria 11147
739 Ga0157374_10006263 3300013296 Bacteria 10091
740 Ga0157374_10019006 3300013296 Bacteria 6077
741 Ga0157374_10021599 3300013296 Bacteria 5731
742 Ga0157374_10027362 3300013296 Bacteria 5142
743 Ga0157374_10029976 3300013296 Bacteria 4936
744 Ga0157374_10038390 3300013296 Unclassified 4402
745 Ga0157374_10054054 3300013296 Unclassified 3745
746 Ga0157374_10092949 3300013296 Bacteria 2879
747 Ga0157374_10105544 3300013296 Bacteria 2706
748 Ga0157374_10143060 3300013296 Bacteria 2322
749 Ga0157374_10249784 3300013296 Bacteria 1745
750 Ga0157374_10360013 3300013296 Bacteria 1447
751 Ga0157374_10367802 3300013296 Bacteria 1431
752 Ga0157374_10525224 3300013296 Unclassified 1190
753 Ga0157378_10000429 3300013297 Bacteria 41084
754 Ga0157378_10000441 3300013297 Bacteria 40161
755 Ga0157378_10004252 3300013297 Bacteria 12628
756 Ga0157378_10060646 3300013297 Unclassified 3375
757 Ga0157378_10104773 3300013297 Bacteria 2586
758 Ga0157378_10123009 3300013297 Bacteria 2394
759 Ga0157378_10145771 3300013297 Bacteria 2202
760 Ga0157378_10162126 3300013297 Bacteria 2092
761 Ga0157378_10192863 3300013297 Bacteria 1923
762 Ga0157378_10208767 3300013297 Bacteria 1851
763 Ga0157378_10215790 3300013297 Unclassified 1822
764 Ga0157378_10243712 3300013297 Bacteria 1718
765 Ga0157378_10364219 3300013297 Bacteria 1415
766 Ga0157378_10481330 3300013297 Bacteria 1237
767 Ga0157378_10522054 3300013297 Bacteria 1189
768 Ga0157378_10869247 3300013297 Bacteria 931
769 Ga0163162_10000223 3300013306 Bacteria 51991
770 Ga0163162_10013694 3300013306 Bacteria 7924
771 Ga0163162_10021145 3300013306 Bacteria 6401
772 Ga0163162_10032242 3300013306 Bacteria 5202
773 Ga0163162_10071089 3300013306 Bacteria 3532
774 Ga0163162_10105774 3300013306 Bacteria 2908
775 Ga0163162_10121811 3300013306 Bacteria 2713
776 Ga0163162_10178373 3300013306 Bacteria 2250
777 Ga0163162_10180297 3300013306 Bacteria 2238
778 Ga0163162_10188644 3300013306 Bacteria 2189
779 Ga0163162_10192852 3300013306 Unclassified 2165
780 Ga0163162_10206272 3300013306 Unclassified 2095
781 Ga0163162_10348734 3300013306 Bacteria 1613
782 Ga0157372_10000873 3300013307 Bacteria 32729
783 Ga0157372_10011291 3300013307 Bacteria 9503
784 Ga0157372_10055063 3300013307 Bacteria 4440
785 Ga0157372_10086491 3300013307 Bacteria 3556
786 Ga0157372_10096097 3300013307 Bacteria 3376
787 Ga0157372_10116012 3300013307 Bacteria 3070
788 Ga0157372_10150463 3300013307 Bacteria 2686
789 Ga0157372_10165050 3300013307 Bacteria 2561
790 Ga0157372_10168246 3300013307 Bacteria 2535
791 Ga0157372_10186785 3300013307 Bacteria 2400
792 Ga0157372_10230713 3300013307 Bacteria 2146
793 Ga0157372_10396092 3300013307 Bacteria 1609
794 Ga0157372_10535321 3300013307 Bacteria 1365
795 Ga0157372_10695517 3300013307 Bacteria 1183
796 Ga0157372_10885733 3300013307 Bacteria 1036
797 Ga0157375_10000871 3300013308 Bacteria 26276
798 Ga0157375_10018864 3300013308 Bacteria 6263
799 Ga0157375_10020522 3300013308 Bacteria 6037
800 Ga0157375_10020952 3300013308 Bacteria 5983
801 Ga0157375_10031268 3300013308 Bacteria 5029
802 Ga0157375_10037474 3300013308 Bacteria 4647
803 Ga0157375_10109654 3300013308 Unclassified 2856
804 Ga0157375_10194570 3300013308 Bacteria 2183
805 Ga0157375_10297742 3300013308 Bacteria 1777
806 Ga0157375_10522454 3300013308 Bacteria 1350
807 Ga0157375_10714915 3300013308 Bacteria 1155
808 Ga0157375_10763857 3300013308 Bacteria 1117
809 Ga0157375_10816083 3300013308 Bacteria 1081
810 Ga0163163_10031660 3300014325 Bacteria 5106
811 Ga0163163_10060742 3300014325 Bacteria 3744
812 Ga0163163_10196935 3300014325 Bacteria 2063
813 Ga0163163_10240603 3300014325 Bacteria 1860
814 Ga0163163_10262784 3300014325 Bacteria 1777
815 Ga0163163_10282937 3300014325 Unclassified 1710
816 Ga0163163_10315800 3300014325 Bacteria 1616
817 Ga0163163_10330456 3300014325 Unclassified 1579
818 Ga0182008_10005435 3300014497 Bacteria 7254
819 Ga0157379_10015718 3300014968 Bacteria 6651
820 Ga0157379_10101073 3300014968 Bacteria 2588
821 Ga0157379_10149725 3300014968 Bacteria 2105
822 Ga0157379_10181221 3300014968 Bacteria 1903
823 Ga0157379_10208312 3300014968 Bacteria 1769
824 Ga0157379_10399348 3300014968 Bacteria 1263
825 Ga0157379_10602583 3300014968 Bacteria 1026
826 Ga0157376_10000097 3300014969 Bacteria 65460
827 Ga0157376_10002784 3300014969 Bacteria 11942
828 Ga0157376_10014068 3300014969 Bacteria 5991
829 Ga0157376_10017022 3300014969 Bacteria 5534
830 Ga0157376_10041475 3300014969 Bacteria 3768
831 Ga0157376_10132867 3300014969 Bacteria 2223
832 Ga0157376_10167069 3300014969 Unclassified 2000
833 Ga0157376_10175480 3300014969 Unclassified 1955
834 Ga0157376_10286635 3300014969 Bacteria 1553
835 Ga0182006_1001362 3300015261 Bacteria 14941
836 Ga0182006_1004039 3300015261 Bacteria 7319
837 Ga0182007_10005312 3300015262 Bacteria 5681
838 Ga0182005_1000061 3300015265 Bacteria 98415
839 Ga0182005_1001673 3300015265 Bacteria 8593
840 Ga0182005_1003851 3300015265 Bacteria 4980
841 Ga0163161_10000097 3300017792 Bacteria 84842
842 Ga0163161_10004671 3300017792 Bacteria 9523
843 Ga0163161_10018241 3300017792 Bacteria 4918
844 Ga0163161_10052583 3300017792 Bacteria 2953
845 Ga0163161_10086573 3300017792 Bacteria 2313
846 Ga0163161_10232199 3300017792 Bacteria 1432
847 Ga0163161_10580527 3300017792 Bacteria 922
848 Ga0213873_10001097 3300021358 Bacteria 4414
849 Ga0213872_10000002 3300021361 Bacteria 554092
850 Ga0213872_10000602 3300021361 Bacteria 27343
851 Ga0213872_10025072 3300021361 Bacteria 2742
852 Ga0213876_10018083 3300021384 Bacteria 3719
853 Ga0213876_10076739 3300021384 Bacteria 1765
854 Ga0213871_10001125 3300021441 Bacteria 4255
855 Ga0209436_100544 3300025208 Bacteria 16288
856 Ga0207427_100060 3300025231 Bacteria 186274
857 Ga0209437_100021 3300025233 Bacteria 646400
858 Ga0209437_100130 3300025233 Bacteria 183731
859 Ga0209258_100029 3300025242 Bacteria 490648
860 Ga0209646_1000006 3300025246 Bacteria 694084
861 Ga0209646_1000045 3300025246 Bacteria 333765
862 Ga0209026_1000308 3300025250 Bacteria 53197
863 Ga0209026_1000591 3300025250 Bacteria 23639
864 Ga0209026_1017186 3300025250 Bacteria 1161
865 Ga0209148_1000230 3300025254 Bacteria 91940
866 Ga0209129_1008054 3300025258 Bacteria 2999
867 Ga0209233_1000035 3300025261 Bacteria 568478
868 Ga0209233_1001607 3300025261 Bacteria 8800
869 Ga0209233_1002746 3300025261 Bacteria 6336
870 Ga0209233_1003388 3300025261 Bacteria 5620
871 Ga0207666_1003319 3300025271 Bacteria 1975
872 Ga0207666_1004767 3300025271 Viruses 1712
873 Ga0207666_1011331 3300025271 Bacteria 1231
874 Ga0209455_1001221 3300025272 Bacteria 12223
875 Ga0209673_1054352 3300025273 Bacteria 1038
876 Ga0209564_1001245 3300025295 Bacteria 28363
877 Ga0209758_1019961 3300025297 Bacteria 3198
878 Ga0209050_1000876 3300025298 Bacteria 40459
879 Ga0209050_1016309 3300025298 Bacteria 3050
880 Ga0209050_1031034 3300025298 Bacteria 1673
881 Ga0207426_1000060 3300025302 Bacteria 363139
882 Ga0207426_1000159 3300025302 Bacteria 175899
883 Ga0207426_1007154 3300025302 Bacteria 4712
884 Ga0207697_10001693 3300025315 Bacteria 11873
885 Ga0207697_10014686 3300025315 Unclassified 3246
886 Ga0207697_10060785 3300025315 Unclassified 1571
887 Ga0207697_10105216 3300025315 Bacteria 1205
888 Ga0207656_10123087 3300025321 Bacteria 1209
889 Ga0207656_10196493 3300025321 Bacteria 973
890 Ga0207653_10111428 3300025885 Bacteria 977
891 Ga0207692_10029907 3300025898 Bacteria 2593
892 Ga0207692_10061999 3300025898 Bacteria 1940
893 Ga0207692_10155445 3300025898 Bacteria 1313
894 Ga0207692_10269398 3300025898 Bacteria 1026
895 Ga0207642_10009091 3300025899 Bacteria 3442
896 Ga0207642_10091551 3300025899 Bacteria 1503
897 Ga0207642_10131359 3300025899 Bacteria 1307
898 Ga0207710_10119726 3300025900 Unclassified 1256
899 Ga0207688_10007881 3300025901 Bacteria 5796
900 Ga0207688_10020631 3300025901 Bacteria 3598
901 Ga0207680_10000086 3300025903 Bacteria 42622
902 Ga0207680_10043520 3300025903 Bacteria 2634
903 Ga0207680_10056882 3300025903 Unclassified 2364
904 Ga0207680_10088565 3300025903 Bacteria 1963
905 Ga0207680_10141846 3300025903 Bacteria 1593
906 Ga0207680_10142568 3300025903 Bacteria 1590
907 Ga0207680_10220379 3300025903 Bacteria 1300
908 Ga0207680_10290197 3300025903 Bacteria 1138
909 Ga0207647_10000076 3300025904 Bacteria 75824
910 Ga0207647_10008849 3300025904 Bacteria 7184
911 Ga0207647_10033951 3300025904 Bacteria 3261
912 Ga0207647_10041616 3300025904 Bacteria 2888
913 Ga0207647_10189873 3300025904 Bacteria 1191
914 Ga0207685_10000076 3300025905 Bacteria 22975
915 Ga0207685_10023356 3300025905 Bacteria 2104
916 Ga0207685_10108687 3300025905 Bacteria 1198
917 Ga0207685_10159375 3300025905 Bacteria 1029
918 Ga0207685_10179772 3300025905 Bacteria 980
919 Ga0207699_10038079 3300025906 Bacteria 2753
920 Ga0207699_10060127 3300025906 Bacteria 2280
921 Ga0207699_10117760 3300025906 Bacteria 1713
922 Ga0207645_10003509 3300025907 Bacteria 11865
923 Ga0207645_10026000 3300025907 Bacteria 3786
924 Ga0207645_10031748 3300025907 Bacteria 3396
925 Ga0207645_10035528 3300025907 Unclassified 3200
926 Ga0207645_10047712 3300025907 Bacteria 2735
927 Ga0207643_10099096 3300025908 Bacteria 1707
928 Ga0207705_10008054 3300025909 Bacteria 7724
929 Ga0207705_10015731 3300025909 Bacteria 5433
930 Ga0207705_10030079 3300025909 Bacteria 3873
931 Ga0207705_10139147 3300025909 Bacteria 1812
932 Ga0207684_10005894 3300025910 Bacteria 11223
933 Ga0207684_10006457 3300025910 Bacteria 10690
934 Ga0207684_10016256 3300025910 Bacteria 6388
935 Ga0207684_10035157 3300025910 Bacteria 4255
936 Ga0207684_10046528 3300025910 Bacteria 3681
937 Ga0207684_10056072 3300025910 Bacteria 3342
938 Ga0207684_10097845 3300025910 Bacteria 2506
939 Ga0207684_10099839 3300025910 Bacteria 2480
940 Ga0207684_10227602 3300025910 Bacteria 1609
941 Ga0207684_10368160 3300025910 Bacteria 1237
942 Ga0207684_10439577 3300025910 Bacteria 1120
943 Ga0207654_10001544 3300025911 Bacteria 12096
944 Ga0207654_10005983 3300025911 Bacteria 6120
945 Ga0207654_10011570 3300025911 Unclassified 4503
946 Ga0207654_10015317 3300025911 Bacteria 3976
947 Ga0207654_10044327 3300025911 Bacteria 2526
948 Ga0207654_10092299 3300025911 Bacteria 1848
949 Ga0207654_10266058 3300025911 Bacteria 1155
950 Ga0207707_10001086 3300025912 Bacteria 25962
951 Ga0207707_10433323 3300025912 Bacteria 1126
952 Ga0207695_10000058 3300025913 Bacteria 366582
953 Ga0207695_10000200 3300025913 Bacteria 165896
954 Ga0207695_10000474 3300025913 Bacteria 87178
955 Ga0207695_10000659 3300025913 Bacteria 68040
956 Ga0207695_10001190 3300025913 Bacteria 44747
957 Ga0207695_10002235 3300025913 Bacteria 29044
958 Ga0207695_10014138 3300025913 Bacteria 9472
959 Ga0207695_10016801 3300025913 Bacteria 8545
960 Ga0207695_10034959 3300025913 Bacteria 5456
961 Ga0207695_10036543 3300025913 Bacteria 5310
962 Ga0207695_10046237 3300025913 Bacteria 4614
963 Ga0207695_10097705 3300025913 Bacteria 2937
964 Ga0207695_10357581 3300025913 Bacteria 1347
965 Ga0207695_10507389 3300025913 Unclassified 1088
966 Ga0207671_10000661 3300025914 Bacteria 44970
967 Ga0207671_10000803 3300025914 Bacteria 39858
968 Ga0207671_10001644 3300025914 Bacteria 25452
969 Ga0207671_10002915 3300025914 Bacteria 17652
970 Ga0207671_10003590 3300025914 Bacteria 15339
971 Ga0207671_10004905 3300025914 Bacteria 12571
972 Ga0207671_10005056 3300025914 Bacteria 12320
973 Ga0207671_10007719 3300025914 Bacteria 9276
974 Ga0207671_10019259 3300025914 Bacteria 5221
975 Ga0207671_10025394 3300025914 Bacteria 4450
976 Ga0207671_10056869 3300025914 Bacteria 2899
977 Ga0207671_10077590 3300025914 Bacteria 2487
978 Ga0207671_10112302 3300025914 Bacteria 2075
979 Ga0207671_10246703 3300025914 Unclassified 1403
980 Ga0207671_10353822 3300025914 Bacteria 1165
981 Ga0207693_10006739 3300025915 Bacteria 9483
982 Ga0207693_10069869 3300025915 Bacteria 2748
983 Ga0207693_10105293 3300025915 Bacteria 2212
984 Ga0207693_10109469 3300025915 Bacteria 2167
985 Ga0207693_10165176 3300025915 Bacteria 1742
986 Ga0207693_10244194 3300025915 Bacteria 1409
987 Ga0207693_10414540 3300025915 Bacteria 1053
988 Ga0207663_10003775 3300025916 Bacteria 7471
989 Ga0207663_10058622 3300025916 Bacteria 2431
990 Ga0207663_10259020 3300025916 Bacteria 1284
991 Ga0207663_10353272 3300025916 Bacteria 1113
992 Ga0207663_10462645 3300025916 Bacteria 980
993 Ga0207663_10606915 3300025916 Bacteria 860
994 Ga0207660_10016797 3300025917 Bacteria 4853
995 Ga0207662_10002651 3300025918 Bacteria 9024
996 Ga0207662_10461679 3300025918 Bacteria 870
997 Ga0207657_10004074 3300025919 Bacteria 15509
998 Ga0207657_10041114 3300025919 Bacteria 4090
999 Ga0207657_10111671 3300025919 Unclassified 2256
1000 Ga0207657_10135507 3300025919 Bacteria 2015
1001 Ga0207657_10169655 3300025919 Bacteria 1769
1002 Ga0207657_10469421 3300025919 Bacteria 987
1003 Ga0207657_10521478 3300025919 Bacteria 930
1004 Ga0207649_10000530 3300025920 Bacteria 26570
1005 Ga0207649_10138554 3300025920 Bacteria 1662
1006 Ga0207649_10215656 3300025920 Bacteria 1364
1007 Ga0207652_10002241 3300025921 Bacteria 16465
1008 Ga0207652_10006423 3300025921 Bacteria 9479
1009 Ga0207652_10333225 3300025921 Bacteria 1370
1010 Ga0207652_10468875 3300025921 Bacteria 1134
1011 Ga0207646_10000625 3300025922 Bacteria 46082
1012 Ga0207646_10002765 3300025922 Bacteria 20492
1013 Ga0207646_10039451 3300025922 Bacteria 4251
1014 Ga0207646_10064785 3300025922 Bacteria 3262
1015 Ga0207646_10080197 3300025922 Bacteria 2918
1016 Ga0207646_10098829 3300025922 Bacteria 2615
1017 Ga0207646_10115423 3300025922 Bacteria 2412
1018 Ga0207646_10213873 3300025922 Bacteria 1741
1019 Ga0207646_10215936 3300025922 Bacteria 1732
1020 Ga0207646_10233807 3300025922 Bacteria 1661
1021 Ga0207646_10429767 3300025922 Bacteria 1192
1022 Ga0207646_10508698 3300025922 Bacteria 1085
1023 Ga0207681_10024677 3300025923 Bacteria 3860
1024 Ga0207681_10075812 3300025923 Unclassified 2360
1025 Ga0207681_10116300 3300025923 Bacteria 1954
1026 Ga0207694_10003129 3300025924 Bacteria 13234
1027 Ga0207694_10007600 3300025924 Bacteria 8218
1028 Ga0207694_10052405 3300025924 Bacteria 3163
1029 Ga0207694_10094807 3300025924 Bacteria 2358
1030 Ga0207694_10112718 3300025924 Unclassified 2164
1031 Ga0207694_10120323 3300025924 Bacteria 2096
1032 Ga0207694_10189327 3300025924 Bacteria 1671
1033 Ga0207694_10272399 3300025924 Bacteria 1389
1034 Ga0207694_10277632 3300025924 Bacteria 1375
1035 Ga0207694_10537667 3300025924 Unclassified 980
1036 Ga0207694_10573882 3300025924 Bacteria 948
1037 Ga0207650_10095060 3300025925 Bacteria 2284
1038 Ga0207659_10034348 3300025926 Bacteria 3496
1039 Ga0207659_10057527 3300025926 Unclassified 2788
1040 Ga0207659_10192202 3300025926 Bacteria 1625
1041 Ga0207659_10237760 3300025926 Bacteria 1472
1042 Ga0207659_10317772 3300025926 Bacteria 1284
1043 Ga0207687_10012920 3300025927 Bacteria 5457
1044 Ga0207687_10025360 3300025927 Bacteria 3967
1045 Ga0207687_10117405 3300025927 Bacteria 1984
1046 Ga0207687_10130361 3300025927 Bacteria 1894
1047 Ga0207687_10217222 3300025927 Bacteria 1503
1048 Ga0207700_10010139 3300025928 Bacteria 5925
1049 Ga0207700_10020574 3300025928 Bacteria 4486
1050 Ga0207700_10109842 3300025928 Bacteria 2217
1051 Ga0207700_10110240 3300025928 Bacteria 2213
1052 Ga0207700_10209893 3300025928 Bacteria 1646
1053 Ga0207700_10214144 3300025928 Bacteria 1630
1054 Ga0207700_10283572 3300025928 Unclassified 1426
1055 Ga0207700_10390841 3300025928 Bacteria 1218
1056 Ga0207700_10439922 3300025928 Bacteria 1148
1057 Ga0207664_10021168 3300025929 Bacteria 4831
1058 Ga0207664_10051394 3300025929 Bacteria 3254
1059 Ga0207664_10228083 3300025929 Bacteria 1618
1060 Ga0207664_10275651 3300025929 Bacteria 1475
1061 Ga0207664_10284705 3300025929 Bacteria 1451
1062 Ga0207664_10285249 3300025929 Bacteria 1450
1063 Ga0207644_10025172 3300025931 Bacteria 4091
1064 Ga0207644_10057052 3300025931 Bacteria 2819
1065 Ga0207644_10161245 3300025931 Bacteria 1743
1066 Ga0207644_10310710 3300025931 Bacteria 1272
1067 Ga0207644_10332953 3300025931 Bacteria 1230
1068 Ga0207644_10337884 3300025931 Bacteria 1221
1069 Ga0207644_10697424 3300025931 Bacteria 846
1070 Ga0207690_10001262 3300025932 Bacteria 16007
1071 Ga0207690_10020898 3300025932 Bacteria 4052
1072 Ga0207690_10034187 3300025932 Bacteria 3274
1073 Ga0207690_10044139 3300025932 Bacteria 2937
1074 Ga0207690_10161831 3300025932 Bacteria 1669
1075 Ga0207690_10244380 3300025932 Bacteria 1384
1076 Ga0207706_10000165 3300025933 Bacteria 73590
1077 Ga0207706_10021646 3300025933 Bacteria 5772
1078 Ga0207706_10044497 3300025933 Bacteria 3935
1079 Ga0207706_10087353 3300025933 Unclassified 2742
1080 Ga0207706_10207640 3300025933 Bacteria 1717
1081 Ga0207706_10261986 3300025933 Bacteria 1509
1082 Ga0207706_10330407 3300025933 Bacteria 1326
1083 Ga0207686_10016579 3300025934 Bacteria 4136
1084 Ga0207686_10031129 3300025934 Bacteria 3166
1085 Ga0207686_10049656 3300025934 Bacteria 2605
1086 Ga0207686_10188785 3300025934 Bacteria 1467
1087 Ga0207686_10238554 3300025934 Bacteria 1322
1088 Ga0207686_10396262 3300025934 Bacteria 1050
1089 Ga0207709_10054143 3300025935 Bacteria 2472
1090 Ga0207670_10295407 3300025936 Bacteria 1267
1091 Ga0207669_10028918 3300025937 Bacteria 3056
1092 Ga0207669_10120248 3300025937 Bacteria 1781
1093 Ga0207669_10232397 3300025937 Bacteria 1361
1094 Ga0207669_10289308 3300025937 Bacteria 1240
1095 Ga0207704_10023178 3300025938 Bacteria 3341
1096 Ga0207704_10057338 3300025938 Bacteria 2392
1097 Ga0207704_10094083 3300025938 Bacteria 1978
1098 Ga0207704_10122688 3300025938 Bacteria 1782
1099 Ga0207704_10189130 3300025938 Unclassified 1496
1100 Ga0207665_10007568 3300025939 Bacteria 7175
1101 Ga0207665_10020315 3300025939 Bacteria 4364
1102 Ga0207665_10025433 3300025939 Bacteria 3906
1103 Ga0207665_10053313 3300025939 Bacteria 2726
1104 Ga0207665_10125622 3300025939 Bacteria 1816
1105 Ga0207665_10131740 3300025939 Unclassified 1776
1106 Ga0207665_10196636 3300025939 Unclassified 1467
1107 Ga0207665_10204912 3300025939 Bacteria 1439
1108 Ga0207665_10320081 3300025939 Bacteria 1164
1109 Ga0207691_10004699 3300025940 Bacteria 13223
1110 Ga0207691_10077611 3300025940 Bacteria 2991
1111 Ga0207691_10131253 3300025940 Unclassified 2213
1112 Ga0207691_10329507 3300025940 Bacteria 1308
1113 Ga0207711_10010770 3300025941 Bacteria 7602
1114 Ga0207711_10013360 3300025941 Bacteria 6821
1115 Ga0207711_10063515 3300025941 Bacteria 3188
1116 Ga0207711_10188744 3300025941 Bacteria 1877
1117 Ga0207711_10220786 3300025941 Unclassified 1733
1118 Ga0207711_10280749 3300025941 Bacteria 1534
1119 Ga0207711_10429191 3300025941 Bacteria 1230
1120 Ga0207689_10009286 3300025942 Bacteria 8502
1121 Ga0207689_10014900 3300025942 Bacteria 6596
1122 Ga0207689_10100372 3300025942 Bacteria 2378
1123 Ga0207689_10142936 3300025942 Bacteria 1971
1124 Ga0207661_10142667 3300025944 Bacteria 2063
1125 Ga0207661_10654729 3300025944 Bacteria 965
1126 Ga0207679_10242746 3300025945 Bacteria 1527
1127 Ga0207679_10296712 3300025945 Bacteria 1391
1128 Ga0207679_10367826 3300025945 Bacteria 1258
1129 Ga0207679_10458177 3300025945 Bacteria 1132
1130 Ga0207667_10000231 3300025949 Bacteria 77567
1131 Ga0207667_10000770 3300025949 Bacteria 41675
1132 Ga0207667_10004285 3300025949 Bacteria 17478
1133 Ga0207667_10040743 3300025949 Bacteria 4944
1134 Ga0207667_10058352 3300025949 Bacteria 4049
1135 Ga0207667_10058910 3300025949 Bacteria 4026
1136 Ga0207667_10065966 3300025949 Bacteria 3774
1137 Ga0207667_10074201 3300025949 Bacteria 3534
1138 Ga0207667_10086417 3300025949 Bacteria 3245
1139 Ga0207667_10423844 3300025949 Bacteria 1354
1140 Ga0207667_10725282 3300025949 Bacteria 995
1141 Ga0207667_10899763 3300025949 Bacteria 877
1142 Ga0207651_10009930 3300025960 Bacteria 5243
1143 Ga0207651_10114722 3300025960 Bacteria 2030
1144 Ga0207712_10096194 3300025961 Unclassified 2191
1145 Ga0207712_10244905 3300025961 Bacteria 1446
1146 Ga0207712_10340348 3300025961 Bacteria 1244
1147 Ga0207712_10743902 3300025961 Bacteria 858
1148 Ga0207668_10060197 3300025972 Bacteria 2664
1149 Ga0207668_10065312 3300025972 Bacteria 2575
1150 Ga0207668_10142233 3300025972 Bacteria 1846
1151 Ga0207668_10169532 3300025972 Bacteria 1711
1152 Ga0207668_10436614 3300025972 Bacteria 1114
1153 Ga0207668_10614573 3300025972 Bacteria 948
1154 Ga0207640_10000002 3300025981 Bacteria 524211
1155 Ga0207640_10017825 3300025981 Bacteria 4161
1156 Ga0207640_10173063 3300025981 Bacteria 1611
1157 Ga0207658_10062424 3300025986 Bacteria 2788
1158 Ga0207658_10072624 3300025986 Bacteria 2609
1159 Ga0207658_10123069 3300025986 Viruses 2071
1160 Ga0207658_10290982 3300025986 Bacteria 1404
1161 Ga0207658_10490226 3300025986 Unclassified 1093
1162 Ga0207658_10592210 3300025986 Bacteria 996
1163 Ga0207677_10011777 3300026023 Bacteria 5000
1164 Ga0207677_10069049 3300026023 Bacteria 2483
1165 Ga0207677_10092305 3300026023 Bacteria 2204
1166 Ga0207677_10113187 3300026023 Unclassified 2025
1167 Ga0207677_10159613 3300026023 Bacteria 1750
1168 Ga0207677_10201763 3300026023 Unclassified 1581
1169 Ga0207677_10218598 3300026023 Bacteria 1527
1170 Ga0207703_10001354 3300026035 Bacteria 22446
1171 Ga0207703_10001669 3300026035 Bacteria 19954
1172 Ga0207703_10030800 3300026035 Bacteria 4240
1173 Ga0207703_10115180 3300026035 Unclassified 2300
1174 Ga0207703_10121098 3300026035 Unclassified 2246
1175 Ga0207703_10206020 3300026035 Bacteria 1750
1176 Ga0207703_10330766 3300026035 Bacteria 1398
1177 Ga0207703_10333055 3300026035 Bacteria 1393
1178 Ga0207703_10613296 3300026035 Bacteria 1030
1179 Ga0207639_10000009 3300026041 Bacteria 432727
1180 Ga0207639_10040165 3300026041 Bacteria 3490
1181 Ga0207639_10101209 3300026041 Bacteria 2329
1182 Ga0207639_10455988 3300026041 Bacteria 1161
1183 Ga0207639_10757777 3300026041 Bacteria 903
1184 Ga0207678_10000624 3300026067 Bacteria 32352
1185 Ga0207678_10001362 3300026067 Bacteria 22534
1186 Ga0207678_10070343 3300026067 Bacteria 3000
1187 Ga0207678_10088461 3300026067 Bacteria 2647
1188 Ga0207678_10245080 3300026067 Bacteria 1535
1189 Ga0207708_10086058 3300026075 Bacteria 2419
1190 Ga0207702_10060900 3300026078 Bacteria 3218
1191 Ga0207702_10235703 3300026078 Unclassified 1712
1192 Ga0207702_10236442 3300026078 Bacteria 1710
1193 Ga0207702_10262469 3300026078 Unclassified 1627
1194 Ga0207702_10770851 3300026078 Bacteria 950
1195 Ga0207641_10000132 3300026088 Bacteria 109247
1196 Ga0207641_10005723 3300026088 Bacteria 10560
1197 Ga0207641_10046016 3300026088 Bacteria 3677
1198 Ga0207641_10260374 3300026088 Bacteria 1624
1199 Ga0207641_10272373 3300026088 Bacteria 1589
1200 Ga0207641_10398732 3300026088 Bacteria 1321
1201 Ga0207641_10608043 3300026088 Bacteria 1071
1202 Ga0207648_10056712 3300026089 Bacteria 3418
1203 Ga0207648_10164563 3300026089 Bacteria 1960
1204 Ga0207648_10273109 3300026089 Bacteria 1510
1205 Ga0207648_10297346 3300026089 Bacteria 1447
1206 Ga0207648_10469069 3300026089 Unclassified 1148
1207 Ga0207676_10049615 3300026095 Unclassified 3266
1208 Ga0207676_10119733 3300026095 Bacteria 2218
1209 Ga0207676_10140557 3300026095 Bacteria 2066
1210 Ga0207676_10556718 3300026095 Bacteria 1096
1211 Ga0207676_10810670 3300026095 Bacteria 914
1212 Ga0207676_10864793 3300026095 Bacteria 885
1213 Ga0207674_10015348 3300026116 Bacteria 8417
1214 Ga0207674_10044091 3300026116 Bacteria 4596
1215 Ga0207674_10072313 3300026116 Bacteria 3464
1216 Ga0207674_10112209 3300026116 Bacteria 2700
1217 Ga0207674_10273771 3300026116 Unclassified 1636
1218 Ga0207675_100038279 3300026118 Bacteria 4475
1219 Ga0207675_100300251 3300026118 Unclassified 1564
1220 Ga0207675_100323684 3300026118 Bacteria 1506
1221 Ga0207675_100462319 3300026118 Bacteria 1259
1222 Ga0207683_10032217 3300026121 Bacteria 4553
1223 Ga0207683_10055781 3300026121 Bacteria 3465
1224 Ga0207683_10317509 3300026121 Bacteria 1427
1225 Ga0207683_10320159 3300026121 Bacteria 1421
1226 Ga0207683_10361633 3300026121 Archaea 1333
1227 Ga0207698_10110971 3300026142 Bacteria 2298
1228 Ga0207698_10147564 3300026142 Bacteria 2036
1229 Ga0207698_10180080 3300026142 Bacteria 1871
1230 Ga0207698_10208216 3300026142 Viruses 1757
1231 Ga0207698_10217018 3300026142 Bacteria 1726
1232 Ga0207698_10325447 3300026142 Archaea 1441
1233 Ga0207698_10355960 3300026142 Bacteria 1384
1234 Ga0207698_10670852 3300026142 Bacteria 1029
1235 Ga0207698_10741560 3300026142 Bacteria 980
1236 Ga0209974_10049712 3300027876 Bacteria 1407
1237 Ga0207428_10003260 3300027907 Bacteria 15816
1238 Ga0207428_10022637 3300027907 Bacteria 5300
1239 Ga0207428_10178631 3300027907 Bacteria 1604
1240 Ga0207428_10437848 3300027907 Bacteria 954
1241 Ga0265354_1000929 3300028016 Bacteria 4639
1242 Ga0268266_10001437 3300028379 Bacteria 28363
1243 Ga0268266_10002230 3300028379 Bacteria 21166
1244 Ga0268266_10004567 3300028379 Bacteria 13229
1245 Ga0268266_10047139 3300028379 Bacteria 3691
1246 Ga0268266_10085269 3300028379 Bacteria 2759
1247 Ga0268266_10146242 3300028379 Bacteria 2125
1248 Ga0268266_10264329 3300028379 Bacteria 1595
1249 Ga0268266_10318979 3300028379 Bacteria 1454
1250 Ga0268266_10428320 3300028379 Bacteria 1255
1251 Ga0268266_10543153 3300028379 Bacteria 1113
1252 Ga0268265_10000297 3300028380 Bacteria 55640
1253 Ga0268265_10116441 3300028380 Unclassified 2193
1254 Ga0268265_10157567 3300028380 Bacteria 1924
1255 Ga0268265_10296963 3300028380 Bacteria 1453
1256 Ga0268264_10019696 3300028381 Bacteria 5512
1257 Ga0268264_10020992 3300028381 Bacteria 5336
1258 Ga0268264_10026134 3300028381 Unclassified 4768
1259 Ga0268264_10026456 3300028381 Bacteria 4742
1260 Ga0268264_10039417 3300028381 Bacteria 3903
1261 Ga0268264_10087769 3300028381 Bacteria 2675
1262 Ga0268264_10111230 3300028381 Viruses 2399
1263 Ga0268264_10182129 3300028381 Unclassified 1909
1264 Ga0268264_10194111 3300028381 Bacteria 1853
1265 Ga0268264_10338898 3300028381 Bacteria 1428
1266 Ga0268264_10368764 3300028381 Bacteria 1372
1267 Ga0265322_10033185 3300028654 Bacteria 1472
1268 Ga0307517_10009298 3300028786 Bacteria 13961
1269 Ga0307517_10020980 3300028786 Bacteria 8286
1270 Ga0307515_10000076 3300028794 Bacteria 228736
1271 Ga0307515_10001092 3300028794 Bacteria 62178
1272 Ga0307515_10004328 3300028794 Bacteria 29443
1273 Ga0307515_10046299 3300028794 Bacteria 6653
1274 Ga0307515_10145253 3300028794 Bacteria 2516
1275 Ga0307515_10176217 3300028794 Bacteria 2108
1276 Ga0265338_10000053 3300028800 Bacteria 208184
1277 Ga0265338_10000096 3300028800 Bacteria 164859
1278 Ga0265338_10012413 3300028800 Bacteria 9713
1279 Ga0265338_10129981 3300028800 Bacteria 1991
1280 Ga0265338_10194102 3300028800 Bacteria 1536
1281 Ga0265338_10318098 3300028800 Bacteria 1127
1282 Ga0265324_10000003 3300029957 Bacteria 379527
1283 Ga0265324_10007037 3300029957 Bacteria 4619
1284 Ga0307511_10003970 3300030521 Bacteria 15119
1285 Ga0316181_1158880 3300030744 Bacteria 15163
1286 Ga0316181_1280348 3300030744 Bacteria 1723
1287 Ga0265762_1010404 3300030760 Bacteria 1662
1288 Ga0265760_10015282 3300031090 Bacteria 2200
1289 Ga0265332_10050648 3300031238 Bacteria 1785
1290 Ga0265320_10099032 3300031240 Bacteria 1344
1291 Ga0265325_10000483 3300031241 Bacteria 28838
1292 Ga0265325_10000976 3300031241 Bacteria 20534
1293 Ga0265325_10184605 3300031241 Bacteria 970
1294 Ga0265329_10002461 3300031242 Bacteria 8358
1295 Ga0265339_10156263 3300031249 Bacteria 1150
1296 Ga0265331_10087975 3300031250 Bacteria 1438
1297 Ga0265327_10000544 3300031251 Bacteria 64453
1298 Ga0265327_10001236 3300031251 Bacteria 34281
1299 Ga0265327_10001849 3300031251 Bacteria 24567
1300 Ga0265316_10273115 3300031344 Bacteria 1237
1301 Ga0307513_10141183 3300031456 Bacteria 2335
1302 Ga0307513_10265803 3300031456 Bacteria 1502
1303 Ga0307509_10175490 3300031507 Bacteria 2016
1304 Ga0307509_10210524 3300031507 Bacteria 1769
1305 Ga0307408_100000459 3300031548 Bacteria 35665
1306 Ga0307408_100478324 3300031548 Bacteria 1086
1307 Ga0265313_10034549 3300031595 Bacteria 2556
1308 Ga0265313_10152642 3300031595 Bacteria 986
1309 Ga0307508_10000116 3300031616 Bacteria 94844
1310 Ga0265314_10000405 3300031711 Bacteria 58544
1311 Ga0307405_10058203 3300031731 Bacteria 2431
1312 Ga0307406_10000026 3300031901 Bacteria 92099
1313 Ga0307407_10000021 3300031903 Bacteria 122064
1314 Ga0307412_10000001 3300031911 Bacteria 822691
1315 Ga0307412_10000009 3300031911 Bacteria 445987
1316 Ga0307412_10397908 3300031911 Bacteria 1120
1317 Ga0307409_100000253 3300031995 Bacteria 21625
1318 Ga0307409_100179688 3300031995 Bacteria 1872
1319 Ga0307416_100064062 3300032002 Bacteria 3014
1320 Ga0307416_100131092 3300032002 Bacteria 2257
1321 Ga0307416_100269521 3300032002 Bacteria 1670
1322 Ga0307414_10000015 3300032004 Bacteria 268602
1323 Ga0307414_10009621 3300032004 Bacteria 5563
1324 Ga0307414_10022425 3300032004 Bacteria 3981
1325 Ga0307414_10048663 3300032004 Bacteria 2926
1326 Ga0307414_10112843 3300032004 Bacteria 2073
1327 Ga0307414_10138141 3300032004 Bacteria 1903
1328 Ga0307414_10211622 3300032004 Bacteria 1585
1329 Ga0307411_10092460 3300032005 Bacteria 2116
1330 Ga0307411_10518975 3300032005 Bacteria 1011
1331 Ga0307510_10019189 3300033180 Bacteria 8023
1332 Ga0307510_10353517 3300033180 Bacteria 919
1333 Ga0307510_10394291 3300033180 Bacteria 828
1334 Ga0316212_1002217 3300033547 Bacteria 2755
1335 Ga0373928_0000033 3300035084 Bacteria 23360
1336 Ga0373929_0000845 3300035085 Bacteria 5959
1337 Ga0373934_0058119 3300035086 Bacteria 1539
1338 Ga0373944_0000107 3300035089 Bacteria 15195
1339 Ga0373949_0000601 3300035090 Bacteria 11726
1340 Ga0373951_0001878 3300035091 Bacteria 5411
1341 Ga0373932_0000001 3300035112 Bacteria 1459067
1342 Ga0373945_0062483 3300035116 Bacteria 1392
1343 Ga0373953_0047822 3300035117 Unclassified 1722
1344 Ga0373953_0066450 3300035117 Bacteria 1482
1345 Ga0373956_0093672 3300035119 Bacteria 1388
1346 Ga0373960_0064186 3300035121 Bacteria 1121
1347 Ga0373943_0014521 3300035170 Unclassified 3568
1348 Ga0373943_0037749 3300035170 Bacteria 2320
1349 Ga0373946_0086854 3300035171 Bacteria 1379
1350 Ga0373955_0020220 3300035172 Bacteria 3343
1351 Ga0373955_0067665 3300035172 Bacteria 1989
1352 Ga0373962_0000101 3300035242 Bacteria 18833
1353 Ga0373924_0052477 3300035410 Bacteria 1692
1354 Ga0373924_0170537 3300035410 Bacteria 956
1355 Ga0373924_0207964 3300035410 Bacteria 864
1356 Ga0373931_0000002 3300035691 Bacteria 599830
1357 Ga0373931_0017875 3300035691 Bacteria 3514
1358 Ga0373931_0060659 3300035691 Bacteria 2037
1359 Ga0373931_0065346 3300035691 Bacteria 1971
1360 Ga0373935_0017654 3300035692 Unclassified 4332
1361 Ga0373935_0038052 3300035692 Bacteria 3011
1362 Ga0373935_0040796 3300035692 Bacteria 2914
1363 Ga0373935_0085397 3300035692 Bacteria 2058
1364 Ga0373935_0213109 3300035692 Bacteria 1339
1365 Ga0373935_0218019 3300035692 Bacteria 1324
1366 Ga0373935_0253575 3300035692 Bacteria 1232
1367 Ga0373927_0000605 3300035695 Bacteria 27344
1368 Ga0373927_0001563 3300035695 Bacteria 17150
1369 Ga0373927_0001731 3300035695 Bacteria 16289
1370 Ga0373927_0007288 3300035695 Bacteria 7502
1371 Ga0373933_0088063 3300035724 Unclassified 1913
1372 Ga0373933_0182140 3300035724 Bacteria 1340
1373 Ga0373947_0010476 3300035725 Bacteria 5320
1374 Ga0373947_0014603 3300035725 Bacteria 4504
1375 Ga0373947_0029059 3300035725 Bacteria 3242
1376 Ga0373947_0126406 3300035725 Bacteria 1628
1377 Ga0373947_0132343 3300035725 Bacteria 1593
1378 Ga0373947_0324446 3300035725 Bacteria 1030
1379 Ga0373937_0026160 3300036401 Bacteria 5273
1380 Ga0373937_0071800 3300036401 Bacteria 3193
1381 Ga0373937_0156646 3300036401 Bacteria 2135
1382 Ga0373937_0192580 3300036401 Bacteria 1916
1383 Ga0373937_0549095 3300036401 Bacteria 1097
1384 Ga0265778_018313 3300036457 Bacteria 850
1385 Ga0373925_0000215 3300037068 Bacteria 62800
1386 Ga0373925_0015026 3300037068 Bacteria 5596
1387 Ga0373925_0015234 3300037068 Bacteria 5559
1388 Ga0373925_0105766 3300037068 Bacteria 2169
1389 Ga0373925_0250236 3300037068 Bacteria 1421
1390 Ga0373925_0251740 3300037068 Bacteria 1417
1391 Ga0373925_0314838 3300037068 Bacteria 1265
1392 Ga0373925_0491365 3300037068 Bacteria 1007
1393 Ga0395899_0235392 3300037312 Bacteria 1263
1394 Ga0395900_0000657 3300037418 Bacteria 46277
1395 Ga0395900_0002169 3300037418 Bacteria 21931
1396 Ga0395900_0011309 3300037418 Bacteria 9130
1397 Ga0395898_0008660 3300037466 Bacteria 10734
1398 Ga0395898_0010842 3300037466 Bacteria 9521
1399 Ga0395905_0000002 3300037471 Bacteria 1356358
1400 Ga0395905_0173370 3300037471 Bacteria 2026
1401 Ga0395905_0175029 3300037471 Bacteria 2015
1402 Ga0395905_0661059 3300037471 Bacteria 947
1403 Ga0436364_0953089 3300037853 Bacteria 2474
1404 Ga0395901_0002060 3300038443 Bacteria 20612
1405 Ga0395901_0074788 3300038443 Bacteria 3534
1406 Ga0395901_0086602 3300038443 Bacteria 3276
1407 Ga0395901_0165702 3300038443 Bacteria 2321
1408 Ga0395901_0274419 3300038443 Bacteria 1753
1409 Ga0436365_0253928 3300039437 Bacteria 8598
1410 Ga0436360_0146362 3300039438 Bacteria 12225
1411 Ga0436360_0715715 3300039438 Bacteria 1128
1412 Ga0436360_0740786 3300039438 Bacteria 1361
1413 Ga0436360_0787424 3300039438 Bacteria 2087
1414 Ga0436360_0861137 3300039438 Bacteria 4226
1415 Ga0436360_1069475 3300039438 Bacteria 1944
1416 Ga0436361_0429461 3300039447 Bacteria 960
1417 Ga0436361_0585330 3300039447 Bacteria 3798
1418 Ga0436361_0855221 3300039447 Bacteria 27363
1419 Ga0436362_0382984 3300039453 Bacteria 14450
1420 Ga0436362_1236702 3300039453 Bacteria 1213
1421 Ga0439447_045642 3300041407 Bacteria 1057
1422 Ga0451807_2464331 3300041486 Bacteria 2491
1423 Ga0439445_0000394 3300042004 Bacteria 8835
1424 Ga0439449_0023428 3300042007 Bacteria 2309
1425 Ga0439434_0012601 3300042435 Bacteria 2503
1426 Ga0439435_0090056 3300042436 Bacteria 931
1427 Ga0439464_0081388 3300042439 Bacteria 967
1428 Ga0439460_0021407 3300042461 Bacteria 1767
1429 Ga0451577_0075287 3300042876 Bacteria 3010
1430 Ga0451577_0305386 3300042876 Bacteria 1442
1431 Ga0466972_0000019 3300044658 Bacteria 198523
1432 Ga0466966_0143238 3300044684 Bacteria 1460
1433 Ga0453684_0494672 3300044712 Bacteria 1355
1434 Ga0466968_0112748 3300044735 Bacteria 1224
1435 Ga0466970_0003287 3300044765 Bacteria 7855
1436 Ga0466957_0132236 3300044842 Bacteria 1600
1437 Ga0451576_0070987 3300045051 Bacteria 3625
1438 Ga0451576_0096464 3300045051 Bacteria 3076
1439 Ga0451576_0105314 3300045051 Bacteria 2934
1440 Ga0451576_0127998 3300045051 Bacteria 2646
1441 Ga0451576_0240038 3300045051 Bacteria 1893
1442 Ga0451576_0251267 3300045051 Bacteria 1848
1443 Ga0451576_0554318 3300045051 Bacteria 1208
1444 Ga0451576_1007477 3300045051 Bacteria 873
1445 Ga0495627_005848 3300046453 Bacteria 4893
1446 Ga0495592_0076533 3300046454 Bacteria 2427
1447 Ga0495592_0183310 3300046454 Bacteria 1424
1448 Ga0495603_0020222 3300046455 Bacteria 4035
1449 Ga0495651_0043505 3300046462 Bacteria 3484
1450 Ga0495651_0044993 3300046462 Bacteria 3420
1451 Ga0495651_0270947 3300046462 Bacteria 1151
1452 Ga0495653_0111217 3300046463 Bacteria 1968
1453 Ga0495653_0134376 3300046463 Bacteria 1747
1454 Ga0495650_0000022 3300046471 Bacteria 530747
1455 Ga0495650_0000030 3300046471 Bacteria 436318
1456 Ga0495650_0000036 3300046471 Bacteria 400633
1457 Ga0495650_0000095 3300046471 Bacteria 218020
1458 Ga0495650_0057210 3300046471 Bacteria 1579
1459 Ga0495650_0057920 3300046471 Bacteria 1566
1460 Ga0495580_0001994 3300046472 Bacteria 17957
1461 Ga0495580_0023216 3300046472 Bacteria 4557
1462 Ga0495580_0097339 3300046472 Bacteria 2046
1463 Ga0495580_0116033 3300046472 Bacteria 1860
1464 Ga0495639_0223262 3300046475 Bacteria 927
1465 Ga0495662_0007085 3300046476 Bacteria 5566
1466 Ga0495664_0002538 3300046477 Bacteria 9813
1467 Ga0495664_0031676 3300046477 Bacteria 3101
1468 Ga0495664_0089458 3300046477 Bacteria 1851
1469 Ga0495585_0000198 3300046492 Bacteria 62640
1470 Ga0495585_0013061 3300046492 Bacteria 4871
1471 Ga0495585_0142150 3300046492 Bacteria 1256
1472 Ga0495594_0004316 3300046499 Bacteria 7309
1473 Ga0495596_0030617 3300046500 Bacteria 2153
1474 Ga0495583_0097043 3300046506 Bacteria 1262
1475 Ga0495606_0000009 3300046507 Bacteria 306313
1476 Ga0495606_0000109 3300046507 Bacteria 139572
1477 Ga0495606_0003985 3300046507 Bacteria 15097
1478 Ga0495606_0004976 3300046507 Bacteria 12959
1479 Ga0495606_0010903 3300046507 Bacteria 7481
1480 Ga0495606_0012394 3300046507 Bacteria 6840
1481 Ga0495606_0013915 3300046507 Bacteria 6315
1482 Ga0495606_0073017 3300046507 Bacteria 2154
1483 Ga0495606_0094811 3300046507 Bacteria 1828
1484 Ga0495606_0279172 3300046507 Unclassified 914
1485 Ga0495610_0000080 3300046512 Bacteria 114528
1486 Ga0495610_0000270 3300046512 Bacteria 54119
1487 Ga0495610_0000783 3300046512 Bacteria 29899
1488 Ga0495610_0005278 3300046512 Bacteria 9242
1489 Ga0495610_0048069 3300046512 Bacteria 2096
1490 Ga0495610_0186481 3300046512 Bacteria 859
1491 Ga0495616_0002230 3300046513 Bacteria 12967
1492 Ga0495618_0143001 3300046514 Bacteria 1530
1493 Ga0495628_0000041 3300046516 Bacteria 102320
1494 Ga0495628_0028970 3300046516 Bacteria 4494
1495 Ga0495628_0063608 3300046516 Bacteria 2890
1496 Ga0495628_0122859 3300046516 Bacteria 1990
1497 Ga0495628_0122911 3300046516 Bacteria 1990
1498 Ga0495630_0002005 3300046517 Bacteria 14160
1499 Ga0495630_0015774 3300046517 Bacteria 5521
1500 Ga0495630_0345131 3300046517 Bacteria 1139
1501 Ga0495631_0125326 3300046518 Bacteria 1104
1502 Ga0495632_0000008 3300046519 Bacteria 294056
1503 Ga0495632_0000112 3300046519 Bacteria 83248
1504 Ga0495637_0067880 3300046520 Bacteria 1446
1505 Ga0495637_0093735 3300046520 Bacteria 1181
1506 Ga0495637_0118949 3300046520 Bacteria 1018
1507 Ga0495637_0153494 3300046520 Bacteria 868
1508 Ga0495643_0055800 3300046522 Bacteria 2111
1509 Ga0495644_0000075 3300046523 Bacteria 48572
1510 Ga0495644_0000076 3300046523 Bacteria 48468
1511 Ga0495648_0008857 3300046524 Bacteria 7871
1512 Ga0495648_0032458 3300046524 Bacteria 3425
1513 Ga0495648_0035850 3300046524 Bacteria 3210
1514 Ga0495663_0006646 3300046525 Bacteria 3191
1515 Ga0495666_0005232 3300046526 Bacteria 6551
1516 Ga0495642_0071544 3300046528 Bacteria 1451
1517 Ga0495642_0074359 3300046528 Bacteria 1424
1518 Ga0495652_0033213 3300046529 Bacteria 4507
1519 Ga0495652_0098415 3300046529 Bacteria 2377
1520 Ga0495652_0232866 3300046529 Bacteria 1376
1521 Ga0495652_0247343 3300046529 Bacteria 1323
1522 Ga0495654_0000129 3300046530 Bacteria 81860
1523 Ga0495640_0055191 3300046533 Bacteria 2718
1524 Ga0495586_0292885 3300046535 Bacteria 932
1525 Ga0495587_0047666 3300046536 Bacteria 2540
1526 Ga0495609_0001316 3300046538 Bacteria 16887
1527 Ga0495645_0002958 3300046543 Bacteria 11507
1528 Ga0495645_0005363 3300046543 Bacteria 8791
1529 Ga0495645_0036006 3300046543 Bacteria 3609
1530 Ga0495645_0047707 3300046543 Bacteria 3120
1531 Ga0495645_0078181 3300046543 Bacteria 2378
1532 Ga0495633_0000027 3300046558 Bacteria 204613
1533 Ga0495633_0028707 3300046558 Bacteria 2709
1534 Ga0495667_0092994 3300046559 Bacteria 1952
1535 Ga0495667_0137514 3300046559 Bacteria 1575
1536 Ga0495667_0142268 3300046559 Bacteria 1546
1537 Ga0495667_0212044 3300046559 Bacteria 1237
1538 Ga0495656_0015261 3300046615 Bacteria 2897
1539 Ga0495668_0000010 3300046616 Bacteria 487308
1540 Ga0495668_0064646 3300046616 Bacteria 2014
1541 Ga0495668_0076267 3300046616 Bacteria 1841
1542 Ga0495634_0096238 3300046642 Bacteria 1917
1543 Ga0495611_0000342 3300046648 Bacteria 30350
1544 Ga0495611_0217345 3300046648 Bacteria 889
1545 Ga0495625_0000007 3300046660 Bacteria 565749
1546 Ga0495625_0000289 3300046660 Bacteria 77651
1547 Ga0495625_0000576 3300046660 Bacteria 53723
1548 Ga0495625_0015147 3300046660 Bacteria 6119
1549 Ga0495625_0026503 3300046660 Bacteria 4381
1550 Ga0495625_0030448 3300046660 Bacteria 4027
1551 Ga0495625_0031693 3300046660 Bacteria 3929
1552 Ga0495625_0070292 3300046660 Bacteria 2458
1553 Ga0495625_0097532 3300046660 Bacteria 2023
1554 Ga0495625_0113942 3300046660 Bacteria 1846
1555 Ga0495625_0119709 3300046660 Bacteria 1793
1556 Ga0495625_0168013 3300046660 Bacteria 1466
1557 Ga0495625_0383443 3300046660 Bacteria 881
1558 Ga0495661_0004927 3300046665 Bacteria 9552
1559 Ga0495661_0005579 3300046665 Bacteria 8922
1560 Ga0495661_0012118 3300046665 Bacteria 5828
1561 Ga0495661_0099037 3300046665 Bacteria 1644
1562 Ga0495599_0025262 3300046678 Bacteria 3718
1563 Ga0495599_0032020 3300046678 Bacteria 3300
1564 Ga0495623_0028098 3300046679 Bacteria 3621
1565 Ga0495623_0038896 3300046679 Bacteria 3041
1566 Ga0495623_0054998 3300046679 Bacteria 2510
1567 Ga0495646_0037602 3300046680 Bacteria 2993
1568 Ga0495646_0196417 3300046680 Bacteria 1100
1569 Ga0495658_0298807 3300046683 Bacteria 1018
1570 Ga0495658_0483644 3300046683 Bacteria 792
1571 Ga0495669_0002214 3300046684 Bacteria 7980
1572 Ga0495669_0016551 3300046684 Bacteria 3159
1573 Ga0495613_0381204 3300046689 Bacteria 964
1574 Ga0495624_0175598 3300046690 Bacteria 1306
1575 Ga0495670_0005705 3300046691 Bacteria 6106
1576 Ga0495670_0147092 3300046691 Bacteria 1234
1577 Ga0495649_0000007 3300046694 Bacteria 518037
1578 Ga0495600_0151715 3300046809 Bacteria 1500
1579 Ga0495600_0202691 3300046809 Bacteria 1274
1580 Ga0495660_0005538 3300046810 Bacteria 7558
1581 Ga0495581_0090808 3300047315 Bacteria 1772
1582 Ga0495581_0129745 3300047315 Bacteria 1469
1583 Ga0495604_0067498 3300047317 Bacteria 2717
1584 Ga0495604_0122828 3300047317 Bacteria 1877
1585 Ga0495636_0014481 3300047318 Bacteria 3136
1586 Ga0495674_0031437 3300047319 Bacteria 4822
1587 Ga0495674_0059924 3300047319 Bacteria 3323
1588 Ga0495674_0124778 3300047319 Bacteria 2173
1589 Ga0495672_0074765 3300047320 Bacteria 1907
1590 Ga0495672_0078528 3300047320 Bacteria 1846
1591 Ga0495676_0080314 3300047321 Bacteria 2477
1592 Ga0495680_0047117 3300047322 Bacteria 3393
1593 Ga0495680_0279618 3300047322 Bacteria 1177
1594 Ga0495683_0020798 3300047323 Bacteria 3384
1595 Ga0495683_0036594 3300047323 Bacteria 2491
1596 Ga0495683_0104602 3300047323 Bacteria 1358
1597 Ga0495687_000960 3300047443 Bacteria 29594
1598 Ga0495675_0138295 3300047444 Bacteria 1511
1599 Ga0495673_0030286 3300047469 Bacteria 2543
1600 Ga0495681_0089589 3300047470 Bacteria 1361
1601 Ga0495684_0005038 3300047471 Bacteria 10309
1602 Ga0495684_0056102 3300047471 Bacteria 3004
1603 Ga0495684_0071559 3300047471 Unclassified 2635
1604 Ga0495684_0120927 3300047471 Bacteria 1972
1605 Ga0495684_0215058 3300047471 Bacteria 1411
1606 Ga0495686_0000026 3300047472 Bacteria 383637
1607 Ga0495686_0000064 3300047472 Bacteria 226284
1608 Ga0495686_0000277 3300047472 Bacteria 90929
1609 Ga0495686_0006195 3300047472 Bacteria 9228
1610 Ga0495686_0021029 3300047472 Bacteria 4343
1611 Ga0495686_0029470 3300047472 Bacteria 3570
1612 Ga0495686_0032401 3300047472 Bacteria 3383
1613 Ga0495686_0041117 3300047472 Bacteria 2945
1614 Ga0495686_0050475 3300047472 Bacteria 2614
1615 Ga0495686_0120909 3300047472 Bacteria 1561
1616 Ga0495686_0175288 3300047472 Bacteria 1245
1617 Ga0495686_0183800 3300047472 Unclassified 1210
1618 Ga0495602_0224933 3300048088 Unclassified 1414
1619 Ga0495602_0225993 3300048088 Bacteria 1409
1620 Ga0496100_0004064 3300048903 Bacteria 7714
1621 Ga0496100_0043793 3300048903 Bacteria 2864
1622 Ga0496100_0126562 3300048903 Bacteria 1794
1623 Ga0496101_0006160 3300048904 Bacteria 7705
1624 Ga0496101_0013899 3300048904 Bacteria 5404
1625 Ga0496101_0103500 3300048904 Bacteria 2134
1626 Ga0496101_0166953 3300048904 Bacteria 1690
1627 Ga0496101_0201505 3300048904 Bacteria 1539
1628 Ga0496101_0430090 3300048904 Bacteria 1041
1629 Ga0496101_0512549 3300048904 Bacteria 948
1630 Ga0496101_0710274 3300048904 Bacteria 794
1631 Ga0496102_0000946 3300048905 Bacteria 27368
1632 Ga0496102_0139945 3300048905 Bacteria 2269
1633 Ga0496102_0202514 3300048905 Bacteria 1871
1634 Ga0496102_0223781 3300048905 Unclassified 1774
1635 Ga0496102_0322287 3300048905 Bacteria 1456
1636 Ga0496102_0540193 3300048905 Bacteria 1088
1637 Ga0496103_0010131 3300048906 Bacteria 5574
1638 Ga0496103_0040210 3300048906 Bacteria 2874
1639 Ga0496103_0070560 3300048906 Bacteria 2186
1640 Ga0496103_0141636 3300048906 Bacteria 1538
1641 Ga0496104_0000027 3300048907 Bacteria 203475
1642 Ga0496104_0011624 3300048907 Bacteria 7891
1643 Ga0496104_0016360 3300048907 Bacteria 6735
1644 Ga0496104_0021707 3300048907 Bacteria 5897
1645 Ga0496104_0048811 3300048907 Bacteria 3991
1646 Ga0496104_0084748 3300048907 Bacteria 3024
1647 Ga0496104_0168117 3300048907 Bacteria 2103
1648 Ga0496105_0001188 3300048908 Bacteria 18120
1649 Ga0496105_0002965 3300048908 Bacteria 12457
1650 Ga0496105_0038031 3300048908 Bacteria 3964
1651 Ga0496105_0059892 3300048908 Bacteria 3141
1652 Ga0496105_0115500 3300048908 Bacteria 2214
1653 Ga0496105_0166259 3300048908 Unclassified 1810
1654 Ga0496105_0339364 3300048908 Bacteria 1202
1655 Ga0496106_0005544 3300048909 Bacteria 9341
1656 Ga0496106_0007251 3300048909 Bacteria 8188
1657 Ga0496106_0244603 3300048909 Unclassified 1434
1658 Ga0496107_0030961 3300048910 Bacteria 3815
1659 Ga0496107_0041881 3300048910 Bacteria 3290
1660 Ga0496107_0051037 3300048910 Bacteria 2982
1661 Ga0496107_0750623 3300048910 Bacteria 716
1662 Ga0496108_0122283 3300048911 Bacteria 2233
1663 Ga0496108_0169442 3300048911 Bacteria 1889
1664 Ga0496109_0000091 3300048912 Bacteria 93698
1665 Ga0496109_0017683 3300048912 Bacteria 6254
1666 Ga0496109_0049859 3300048912 Unclassified 3813
1667 Ga0496109_0156055 3300048912 Bacteria 2138
1668 Ga0496109_0216891 3300048912 Bacteria 1799
1669 Ga0496109_0668576 3300048912 Bacteria 976
1670 Ga0496110_0002962 3300048913 Bacteria 12872
1671 Ga0496110_0049965 3300048913 Bacteria 3671
1672 Ga0496110_0283452 3300048913 Bacteria 1509
1673 Ga0496110_0462548 3300048913 Unclassified 1156
1674 Ga0496110_0580968 3300048913 Bacteria 1017
1675 Ga0496110_0684588 3300048913 Bacteria 926
1676 Ga0496110_0804496 3300048913 Bacteria 844
1677 Ga0496111_0125921 3300048914 Bacteria 1894
1678 Ga0496111_0297399 3300048914 Bacteria 1197
1679 Ga0496112_0008797 3300048915 Bacteria 9060
1680 Ga0496112_0031173 3300048915 Bacteria 5168
1681 Ga0496112_0051547 3300048915 Bacteria 4037
1682 Ga0496112_0060874 3300048915 Bacteria 3720
1683 Ga0496112_0086152 3300048915 Bacteria 3108
1684 Ga0496112_0107454 3300048915 Bacteria 2760
1685 Ga0496112_0177829 3300048915 Bacteria 2092
1686 Ga0496112_0206523 3300048915 Bacteria 1922
1687 Ga0496112_0212245 3300048915 Bacteria 1893
1688 Ga0496112_0454907 3300048915 Unclassified 1218
1689 Ga0496112_0585591 3300048915 Bacteria 1048
1690 Ga0496113_0012323 3300048916 Bacteria 5743
1691 Ga0496113_0072026 3300048916 Bacteria 2629
1692 Ga0496113_0224036 3300048916 Bacteria 1499
1693 Ga0496113_0225434 3300048916 Bacteria 1494
1694 Ga0496113_0243301 3300048916 Bacteria 1436
1695 Ga0496113_0267995 3300048916 Bacteria 1365
1696 Ga0496113_0351654 3300048916 Bacteria 1182
1697 Ga0496114_0075334 3300048917 Bacteria 2842
1698 Ga0496114_0221236 3300048917 Bacteria 1662
1699 Ga0496115_0009806 3300048918 Bacteria 7131
1700 Ga0496115_0020238 3300048918 Bacteria 5131
1701 Ga0496115_0030154 3300048918 Bacteria 4265
1702 Ga0496115_0055630 3300048918 Bacteria 3178
1703 Ga0496115_0093407 3300048918 Bacteria 2460
1704 Ga0496115_0219031 3300048918 Bacteria 1571
1705 Ga0496115_0349023 3300048918 Bacteria 1207
1706 Ga0496116_0105114 3300048919 Bacteria 1676
1707 Ga0496117_0030397 3300048920 Bacteria 4147
1708 Ga0496117_0174248 3300048920 Bacteria 1245
1709 Ga0496118_0001748 3300048921 Bacteria 31538
1710 Ga0496119_0141089 3300048922 Bacteria 1301
1711 Ga0496121_0000011 3300048924 Bacteria 792193
1712 Ga0496121_0000044 3300048924 Bacteria 337672
1713 Ga0496121_0324816 3300048924 Bacteria 1035
1714 Ga0496121_0333166 3300048924 Bacteria 1017
1715 Ga0496122_0003747 3300048925 Bacteria 19611
1716 Ga0496123_0058130 3300048926 Bacteria 2511
1717 Ga0496125_0023369 3300048928 Bacteria 5707
1718 Ga0496126_0000111 3300048929 Bacteria 195620
1719 Ga0496126_0002726 3300048929 Bacteria 23341
1720 Ga0496126_0005234 3300048929 Bacteria 14933
1721 Ga0496126_0014583 3300048929 Bacteria 7939
1722 Ga0496126_0420184 3300048929 Bacteria 1081
1723 Ga0501305_031555 3300049161 Bacteria 828
1724 Ga0495682_0047733 3300049460 Bacteria 1562
1725 Ga0501300_003229 3300049523 Bacteria 2431
1726 Ga0501031_0000726 3300049568 Bacteria 19747
1727 Ga0501032_0002304 3300049569 Bacteria 14985
1728 Ga0501034_0005765 3300049571 Bacteria 13466
1729 Ga0501034_0038204 3300049571 Bacteria 4862
1730 Ga0501034_0275220 3300049571 Bacteria 1624
1731 Ga0501034_0447320 3300049571 Bacteria 1210
1732 Ga0501037_0000547 3300049573 Bacteria 29890
1733 Ga0501038_0002643 3300049574 Bacteria 16763
1734 Ga0501038_0111914 3300049574 Bacteria 2261
1735 Ga0501039_0059539 3300049575 Bacteria 2958
1736 Ga0501041_0099402 3300049577 Bacteria 1800
1737 Ga0501043_0007415 3300049579 Bacteria 8704
1738 Ga0501043_0010762 3300049579 Bacteria 7164
1739 Ga0501043_0023087 3300049579 Bacteria 4879
1740 Ga0501046_0001515 3300049580 Bacteria 22165
1741 Ga0501046_0008970 3300049580 Bacteria 8684
1742 Ga0501047_0004941 3300049581 Bacteria 12519
1743 Ga0501047_0238654 3300049581 Bacteria 1669
1744 Ga0501047_0457317 3300049581 Bacteria 1105
1745 Ga0501048_0040585 3300049582 Bacteria 3335
1746 Ga0501048_0467870 3300049582 Bacteria 903
1747 Ga0501068_0164201 3300049584 Bacteria 1400
1748 Ga0501068_0428089 3300049584 Bacteria 855
1749 Ga0501070_0000452 3300049586 Bacteria 37359
1750 Ga0501071_0039815 3300049587 Bacteria 3363
1751 Ga0501073_0002112 3300049589 Bacteria 14892
1752 Ga0501075_0048900 3300049591 Bacteria 3178
1753 Ga0501227_000581 3300049665 Bacteria 7985
1754 Ga0501247_000834 3300049677 Bacteria 2712
1755 Ga0501249_007668 3300049679 Bacteria 2235
1756 Ga0501249_043169 3300049679 Bacteria 1025
1757 Ga0501080_0020208 3300049742 Bacteria 6164
1758 Ga0501080_0504107 3300049742 Bacteria 1081
1759 Ga0501081_0001799 3300049743 Bacteria 13294
1760 Ga0501083_0002960 3300049744 Bacteria 11774
1761 Ga0501083_0058808 3300049744 Bacteria 2572
1762 Ga0501241_011915 3300049758 Bacteria 1579
1763 Ga0501035_0026004 3300049822 Bacteria 5361
1764 Ga0501044_0004088 3300049823 Bacteria 16365
1765 Ga0501044_0083833 3300049823 Bacteria 3222
1766 Ga0501044_0131829 3300049823 Bacteria 2493
1767 Ga0501044_0205328 3300049823 Bacteria 1927
1768 nmdc:mga03n38_18187_c1 3300050490 Bacteria 2769
1769 nmdc:mga00v17_156316_c1 3300050491 Bacteria 1466
1770 nmdc:mga0k408_142881_c1 3300050493 Bacteria 1424
1771 nmdc:mga0k408_166_c1 3300050493 Bacteria 34700
1772 nmdc:mga0k408_5196_c1 3300050493 Bacteria 6903
1773 nmdc:mga0k408_82778_c1 3300050493 Bacteria 1881
1774 nmdc:mga06z11_249297_c1 3300050494 Bacteria 1045
1775 nmdc:mga05p37_104492_c1 3300050507 Bacteria 3485
1776 nmdc:mga05p37_17846_c1 3300050507 Bacteria 8566
1777 nmdc:mga05p37_294687_c1 3300050507 Bacteria 1930
1778 nmdc:mga05p37_2967_c1 3300050507 Bacteria 19697
1779 nmdc:mga05p37_594328_c1 3300050507 Bacteria 1250
1780 nmdc:mga05p37_735341_c1 3300050507 Bacteria 1090
1781 nmdc:mga05p37_866028_c1 3300050507 Bacteria 979
1782 nmdc:mga05p37_97754_c1 3300050507 Bacteria 3616
1783 nmdc:mga09592_138225_c1 3300050508 Bacteria 2099
1784 nmdc:mga0qj67_328988_c1 3300050509 Bacteria 1237
1785 nmdc:mga06r32_17245_c1 3300050510 Bacteria 6591
1786 nmdc:mga06r32_299080_c1 3300050510 Bacteria 1596
1787 nmdc:mga06r32_320973_c1 3300050510 Bacteria 1534
1788 nmdc:mga06r32_906622_c1 3300050510 Bacteria 838
1789 nmdc:mga08y16_117879_c1 3300050511 Bacteria 2763
1790 nmdc:mga08y16_17119_c1 3300050511 Bacteria 7631
1791 nmdc:mga08y16_274775_c1 3300050511 Bacteria 1739
1792 nmdc:mga08y16_367293_c1 3300050511 Bacteria 1476
1793 nmdc:mga08y16_48835_c1 3300050511 Bacteria 4429
1794 nmdc:mga08y16_503066_c1 3300050511 Bacteria 1231
1795 nmdc:mga08y16_55335_c1 3300050511 Bacteria 4146
1796 nmdc:mga0n895_145316_c1 3300050512 Bacteria 2401
1797 nmdc:mga0n895_380239_c1 3300050512 Bacteria 1429
1798 nmdc:mga0n895_486087_c1 3300050512 Bacteria 1245
1799 nmdc:mga0n895_526520_c1 3300050512 Bacteria 1189
1800 nmdc:mga0n895_532451_c1 3300050512 Bacteria 1182
1801 nmdc:mga0n895_70428_c1 3300050512 Bacteria 3466
1802 nmdc:mga0n895_71563_c1 3300050512 Bacteria 3439
1803 nmdc:mga0rr50_218078_c1 3300050513 Bacteria 1574
1804 nmdc:mga0rr50_267035_c1 3300050513 Bacteria 1425
1805 nmdc:mga0rr50_635343_c1 3300050513 Unclassified 911
1806 nmdc:mga0rr50_658680_c1 3300050513 Unclassified 893
1807 nmdc:mga0rr50_662066_c1 3300050513 Bacteria 891
1808 nmdc:mga0rr50_678294_c1 3300050513 Bacteria 879
1809 nmdc:mga08x19_330680_c1 3300050514 Bacteria 1062
1810 nmdc:mga08x19_689_c1 3300050514 Bacteria 21661
1811 nmdc:mga0a205_105939_c1 3300050515 Bacteria 2710
1812 nmdc:mga0a205_153371_c1 3300050515 Bacteria 2202
1813 nmdc:mga0a205_193006_c1 3300050515 Bacteria 1928
1814 nmdc:mga0a205_217946_c1 3300050515 Bacteria 1795
1815 nmdc:mga0a205_248389_c1 3300050515 Bacteria 1659
1816 nmdc:mga0a205_31521_c1 3300050515 Bacteria 2540
1817 nmdc:mga0a205_363369_c1 3300050515 Bacteria 1314
1818 nmdc:mga0a205_47524_c1 3300050515 Bacteria 4141
1819 nmdc:mga0a205_649607_c1 3300050515 Bacteria 906
1820 nmdc:mga0a205_6645_c1 3300050515 Bacteria 10468
1821 nmdc:mga0a205_760808_c1 3300050515 Bacteria 817
1822 Ga0495601_0071977 3300053077 Bacteria 2208
1823 Ga0495601_0152183 3300053077 Bacteria 1510
1824 Ga0495612_0127115 3300053078 Bacteria 1099
1825 Ga0495595_0094410 3300053084 Bacteria 1438
1826 Ga0495619_0115404 3300053085 Unclassified 1838
1827 Ga0500578_0000003 3300053086 Bacteria 266033
1828 Ga0500643_000021 3300053087 Bacteria 284326
1829 Ga0500643_002380 3300053087 Bacteria 9797
1830 Ga0500644_0013203 3300053088 Bacteria 2302
1831 Ga0500644_0108073 3300053088 Bacteria 1067
1832 Ga0500583_0000132 3300053092 Bacteria 33604
1833 Ga0500583_0148334 3300053092 Bacteria 1167
1834 Ga0500583_0149451 3300053092 Bacteria 1162
1835 Ga0500641_0000014 3300053096 Bacteria 150696
1836 Ga0500641_0017561 3300053096 Bacteria 2678
1837 Ga0500641_0082126 3300053096 Bacteria 1369
1838 Ga0500650_0180041 3300053098 Bacteria 969
1839 Ga0500555_000024 3300053103 Bacteria 134279
1840 Ga0500555_000113 3300053103 Bacteria 38205
1841 Ga0500555_036128 3300053103 Bacteria 1386
1842 Ga0500556_0003987 3300053104 Bacteria 4259
1843 Ga0500556_0006872 3300053104 Bacteria 3238
1844 Ga0500556_0010957 3300053104 Bacteria 2674
1845 Ga0500556_0043499 3300053104 Bacteria 1595
1846 Ga0500562_000083 3300053108 Bacteria 41350
1847 Ga0500562_001999 3300053108 Bacteria 5116
1848 Ga0500569_000255 3300053109 Bacteria 8456
1849 Ga0500594_0065459 3300053118 Bacteria 1057
1850 Ga0500618_000050 3300053125 Bacteria 105238
1851 Ga0500642_0028512 3300053130 Bacteria 2304
1852 Ga0500642_0147672 3300053130 Bacteria 1103
1853 Ga0500652_010533 3300053131 Bacteria 3172
1854 Ga0500658_0034491 3300053134 Bacteria 1997
1855 Ga0500559_0008235 3300053136 Bacteria 4585
1856 Ga0500559_0008389 3300053136 Bacteria 4531
1857 Ga0500568_0007555 3300053139 Bacteria 5319
1858 Ga0500568_0012736 3300053139 Bacteria 3857
1859 Ga0500568_0125562 3300053139 Bacteria 955
1860 Ga0500573_0153878 3300053140 Bacteria 1256
1861 Ga0500573_0199324 3300053140 Bacteria 1064
1862 Ga0500577_0012747 3300053142 Bacteria 2550
1863 Ga0500589_094521 3300053147 Bacteria 1310
1864 Ga0500604_0006781 3300053151 Bacteria 3030
1865 Ga0500604_0008512 3300053151 Bacteria 2723
1866 Ga0500604_0008830 3300053151 Bacteria 2677
1867 Ga0500604_0065662 3300053151 Bacteria 1148
1868 Ga0500616_0000445 3300053153 Bacteria 54193
1869 Ga0500616_0001834 3300053153 Bacteria 19250
1870 Ga0500616_0035110 3300053153 Bacteria 2728
1871 Ga0500616_0041840 3300053153 Bacteria 2456
1872 Ga0500616_0081095 3300053153 Bacteria 1630
1873 Ga0500622_0000002 3300053156 Bacteria 646442
1874 Ga0500622_0000027 3300053156 Bacteria 232414
1875 Ga0500622_0000062 3300053156 Bacteria 130392
1876 Ga0500622_0000072 3300053156 Bacteria 112062
1877 Ga0500622_0000407 3300053156 Bacteria 40911
1878 Ga0500622_0000619 3300053156 Bacteria 32146
1879 Ga0500622_0005528 3300053156 Bacteria 7560
1880 Ga0500622_0007076 3300053156 Bacteria 6415
1881 Ga0500622_0008291 3300053156 Bacteria 5826
1882 Ga0500622_0046145 3300053156 Unclassified 2253
1883 Ga0500622_0180889 3300053156 Bacteria 974
1884 Ga0500627_0011694 3300053158 Bacteria 3256
1885 Ga0500634_0030694 3300053161 Bacteria 2929
1886 Ga0500637_0198025 3300053178 Bacteria 1145
1887 Ga0500611_001231 3300053727 Bacteria 2748
1888 Ga0500645_000021 3300053730 Bacteria 133415
1889 Ga0500645_003997 3300053730 Bacteria 5802
1890 Ga0500661_003527 3300055283 Bacteria 2936
1891 Ga0500661_006156 3300055283 Bacteria 2237
1892 Ga0500661_010243 3300055283 Bacteria 1708
1893 Ga0500661_011182 3300055283 Bacteria 1626
1894 Ga0500661_013044 3300055283 Bacteria 1498
1895 Ga0530510_0083862 3300061734 Bacteria 2321
1896 Ga0530510_0224409 3300061734 Bacteria 1397

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0787424 Ga0436360_0787424_680_1426 174
2 3300005445 Ga0070708_100107555 Ga0070708_1001075553 176
3 3300048929 Ga0496126_0420184 Ga0496126_0420184_286_1032 187
4 3300013105 Ga0157369_10070994 Ga0157369_100709942 190
5 3300039438 Ga0436360_1069475 Ga0436360_1069475_906_1667 190
6 3300050510 nmdc:mga06r32_17245_c1 nmdc:mga06r32_17245_c1_1473_2267 190
7 3300046471 Ga0495650_0057210 Ga0495650_0057210_341_1156 192
8 3300005840 Ga0068870_10090861 Ga0068870_100908612 193
9 3300009553 Ga0105249_10780358 Ga0105249_107803581 193
10 3300025908 Ga0207643_10099096 Ga0207643_100990962 193
11 3300005544 Ga0070686_100037633 Ga0070686_1000376332 195
12 3300013296 Ga0157374_10000045 Ga0157374_1000004558 195
13 3300014969 Ga0157376_10000097 Ga0157376_1000009715 195
14 3300025903 Ga0207680_10141846 Ga0207680_101418463 195
15 3300026116 Ga0207674_10112209 Ga0207674_101122092 195
16 3300032005 Ga0307411_10518975 Ga0307411_105189752 195
17 iso_pu_bacteria 2977864932 2977869916 195
18 3300005536 Ga0070697_100455655 Ga0070697_1004556551 196
19 3300005577 Ga0068857_100059990 Ga0068857_1000599905 196
20 3300025981 Ga0207640_10173063 Ga0207640_101730631 196
21 3300026116 Ga0207674_10072313 Ga0207674_100723132 196
22 3300005289 Ga0065704_10079873 Ga0065704_100798731 197
23 3300005293 Ga0065715_10194871 Ga0065715_101948712 197
24 3300005295 Ga0065707_10005509 Ga0065707_100055091 197
25 3300005328 Ga0070676_10010263 Ga0070676_100102635 197
26 3300005329 Ga0070683_100030301 Ga0070683_1000303012 197
27 3300005331 Ga0070670_100024906 Ga0070670_1000249062 197
28 3300005335 Ga0070666_10010872 Ga0070666_100108724 197
29 3300005344 Ga0070661_100137095 Ga0070661_1001370951 197
30 3300005347 Ga0070668_100015720 Ga0070668_1000157203 197
31 3300005353 Ga0070669_100043379 Ga0070669_1000433793 197
32 3300005354 Ga0070675_100010994 Ga0070675_1000109946 197
33 3300005355 Ga0070671_100011236 Ga0070671_1000112361 197
34 3300005356 Ga0070674_100008195 Ga0070674_1000081952 197
35 3300005365 Ga0070688_100153159 Ga0070688_1001531592 197
36 3300005367 Ga0070667_100261214 Ga0070667_1002612142 197
37 3300005456 Ga0070678_100003501 Ga0070678_1000035012 197
38 3300005459 Ga0068867_100040700 Ga0068867_1000407003 197
39 3300005466 Ga0070685_10007257 Ga0070685_100072574 197
40 3300005548 Ga0070665_100451264 Ga0070665_1004512642 197
41 3300005564 Ga0070664_100041394 Ga0070664_1000413943 197
42 3300005718 Ga0068866_10077209 Ga0068866_100772092 197
43 3300006237 Ga0097621_100131999 Ga0097621_1001319993 197
44 3300006358 Ga0068871_100093596 Ga0068871_1000935964 197
45 3300006852 Ga0075433_10162474 Ga0075433_101624741 197
46 3300006881 Ga0068865_100412591 Ga0068865_1004125912 197
47 3300009094 Ga0111539_10009211 Ga0111539_100092114 197
48 3300010375 Ga0105239_10603247 Ga0105239_106032472 197
49 3300013296 Ga0157374_10004978 Ga0157374_100049783 197
50 3300013297 Ga0157378_10104773 Ga0157378_101047734 197
51 3300013306 Ga0163162_10032242 Ga0163162_100322423 197
52 3300013308 Ga0157375_10037474 Ga0157375_100374743 197
53 3300014325 Ga0163163_10330456 Ga0163163_103304562 197
54 3300014969 Ga0157376_10017022 Ga0157376_100170223 197
55 3300025913 Ga0207695_10507389 Ga0207695_105073891 197
56 3300027907 Ga0207428_10022637 Ga0207428_100226371 197
57 3300035116 Ga0373945_0062483 Ga0373945_0062483_274_1035 197
58 3300035170 Ga0373943_0014521 Ga0373943_0014521_274_1035 197
59 3300035410 Ga0373924_0207964 Ga0373924_0207964_79_840 197
60 3300035692 Ga0373935_0017654 Ga0373935_0017654_2969_3730 197
61 3300035695 Ga0373927_0001563 Ga0373927_0001563_1332_2093 197
62 3300035725 Ga0373947_0014603 Ga0373947_0014603_2749_3510 197
63 3300037068 Ga0373925_0015026 Ga0373925_0015026_127_888 197
64 3300046517 Ga0495630_0002005 Ga0495630_0002005_11094_11855 197
65 3300046526 Ga0495666_0005232 Ga0495666_0005232_1361_2122 197
66 3300047321 Ga0495676_0080314 Ga0495676_0080314_717_1478 197
67 3300050511 nmdc:mga08y16_48835_c1 nmdc:mga08y16_48835_c1_3294_4049 197
68 3300050515 nmdc:mga0a205_363369_c1 nmdc:mga0a205_363369_c1_213_968 197
69 3300048904 Ga0496101_0430090 Ga0496101_0430090_132_884 199
70 3300048907 Ga0496104_0048811 Ga0496104_0048811_2608_3360 199
71 3300048908 Ga0496105_0059892 Ga0496105_0059892_378_1130 199
72 3300048913 Ga0496110_0804496 Ga0496110_0804496_80_832 199
73 3300048915 Ga0496112_0051547 Ga0496112_0051547_3207_3959 199
74 3300048917 Ga0496114_0221236 Ga0496114_0221236_774_1526 199
75 3300053088 Ga0500644_0108073 Ga0500644_0108073_283_1029 199
76 3300053156 Ga0500622_0046145 Ga0500622_0046145_1163_1909 199
77 3300005329 Ga0070683_100251076 Ga0070683_1002510762 200
78 3300005344 Ga0070661_100242612 Ga0070661_1002426121 200
79 3300005345 Ga0070692_10102739 Ga0070692_101027393 200
80 3300005366 Ga0070659_100047801 Ga0070659_1000478013 200
81 3300005457 Ga0070662_100143947 Ga0070662_1001439471 200
82 3300005471 Ga0070698_100036143 Ga0070698_1000361432 200
83 3300005518 Ga0070699_100041592 Ga0070699_1000415925 200
84 3300005535 Ga0070684_100316807 Ga0070684_1003168071 200
85 3300005536 Ga0070697_100127563 Ga0070697_1001275632 200
86 3300005539 Ga0068853_100028133 Ga0068853_1000281336 200
87 3300005547 Ga0070693_100029869 Ga0070693_1000298693 200
88 3300005563 Ga0068855_100073694 Ga0068855_1000736946 200
89 3300005564 Ga0070664_100173995 Ga0070664_1001739952 200
90 3300005614 Ga0068856_100113872 Ga0068856_1001138724 200
91 3300005618 Ga0068864_100078641 Ga0068864_1000786413 200
92 3300005718 Ga0068866_10049965 Ga0068866_100499653 200
93 3300005843 Ga0068860_100013670 Ga0068860_1000136705 200
94 3300006173 Ga0070716_100143688 Ga0070716_1001436882 200
95 3300006237 Ga0097621_100154495 Ga0097621_1001544953 200
96 3300006914 Ga0075436_100135679 Ga0075436_1001356792 200
97 3300009098 Ga0105245_10087081 Ga0105245_100870813 200
98 3300009101 Ga0105247_10084731 Ga0105247_100847312 200
99 3300009147 Ga0114129_10302434 Ga0114129_103024343 200
100 3300009174 Ga0105241_10041817 Ga0105241_100418173 200
101 3300009176 Ga0105242_10086226 Ga0105242_100862262 200
102 3300009177 Ga0105248_10031676 Ga0105248_100316763 200
103 3300009551 Ga0105238_10112330 Ga0105238_101123301 200
104 3300009553 Ga0105249_10547733 Ga0105249_105477331 200
105 3300010375 Ga0105239_10105566 Ga0105239_101055662 200
106 3300011119 Ga0105246_10060061 Ga0105246_100600611 200
107 3300011119 Ga0105246_10206202 Ga0105246_102062022 200
108 3300013296 Ga0157374_10249784 Ga0157374_102497842 200
109 3300013306 Ga0163162_10188644 Ga0163162_101886443 200
110 3300014325 Ga0163163_10315800 Ga0163163_103158002 200
111 3300025911 Ga0207654_10266058 Ga0207654_102660581 200
112 3300025919 Ga0207657_10135507 Ga0207657_101355073 200
113 3300025920 Ga0207649_10215656 Ga0207649_102156561 200
114 3300025924 Ga0207694_10094807 Ga0207694_100948073 200
115 3300025927 Ga0207687_10217222 Ga0207687_102172222 200
116 3300025932 Ga0207690_10244380 Ga0207690_102443802 200
117 3300025933 Ga0207706_10021646 Ga0207706_100216461 200
118 3300025934 Ga0207686_10016579 Ga0207686_100165793 200
119 3300025939 Ga0207665_10025433 Ga0207665_100254334 200
120 3300025941 Ga0207711_10013360 Ga0207711_100133603 200
121 3300025944 Ga0207661_10654729 Ga0207661_106547291 200
122 3300025945 Ga0207679_10242746 Ga0207679_102427462 200
123 3300025949 Ga0207667_10086417 Ga0207667_100864173 200
124 3300026041 Ga0207639_10040165 Ga0207639_100401655 200
125 3300026078 Ga0207702_10060900 Ga0207702_100609005 200
126 3300026089 Ga0207648_10056712 Ga0207648_100567124 200
127 3300026095 Ga0207676_10119733 Ga0207676_101197332 200
128 3300026142 Ga0207698_10355960 Ga0207698_103559601 200
129 3300046507 Ga0495606_0000109 Ga0495606_0000109_64735_65502 200
130 3300046512 Ga0495610_0000080 Ga0495610_0000080_48417_49184 200
131 3300048915 Ga0496112_0206523 Ga0496112_0206523_274_1023 200
132 3300050512 nmdc:mga0n895_380239_c1 nmdc:mga0n895_380239_c1_503_1252 200
133 3300053140 Ga0500573_0199324 Ga0500573_0199324_249_1007 200
134 3300053153 Ga0500616_0081095 Ga0500616_0081095_806_1564 200
135 3300005434 Ga0070709_10036884 Ga0070709_100368842 201
136 3300006163 Ga0070715_10087480 Ga0070715_100874802 201
137 3300006178 Ga0075367_10120258 Ga0075367_101202582 201
138 3300009174 Ga0105241_10220904 Ga0105241_102209041 201
139 3300009551 Ga0105238_10761223 Ga0105238_107612231 201
140 3300014325 Ga0163163_10060742 Ga0163163_100607424 201
141 3300014968 Ga0157379_10399348 Ga0157379_103993481 201
142 3300025905 Ga0207685_10179772 Ga0207685_101797721 201
143 3300025906 Ga0207699_10060127 Ga0207699_100601273 201
144 3300028379 Ga0268266_10146242 Ga0268266_101462422 201
145 3300048904 Ga0496101_0512549 Ga0496101_0512549_13_762 201
146 3300048905 Ga0496102_0202514 Ga0496102_0202514_748_1497 201
147 3300048908 Ga0496105_0115500 Ga0496105_0115500_927_1676 201
148 3300048911 Ga0496108_0169442 Ga0496108_0169442_121_870 201
149 3300048914 Ga0496111_0125921 Ga0496111_0125921_122_871 201
150 3300048916 Ga0496113_0072026 Ga0496113_0072026_846_1595 201
151 3300049571 Ga0501034_0447320 Ga0501034_0447320_42_647 201
152 3300005435 Ga0070714_100253080 Ga0070714_1002530802 202
153 3300005435 Ga0070714_100272064 Ga0070714_1002720642 202
154 3300005842 Ga0068858_100452040 Ga0068858_1004520402 202
155 3300006844 Ga0075428_100038091 Ga0075428_1000380913 202
156 3300006914 Ga0075436_100000737 Ga0075436_1000007378 202
157 3300009093 Ga0105240_10447402 Ga0105240_104474022 202
158 3300010375 Ga0105239_10644431 Ga0105239_106444312 202
159 3300013307 Ga0157372_10150463 Ga0157372_101504633 202
160 3300025298 Ga0209050_1016309 Ga0209050_10163093 202
161 3300025928 Ga0207700_10010139 Ga0207700_100101392 202
162 3300025929 Ga0207664_10285249 Ga0207664_102852492 202
163 3300035086 Ga0373934_0058119 Ga0373934_0058119_899_1507 202
164 3300046463 Ga0495653_0134376 Ga0495653_0134376_229_981 202
165 3300046683 Ga0495658_0483644 Ga0495658_0483644_98_706 202
166 3300048916 Ga0496113_0224036 Ga0496113_0224036_67_819 202
167 3300050514 nmdc:mga08x19_689_c1 nmdc:mga08x19_689_c1_9888_10640 202
168 3300053084 Ga0495595_0094410 Ga0495595_0094410_297_1049 202
169 3300003320 rootH2_10011305 rootH2_100113059 203
170 3300005344 Ga0070661_100065765 Ga0070661_1000657652 203
171 3300009553 Ga0105249_10172037 Ga0105249_101720372 203
172 3300013307 Ga0157372_10055063 Ga0157372_100550634 203
173 3300014325 Ga0163163_10031660 Ga0163163_100316602 203
174 3300014969 Ga0157376_10167069 Ga0157376_101670692 203
175 3300025961 Ga0207712_10096194 Ga0207712_100961942 203
176 3300028381 Ga0268264_10026134 Ga0268264_100261345 203
177 3300031911 Ga0307412_10000009 Ga0307412_1000000962 203
178 3300032004 Ga0307414_10009621 Ga0307414_100096217 203
179 3300038443 Ga0395901_0165702 Ga0395901_0165702_1547_2308 203
180 3300044735 Ga0466968_0112748 Ga0466968_0112748_597_1214 203
181 3300048908 Ga0496105_0166259 Ga0496105_0166259_387_1166 203
182 3300048919 Ga0496116_0105114 Ga0496116_0105114_177_923 203
183 3300048920 Ga0496117_0030397 Ga0496117_0030397_832_1578 203
184 3300048921 Ga0496118_0001748 Ga0496118_0001748_19924_20670 203
185 3300048924 Ga0496121_0000044 Ga0496121_0000044_216904_217650 203
186 3300049744 Ga0501083_0058808 Ga0501083_0058808_694_1446 203
187 3300053153 Ga0500616_0041840 Ga0500616_0041840_225_974 203
188 3300005290 Ga0065712_10087055 Ga0065712_100870552 204
189 3300005293 Ga0065715_10147683 Ga0065715_101476832 204
190 3300005330 Ga0070690_100002114 Ga0070690_1000021143 204
191 3300005335 Ga0070666_10002624 Ga0070666_100026247 204
192 3300005355 Ga0070671_100017645 Ga0070671_1000176456 204
193 3300005367 Ga0070667_100075388 Ga0070667_1000753883 204
194 3300005445 Ga0070708_100213318 Ga0070708_1002133182 204
195 3300005456 Ga0070678_100211814 Ga0070678_1002118143 204
196 3300005544 Ga0070686_100062590 Ga0070686_1000625903 204
197 3300005578 Ga0068854_100226516 Ga0068854_1002265161 204
198 3300005615 Ga0070702_100037631 Ga0070702_1000376312 204
199 3300005617 Ga0068859_100157980 Ga0068859_1001579802 204
200 3300005618 Ga0068864_100025453 Ga0068864_1000254534 204
201 3300005842 Ga0068858_100014256 Ga0068858_1000142567 204
202 3300006048 Ga0075363_100073380 Ga0075363_1000733802 204
203 3300006051 Ga0075364_10179029 Ga0075364_101790292 204
204 3300006237 Ga0097621_100304925 Ga0097621_1003049252 204
205 3300006358 Ga0068871_100050501 Ga0068871_1000505014 204
206 3300006931 Ga0097620_100157981 Ga0097620_1001579814 204
207 3300009101 Ga0105247_10031084 Ga0105247_100310842 204
208 3300009176 Ga0105242_10007558 Ga0105242_100075588 204
209 3300013296 Ga0157374_10054054 Ga0157374_100540542 204
210 3300013297 Ga0157378_10215790 Ga0157378_102157903 204
211 3300013308 Ga0157375_10109654 Ga0157375_101096543 204
212 3300014968 Ga0157379_10015718 Ga0157379_100157182 204
213 3300017792 Ga0163161_10004671 Ga0163161_100046717 204
214 3300025903 Ga0207680_10056882 Ga0207680_100568823 204
215 3300025927 Ga0207687_10012920 Ga0207687_100129205 204
216 3300025941 Ga0207711_10220786 Ga0207711_102207862 204
217 3300025986 Ga0207658_10490226 Ga0207658_104902261 204
218 3300026023 Ga0207677_10201763 Ga0207677_102017631 204
219 3300026035 Ga0207703_10030800 Ga0207703_100308007 204
220 3300026035 Ga0207703_10121098 Ga0207703_101210982 204
221 3300026095 Ga0207676_10049615 Ga0207676_100496154 204
222 3300026121 Ga0207683_10361633 Ga0207683_103616332 204
223 3300026142 Ga0207698_10325447 Ga0207698_103254472 204
224 3300031251 Ga0265327_10000544 Ga0265327_1000054465 204
225 3300048912 Ga0496109_0049859 Ga0496109_0049859_2529_3401 204
226 3300050490 nmdc:mga03n38_18187_c1 nmdc:mga03n38_18187_c1_1215_1970 204
227 3300050491 nmdc:mga00v17_156316_c1 nmdc:mga00v17_156316_c1_504_1259 204
228 3300005445 Ga0070708_100235214 Ga0070708_1002352143 205
229 3300005467 Ga0070706_100262307 Ga0070706_1002623072 205
230 3300005468 Ga0070707_100221720 Ga0070707_1002217202 205
231 3300005471 Ga0070698_100303759 Ga0070698_1003037593 205
232 3300005518 Ga0070699_100482206 Ga0070699_1004822061 205
233 3300005536 Ga0070697_100297742 Ga0070697_1002977422 205
234 3300005983 Ga0081540_1009888 Ga0081540_10098883 205
235 3300006237 Ga0097621_100057906 Ga0097621_1000579063 205
236 3300006237 Ga0097621_100412046 Ga0097621_1004120462 205
237 3300006358 Ga0068871_100029182 Ga0068871_1000291823 205
238 3300006358 Ga0068871_100095800 Ga0068871_1000958002 205
239 3300009094 Ga0111539_10350803 Ga0111539_103508032 205
240 3300009098 Ga0105245_10104451 Ga0105245_101044513 205
241 3300013308 Ga0157375_10816083 Ga0157375_108160831 205
242 3300025922 Ga0207646_10064785 Ga0207646_100647853 205
243 3300025927 Ga0207687_10130361 Ga0207687_101303612 205
244 3300027907 Ga0207428_10178631 Ga0207428_101786312 205
245 3300045051 Ga0451576_0105314 Ga0451576_0105314_541_1296 205
246 3300047319 Ga0495674_0124778 Ga0495674_0124778_214_966 205
247 3300050511 nmdc:mga08y16_274775_c1 nmdc:mga08y16_274775_c1_309_1067 205
248 3300005436 Ga0070713_100371393 Ga0070713_1003713932 206
249 3300006177 Ga0075362_10088742 Ga0075362_100887422 206
250 3300013104 Ga0157370_10070866 Ga0157370_100708661 206
251 3300013307 Ga0157372_10011291 Ga0157372_100112914 206
252 3300025921 Ga0207652_10468875 Ga0207652_104688751 206
253 3300033180 Ga0307510_10019189 Ga0307510_100191898 206
254 3300035692 Ga0373935_0038052 Ga0373935_0038052_1334_2086 206
255 3300035725 Ga0373947_0324446 Ga0373947_0324446_14_766 206
256 3300045051 Ga0451576_1007477 Ga0451576_1007477_41_796 206
257 3300047322 Ga0495680_0279618 Ga0495680_0279618_398_1150 206
258 3300047323 Ga0495683_0036594 Ga0495683_0036594_305_1063 206
259 3300005434 Ga0070709_10186006 Ga0070709_101860061 207
260 3300005435 Ga0070714_100050767 Ga0070714_1000507674 207
261 3300005437 Ga0070710_10286440 Ga0070710_102864401 207
262 3300005458 Ga0070681_10164729 Ga0070681_101647292 207
263 3300005563 Ga0068855_100071970 Ga0068855_1000719702 207
264 3300005616 Ga0068852_100092321 Ga0068852_1000923212 207
265 3300013105 Ga0157369_10109789 Ga0157369_101097892 207
266 3300025929 Ga0207664_10051394 Ga0207664_100513942 207
267 3300025949 Ga0207667_10040743 Ga0207667_100407435 207
268 3300026067 Ga0207678_10001362 Ga0207678_1000136216 207
269 3300026142 Ga0207698_10180080 Ga0207698_101800801 207
270 3300048907 Ga0496104_0016360 Ga0496104_0016360_5906_6652 207
271 3300048908 Ga0496105_0001188 Ga0496105_0001188_5906_6652 207
272 3300048918 Ga0496115_0349023 Ga0496115_0349023_364_1116 207
273 3300005339 Ga0070660_100142614 Ga0070660_1001426141 208
274 3300005366 Ga0070659_100146114 Ga0070659_1001461141 208
275 3300005445 Ga0070708_100352369 Ga0070708_1003523691 208
276 3300005468 Ga0070707_100163615 Ga0070707_1001636154 208
277 3300005518 Ga0070699_100035456 Ga0070699_1000354565 208
278 3300005564 Ga0070664_100143351 Ga0070664_1001433513 208
279 3300005616 Ga0068852_100281736 Ga0068852_1002817362 208
280 3300009148 Ga0105243_10448560 Ga0105243_104485602 208
281 3300009174 Ga0105241_10277315 Ga0105241_102773152 208
282 3300009551 Ga0105238_10047826 Ga0105238_100478265 208
283 3300013307 Ga0157372_10186785 Ga0157372_101867852 208
284 3300025919 Ga0207657_10521478 Ga0207657_105214781 208
285 3300025945 Ga0207679_10458177 Ga0207679_104581772 208
286 3300025949 Ga0207667_10074201 Ga0207667_100742013 208
287 3300026041 Ga0207639_10101209 Ga0207639_101012092 208
288 3300026142 Ga0207698_10217018 Ga0207698_102170181 208
289 3300028016 Ga0265354_1000929 Ga0265354_10009292 208
290 3300033547 Ga0316212_1002217 Ga0316212_10022173 208
291 3300046543 Ga0495645_0036006 Ga0495645_0036006_885_1637 208
292 3300053130 Ga0500642_0147672 Ga0500642_0147672_115_864 208
293 3300005471 Ga0070698_100010723 Ga0070698_1000107237 209
294 3300005518 Ga0070699_100000081 Ga0070699_10000008129 209
295 3300006844 Ga0075428_100028555 Ga0075428_1000285553 209
296 3300009553 Ga0105249_10928593 Ga0105249_109285932 209
297 3300025910 Ga0207684_10368160 Ga0207684_103681602 209
298 3300026035 Ga0207703_10613296 Ga0207703_106132962 209
299 3300048913 Ga0496110_0002962 Ga0496110_0002962_7817_8566 209
300 3300005355 Ga0070671_100033111 Ga0070671_1000331114 210
301 3300006175 Ga0070712_100166686 Ga0070712_1001666863 210
302 3300006237 Ga0097621_100011575 Ga0097621_1000115752 210
303 3300013307 Ga0157372_10535321 Ga0157372_105353211 210
304 3300025931 Ga0207644_10025172 Ga0207644_100251723 210
305 3300031507 Ga0307509_10210524 Ga0307509_102105242 210
306 3300035692 Ga0373935_0213109 Ga0373935_0213109_103_855 210
307 3300035695 Ga0373927_0001731 Ga0373927_0001731_10218_10970 210
308 3300039438 Ga0436360_0715715 Ga0436360_0715715_321_1085 210
309 3300048904 Ga0496101_0166953 Ga0496101_0166953_164_901 210
310 3300048915 Ga0496112_0086152 Ga0496112_0086152_1692_2453 210
311 3300048918 Ga0496115_0055630 Ga0496115_0055630_524_1285 210
312 3300049581 Ga0501047_0457317 Ga0501047_0457317_212_970 210
313 3300049823 Ga0501044_0131829 Ga0501044_0131829_130_882 210
314 3300005436 Ga0070713_100075165 Ga0070713_1000751652 211
315 3300006173 Ga0070716_100089233 Ga0070716_1000892333 211
316 3300006914 Ga0075436_100003057 Ga0075436_1000030572 211
317 3300025250 Ga0209026_1017186 Ga0209026_10171862 211
318 3300025928 Ga0207700_10109842 Ga0207700_101098422 211
319 3300031616 Ga0307508_10000116 Ga0307508_1000011628 211
320 3300036401 Ga0373937_0071800 Ga0373937_0071800_1068_1817 211
321 3300050514 nmdc:mga08x19_330680_c1 nmdc:mga08x19_330680_c1_46_798 211
322 3300053092 Ga0500583_0148334 Ga0500583_0148334_211_960 211
323 3300053096 Ga0500641_0017561 Ga0500641_0017561_578_1327 211
324 3300053118 Ga0500594_0065459 Ga0500594_0065459_266_1015 211
325 3300053151 Ga0500604_0008512 Ga0500604_0008512_217_966 211
326 3300005327 Ga0070658_10127589 Ga0070658_101275891 212
327 3300005468 Ga0070707_100134558 Ga0070707_1001345583 212
328 3300005471 Ga0070698_100026358 Ga0070698_1000263583 212
329 3300009093 Ga0105240_10012336 Ga0105240_100123366 212
330 3300013105 Ga0157369_10181703 Ga0157369_101817033 212
331 3300025909 Ga0207705_10030079 Ga0207705_100300792 212
332 3300025913 Ga0207695_10000474 Ga0207695_1000047470 212
333 3300025922 Ga0207646_10115423 Ga0207646_101154233 212
334 3300026041 Ga0207639_10757777 Ga0207639_107577771 212
335 3300005355 Ga0070671_100079001 Ga0070671_1000790013 213
336 3300005547 Ga0070693_100115109 Ga0070693_1001151091 213
337 3300006237 Ga0097621_100305393 Ga0097621_1003053932 213
338 3300006844 Ga0075428_100299543 Ga0075428_1002995432 213
339 3300017792 Ga0163161_10000097 Ga0163161_1000009774 213
340 3300025931 Ga0207644_10161245 Ga0207644_101612452 213
341 3300026067 Ga0207678_10088461 Ga0207678_100884613 213
342 3300048907 Ga0496104_0168117 Ga0496104_0168117_583_1362 213
343 3300048915 Ga0496112_0454907 Ga0496112_0454907_366_1118 213
344 3300053153 Ga0500616_0001834 Ga0500616_0001834_16566_17315 213
345 3300005547 Ga0070693_100109582 Ga0070693_1001095823 214
346 3300046660 Ga0495625_0113942 Ga0495625_0113942_27_776 214
347 3300050515 nmdc:mga0a205_760808_c1 nmdc:mga0a205_760808_c1_78_800 214
348 iso_pu_bacteria 2687453341 2688392569 214
349 3300005336 Ga0070680_100015710 Ga0070680_1000157101 215
350 3300005337 Ga0070682_100030349 Ga0070682_1000303491 215
351 3300005339 Ga0070660_100142216 Ga0070660_1001422162 215
352 3300005441 Ga0070700_100201380 Ga0070700_1002013801 215
353 3300005530 Ga0070679_100089011 Ga0070679_1000890113 215
354 3300005539 Ga0068853_100035441 Ga0068853_1000354412 215
355 3300005547 Ga0070693_100038541 Ga0070693_1000385414 215
356 3300005563 Ga0068855_100177752 Ga0068855_1001777522 215
357 3300005577 Ga0068857_100044996 Ga0068857_1000449961 215
358 3300009093 Ga0105240_10018484 Ga0105240_1001848412 215
359 3300009174 Ga0105241_10030734 Ga0105241_100307342 215
360 3300009174 Ga0105241_10198702 Ga0105241_101987022 215
361 3300009545 Ga0105237_10000462 Ga0105237_1000046239 215
362 3300013104 Ga0157370_10122116 Ga0157370_101221164 215
363 3300013105 Ga0157369_10493202 Ga0157369_104932022 215
364 3300025911 Ga0207654_10044327 Ga0207654_100443274 215
365 3300025912 Ga0207707_10001086 Ga0207707_1000108631 215
366 3300025913 Ga0207695_10357581 Ga0207695_103575811 215
367 3300025914 Ga0207671_10003590 Ga0207671_1000359012 215
368 3300025914 Ga0207671_10353822 Ga0207671_103538222 215
369 3300025916 Ga0207663_10259020 Ga0207663_102590202 215
370 3300025917 Ga0207660_10016797 Ga0207660_100167975 215
371 3300025919 Ga0207657_10041114 Ga0207657_100411148 215
372 3300025921 Ga0207652_10002241 Ga0207652_1000224114 215
373 3300025932 Ga0207690_10161831 Ga0207690_101618311 215
374 3300025949 Ga0207667_10423844 Ga0207667_104238442 215
375 3300026116 Ga0207674_10273771 Ga0207674_102737711 215
376 3300003320 rootH2_10037706 rootH2_100377069 216
377 3300003323 rootH1_10000508 rootH1_1000050829 216
378 3300005434 Ga0070709_10011492 Ga0070709_100114923 216
379 3300005435 Ga0070714_100062325 Ga0070714_1000623253 216
380 3300005435 Ga0070714_100110247 Ga0070714_1001102472 216
381 3300005439 Ga0070711_100210818 Ga0070711_1002108181 216
382 3300005563 Ga0068855_100004117 Ga0068855_10000411711 216
383 3300005577 Ga0068857_100188875 Ga0068857_1001888751 216
384 3300005578 Ga0068854_100563648 Ga0068854_1005636481 216
385 3300005616 Ga0068852_100057378 Ga0068852_1000573783 216
386 3300006175 Ga0070712_100215143 Ga0070712_1002151432 216
387 3300006844 Ga0075428_100091878 Ga0075428_1000918783 216
388 3300006871 Ga0075434_100254204 Ga0075434_1002542041 216
389 3300007076 Ga0075435_100078789 Ga0075435_1000787893 216
390 3300009093 Ga0105240_10021607 Ga0105240_100216074 216
391 3300009094 Ga0111539_10165920 Ga0111539_101659202 216
392 3300009147 Ga0114129_10009005 Ga0114129_1000900511 216
393 3300009551 Ga0105238_10235085 Ga0105238_102350852 216
394 3300013102 Ga0157371_10092471 Ga0157371_100924712 216
395 3300013104 Ga0157370_10034091 Ga0157370_100340915 216
396 3300013105 Ga0157369_10113226 Ga0157369_101132262 216
397 3300013307 Ga0157372_10116012 Ga0157372_101160123 216
398 3300013307 Ga0157372_10165050 Ga0157372_101650502 216
399 3300025898 Ga0207692_10029907 Ga0207692_100299074 216
400 3300025903 Ga0207680_10220379 Ga0207680_102203792 216
401 3300025905 Ga0207685_10108687 Ga0207685_101086871 216
402 3300025913 Ga0207695_10016801 Ga0207695_1001680113 216
403 3300025915 Ga0207693_10069869 Ga0207693_100698693 216
404 3300025928 Ga0207700_10110240 Ga0207700_101102403 216
405 3300025949 Ga0207667_10004285 Ga0207667_1000428510 216
406 3300026142 Ga0207698_10110971 Ga0207698_101109712 216
407 3300031995 Ga0307409_100179688 Ga0307409_1001796882 216
408 3300046471 Ga0495650_0057920 Ga0495650_0057920_138_887 216
409 3300048910 Ga0496107_0750623 Ga0496107_0750623_12_662 216
410 3300048924 Ga0496121_0324816 Ga0496121_0324816_137_883 216
411 3300050507 nmdc:mga05p37_866028_c1 nmdc:mga05p37_866028_c1_76_831 216
412 3300050512 nmdc:mga0n895_486087_c1 nmdc:mga0n895_486087_c1_92_856 216
413 3300050513 nmdc:mga0rr50_662066_c1 nmdc:mga0rr50_662066_c1_26_754 216
414 3300050515 nmdc:mga0a205_31521_c1 nmdc:mga0a205_31521_c1_1393_2157 216
415 3300053104 Ga0500556_0006872 Ga0500556_0006872_850_1590 216
416 3300002738 JGI25154J39366_1000044 JGI25154J39366_100004417 217
417 3300002741 JGI25157J39369_1002913 JGI25157J39369_10029135 217
418 3300003322 rootL2_10380150 rootL2_103801502 217
419 3300005354 Ga0070675_100094083 Ga0070675_1000940832 217
420 3300005436 Ga0070713_100013655 Ga0070713_1000136552 217
421 3300005444 Ga0070694_100347366 Ga0070694_1003473662 217
422 3300005458 Ga0070681_10210569 Ga0070681_102105692 217
423 3300005467 Ga0070706_100177270 Ga0070706_1001772701 217
424 3300006028 Ga0070717_10050436 Ga0070717_100504364 217
425 3300009545 Ga0105237_10131491 Ga0105237_101314911 217
426 3300009551 Ga0105238_10571369 Ga0105238_105713692 217
427 3300010375 Ga0105239_10808200 Ga0105239_108082001 217
428 3300013296 Ga0157374_10092949 Ga0157374_100929492 217
429 3300025246 Ga0209646_1000006 Ga0209646_1000006249 217
430 3300025250 Ga0209026_1000308 Ga0209026_100030820 217
431 3300025912 Ga0207707_10433323 Ga0207707_104333231 217
432 3300025914 Ga0207671_10056869 Ga0207671_100568695 217
433 3300025924 Ga0207694_10272399 Ga0207694_102723992 217
434 3300025926 Ga0207659_10237760 Ga0207659_102377602 217
435 3300025928 Ga0207700_10020574 Ga0207700_100205744 217
436 3300026023 Ga0207677_10092305 Ga0207677_100923052 217
437 3300030760 Ga0265762_1010404 Ga0265762_10104042 217
438 3300031090 Ga0265760_10015282 Ga0265760_100152822 217
439 3300036457 Ga0265778_018313 Ga0265778_018313_64_816 217
440 3300005356 Ga0070674_100579503 Ga0070674_1005795031 218
441 3300005445 Ga0070708_100412077 Ga0070708_1004120771 218
442 3300005518 Ga0070699_100000016 Ga0070699_10000001614 218
443 3300005539 Ga0068853_100978456 Ga0068853_1009784561 218
444 3300005563 Ga0068855_100149138 Ga0068855_1001491382 218
445 3300005718 Ga0068866_10124084 Ga0068866_101240842 218
446 3300009177 Ga0105248_10679859 Ga0105248_106798592 218
447 3300010375 Ga0105239_10009662 Ga0105239_100096629 218
448 3300013297 Ga0157378_10145771 Ga0157378_101457711 218
449 3300025941 Ga0207711_10429191 Ga0207711_104291912 218
450 3300031548 Ga0307408_100478324 Ga0307408_1004783242 218
451 3300031731 Ga0307405_10058203 Ga0307405_100582032 218
452 3300032002 Ga0307416_100064062 Ga0307416_1000640624 218
453 3300046616 Ga0495668_0076267 Ga0495668_0076267_977_1726 218
454 3300046660 Ga0495625_0070292 Ga0495625_0070292_667_1416 218
455 3300009094 Ga0111539_10164624 Ga0111539_101646241 219
456 3300009551 Ga0105238_10106154 Ga0105238_101061543 219
457 3300027907 Ga0207428_10437848 Ga0207428_104378481 219
458 3300028800 Ga0265338_10194102 Ga0265338_101941022 219
459 3300031456 Ga0307513_10141183 Ga0307513_101411832 219
460 3300032004 Ga0307414_10112843 Ga0307414_101128432 219
461 3300050511 nmdc:mga08y16_503066_c1 nmdc:mga08y16_503066_c1_309_1058 219
462 3300005338 Ga0068868_100005587 Ga0068868_1000055875 220
463 3300005347 Ga0070668_100053794 Ga0070668_1000537944 220
464 3300005355 Ga0070671_100443511 Ga0070671_1004435111 220
465 3300005444 Ga0070694_100524219 Ga0070694_1005242191 220
466 3300005467 Ga0070706_100010077 Ga0070706_1000100773 220
467 3300005467 Ga0070706_100043281 Ga0070706_1000432814 220
468 3300005536 Ga0070697_100040764 Ga0070697_1000407643 220
469 3300005536 Ga0070697_100098651 Ga0070697_1000986514 220
470 3300005536 Ga0070697_100283579 Ga0070697_1002835791 220
471 3300005549 Ga0070704_100199408 Ga0070704_1001994083 220
472 3300005615 Ga0070702_100105824 Ga0070702_1001058242 220
473 3300005617 Ga0068859_100000208 Ga0068859_1000002085 220
474 3300005841 Ga0068863_100030187 Ga0068863_1000301874 220
475 3300005842 Ga0068858_100065122 Ga0068858_1000651223 220
476 3300005842 Ga0068858_100238208 Ga0068858_1002382082 220
477 3300005843 Ga0068860_100064419 Ga0068860_1000644192 220
478 3300005843 Ga0068860_100206859 Ga0068860_1002068592 220
479 3300005844 Ga0068862_100000404 Ga0068862_10000040420 220
480 3300006163 Ga0070715_10000099 Ga0070715_100000993 220
481 3300006237 Ga0097621_100002700 Ga0097621_10000270012 220
482 3300006358 Ga0068871_100001480 Ga0068871_1000014808 220
483 3300006931 Ga0097620_100000208 Ga0097620_1000002085 220
484 3300009098 Ga0105245_10008717 Ga0105245_1000871710 220
485 3300009174 Ga0105241_10030744 Ga0105241_100307443 220
486 3300010375 Ga0105239_10119152 Ga0105239_101191524 220
487 3300010375 Ga0105239_10171291 Ga0105239_101712912 220
488 3300013296 Ga0157374_10143060 Ga0157374_101430602 220
489 3300013297 Ga0157378_10000429 Ga0157378_1000042919 220
490 3300013306 Ga0163162_10192852 Ga0163162_101928523 220
491 3300025321 Ga0207656_10196493 Ga0207656_101964931 220
492 3300025899 Ga0207642_10131359 Ga0207642_101313592 220
493 3300025905 Ga0207685_10000076 Ga0207685_100000763 220
494 3300025910 Ga0207684_10035157 Ga0207684_100351574 220
495 3300025922 Ga0207646_10429767 Ga0207646_104297672 220
496 3300025927 Ga0207687_10025360 Ga0207687_100253603 220
497 3300025972 Ga0207668_10142233 Ga0207668_101422332 220
498 3300026023 Ga0207677_10159613 Ga0207677_101596132 220
499 3300026035 Ga0207703_10115180 Ga0207703_101151803 220
500 3300026035 Ga0207703_10206020 Ga0207703_102060203 220
501 3300028379 Ga0268266_10047139 Ga0268266_100471393 220
502 3300028380 Ga0268265_10000297 Ga0268265_1000029724 220
503 3300028381 Ga0268264_10182129 Ga0268264_101821293 220
504 3300032002 Ga0307416_100269521 Ga0307416_1002695213 220
505 3300048922 Ga0496119_0141089 Ga0496119_0141089_155_904 220
506 3300049568 Ga0501031_0000726 Ga0501031_0000726_9461_10210 220
507 3300049569 Ga0501032_0002304 Ga0501032_0002304_12333_13082 220
508 3300049571 Ga0501034_0005765 Ga0501034_0005765_7023_7772 220
509 3300049573 Ga0501037_0000547 Ga0501037_0000547_24030_24779 220
510 3300049574 Ga0501038_0002643 Ga0501038_0002643_9858_10607 220
511 3300049575 Ga0501039_0059539 Ga0501039_0059539_10_759 220
512 3300049579 Ga0501043_0007415 Ga0501043_0007415_6793_7542 220
513 3300049580 Ga0501046_0001515 Ga0501046_0001515_7389_8138 220
514 3300049581 Ga0501047_0004941 Ga0501047_0004941_6793_7542 220
515 3300049584 Ga0501068_0164201 Ga0501068_0164201_424_1173 220
516 3300049589 Ga0501073_0002112 Ga0501073_0002112_12249_12998 220
517 3300049742 Ga0501080_0020208 Ga0501080_0020208_2900_3649 220
518 3300049822 Ga0501035_0026004 Ga0501035_0026004_922_1671 220
519 3300049823 Ga0501044_0004088 Ga0501044_0004088_1896_2645 220
520 3300050513 nmdc:mga0rr50_267035_c1 nmdc:mga0rr50_267035_c1_475_1263 220
521 3300005577 Ga0068857_100487763 Ga0068857_1004877631 221
522 3300006844 Ga0075428_100373634 Ga0075428_1003736342 221
523 3300006852 Ga0075433_10161145 Ga0075433_101611453 221
524 3300006871 Ga0075434_100122092 Ga0075434_1001220923 221
525 3300006871 Ga0075434_100830442 Ga0075434_1008304421 221
526 3300006880 Ga0075429_100393429 Ga0075429_1003934292 221
527 3300009093 Ga0105240_10006298 Ga0105240_100062984 221
528 3300009101 Ga0105247_10039932 Ga0105247_100399324 221
529 3300009147 Ga0114129_10115725 Ga0114129_101157252 221
530 3300009545 Ga0105237_10005576 Ga0105237_1000557613 221
531 3300009545 Ga0105237_10477868 Ga0105237_104778682 221
532 3300009551 Ga0105238_10005207 Ga0105238_1000520711 221
533 3300010375 Ga0105239_10001588 Ga0105239_1000158817 221
534 3300014968 Ga0157379_10101073 Ga0157379_101010734 221
535 3300014969 Ga0157376_10175480 Ga0157376_101754803 221
536 3300025900 Ga0207710_10119726 Ga0207710_101197263 221
537 3300025913 Ga0207695_10097705 Ga0207695_100977052 221
538 3300025914 Ga0207671_10007719 Ga0207671_100077197 221
539 3300025924 Ga0207694_10007600 Ga0207694_100076007 221
540 3300027907 Ga0207428_10003260 Ga0207428_1000326015 221
541 3300048906 Ga0496103_0070560 Ga0496103_0070560_1317_2066 221
542 3300048912 Ga0496109_0000091 Ga0496109_0000091_42520_43269 221
543 3300049744 Ga0501083_0002960 Ga0501083_0002960_7750_8502 221
544 3300050509 nmdc:mga0qj67_328988_c1 nmdc:mga0qj67_328988_c1_206_955 221
545 3300050510 nmdc:mga06r32_299080_c1 nmdc:mga06r32_299080_c1_91_840 221
546 3300050511 nmdc:mga08y16_17119_c1 nmdc:mga08y16_17119_c1_6352_7101 221
547 3300050512 nmdc:mga0n895_145316_c1 nmdc:mga0n895_145316_c1_203_952 221
548 3300050515 nmdc:mga0a205_193006_c1 nmdc:mga0a205_193006_c1_715_1464 221
549 3300005334 Ga0068869_100002026 Ga0068869_1000020269 222
550 3300005338 Ga0068868_100035641 Ga0068868_1000356413 222
551 3300005340 Ga0070689_100255780 Ga0070689_1002557801 222
552 3300005353 Ga0070669_100083335 Ga0070669_1000833354 222
553 3300005365 Ga0070688_100574907 Ga0070688_1005749071 222
554 3300005436 Ga0070713_100022470 Ga0070713_1000224702 222
555 3300005445 Ga0070708_100711501 Ga0070708_1007115011 222
556 3300005459 Ga0068867_100109262 Ga0068867_1001092622 222
557 3300005466 Ga0070685_10022127 Ga0070685_100221273 222
558 3300005616 Ga0068852_100620363 Ga0068852_1006203632 222
559 3300005617 Ga0068859_100572158 Ga0068859_1005721582 222
560 3300005719 Ga0068861_100036613 Ga0068861_1000366132 222
561 3300005842 Ga0068858_100029020 Ga0068858_1000290204 222
562 3300006175 Ga0070712_100199206 Ga0070712_1001992063 222
563 3300006237 Ga0097621_100047933 Ga0097621_1000479332 222
564 3300006237 Ga0097621_100065377 Ga0097621_1000653773 222
565 3300006358 Ga0068871_100299793 Ga0068871_1002997931 222
566 3300006871 Ga0075434_100363425 Ga0075434_1003634252 222
567 3300006881 Ga0068865_100197928 Ga0068865_1001979283 222
568 3300006931 Ga0097620_100572156 Ga0097620_1005721562 222
569 3300009098 Ga0105245_10185869 Ga0105245_101858692 222
570 3300009098 Ga0105245_10319830 Ga0105245_103198303 222
571 3300009545 Ga0105237_10038402 Ga0105237_100384023 222
572 3300010375 Ga0105239_10538090 Ga0105239_105380902 222
573 3300013296 Ga0157374_10006263 Ga0157374_100062632 222
574 3300013297 Ga0157378_10060646 Ga0157378_100606463 222
575 3300013306 Ga0163162_10206272 Ga0163162_102062722 222
576 3300013308 Ga0157375_10018864 Ga0157375_100188644 222
577 3300014969 Ga0157376_10132867 Ga0157376_101328672 222
578 3300025898 Ga0207692_10061999 Ga0207692_100619992 222
579 3300025904 Ga0207647_10008849 Ga0207647_100088496 222
580 3300025905 Ga0207685_10159375 Ga0207685_101593751 222
581 3300025914 Ga0207671_10246703 Ga0207671_102467032 222
582 3300025915 Ga0207693_10109469 Ga0207693_101094693 222
583 3300025927 Ga0207687_10117405 Ga0207687_101174052 222
584 3300025929 Ga0207664_10275651 Ga0207664_102756512 222
585 3300025942 Ga0207689_10014900 Ga0207689_100149006 222
586 3300026035 Ga0207703_10001354 Ga0207703_1000135412 222
587 3300026118 Ga0207675_100300251 Ga0207675_1003002511 222
588 3300028380 Ga0268265_10116441 Ga0268265_101164412 222
589 3300028381 Ga0268264_10020992 Ga0268264_100209923 222
590 3300029957 Ga0265324_10000003 Ga0265324_10000003214 222
591 3300031595 Ga0265313_10034549 Ga0265313_100345492 222
592 3300032005 Ga0307411_10092460 Ga0307411_100924602 222
593 3300046519 Ga0495632_0000008 Ga0495632_0000008_84345_85118 222
594 3300048915 Ga0496112_0008797 Ga0496112_0008797_6388_7137 222
595 3300048918 Ga0496115_0093407 Ga0496115_0093407_1330_2112 222
596 3300053136 Ga0500559_0008235 Ga0500559_0008235_126_869 222
597 3300053136 Ga0500559_0008389 Ga0500559_0008389_363_1109 222
598 3300053139 Ga0500568_0007555 Ga0500568_0007555_421_1161 222
599 3300055283 Ga0500661_010243 Ga0500661_010243_863_1609 222
600 iso_pu_bacteria 2929239360 2929241935 222
601 3300002738 JGI25154J39366_1000008 JGI25154J39366_100000867 223
602 3300002741 JGI25157J39369_1003689 JGI25157J39369_10036893 223
603 3300003215 JGI25153J46596_10001539 JGI25153J46596_100015396 223
604 3300005262 Ga0065165_1045272 Ga0065165_10452721 223
605 3300005336 Ga0070680_100042412 Ga0070680_1000424124 223
606 3300005436 Ga0070713_100057867 Ga0070713_1000578672 223
607 3300005439 Ga0070711_100172012 Ga0070711_1001720121 223
608 3300005467 Ga0070706_100047830 Ga0070706_1000478304 223
609 3300005467 Ga0070706_100102346 Ga0070706_1001023461 223
610 3300005467 Ga0070706_100412957 Ga0070706_1004129572 223
611 3300005467 Ga0070706_100494185 Ga0070706_1004941852 223
612 3300005468 Ga0070707_100181526 Ga0070707_1001815265 223
613 3300005471 Ga0070698_100250348 Ga0070698_1002503483 223
614 3300005530 Ga0070679_100133018 Ga0070679_1001330184 223
615 3300005536 Ga0070697_100121460 Ga0070697_1001214603 223
616 3300005548 Ga0070665_100110880 Ga0070665_1001108801 223
617 3300005563 Ga0068855_100142587 Ga0068855_1001425873 223
618 3300005841 Ga0068863_100048980 Ga0068863_1000489805 223
619 3300005981 Ga0081538_10026558 Ga0081538_100265584 223
620 3300006028 Ga0070717_10417289 Ga0070717_104172892 223
621 3300006163 Ga0070715_10153476 Ga0070715_101534762 223
622 3300006871 Ga0075434_100456149 Ga0075434_1004561492 223
623 3300006881 Ga0068865_100095460 Ga0068865_1000954603 223
624 3300007076 Ga0075435_100837133 Ga0075435_1008371331 223
625 3300009093 Ga0105240_10024223 Ga0105240_100242233 223
626 3300009094 Ga0111539_10026194 Ga0111539_1002619410 223
627 3300009094 Ga0111539_10420800 Ga0111539_104208002 223
628 3300009147 Ga0114129_11092915 Ga0114129_110929151 223
629 3300009176 Ga0105242_10247377 Ga0105242_102473772 223
630 3300010159 Ga0099796_10097617 Ga0099796_100976171 223
631 3300013100 Ga0157373_10008118 Ga0157373_100081182 223
632 3300013100 Ga0157373_10041231 Ga0157373_100412312 223
633 3300013104 Ga0157370_10125871 Ga0157370_101258713 223
634 3300013297 Ga0157378_10481330 Ga0157378_104813301 223
635 3300013307 Ga0157372_10096097 Ga0157372_100960974 223
636 3300013307 Ga0157372_10230713 Ga0157372_102307132 223
637 3300021384 Ga0213876_10018083 Ga0213876_100180835 223
638 3300021384 Ga0213876_10076739 Ga0213876_100767393 223
639 3300025246 Ga0209646_1000045 Ga0209646_100004569 223
640 3300025250 Ga0209026_1000591 Ga0209026_100059115 223
641 3300025297 Ga0209758_1019961 Ga0209758_10199612 223
642 3300025302 Ga0207426_1000159 Ga0207426_10001595 223
643 3300025905 Ga0207685_10023356 Ga0207685_100233562 223
644 3300025910 Ga0207684_10056072 Ga0207684_100560722 223
645 3300025913 Ga0207695_10046237 Ga0207695_100462374 223
646 3300025915 Ga0207693_10165176 Ga0207693_101651762 223
647 3300025916 Ga0207663_10462645 Ga0207663_104626452 223
648 3300025916 Ga0207663_10606915 Ga0207663_106069151 223
649 3300025928 Ga0207700_10209893 Ga0207700_102098932 223
650 3300025931 Ga0207644_10057052 Ga0207644_100570521 223
651 3300025938 Ga0207704_10057338 Ga0207704_100573382 223
652 3300025939 Ga0207665_10053313 Ga0207665_100533132 223
653 3300026088 Ga0207641_10272373 Ga0207641_102723731 223
654 3300026089 Ga0207648_10469069 Ga0207648_104690691 223
655 3300028379 Ga0268266_10085269 Ga0268266_100852691 223
656 3300028794 Ga0307515_10046299 Ga0307515_100462994 223
657 3300028800 Ga0265338_10012413 Ga0265338_100124133 223
658 3300031241 Ga0265325_10000483 Ga0265325_100004832 223
659 3300031344 Ga0265316_10273115 Ga0265316_102731152 223
660 3300031595 Ga0265313_10152642 Ga0265313_101526422 223
661 3300031903 Ga0307407_10000021 Ga0307407_1000002129 223
662 3300035172 Ga0373955_0067665 Ga0373955_0067665_868_1614 223
663 3300035724 Ga0373933_0088063 Ga0373933_0088063_258_1004 223
664 3300036401 Ga0373937_0549095 Ga0373937_0549095_293_1039 223
665 3300037418 Ga0395900_0000657 Ga0395900_0000657_8714_9460 223
666 3300037418 Ga0395900_0002169 Ga0395900_0002169_17553_18299 223
667 3300037471 Ga0395905_0661059 Ga0395905_0661059_25_786 223
668 3300039437 Ga0436365_0253928 Ga0436365_0253928_664_1410 223
669 3300039438 Ga0436360_0740786 Ga0436360_0740786_224_973 223
670 3300039438 Ga0436360_0861137 Ga0436360_0861137_953_1699 223
671 3300039447 Ga0436361_0429461 Ga0436361_0429461_118_870 223
672 3300039453 Ga0436362_1236702 Ga0436362_1236702_173_979 223
673 3300046454 Ga0495592_0183310 Ga0495592_0183310_176_925 223
674 3300046462 Ga0495651_0043505 Ga0495651_0043505_1093_1842 223
675 3300046462 Ga0495651_0270947 Ga0495651_0270947_211_969 223
676 3300046463 Ga0495653_0111217 Ga0495653_0111217_927_1676 223
677 3300046476 Ga0495662_0007085 Ga0495662_0007085_1785_2534 223
678 3300046477 Ga0495664_0002538 Ga0495664_0002538_8963_9712 223
679 3300046507 Ga0495606_0013915 Ga0495606_0013915_4927_5679 223
680 3300046516 Ga0495628_0028970 Ga0495628_0028970_3532_4311 223
681 3300046516 Ga0495628_0063608 Ga0495628_0063608_1490_2239 223
682 3300046517 Ga0495630_0015774 Ga0495630_0015774_1093_1842 223
683 3300046519 Ga0495632_0000112 Ga0495632_0000112_43492_44295 223
684 3300046529 Ga0495652_0033213 Ga0495652_0033213_3218_3967 223
685 3300046529 Ga0495652_0247343 Ga0495652_0247343_454_1233 223
686 3300046533 Ga0495640_0055191 Ga0495640_0055191_651_1400 223
687 3300046543 Ga0495645_0002958 Ga0495645_0002958_6932_7681 223
688 3300046559 Ga0495667_0092994 Ga0495667_0092994_838_1587 223
689 3300046559 Ga0495667_0212044 Ga0495667_0212044_255_1034 223
690 3300046642 Ga0495634_0096238 Ga0495634_0096238_850_1599 223
691 3300046678 Ga0495599_0025262 Ga0495599_0025262_1650_2408 223
692 3300046678 Ga0495599_0032020 Ga0495599_0032020_2364_3113 223
693 3300046679 Ga0495623_0038896 Ga0495623_0038896_2099_2848 223
694 3300046690 Ga0495624_0175598 Ga0495624_0175598_129_881 223
695 3300046809 Ga0495600_0151715 Ga0495600_0151715_172_921 223
696 3300047319 Ga0495674_0031437 Ga0495674_0031437_4025_4774 223
697 3300047322 Ga0495680_0047117 Ga0495680_0047117_2574_3323 223
698 3300047444 Ga0495675_0138295 Ga0495675_0138295_682_1431 223
699 3300047471 Ga0495684_0215058 Ga0495684_0215058_356_1105 223
700 3300047472 Ga0495686_0000026 Ga0495686_0000026_153088_153834 223
701 3300048088 Ga0495602_0224933 Ga0495602_0224933_153_899 223
702 3300048912 Ga0496109_0156055 Ga0496109_0156055_1366_2112 223
703 3300048915 Ga0496112_0212245 Ga0496112_0212245_931_1677 223
704 3300048918 Ga0496115_0030154 Ga0496115_0030154_1736_2482 223
705 3300049579 Ga0501043_0010762 Ga0501043_0010762_2863_3612 223
706 3300049580 Ga0501046_0008970 Ga0501046_0008970_7571_8320 223
707 3300049582 Ga0501048_0040585 Ga0501048_0040585_746_1495 223
708 3300049586 Ga0501070_0000452 Ga0501070_0000452_19057_19806 223
709 3300049758 Ga0501241_011915 Ga0501241_011915_44_796 223
710 3300050507 nmdc:mga05p37_735341_c1 nmdc:mga05p37_735341_c1_259_1008 223
711 3300050511 nmdc:mga08y16_117879_c1 nmdc:mga08y16_117879_c1_642_1403 223
712 3300050512 nmdc:mga0n895_532451_c1 nmdc:mga0n895_532451_c1_101_850 223
713 3300050515 nmdc:mga0a205_248389_c1 nmdc:mga0a205_248389_c1_552_1301 223
714 3300053085 Ga0495619_0115404 Ga0495619_0115404_807_1553 223
715 3300053087 Ga0500643_002380 Ga0500643_002380_6216_6953 223
716 3300053104 Ga0500556_0043499 Ga0500556_0043499_372_1076 223
717 3300053151 Ga0500604_0008830 Ga0500604_0008830_1318_2070 223
718 3300053156 Ga0500622_0000407 Ga0500622_0000407_26241_26993 223
719 3300053156 Ga0500622_0000619 Ga0500622_0000619_18069_18821 223
720 3300061734 Ga0530510_0224409 Ga0530510_0224409_564_1310 223
721 iso_pu_bacteria 2747842501 2748016605 223
722 iso_pu_bacteria 2914759650 2914763631 223
723 iso_pu_bacteria 2928526807 2928528227 223
724 iso_pu_bacteria 2929239360 2929242316 223
725 iso_pu_bacteria 2941471342 2941471437 223
726 iso_pu_bacteria 8003151029 8003152644 223
727 2162886006 SwRhRL3b_contig_594252 SwRhRL3b_0460.00000320 224
728 2162886007 SwRhRL2b_contig_1167519 SwRhRL2b_0963.00003460 224
729 3300000545 CNXas_1000634 CNXas_10006342 224
730 3300001979 JGI24740J21852_10004991 JGI24740J21852_100049911 224
731 3300001979 JGI24740J21852_10005842 JGI24740J21852_100058423 224
732 3300001989 JGI24739J22299_10015576 JGI24739J22299_100155764 224
733 3300001989 JGI24739J22299_10021139 JGI24739J22299_100211392 224
734 3300002067 JGI24735J21928_10000020 JGI24735J21928_100000202 224
735 3300002067 JGI24735J21928_10068841 JGI24735J21928_100688411 224
736 3300002126 JGI24035J26624_1013038 JGI24035J26624_10130381 224
737 3300002737 JGI25162J39368_1000055 JGI25162J39368_100005569 224
738 3300002772 JGI25164J39214_1002336 JGI25164J39214_10023362 224
739 3300003214 JGI25165J46597_1001525 JGI25165J46597_100152517 224
740 3300003214 JGI25165J46597_1009608 JGI25165J46597_10096082 224
741 3300003320 rootH2_10044342 rootH2_100443425 224
742 3300003320 rootH2_10140174 rootH2_101401742 224
743 3300003322 rootL2_10014743 rootL2_100147432 224
744 3300003322 rootL2_10103814 rootL2_101038143 224
745 3300003322 rootL2_10175248 rootL2_101752481 224
746 3300003323 rootH1_10005847 rootH1_100058477 224
747 3300003323 rootH1_10056276 rootH1_100562765 224
748 3300003323 rootH1_10096655 rootH1_100966554 224
749 3300003323 rootH1_10209705 rootH1_102097052 224
750 3300003761 Ga0055535_1001727 Ga0055535_10017279 224
751 3300003762 Ga0055542_1002429 Ga0055542_10024293 224
752 3300003771 Ga0055526_1024774 Ga0055526_10247742 224
753 3300003791 Ga0055530_10006278 Ga0055530_100062782 224
754 3300003794 Ga0055531_10000189 Ga0055531_1000018946 224
755 3300005262 Ga0065165_1001201 Ga0065165_100120134 224
756 3300005262 Ga0065165_1006211 Ga0065165_10062113 224
757 3300005288 Ga0065714_10002586 Ga0065714_100025861 224
758 3300005289 Ga0065704_10000252 Ga0065704_1000025239 224
759 3300005289 Ga0065704_10005884 Ga0065704_100058842 224
760 3300005289 Ga0065704_10007270 Ga0065704_100072704 224
761 3300005289 Ga0065704_10195315 Ga0065704_101953152 224
762 3300005290 Ga0065712_10015861 Ga0065712_100158614 224
763 3300005290 Ga0065712_10078440 Ga0065712_100784403 224
764 3300005290 Ga0065712_10115891 Ga0065712_101158913 224
765 3300005293 Ga0065715_10000833 Ga0065715_100008336 224
766 3300005293 Ga0065715_10011047 Ga0065715_100110473 224
767 3300005295 Ga0065707_10182530 Ga0065707_101825302 224
768 3300005295 Ga0065707_10265725 Ga0065707_102657252 224
769 3300005327 Ga0070658_10003508 Ga0070658_100035089 224
770 3300005327 Ga0070658_10009602 Ga0070658_100096028 224
771 3300005327 Ga0070658_10014699 Ga0070658_100146994 224
772 3300005327 Ga0070658_10023827 Ga0070658_100238278 224
773 3300005328 Ga0070676_10003745 Ga0070676_100037455 224
774 3300005328 Ga0070676_10005906 Ga0070676_100059067 224
775 3300005328 Ga0070676_10009622 Ga0070676_100096224 224
776 3300005328 Ga0070676_10014088 Ga0070676_100140885 224
777 3300005328 Ga0070676_10065295 Ga0070676_100652952 224
778 3300005328 Ga0070676_10161914 Ga0070676_101619141 224
779 3300005329 Ga0070683_100038652 Ga0070683_1000386525 224
780 3300005329 Ga0070683_100543508 Ga0070683_1005435082 224
781 3300005331 Ga0070670_100165946 Ga0070670_1001659463 224
782 3300005331 Ga0070670_100610015 Ga0070670_1006100152 224
783 3300005333 Ga0070677_10023374 Ga0070677_100233742 224
784 3300005334 Ga0068869_100015189 Ga0068869_1000151893 224
785 3300005334 Ga0068869_100030385 Ga0068869_1000303854 224
786 3300005334 Ga0068869_100284018 Ga0068869_1002840182 224
787 3300005334 Ga0068869_100338840 Ga0068869_1003388402 224
788 3300005334 Ga0068869_100517359 Ga0068869_1005173591 224
789 3300005335 Ga0070666_10000227 Ga0070666_1000022723 224
790 3300005335 Ga0070666_10027658 Ga0070666_100276583 224
791 3300005335 Ga0070666_10117514 Ga0070666_101175142 224
792 3300005336 Ga0070680_100218769 Ga0070680_1002187692 224
793 3300005337 Ga0070682_100030858 Ga0070682_1000308584 224
794 3300005337 Ga0070682_100277017 Ga0070682_1002770172 224
795 3300005338 Ga0068868_100029206 Ga0068868_1000292065 224
796 3300005338 Ga0068868_100031275 Ga0068868_1000312753 224
797 3300005338 Ga0068868_100077785 Ga0068868_1000777852 224
798 3300005338 Ga0068868_100217797 Ga0068868_1002177972 224
799 3300005339 Ga0070660_100019730 Ga0070660_1000197305 224
800 3300005339 Ga0070660_100356774 Ga0070660_1003567741 224
801 3300005339 Ga0070660_100585485 Ga0070660_1005854851 224
802 3300005344 Ga0070661_100000247 Ga0070661_10000024733 224
803 3300005345 Ga0070692_10322040 Ga0070692_103220401 224
804 3300005347 Ga0070668_100005473 Ga0070668_1000054733 224
805 3300005347 Ga0070668_100016166 Ga0070668_1000161664 224
806 3300005347 Ga0070668_100383644 Ga0070668_1003836441 224
807 3300005347 Ga0070668_100469492 Ga0070668_1004694922 224
808 3300005347 Ga0070668_100561798 Ga0070668_1005617981 224
809 3300005347 Ga0070668_100809750 Ga0070668_1008097501 224
810 3300005353 Ga0070669_100009291 Ga0070669_1000092911 224
811 3300005353 Ga0070669_100028186 Ga0070669_1000281862 224
812 3300005353 Ga0070669_100081084 Ga0070669_1000810842 224
813 3300005353 Ga0070669_100269148 Ga0070669_1002691483 224
814 3300005354 Ga0070675_100049260 Ga0070675_1000492602 224
815 3300005354 Ga0070675_100221586 Ga0070675_1002215863 224
816 3300005354 Ga0070675_100541491 Ga0070675_1005414912 224
817 3300005354 Ga0070675_100590334 Ga0070675_1005903341 224
818 3300005355 Ga0070671_100153809 Ga0070671_1001538092 224
819 3300005355 Ga0070671_100486301 Ga0070671_1004863011 224
820 3300005356 Ga0070674_100019247 Ga0070674_1000192474 224
821 3300005356 Ga0070674_100051526 Ga0070674_1000515264 224
822 3300005356 Ga0070674_100108310 Ga0070674_1001083103 224
823 3300005364 Ga0070673_100058915 Ga0070673_1000589152 224
824 3300005364 Ga0070673_100070859 Ga0070673_1000708592 224
825 3300005366 Ga0070659_100010031 Ga0070659_1000100316 224
826 3300005366 Ga0070659_100011268 Ga0070659_1000112684 224
827 3300005366 Ga0070659_100021695 Ga0070659_1000216954 224
828 3300005367 Ga0070667_100007324 Ga0070667_1000073247 224
829 3300005367 Ga0070667_100025068 Ga0070667_1000250682 224
830 3300005367 Ga0070667_100172428 Ga0070667_1001724282 224
831 3300005367 Ga0070667_100178478 Ga0070667_1001784781 224
832 3300005367 Ga0070667_100211702 Ga0070667_1002117023 224
833 3300005367 Ga0070667_100259528 Ga0070667_1002595282 224
834 3300005367 Ga0070667_100269328 Ga0070667_1002693282 224
835 3300005434 Ga0070709_10018964 Ga0070709_100189644 224
836 3300005434 Ga0070709_10209651 Ga0070709_102096512 224
837 3300005434 Ga0070709_10553072 Ga0070709_105530721 224
838 3300005435 Ga0070714_100006646 Ga0070714_1000066467 224
839 3300005435 Ga0070714_100820863 Ga0070714_1008208631 224
840 3300005435 Ga0070714_100993542 Ga0070714_1009935421 224
841 3300005436 Ga0070713_100071421 Ga0070713_1000714214 224
842 3300005436 Ga0070713_100111263 Ga0070713_1001112633 224
843 3300005436 Ga0070713_100375562 Ga0070713_1003755622 224
844 3300005437 Ga0070710_10113403 Ga0070710_101134031 224
845 3300005437 Ga0070710_10230748 Ga0070710_102307481 224
846 3300005439 Ga0070711_100008600 Ga0070711_1000086006 224
847 3300005439 Ga0070711_100177761 Ga0070711_1001777611 224
848 3300005439 Ga0070711_100257919 Ga0070711_1002579192 224
849 3300005439 Ga0070711_100366625 Ga0070711_1003666252 224
850 3300005439 Ga0070711_100399312 Ga0070711_1003993121 224
851 3300005439 Ga0070711_100417994 Ga0070711_1004179941 224
852 3300005439 Ga0070711_100429938 Ga0070711_1004299382 224
853 3300005439 Ga0070711_100470542 Ga0070711_1004705422 224
854 3300005440 Ga0070705_100087329 Ga0070705_1000873293 224
855 3300005441 Ga0070700_100132463 Ga0070700_1001324632 224
856 3300005441 Ga0070700_100134242 Ga0070700_1001342422 224
857 3300005441 Ga0070700_100171379 Ga0070700_1001713793 224
858 3300005444 Ga0070694_100170958 Ga0070694_1001709582 224
859 3300005444 Ga0070694_100258936 Ga0070694_1002589361 224
860 3300005445 Ga0070708_100007408 Ga0070708_1000074086 224
861 3300005445 Ga0070708_100034939 Ga0070708_1000349393 224
862 3300005445 Ga0070708_100152747 Ga0070708_1001527474 224
863 3300005445 Ga0070708_100318265 Ga0070708_1003182652 224
864 3300005445 Ga0070708_100358321 Ga0070708_1003583212 224
865 3300005445 Ga0070708_100573089 Ga0070708_1005730892 224
866 3300005455 Ga0070663_100076702 Ga0070663_1000767022 224
867 3300005455 Ga0070663_100191091 Ga0070663_1001910913 224
868 3300005456 Ga0070678_100121952 Ga0070678_1001219522 224
869 3300005456 Ga0070678_100133195 Ga0070678_1001331952 224
870 3300005456 Ga0070678_100594439 Ga0070678_1005944391 224
871 3300005457 Ga0070662_100013141 Ga0070662_1000131415 224
872 3300005457 Ga0070662_100045091 Ga0070662_1000450912 224
873 3300005457 Ga0070662_100233829 Ga0070662_1002338292 224
874 3300005458 Ga0070681_10452918 Ga0070681_104529181 224
875 3300005459 Ga0068867_100055382 Ga0068867_1000553822 224
876 3300005459 Ga0068867_100803296 Ga0068867_1008032961 224
877 3300005466 Ga0070685_10014417 Ga0070685_100144173 224
878 3300005467 Ga0070706_100000380 Ga0070706_10000038043 224
879 3300005467 Ga0070706_100003785 Ga0070706_10000378520 224
880 3300005467 Ga0070706_100049239 Ga0070706_1000492394 224
881 3300005467 Ga0070706_100052666 Ga0070706_1000526664 224
882 3300005467 Ga0070706_100056553 Ga0070706_1000565534 224
883 3300005467 Ga0070706_100134661 Ga0070706_1001346611 224
884 3300005467 Ga0070706_100141608 Ga0070706_1001416082 224
885 3300005467 Ga0070706_100199842 Ga0070706_1001998422 224
886 3300005467 Ga0070706_100216541 Ga0070706_1002165412 224
887 3300005467 Ga0070706_100366219 Ga0070706_1003662192 224
888 3300005468 Ga0070707_100000335 Ga0070707_10000033525 224
889 3300005468 Ga0070707_100003103 Ga0070707_1000031033 224
890 3300005468 Ga0070707_100021000 Ga0070707_10002100010 224
891 3300005468 Ga0070707_100065557 Ga0070707_1000655574 224
892 3300005468 Ga0070707_100081499 Ga0070707_1000814992 224
893 3300005468 Ga0070707_100084002 Ga0070707_1000840023 224
894 3300005468 Ga0070707_100490709 Ga0070707_1004907091 224
895 3300005471 Ga0070698_100007734 Ga0070698_1000077346 224
896 3300005471 Ga0070698_100049971 Ga0070698_1000499713 224
897 3300005471 Ga0070698_100122006 Ga0070698_1001220062 224
898 3300005471 Ga0070698_100187601 Ga0070698_1001876012 224
899 3300005518 Ga0070699_100152133 Ga0070699_1001521331 224
900 3300005518 Ga0070699_100212182 Ga0070699_1002121822 224
901 3300005518 Ga0070699_100245318 Ga0070699_1002453183 224
902 3300005518 Ga0070699_100394175 Ga0070699_1003941751 224
903 3300005530 Ga0070679_100126080 Ga0070679_1001260802 224
904 3300005530 Ga0070679_100134821 Ga0070679_1001348212 224
905 3300005530 Ga0070679_100314635 Ga0070679_1003146352 224
906 3300005536 Ga0070697_100000252 Ga0070697_1000002527 224
907 3300005536 Ga0070697_100007271 Ga0070697_1000072717 224
908 3300005536 Ga0070697_100100320 Ga0070697_1001003203 224
909 3300005536 Ga0070697_100101722 Ga0070697_1001017222 224
910 3300005536 Ga0070697_100234294 Ga0070697_1002342942 224
911 3300005536 Ga0070697_100269229 Ga0070697_1002692292 224
912 3300005536 Ga0070697_100479329 Ga0070697_1004793292 224
913 3300005536 Ga0070697_100582450 Ga0070697_1005824501 224
914 3300005539 Ga0068853_100059711 Ga0068853_1000597112 224
915 3300005539 Ga0068853_100096031 Ga0068853_1000960312 224
916 3300005539 Ga0068853_100255950 Ga0068853_1002559502 224
917 3300005539 Ga0068853_100375875 Ga0068853_1003758752 224
918 3300005543 Ga0070672_100076750 Ga0070672_1000767503 224
919 3300005543 Ga0070672_100183965 Ga0070672_1001839652 224
920 3300005543 Ga0070672_100687565 Ga0070672_1006875652 224
921 3300005544 Ga0070686_100140871 Ga0070686_1001408713 224
922 3300005544 Ga0070686_100173903 Ga0070686_1001739032 224
923 3300005545 Ga0070695_100021165 Ga0070695_1000211655 224
924 3300005545 Ga0070695_100312646 Ga0070695_1003126462 224
925 3300005546 Ga0070696_100195875 Ga0070696_1001958752 224
926 3300005546 Ga0070696_100345529 Ga0070696_1003455291 224
927 3300005547 Ga0070693_100079752 Ga0070693_1000797522 224
928 3300005547 Ga0070693_100229325 Ga0070693_1002293251 224
929 3300005548 Ga0070665_100244771 Ga0070665_1002447712 224
930 3300005548 Ga0070665_100386477 Ga0070665_1003864772 224
931 3300005549 Ga0070704_100008813 Ga0070704_1000088135 224
932 3300005549 Ga0070704_100086630 Ga0070704_1000866303 224
933 3300005549 Ga0070704_100207639 Ga0070704_1002076392 224
934 3300005549 Ga0070704_100230094 Ga0070704_1002300942 224
935 3300005549 Ga0070704_100759015 Ga0070704_1007590151 224
936 3300005563 Ga0068855_100000982 Ga0068855_10000098216 224
937 3300005563 Ga0068855_100001481 Ga0068855_10000148115 224
938 3300005563 Ga0068855_100003069 Ga0068855_1000030695 224
939 3300005563 Ga0068855_100163438 Ga0068855_1001634385 224
940 3300005563 Ga0068855_100434033 Ga0068855_1004340332 224
941 3300005563 Ga0068855_100505886 Ga0068855_1005058862 224
942 3300005563 Ga0068855_101041134 Ga0068855_1010411341 224
943 3300005564 Ga0070664_100065111 Ga0070664_1000651113 224
944 3300005577 Ga0068857_100007043 Ga0068857_1000070434 224
945 3300005577 Ga0068857_100240449 Ga0068857_1002404493 224
946 3300005578 Ga0068854_100000042 Ga0068854_10000004225 224
947 3300005578 Ga0068854_100056154 Ga0068854_1000561543 224
948 3300005614 Ga0068856_100153658 Ga0068856_1001536581 224
949 3300005614 Ga0068856_100220137 Ga0068856_1002201372 224
950 3300005615 Ga0070702_100452103 Ga0070702_1004521031 224
951 3300005616 Ga0068852_100263141 Ga0068852_1002631413 224
952 3300005616 Ga0068852_100331533 Ga0068852_1003315332 224
953 3300005616 Ga0068852_100524690 Ga0068852_1005246902 224
954 3300005616 Ga0068852_100629214 Ga0068852_1006292141 224
955 3300005617 Ga0068859_100000025 Ga0068859_10000002555 224
956 3300005617 Ga0068859_100048359 Ga0068859_1000483594 224
957 3300005617 Ga0068859_100512565 Ga0068859_1005125652 224
958 3300005618 Ga0068864_100023718 Ga0068864_1000237184 224
959 3300005718 Ga0068866_10008266 Ga0068866_100082663 224
960 3300005719 Ga0068861_100037038 Ga0068861_1000370384 224
961 3300005834 Ga0068851_10223188 Ga0068851_102231881 224
962 3300005841 Ga0068863_100002521 Ga0068863_1000025213 224
963 3300005841 Ga0068863_100012988 Ga0068863_1000129883 224
964 3300005841 Ga0068863_100488647 Ga0068863_1004886472 224
965 3300005841 Ga0068863_100815462 Ga0068863_1008154621 224
966 3300005842 Ga0068858_100115195 Ga0068858_1001151953 224
967 3300005842 Ga0068858_100279002 Ga0068858_1002790021 224
968 3300005842 Ga0068858_100339095 Ga0068858_1003390951 224
969 3300005842 Ga0068858_100488973 Ga0068858_1004889732 224
970 3300005842 Ga0068858_100636916 Ga0068858_1006369162 224
971 3300005843 Ga0068860_100001782 Ga0068860_10000178220 224
972 3300005843 Ga0068860_100015605 Ga0068860_1000156056 224
973 3300005843 Ga0068860_100063516 Ga0068860_1000635162 224
974 3300005843 Ga0068860_100086795 Ga0068860_1000867953 224
975 3300005843 Ga0068860_100102326 Ga0068860_1001023265 224
976 3300005843 Ga0068860_100153793 Ga0068860_1001537932 224
977 3300005844 Ga0068862_100704314 Ga0068862_1007043141 224
978 3300005937 Ga0081455_10322309 Ga0081455_103223091 224
979 3300005983 Ga0081540_1001169 Ga0081540_10011691 224
980 3300005983 Ga0081540_1013318 Ga0081540_10133183 224
981 3300005983 Ga0081540_1059959 Ga0081540_10599592 224
982 3300005985 Ga0081539_10007502 Ga0081539_100075026 224
983 3300006028 Ga0070717_10038829 Ga0070717_100388298 224
984 3300006028 Ga0070717_10063866 Ga0070717_100638663 224
985 3300006028 Ga0070717_10099917 Ga0070717_100999172 224
986 3300006028 Ga0070717_10101786 Ga0070717_101017864 224
987 3300006028 Ga0070717_10200761 Ga0070717_102007612 224
988 3300006028 Ga0070717_10342410 Ga0070717_103424102 224
989 3300006163 Ga0070715_10168508 Ga0070715_101685082 224
990 3300006163 Ga0070715_10293758 Ga0070715_102937581 224
991 3300006173 Ga0070716_100055914 Ga0070716_1000559142 224
992 3300006173 Ga0070716_100229832 Ga0070716_1002298322 224
993 3300006173 Ga0070716_100265407 Ga0070716_1002654072 224
994 3300006173 Ga0070716_100351347 Ga0070716_1003513471 224
995 3300006175 Ga0070712_100003626 Ga0070712_1000036265 224
996 3300006175 Ga0070712_100104111 Ga0070712_1001041112 224
997 3300006175 Ga0070712_100166475 Ga0070712_1001664752 224
998 3300006175 Ga0070712_100190589 Ga0070712_1001905893 224
999 3300006175 Ga0070712_100341253 Ga0070712_1003412531 224
1000 3300006175 Ga0070712_100410041 Ga0070712_1004100412 224
1001 3300006175 Ga0070712_100543175 Ga0070712_1005431751 224
1002 3300006175 Ga0070712_100770036 Ga0070712_1007700361 224
1003 3300006195 Ga0075366_10000275 Ga0075366_1000027512 224
1004 3300006195 Ga0075366_10011506 Ga0075366_100115064 224
1005 3300006195 Ga0075366_10036816 Ga0075366_100368163 224
1006 3300006237 Ga0097621_100066713 Ga0097621_1000667133 224
1007 3300006237 Ga0097621_100356933 Ga0097621_1003569333 224
1008 3300006237 Ga0097621_100656287 Ga0097621_1006562871 224
1009 3300006353 Ga0075370_10014841 Ga0075370_100148414 224
1010 3300006358 Ga0068871_100026828 Ga0068871_1000268285 224
1011 3300006358 Ga0068871_100124553 Ga0068871_1001245531 224
1012 3300006358 Ga0068871_100193049 Ga0068871_1001930492 224
1013 3300006844 Ga0075428_100096731 Ga0075428_1000967314 224
1014 3300006844 Ga0075428_100149286 Ga0075428_1001492862 224
1015 3300006844 Ga0075428_100208738 Ga0075428_1002087382 224
1016 3300006844 Ga0075428_100244670 Ga0075428_1002446703 224
1017 3300006844 Ga0075428_100291296 Ga0075428_1002912962 224
1018 3300006844 Ga0075428_100748057 Ga0075428_1007480572 224
1019 3300006844 Ga0075428_100972974 Ga0075428_1009729741 224
1020 3300006846 Ga0075430_100088860 Ga0075430_1000888602 224
1021 3300006846 Ga0075430_100346398 Ga0075430_1003463981 224
1022 3300006846 Ga0075430_100359096 Ga0075430_1003590962 224
1023 3300006847 Ga0075431_100076353 Ga0075431_1000763533 224
1024 3300006847 Ga0075431_100108798 Ga0075431_1001087983 224
1025 3300006847 Ga0075431_100317799 Ga0075431_1003177992 224
1026 3300006852 Ga0075433_10006176 Ga0075433_100061768 224
1027 3300006852 Ga0075433_10055348 Ga0075433_100553483 224
1028 3300006852 Ga0075433_10094826 Ga0075433_100948262 224
1029 3300006852 Ga0075433_10196485 Ga0075433_101964852 224
1030 3300006852 Ga0075433_10313570 Ga0075433_103135702 224
1031 3300006871 Ga0075434_100015501 Ga0075434_1000155015 224
1032 3300006871 Ga0075434_100047848 Ga0075434_1000478482 224
1033 3300006871 Ga0075434_100088675 Ga0075434_1000886754 224
1034 3300006871 Ga0075434_100293908 Ga0075434_1002939083 224
1035 3300006871 Ga0075434_100448641 Ga0075434_1004486411 224
1036 3300006871 Ga0075434_100494735 Ga0075434_1004947352 224
1037 3300006880 Ga0075429_100123886 Ga0075429_1001238862 224
1038 3300006881 Ga0068865_100058986 Ga0068865_1000589862 224
1039 3300006881 Ga0068865_100121396 Ga0068865_1001213961 224
1040 3300006881 Ga0068865_100330052 Ga0068865_1003300522 224
1041 3300006914 Ga0075436_100161610 Ga0075436_1001616102 224
1042 3300006931 Ga0097620_100000025 Ga0097620_10000002555 224
1043 3300006931 Ga0097620_100048359 Ga0097620_1000483594 224
1044 3300006931 Ga0097620_100512577 Ga0097620_1005125772 224
1045 3300007076 Ga0075435_100302347 Ga0075435_1003023472 224
1046 3300007788 Ga0099795_10056102 Ga0099795_100561022 224
1047 3300009036 Ga0105244_10098353 Ga0105244_100983532 224
1048 3300009092 Ga0105250_10199714 Ga0105250_101997141 224
1049 3300009093 Ga0105240_10000039 Ga0105240_10000039140 224
1050 3300009093 Ga0105240_10000576 Ga0105240_1000057614 224
1051 3300009093 Ga0105240_10001685 Ga0105240_1000168525 224
1052 3300009093 Ga0105240_10001714 Ga0105240_1000171432 224
1053 3300009093 Ga0105240_10007231 Ga0105240_1000723115 224
1054 3300009093 Ga0105240_10007855 Ga0105240_100078556 224
1055 3300009093 Ga0105240_10013125 Ga0105240_100131257 224
1056 3300009093 Ga0105240_10025526 Ga0105240_100255265 224
1057 3300009093 Ga0105240_10053556 Ga0105240_100535561 224
1058 3300009093 Ga0105240_10109476 Ga0105240_101094764 224
1059 3300009093 Ga0105240_10263333 Ga0105240_102633331 224
1060 3300009093 Ga0105240_10279159 Ga0105240_102791593 224
1061 3300009093 Ga0105240_10588786 Ga0105240_105887861 224
1062 3300009098 Ga0105245_10031925 Ga0105245_100319254 224
1063 3300009098 Ga0105245_10087640 Ga0105245_100876402 224
1064 3300009098 Ga0105245_10196458 Ga0105245_101964583 224
1065 3300009098 Ga0105245_10319633 Ga0105245_103196332 224
1066 3300009101 Ga0105247_10056991 Ga0105247_100569914 224
1067 3300009101 Ga0105247_10131122 Ga0105247_101311223 224
1068 3300009147 Ga0114129_10004405 Ga0114129_100044057 224
1069 3300009147 Ga0114129_10007513 Ga0114129_1000751313 224
1070 3300009147 Ga0114129_10034146 Ga0114129_100341465 224
1071 3300009147 Ga0114129_10116170 Ga0114129_101161702 224
1072 3300009147 Ga0114129_10130169 Ga0114129_101301693 224
1073 3300009147 Ga0114129_10339647 Ga0114129_103396473 224
1074 3300009147 Ga0114129_10380804 Ga0114129_103808042 224
1075 3300009147 Ga0114129_10520608 Ga0114129_105206082 224
1076 3300009147 Ga0114129_11111206 Ga0114129_111112061 224
1077 3300009148 Ga0105243_10003268 Ga0105243_100032687 224
1078 3300009148 Ga0105243_10022464 Ga0105243_100224646 224
1079 3300009148 Ga0105243_10428058 Ga0105243_104280582 224
1080 3300009174 Ga0105241_10002757 Ga0105241_100027577 224
1081 3300009174 Ga0105241_10006768 Ga0105241_100067686 224
1082 3300009174 Ga0105241_10049211 Ga0105241_100492112 224
1083 3300009174 Ga0105241_10084671 Ga0105241_100846715 224
1084 3300009174 Ga0105241_10109053 Ga0105241_101090534 224
1085 3300009174 Ga0105241_10230748 Ga0105241_102307482 224
1086 3300009174 Ga0105241_10758463 Ga0105241_107584631 224
1087 3300009176 Ga0105242_10015518 Ga0105242_100155184 224
1088 3300009176 Ga0105242_10026577 Ga0105242_100265773 224
1089 3300009176 Ga0105242_10031668 Ga0105242_100316682 224
1090 3300009176 Ga0105242_10036873 Ga0105242_100368733 224
1091 3300009176 Ga0105242_10073254 Ga0105242_100732544 224
1092 3300009176 Ga0105242_10258969 Ga0105242_102589692 224
1093 3300009176 Ga0105242_10262883 Ga0105242_102628832 224
1094 3300009176 Ga0105242_10392210 Ga0105242_103922102 224
1095 3300009177 Ga0105248_10005758 Ga0105248_100057585 224
1096 3300009177 Ga0105248_10009429 Ga0105248_100094299 224
1097 3300009177 Ga0105248_10171116 Ga0105248_101711163 224
1098 3300009177 Ga0105248_10278280 Ga0105248_102782802 224
1099 3300009177 Ga0105248_10349312 Ga0105248_103493122 224
1100 3300009177 Ga0105248_10518471 Ga0105248_105184712 224
1101 3300009545 Ga0105237_10000833 Ga0105237_1000083333 224
1102 3300009545 Ga0105237_10001758 Ga0105237_1000175823 224
1103 3300009545 Ga0105237_10001824 Ga0105237_1000182413 224
1104 3300009545 Ga0105237_10002198 Ga0105237_1000219810 224
1105 3300009545 Ga0105237_10002198 Ga0105237_100021988 224
1106 3300009545 Ga0105237_10004275 Ga0105237_100042756 224
1107 3300009545 Ga0105237_10006605 Ga0105237_100066054 224
1108 3300009545 Ga0105237_10008327 Ga0105237_100083279 224
1109 3300009545 Ga0105237_10014737 Ga0105237_100147377 224
1110 3300009545 Ga0105237_10047687 Ga0105237_100476872 224
1111 3300009545 Ga0105237_10098218 Ga0105237_100982184 224
1112 3300009545 Ga0105237_10275101 Ga0105237_102751012 224
1113 3300009551 Ga0105238_10016901 Ga0105238_100169013 224
1114 3300009551 Ga0105238_10016959 Ga0105238_100169594 224
1115 3300009551 Ga0105238_10017652 Ga0105238_100176525 224
1116 3300009551 Ga0105238_10051780 Ga0105238_100517803 224
1117 3300009551 Ga0105238_10163836 Ga0105238_101638361 224
1118 3300009551 Ga0105238_10174334 Ga0105238_101743342 224
1119 3300009551 Ga0105238_10262223 Ga0105238_102622232 224
1120 3300009551 Ga0105238_10484908 Ga0105238_104849081 224
1121 3300009551 Ga0105238_10825171 Ga0105238_108251711 224
1122 3300009553 Ga0105249_10009712 Ga0105249_100097122 224
1123 3300009553 Ga0105249_10033849 Ga0105249_100338492 224
1124 3300009553 Ga0105249_10036891 Ga0105249_100368914 224
1125 3300009553 Ga0105249_10977013 Ga0105249_109770131 224
1126 3300010159 Ga0099796_10006175 Ga0099796_100061752 224
1127 3300010375 Ga0105239_10000068 Ga0105239_1000006820 224
1128 3300010375 Ga0105239_10000327 Ga0105239_1000032727 224
1129 3300010375 Ga0105239_10000748 Ga0105239_1000074833 224
1130 3300010375 Ga0105239_10012058 Ga0105239_100120583 224
1131 3300010375 Ga0105239_10228182 Ga0105239_102281822 224
1132 3300010375 Ga0105239_10480012 Ga0105239_104800122 224
1133 3300010375 Ga0105239_10582193 Ga0105239_105821933 224
1134 3300010375 Ga0105239_10591419 Ga0105239_105914192 224
1135 3300011119 Ga0105246_10021367 Ga0105246_100213674 224
1136 3300011119 Ga0105246_10260512 Ga0105246_102605121 224
1137 3300011119 Ga0105246_10462088 Ga0105246_104620882 224
1138 3300013100 Ga0157373_10000366 Ga0157373_1000036632 224
1139 3300013100 Ga0157373_10001171 Ga0157373_100011715 224
1140 3300013100 Ga0157373_10002574 Ga0157373_1000257411 224
1141 3300013100 Ga0157373_10069050 Ga0157373_100690503 224
1142 3300013102 Ga0157371_10000657 Ga0157371_1000065730 224
1143 3300013102 Ga0157371_10005691 Ga0157371_100056911 224
1144 3300013102 Ga0157371_10016381 Ga0157371_100163816 224
1145 3300013102 Ga0157371_10026500 Ga0157371_100265004 224
1146 3300013102 Ga0157371_10368135 Ga0157371_103681352 224
1147 3300013104 Ga0157370_10000018 Ga0157370_10000018111 224
1148 3300013104 Ga0157370_10002843 Ga0157370_100028435 224
1149 3300013104 Ga0157370_10010024 Ga0157370_100100244 224
1150 3300013104 Ga0157370_10013404 Ga0157370_100134047 224
1151 3300013104 Ga0157370_10091491 Ga0157370_100914912 224
1152 3300013104 Ga0157370_10251713 Ga0157370_102517133 224
1153 3300013105 Ga0157369_10079819 Ga0157369_100798193 224
1154 3300013105 Ga0157369_10163835 Ga0157369_101638351 224
1155 3300013296 Ga0157374_10000024 Ga0157374_10000024115 224
1156 3300013296 Ga0157374_10019006 Ga0157374_100190066 224
1157 3300013296 Ga0157374_10021599 Ga0157374_100215994 224
1158 3300013296 Ga0157374_10027362 Ga0157374_100273625 224
1159 3300013296 Ga0157374_10029976 Ga0157374_100299764 224
1160 3300013296 Ga0157374_10038390 Ga0157374_100383902 224
1161 3300013296 Ga0157374_10105544 Ga0157374_101055444 224
1162 3300013296 Ga0157374_10360013 Ga0157374_103600132 224
1163 3300013296 Ga0157374_10367802 Ga0157374_103678022 224
1164 3300013296 Ga0157374_10525224 Ga0157374_105252242 224
1165 3300013297 Ga0157378_10000441 Ga0157378_1000044128 224
1166 3300013297 Ga0157378_10004252 Ga0157378_1000425213 224
1167 3300013297 Ga0157378_10123009 Ga0157378_101230093 224
1168 3300013297 Ga0157378_10162126 Ga0157378_101621262 224
1169 3300013297 Ga0157378_10192863 Ga0157378_101928632 224
1170 3300013297 Ga0157378_10208767 Ga0157378_102087672 224
1171 3300013297 Ga0157378_10243712 Ga0157378_102437122 224
1172 3300013297 Ga0157378_10364219 Ga0157378_103642192 224
1173 3300013297 Ga0157378_10522054 Ga0157378_105220541 224
1174 3300013297 Ga0157378_10869247 Ga0157378_108692471 224
1175 3300013306 Ga0163162_10000223 Ga0163162_1000022329 224
1176 3300013306 Ga0163162_10013694 Ga0163162_100136944 224
1177 3300013306 Ga0163162_10021145 Ga0163162_100211455 224
1178 3300013306 Ga0163162_10071089 Ga0163162_100710893 224
1179 3300013306 Ga0163162_10105774 Ga0163162_101057743 224
1180 3300013306 Ga0163162_10121811 Ga0163162_101218113 224
1181 3300013306 Ga0163162_10178373 Ga0163162_101783733 224
1182 3300013306 Ga0163162_10180297 Ga0163162_101802971 224
1183 3300013306 Ga0163162_10348734 Ga0163162_103487343 224
1184 3300013307 Ga0157372_10000873 Ga0157372_1000087331 224
1185 3300013307 Ga0157372_10086491 Ga0157372_100864916 224
1186 3300013307 Ga0157372_10168246 Ga0157372_101682464 224
1187 3300013307 Ga0157372_10396092 Ga0157372_103960922 224
1188 3300013307 Ga0157372_10695517 Ga0157372_106955171 224
1189 3300013307 Ga0157372_10885733 Ga0157372_108857331 224
1190 3300013308 Ga0157375_10000871 Ga0157375_1000087112 224
1191 3300013308 Ga0157375_10020522 Ga0157375_100205224 224
1192 3300013308 Ga0157375_10020952 Ga0157375_100209526 224
1193 3300013308 Ga0157375_10031268 Ga0157375_100312684 224
1194 3300013308 Ga0157375_10194570 Ga0157375_101945703 224
1195 3300013308 Ga0157375_10297742 Ga0157375_102977422 224
1196 3300013308 Ga0157375_10522454 Ga0157375_105224542 224
1197 3300013308 Ga0157375_10714915 Ga0157375_107149152 224
1198 3300013308 Ga0157375_10763857 Ga0157375_107638572 224
1199 3300014325 Ga0163163_10196935 Ga0163163_101969353 224
1200 3300014325 Ga0163163_10240603 Ga0163163_102406032 224
1201 3300014325 Ga0163163_10262784 Ga0163163_102627842 224
1202 3300014325 Ga0163163_10282937 Ga0163163_102829371 224
1203 3300014497 Ga0182008_10005435 Ga0182008_100054353 224
1204 3300014968 Ga0157379_10149725 Ga0157379_101497252 224
1205 3300014968 Ga0157379_10181221 Ga0157379_101812213 224
1206 3300014968 Ga0157379_10208312 Ga0157379_102083122 224
1207 3300014968 Ga0157379_10602583 Ga0157379_106025831 224
1208 3300014969 Ga0157376_10002784 Ga0157376_100027843 224
1209 3300014969 Ga0157376_10014068 Ga0157376_100140682 224
1210 3300014969 Ga0157376_10041475 Ga0157376_100414754 224
1211 3300014969 Ga0157376_10286635 Ga0157376_102866352 224
1212 3300015261 Ga0182006_1001362 Ga0182006_10013622 224
1213 3300015261 Ga0182006_1004039 Ga0182006_10040391 224
1214 3300015262 Ga0182007_10005312 Ga0182007_100053123 224
1215 3300015265 Ga0182005_1000061 Ga0182005_100006161 224
1216 3300015265 Ga0182005_1001673 Ga0182005_10016733 224
1217 3300015265 Ga0182005_1003851 Ga0182005_10038512 224
1218 3300017792 Ga0163161_10018241 Ga0163161_100182413 224
1219 3300017792 Ga0163161_10052583 Ga0163161_100525832 224
1220 3300017792 Ga0163161_10086573 Ga0163161_100865732 224
1221 3300017792 Ga0163161_10232199 Ga0163161_102321992 224
1222 3300017792 Ga0163161_10580527 Ga0163161_105805271 224
1223 3300021358 Ga0213873_10001097 Ga0213873_100010973 224
1224 3300021361 Ga0213872_10000002 Ga0213872_10000002208 224
1225 3300021361 Ga0213872_10000602 Ga0213872_1000060215 224
1226 3300021361 Ga0213872_10025072 Ga0213872_100250723 224
1227 3300021441 Ga0213871_10001125 Ga0213871_100011254 224
1228 3300025208 Ga0209436_100544 Ga0209436_1005448 224
1229 3300025231 Ga0207427_100060 Ga0207427_10006085 224
1230 3300025233 Ga0209437_100021 Ga0209437_100021481 224
1231 3300025233 Ga0209437_100130 Ga0209437_100130105 224
1232 3300025242 Ga0209258_100029 Ga0209258_10002969 224
1233 3300025254 Ga0209148_1000230 Ga0209148_100023025 224
1234 3300025258 Ga0209129_1008054 Ga0209129_10080543 224
1235 3300025261 Ga0209233_1000035 Ga0209233_1000035157 224
1236 3300025261 Ga0209233_1001607 Ga0209233_10016073 224
1237 3300025261 Ga0209233_1002746 Ga0209233_10027464 224
1238 3300025261 Ga0209233_1003388 Ga0209233_10033888 224
1239 3300025271 Ga0207666_1003319 Ga0207666_10033192 224
1240 3300025271 Ga0207666_1004767 Ga0207666_10047672 224
1241 3300025271 Ga0207666_1011331 Ga0207666_10113311 224
1242 3300025272 Ga0209455_1001221 Ga0209455_10012214 224
1243 3300025273 Ga0209673_1054352 Ga0209673_10543521 224
1244 3300025295 Ga0209564_1001245 Ga0209564_100124516 224
1245 3300025298 Ga0209050_1000876 Ga0209050_100087621 224
1246 3300025298 Ga0209050_1031034 Ga0209050_10310342 224
1247 3300025302 Ga0207426_1000060 Ga0207426_1000060105 224
1248 3300025302 Ga0207426_1007154 Ga0207426_10071544 224
1249 3300025315 Ga0207697_10001693 Ga0207697_1000169314 224
1250 3300025315 Ga0207697_10001693 Ga0207697_100016935 224
1251 3300025315 Ga0207697_10014686 Ga0207697_100146861 224
1252 3300025315 Ga0207697_10060785 Ga0207697_100607851 224
1253 3300025315 Ga0207697_10105216 Ga0207697_101052162 224
1254 3300025321 Ga0207656_10123087 Ga0207656_101230871 224
1255 3300025885 Ga0207653_10111428 Ga0207653_101114281 224
1256 3300025898 Ga0207692_10155445 Ga0207692_101554452 224
1257 3300025898 Ga0207692_10269398 Ga0207692_102693981 224
1258 3300025899 Ga0207642_10009091 Ga0207642_100090912 224
1259 3300025899 Ga0207642_10091551 Ga0207642_100915512 224
1260 3300025901 Ga0207688_10007881 Ga0207688_100078812 224
1261 3300025901 Ga0207688_10020631 Ga0207688_100206312 224
1262 3300025903 Ga0207680_10000086 Ga0207680_1000008630 224
1263 3300025903 Ga0207680_10043520 Ga0207680_100435205 224
1264 3300025903 Ga0207680_10088565 Ga0207680_100885652 224
1265 3300025903 Ga0207680_10142568 Ga0207680_101425682 224
1266 3300025903 Ga0207680_10290197 Ga0207680_102901972 224
1267 3300025904 Ga0207647_10000076 Ga0207647_1000007677 224
1268 3300025904 Ga0207647_10033951 Ga0207647_100339514 224
1269 3300025904 Ga0207647_10041616 Ga0207647_100416161 224
1270 3300025904 Ga0207647_10189873 Ga0207647_101898732 224
1271 3300025906 Ga0207699_10038079 Ga0207699_100380793 224
1272 3300025906 Ga0207699_10117760 Ga0207699_101177601 224
1273 3300025907 Ga0207645_10003509 Ga0207645_1000350910 224
1274 3300025907 Ga0207645_10026000 Ga0207645_100260006 224
1275 3300025907 Ga0207645_10031748 Ga0207645_100317482 224
1276 3300025907 Ga0207645_10035528 Ga0207645_100355283 224
1277 3300025907 Ga0207645_10047712 Ga0207645_100477122 224
1278 3300025909 Ga0207705_10008054 Ga0207705_100080547 224
1279 3300025909 Ga0207705_10015731 Ga0207705_100157313 224
1280 3300025909 Ga0207705_10139147 Ga0207705_101391473 224
1281 3300025910 Ga0207684_10005894 Ga0207684_100058941 224
1282 3300025910 Ga0207684_10006457 Ga0207684_100064574 224
1283 3300025910 Ga0207684_10016256 Ga0207684_100162563 224
1284 3300025910 Ga0207684_10046528 Ga0207684_100465281 224
1285 3300025910 Ga0207684_10097845 Ga0207684_100978452 224
1286 3300025910 Ga0207684_10099839 Ga0207684_100998392 224
1287 3300025910 Ga0207684_10227602 Ga0207684_102276022 224
1288 3300025910 Ga0207684_10439577 Ga0207684_104395772 224
1289 3300025911 Ga0207654_10001544 Ga0207654_100015447 224
1290 3300025911 Ga0207654_10005983 Ga0207654_100059835 224
1291 3300025911 Ga0207654_10011570 Ga0207654_100115703 224
1292 3300025911 Ga0207654_10015317 Ga0207654_100153176 224
1293 3300025911 Ga0207654_10092299 Ga0207654_100922991 224
1294 3300025913 Ga0207695_10000058 Ga0207695_1000005864 224
1295 3300025913 Ga0207695_10000200 Ga0207695_100002004 224
1296 3300025913 Ga0207695_10000659 Ga0207695_1000065942 224
1297 3300025913 Ga0207695_10001190 Ga0207695_1000119019 224
1298 3300025913 Ga0207695_10002235 Ga0207695_1000223512 224
1299 3300025913 Ga0207695_10014138 Ga0207695_100141382 224
1300 3300025913 Ga0207695_10034959 Ga0207695_100349595 224
1301 3300025913 Ga0207695_10036543 Ga0207695_100365435 224
1302 3300025914 Ga0207671_10000661 Ga0207671_1000066110 224
1303 3300025914 Ga0207671_10000803 Ga0207671_1000080315 224
1304 3300025914 Ga0207671_10001644 Ga0207671_1000164411 224
1305 3300025914 Ga0207671_10001644 Ga0207671_100016449 224
1306 3300025914 Ga0207671_10002915 Ga0207671_1000291512 224
1307 3300025914 Ga0207671_10004905 Ga0207671_100049054 224
1308 3300025914 Ga0207671_10005056 Ga0207671_100050569 224
1309 3300025914 Ga0207671_10019259 Ga0207671_100192594 224
1310 3300025914 Ga0207671_10025394 Ga0207671_100253945 224
1311 3300025914 Ga0207671_10077590 Ga0207671_100775902 224
1312 3300025914 Ga0207671_10112302 Ga0207671_101123022 224
1313 3300025915 Ga0207693_10006739 Ga0207693_100067397 224
1314 3300025915 Ga0207693_10105293 Ga0207693_101052932 224
1315 3300025915 Ga0207693_10244194 Ga0207693_102441942 224
1316 3300025915 Ga0207693_10414540 Ga0207693_104145401 224
1317 3300025916 Ga0207663_10003775 Ga0207663_100037755 224
1318 3300025916 Ga0207663_10058622 Ga0207663_100586222 224
1319 3300025916 Ga0207663_10353272 Ga0207663_103532721 224
1320 3300025918 Ga0207662_10002651 Ga0207662_100026517 224
1321 3300025918 Ga0207662_10461679 Ga0207662_104616791 224
1322 3300025919 Ga0207657_10004074 Ga0207657_1000407411 224
1323 3300025919 Ga0207657_10111671 Ga0207657_101116712 224
1324 3300025919 Ga0207657_10169655 Ga0207657_101696553 224
1325 3300025919 Ga0207657_10469421 Ga0207657_104694212 224
1326 3300025920 Ga0207649_10000530 Ga0207649_1000053025 224
1327 3300025920 Ga0207649_10138554 Ga0207649_101385542 224
1328 3300025921 Ga0207652_10006423 Ga0207652_1000642312 224
1329 3300025921 Ga0207652_10333225 Ga0207652_103332252 224
1330 3300025922 Ga0207646_10000625 Ga0207646_1000062510 224
1331 3300025922 Ga0207646_10002765 Ga0207646_100027659 224
1332 3300025922 Ga0207646_10039451 Ga0207646_100394512 224
1333 3300025922 Ga0207646_10080197 Ga0207646_100801972 224
1334 3300025922 Ga0207646_10098829 Ga0207646_100988291 224
1335 3300025922 Ga0207646_10213873 Ga0207646_102138732 224
1336 3300025922 Ga0207646_10215936 Ga0207646_102159362 224
1337 3300025922 Ga0207646_10233807 Ga0207646_102338072 224
1338 3300025922 Ga0207646_10508698 Ga0207646_105086982 224
1339 3300025923 Ga0207681_10024677 Ga0207681_100246774 224
1340 3300025923 Ga0207681_10075812 Ga0207681_100758123 224
1341 3300025923 Ga0207681_10116300 Ga0207681_101163002 224
1342 3300025924 Ga0207694_10003129 Ga0207694_100031293 224
1343 3300025924 Ga0207694_10052405 Ga0207694_100524053 224
1344 3300025924 Ga0207694_10112718 Ga0207694_101127182 224
1345 3300025924 Ga0207694_10120323 Ga0207694_101203231 224
1346 3300025924 Ga0207694_10189327 Ga0207694_101893272 224
1347 3300025924 Ga0207694_10277632 Ga0207694_102776322 224
1348 3300025924 Ga0207694_10537667 Ga0207694_105376671 224
1349 3300025924 Ga0207694_10573882 Ga0207694_105738821 224
1350 3300025925 Ga0207650_10095060 Ga0207650_100950602 224
1351 3300025926 Ga0207659_10034348 Ga0207659_100343482 224
1352 3300025926 Ga0207659_10057527 Ga0207659_100575273 224
1353 3300025926 Ga0207659_10192202 Ga0207659_101922021 224
1354 3300025926 Ga0207659_10317772 Ga0207659_103177721 224
1355 3300025928 Ga0207700_10214144 Ga0207700_102141442 224
1356 3300025928 Ga0207700_10283572 Ga0207700_102835722 224
1357 3300025928 Ga0207700_10390841 Ga0207700_103908412 224
1358 3300025928 Ga0207700_10439922 Ga0207700_104399222 224
1359 3300025929 Ga0207664_10021168 Ga0207664_100211683 224
1360 3300025929 Ga0207664_10228083 Ga0207664_102280831 224
1361 3300025929 Ga0207664_10284705 Ga0207664_102847052 224
1362 3300025931 Ga0207644_10310710 Ga0207644_103107102 224
1363 3300025931 Ga0207644_10332953 Ga0207644_103329531 224
1364 3300025931 Ga0207644_10337884 Ga0207644_103378842 224
1365 3300025931 Ga0207644_10697424 Ga0207644_106974241 224
1366 3300025932 Ga0207690_10001262 Ga0207690_1000126211 224
1367 3300025932 Ga0207690_10020898 Ga0207690_100208984 224
1368 3300025932 Ga0207690_10034187 Ga0207690_100341872 224
1369 3300025932 Ga0207690_10044139 Ga0207690_100441392 224
1370 3300025933 Ga0207706_10000165 Ga0207706_1000016523 224
1371 3300025933 Ga0207706_10044497 Ga0207706_100444972 224
1372 3300025933 Ga0207706_10087353 Ga0207706_100873534 224
1373 3300025933 Ga0207706_10207640 Ga0207706_102076401 224
1374 3300025933 Ga0207706_10261986 Ga0207706_102619862 224
1375 3300025933 Ga0207706_10330407 Ga0207706_103304072 224
1376 3300025934 Ga0207686_10031129 Ga0207686_100311294 224
1377 3300025934 Ga0207686_10049656 Ga0207686_100496564 224
1378 3300025934 Ga0207686_10188785 Ga0207686_101887852 224
1379 3300025934 Ga0207686_10238554 Ga0207686_102385541 224
1380 3300025934 Ga0207686_10396262 Ga0207686_103962622 224
1381 3300025935 Ga0207709_10054143 Ga0207709_100541432 224
1382 3300025936 Ga0207670_10295407 Ga0207670_102954072 224
1383 3300025937 Ga0207669_10028918 Ga0207669_100289183 224
1384 3300025937 Ga0207669_10120248 Ga0207669_101202483 224
1385 3300025937 Ga0207669_10232397 Ga0207669_102323972 224
1386 3300025937 Ga0207669_10289308 Ga0207669_102893082 224
1387 3300025938 Ga0207704_10023178 Ga0207704_100231784 224
1388 3300025938 Ga0207704_10094083 Ga0207704_100940832 224
1389 3300025938 Ga0207704_10122688 Ga0207704_101226882 224
1390 3300025938 Ga0207704_10189130 Ga0207704_101891303 224
1391 3300025939 Ga0207665_10007568 Ga0207665_100075684 224
1392 3300025939 Ga0207665_10020315 Ga0207665_100203158 224
1393 3300025939 Ga0207665_10125622 Ga0207665_101256222 224
1394 3300025939 Ga0207665_10131740 Ga0207665_101317401 224
1395 3300025939 Ga0207665_10196636 Ga0207665_101966361 224
1396 3300025939 Ga0207665_10204912 Ga0207665_102049123 224
1397 3300025939 Ga0207665_10320081 Ga0207665_103200812 224
1398 3300025940 Ga0207691_10004699 Ga0207691_1000469910 224
1399 3300025940 Ga0207691_10077611 Ga0207691_100776111 224
1400 3300025940 Ga0207691_10131253 Ga0207691_101312532 224
1401 3300025940 Ga0207691_10329507 Ga0207691_103295072 224
1402 3300025941 Ga0207711_10010770 Ga0207711_100107703 224
1403 3300025941 Ga0207711_10063515 Ga0207711_100635152 224
1404 3300025941 Ga0207711_10188744 Ga0207711_101887443 224
1405 3300025941 Ga0207711_10280749 Ga0207711_102807492 224
1406 3300025942 Ga0207689_10009286 Ga0207689_100092868 224
1407 3300025942 Ga0207689_10100372 Ga0207689_101003723 224
1408 3300025942 Ga0207689_10142936 Ga0207689_101429361 224
1409 3300025944 Ga0207661_10142667 Ga0207661_101426673 224
1410 3300025945 Ga0207679_10296712 Ga0207679_102967121 224
1411 3300025945 Ga0207679_10367826 Ga0207679_103678261 224
1412 3300025949 Ga0207667_10000231 Ga0207667_100002319 224
1413 3300025949 Ga0207667_10000770 Ga0207667_1000077014 224
1414 3300025949 Ga0207667_10058352 Ga0207667_100583523 224
1415 3300025949 Ga0207667_10058910 Ga0207667_100589103 224
1416 3300025949 Ga0207667_10065966 Ga0207667_100659664 224
1417 3300025949 Ga0207667_10725282 Ga0207667_107252822 224
1418 3300025949 Ga0207667_10899763 Ga0207667_108997631 224
1419 3300025960 Ga0207651_10009930 Ga0207651_100099304 224
1420 3300025960 Ga0207651_10114722 Ga0207651_101147223 224
1421 3300025961 Ga0207712_10244905 Ga0207712_102449051 224
1422 3300025961 Ga0207712_10340348 Ga0207712_103403481 224
1423 3300025961 Ga0207712_10743902 Ga0207712_107439021 224
1424 3300025972 Ga0207668_10060197 Ga0207668_100601972 224
1425 3300025972 Ga0207668_10065312 Ga0207668_100653122 224
1426 3300025972 Ga0207668_10169532 Ga0207668_101695322 224
1427 3300025972 Ga0207668_10436614 Ga0207668_104366142 224
1428 3300025972 Ga0207668_10614573 Ga0207668_106145732 224
1429 3300025981 Ga0207640_10000002 Ga0207640_10000002114 224
1430 3300025981 Ga0207640_10017825 Ga0207640_100178253 224
1431 3300025986 Ga0207658_10062424 Ga0207658_100624243 224
1432 3300025986 Ga0207658_10072624 Ga0207658_100726244 224
1433 3300025986 Ga0207658_10123069 Ga0207658_101230694 224
1434 3300025986 Ga0207658_10290982 Ga0207658_102909822 224
1435 3300025986 Ga0207658_10592210 Ga0207658_105922101 224
1436 3300026023 Ga0207677_10011777 Ga0207677_100117774 224
1437 3300026023 Ga0207677_10069049 Ga0207677_100690493 224
1438 3300026023 Ga0207677_10113187 Ga0207677_101131872 224
1439 3300026023 Ga0207677_10218598 Ga0207677_102185981 224
1440 3300026035 Ga0207703_10001669 Ga0207703_100016699 224
1441 3300026035 Ga0207703_10330766 Ga0207703_103307662 224
1442 3300026035 Ga0207703_10333055 Ga0207703_103330552 224
1443 3300026041 Ga0207639_10000009 Ga0207639_1000000985 224
1444 3300026041 Ga0207639_10455988 Ga0207639_104559882 224
1445 3300026067 Ga0207678_10000624 Ga0207678_1000062423 224
1446 3300026067 Ga0207678_10070343 Ga0207678_100703432 224
1447 3300026067 Ga0207678_10245080 Ga0207678_102450801 224
1448 3300026075 Ga0207708_10086058 Ga0207708_100860584 224
1449 3300026078 Ga0207702_10235703 Ga0207702_102357032 224
1450 3300026078 Ga0207702_10236442 Ga0207702_102364423 224
1451 3300026078 Ga0207702_10262469 Ga0207702_102624692 224
1452 3300026078 Ga0207702_10770851 Ga0207702_107708511 224
1453 3300026088 Ga0207641_10000132 Ga0207641_100001326 224
1454 3300026088 Ga0207641_10005723 Ga0207641_100057239 224
1455 3300026088 Ga0207641_10046016 Ga0207641_100460163 224
1456 3300026088 Ga0207641_10260374 Ga0207641_102603741 224
1457 3300026088 Ga0207641_10398732 Ga0207641_103987322 224
1458 3300026088 Ga0207641_10608043 Ga0207641_106080431 224
1459 3300026089 Ga0207648_10164563 Ga0207648_101645632 224
1460 3300026089 Ga0207648_10273109 Ga0207648_102731092 224
1461 3300026089 Ga0207648_10297346 Ga0207648_102973462 224
1462 3300026095 Ga0207676_10140557 Ga0207676_101405572 224
1463 3300026095 Ga0207676_10556718 Ga0207676_105567181 224
1464 3300026095 Ga0207676_10810670 Ga0207676_108106701 224
1465 3300026095 Ga0207676_10864793 Ga0207676_108647931 224
1466 3300026116 Ga0207674_10015348 Ga0207674_100153488 224
1467 3300026116 Ga0207674_10044091 Ga0207674_100440912 224
1468 3300026118 Ga0207675_100038279 Ga0207675_1000382794 224
1469 3300026118 Ga0207675_100323684 Ga0207675_1003236842 224
1470 3300026118 Ga0207675_100462319 Ga0207675_1004623192 224
1471 3300026121 Ga0207683_10032217 Ga0207683_100322173 224
1472 3300026121 Ga0207683_10055781 Ga0207683_100557813 224
1473 3300026121 Ga0207683_10317509 Ga0207683_103175091 224
1474 3300026121 Ga0207683_10320159 Ga0207683_103201592 224
1475 3300026142 Ga0207698_10147564 Ga0207698_101475643 224
1476 3300026142 Ga0207698_10208216 Ga0207698_102082162 224
1477 3300026142 Ga0207698_10670852 Ga0207698_106708522 224
1478 3300026142 Ga0207698_10741560 Ga0207698_107415602 224
1479 3300027876 Ga0209974_10049712 Ga0209974_100497122 224
1480 3300028379 Ga0268266_10001437 Ga0268266_1000143728 224
1481 3300028379 Ga0268266_10002230 Ga0268266_100022305 224
1482 3300028379 Ga0268266_10004567 Ga0268266_100045672 224
1483 3300028379 Ga0268266_10264329 Ga0268266_102643292 224
1484 3300028379 Ga0268266_10318979 Ga0268266_103189792 224
1485 3300028379 Ga0268266_10428320 Ga0268266_104283202 224
1486 3300028379 Ga0268266_10543153 Ga0268266_105431532 224
1487 3300028380 Ga0268265_10157567 Ga0268265_101575672 224
1488 3300028380 Ga0268265_10296963 Ga0268265_102969632 224
1489 3300028381 Ga0268264_10019696 Ga0268264_100196964 224
1490 3300028381 Ga0268264_10026456 Ga0268264_100264561 224
1491 3300028381 Ga0268264_10039417 Ga0268264_100394174 224
1492 3300028381 Ga0268264_10087769 Ga0268264_100877692 224
1493 3300028381 Ga0268264_10111230 Ga0268264_101112304 224
1494 3300028381 Ga0268264_10194111 Ga0268264_101941112 224
1495 3300028381 Ga0268264_10338898 Ga0268264_103388982 224
1496 3300028381 Ga0268264_10368764 Ga0268264_103687642 224
1497 3300028654 Ga0265322_10033185 Ga0265322_100331852 224
1498 3300028786 Ga0307517_10009298 Ga0307517_1000929814 224
1499 3300028786 Ga0307517_10020980 Ga0307517_100209805 224
1500 3300028794 Ga0307515_10000076 Ga0307515_1000007645 224
1501 3300028794 Ga0307515_10001092 Ga0307515_100010929 224
1502 3300028794 Ga0307515_10004328 Ga0307515_1000432831 224
1503 3300028794 Ga0307515_10145253 Ga0307515_101452532 224
1504 3300028794 Ga0307515_10176217 Ga0307515_101762172 224
1505 3300028800 Ga0265338_10000053 Ga0265338_10000053129 224
1506 3300028800 Ga0265338_10000096 Ga0265338_1000009636 224
1507 3300028800 Ga0265338_10129981 Ga0265338_101299812 224
1508 3300028800 Ga0265338_10318098 Ga0265338_103180981 224
1509 3300029957 Ga0265324_10007037 Ga0265324_100070374 224
1510 3300030521 Ga0307511_10003970 Ga0307511_100039704 224
1511 3300030744 Ga0316181_1158880 Ga0316181_115888017 224
1512 3300030744 Ga0316181_1280348 Ga0316181_12803482 224
1513 3300031238 Ga0265332_10050648 Ga0265332_100506483 224
1514 3300031240 Ga0265320_10099032 Ga0265320_100990322 224
1515 3300031241 Ga0265325_10000976 Ga0265325_1000097615 224
1516 3300031241 Ga0265325_10184605 Ga0265325_101846051 224
1517 3300031242 Ga0265329_10002461 Ga0265329_100024612 224
1518 3300031249 Ga0265339_10156263 Ga0265339_101562631 224
1519 3300031250 Ga0265331_10087975 Ga0265331_100879751 224
1520 3300031251 Ga0265327_10001236 Ga0265327_1000123631 224
1521 3300031251 Ga0265327_10001849 Ga0265327_1000184914 224
1522 3300031456 Ga0307513_10265803 Ga0307513_102658032 224
1523 3300031507 Ga0307509_10175490 Ga0307509_101754902 224
1524 3300031548 Ga0307408_100000459 Ga0307408_10000045920 224
1525 3300031711 Ga0265314_10000405 Ga0265314_1000040541 224
1526 3300031901 Ga0307406_10000026 Ga0307406_1000002622 224
1527 3300031911 Ga0307412_10000001 Ga0307412_10000001646 224
1528 3300031911 Ga0307412_10397908 Ga0307412_103979082 224
1529 3300031995 Ga0307409_100000253 Ga0307409_1000002533 224
1530 3300032002 Ga0307416_100131092 Ga0307416_1001310922 224
1531 3300032004 Ga0307414_10000015 Ga0307414_10000015236 224
1532 3300032004 Ga0307414_10022425 Ga0307414_100224251 224
1533 3300032004 Ga0307414_10048663 Ga0307414_100486633 224
1534 3300032004 Ga0307414_10138141 Ga0307414_101381412 224
1535 3300032004 Ga0307414_10211622 Ga0307414_102116222 224
1536 3300033180 Ga0307510_10353517 Ga0307510_103535171 224
1537 3300033180 Ga0307510_10394291 Ga0307510_103942911 224
1538 3300035084 Ga0373928_0000033 Ga0373928_0000033_13534_14301 224
1539 3300035085 Ga0373929_0000845 Ga0373929_0000845_2118_2885 224
1540 3300035089 Ga0373944_0000107 Ga0373944_0000107_4990_5757 224
1541 3300035090 Ga0373949_0000601 Ga0373949_0000601_8641_9408 224
1542 3300035091 Ga0373951_0001878 Ga0373951_0001878_330_1097 224
1543 3300035112 Ga0373932_0000001 Ga0373932_0000001_1324593_1325360 224
1544 3300035117 Ga0373953_0047822 Ga0373953_0047822_950_1699 224
1545 3300035117 Ga0373953_0066450 Ga0373953_0066450_158_931 224
1546 3300035119 Ga0373956_0093672 Ga0373956_0093672_335_1084 224
1547 3300035121 Ga0373960_0064186 Ga0373960_0064186_147_896 224
1548 3300035170 Ga0373943_0037749 Ga0373943_0037749_549_1304 224
1549 3300035171 Ga0373946_0086854 Ga0373946_0086854_555_1322 224
1550 3300035172 Ga0373955_0020220 Ga0373955_0020220_853_1602 224
1551 3300035242 Ga0373962_0000101 Ga0373962_0000101_4517_5284 224
1552 3300035410 Ga0373924_0052477 Ga0373924_0052477_661_1440 224
1553 3300035410 Ga0373924_0170537 Ga0373924_0170537_73_822 224
1554 3300035691 Ga0373931_0000002 Ga0373931_0000002_170038_170805 224
1555 3300035691 Ga0373931_0017875 Ga0373931_0017875_2451_3200 224
1556 3300035691 Ga0373931_0060659 Ga0373931_0060659_349_1119 224
1557 3300035691 Ga0373931_0065346 Ga0373931_0065346_1112_1918 224
1558 3300035692 Ga0373935_0040796 Ga0373935_0040796_1078_1833 224
1559 3300035692 Ga0373935_0085397 Ga0373935_0085397_220_969 224
1560 3300035692 Ga0373935_0218019 Ga0373935_0218019_175_930 224
1561 3300035692 Ga0373935_0253575 Ga0373935_0253575_296_1063 224
1562 3300035695 Ga0373927_0000605 Ga0373927_0000605_352_1101 224
1563 3300035695 Ga0373927_0007288 Ga0373927_0007288_6341_7108 224
1564 3300035724 Ga0373933_0182140 Ga0373933_0182140_60_815 224
1565 3300035725 Ga0373947_0010476 Ga0373947_0010476_3975_4796 224
1566 3300035725 Ga0373947_0029059 Ga0373947_0029059_142_909 224
1567 3300035725 Ga0373947_0126406 Ga0373947_0126406_563_1318 224
1568 3300035725 Ga0373947_0132343 Ga0373947_0132343_371_1126 224
1569 3300036401 Ga0373937_0026160 Ga0373937_0026160_425_1174 224
1570 3300036401 Ga0373937_0156646 Ga0373937_0156646_656_1417 224
1571 3300036401 Ga0373937_0192580 Ga0373937_0192580_1080_1829 224
1572 3300037068 Ga0373925_0000215 Ga0373925_0000215_41783_42550 224
1573 3300037068 Ga0373925_0015234 Ga0373925_0015234_2176_2925 224
1574 3300037068 Ga0373925_0105766 Ga0373925_0105766_506_1261 224
1575 3300037068 Ga0373925_0250236 Ga0373925_0250236_481_1230 224
1576 3300037068 Ga0373925_0251740 Ga0373925_0251740_480_1229 224
1577 3300037068 Ga0373925_0314838 Ga0373925_0314838_370_1191 224
1578 3300037068 Ga0373925_0491365 Ga0373925_0491365_70_828 224
1579 3300037312 Ga0395899_0235392 Ga0395899_0235392_261_1055 224
1580 3300037418 Ga0395900_0011309 Ga0395900_0011309_3010_3762 224
1581 3300037466 Ga0395898_0008660 Ga0395898_0008660_1713_2465 224
1582 3300037466 Ga0395898_0010842 Ga0395898_0010842_6759_7517 224
1583 3300037471 Ga0395905_0000002 Ga0395905_0000002_817932_818681 224
1584 3300037471 Ga0395905_0173370 Ga0395905_0173370_432_1181 224
1585 3300037471 Ga0395905_0175029 Ga0395905_0175029_668_1429 224
1586 3300037853 Ga0436364_0953089 Ga0436364_0953089_1339_2088 224
1587 3300038443 Ga0395901_0002060 Ga0395901_0002060_11745_12497 224
1588 3300038443 Ga0395901_0074788 Ga0395901_0074788_1160_1909 224
1589 3300038443 Ga0395901_0086602 Ga0395901_0086602_255_1013 224
1590 3300038443 Ga0395901_0274419 Ga0395901_0274419_986_1735 224
1591 3300039438 Ga0436360_0146362 Ga0436360_0146362_3581_4330 224
1592 3300039447 Ga0436361_0585330 Ga0436361_0585330_964_1713 224
1593 3300039447 Ga0436361_0855221 Ga0436361_0855221_14243_14992 224
1594 3300039453 Ga0436362_0382984 Ga0436362_0382984_3597_4346 224
1595 3300041407 Ga0439447_045642 Ga0439447_045642_74_829 224
1596 3300041486 Ga0451807_2464331 Ga0451807_2464331_812_1561 224
1597 3300042004 Ga0439445_0000394 Ga0439445_0000394_3469_4227 224
1598 3300042007 Ga0439449_0023428 Ga0439449_0023428_477_1232 224
1599 3300042435 Ga0439434_0012601 Ga0439434_0012601_87_836 224
1600 3300042436 Ga0439435_0090056 Ga0439435_0090056_140_889 224
1601 3300042439 Ga0439464_0081388 Ga0439464_0081388_162_917 224
1602 3300042461 Ga0439460_0021407 Ga0439460_0021407_942_1691 224
1603 3300042876 Ga0451577_0075287 Ga0451577_0075287_1975_2739 224
1604 3300042876 Ga0451577_0305386 Ga0451577_0305386_66_827 224
1605 3300044658 Ga0466972_0000019 Ga0466972_0000019_12668_13426 224
1606 3300044684 Ga0466966_0143238 Ga0466966_0143238_213_965 224
1607 3300044712 Ga0453684_0494672 Ga0453684_0494672_323_1087 224
1608 3300044765 Ga0466970_0003287 Ga0466970_0003287_3794_4552 224
1609 3300044842 Ga0466957_0132236 Ga0466957_0132236_58_810 224
1610 3300045051 Ga0451576_0070987 Ga0451576_0070987_2209_2973 224
1611 3300045051 Ga0451576_0096464 Ga0451576_0096464_1207_1971 224
1612 3300045051 Ga0451576_0127998 Ga0451576_0127998_916_1677 224
1613 3300045051 Ga0451576_0240038 Ga0451576_0240038_605_1366 224
1614 3300045051 Ga0451576_0251267 Ga0451576_0251267_544_1308 224
1615 3300045051 Ga0451576_0554318 Ga0451576_0554318_220_969 224
1616 3300046453 Ga0495627_005848 Ga0495627_005848_1094_1852 224
1617 3300046454 Ga0495592_0076533 Ga0495592_0076533_1060_1833 224
1618 3300046455 Ga0495603_0020222 Ga0495603_0020222_1681_2430 224
1619 3300046462 Ga0495651_0044993 Ga0495651_0044993_2216_2965 224
1620 3300046471 Ga0495650_0000022 Ga0495650_0000022_173650_174399 224
1621 3300046471 Ga0495650_0000030 Ga0495650_0000030_28461_29225 224
1622 3300046471 Ga0495650_0000036 Ga0495650_0000036_187741_188499 224
1623 3300046471 Ga0495650_0000095 Ga0495650_0000095_56803_57594 224
1624 3300046472 Ga0495580_0001994 Ga0495580_0001994_13232_13981 224
1625 3300046472 Ga0495580_0023216 Ga0495580_0023216_381_1130 224
1626 3300046472 Ga0495580_0097339 Ga0495580_0097339_985_1734 224
1627 3300046472 Ga0495580_0116033 Ga0495580_0116033_428_1177 224
1628 3300046475 Ga0495639_0223262 Ga0495639_0223262_125_880 224
1629 3300046477 Ga0495664_0031676 Ga0495664_0031676_795_1544 224
1630 3300046477 Ga0495664_0089458 Ga0495664_0089458_303_1058 224
1631 3300046492 Ga0495585_0000198 Ga0495585_0000198_23085_23843 224
1632 3300046492 Ga0495585_0013061 Ga0495585_0013061_2723_3484 224
1633 3300046492 Ga0495585_0142150 Ga0495585_0142150_438_1190 224
1634 3300046499 Ga0495594_0004316 Ga0495594_0004316_5776_6528 224
1635 3300046500 Ga0495596_0030617 Ga0495596_0030617_364_1122 224
1636 3300046506 Ga0495583_0097043 Ga0495583_0097043_268_1026 224
1637 3300046507 Ga0495606_0000009 Ga0495606_0000009_191945_192694 224
1638 3300046507 Ga0495606_0003985 Ga0495606_0003985_6068_6826 224
1639 3300046507 Ga0495606_0004976 Ga0495606_0004976_5600_6388 224
1640 3300046507 Ga0495606_0010903 Ga0495606_0010903_2091_2840 224
1641 3300046507 Ga0495606_0012394 Ga0495606_0012394_923_1681 224
1642 3300046507 Ga0495606_0073017 Ga0495606_0073017_415_1173 224
1643 3300046507 Ga0495606_0094811 Ga0495606_0094811_1005_1757 224
1644 3300046507 Ga0495606_0279172 Ga0495606_0279172_54_803 224
1645 3300046512 Ga0495610_0000270 Ga0495610_0000270_31104_31862 224
1646 3300046512 Ga0495610_0000783 Ga0495610_0000783_6838_7629 224
1647 3300046512 Ga0495610_0005278 Ga0495610_0005278_5033_5791 224
1648 3300046512 Ga0495610_0048069 Ga0495610_0048069_1137_1949 224
1649 3300046512 Ga0495610_0186481 Ga0495610_0186481_90_848 224
1650 3300046513 Ga0495616_0002230 Ga0495616_0002230_7287_8036 224
1651 3300046514 Ga0495618_0143001 Ga0495618_0143001_470_1243 224
1652 3300046516 Ga0495628_0000041 Ga0495628_0000041_43816_44565 224
1653 3300046516 Ga0495628_0122859 Ga0495628_0122859_241_1014 224
1654 3300046516 Ga0495628_0122911 Ga0495628_0122911_1102_1851 224
1655 3300046517 Ga0495630_0345131 Ga0495630_0345131_92_841 224
1656 3300046518 Ga0495631_0125326 Ga0495631_0125326_295_1044 224
1657 3300046520 Ga0495637_0067880 Ga0495637_0067880_469_1272 224
1658 3300046520 Ga0495637_0093735 Ga0495637_0093735_386_1144 224
1659 3300046520 Ga0495637_0118949 Ga0495637_0118949_102_860 224
1660 3300046520 Ga0495637_0153494 Ga0495637_0153494_94_813 224
1661 3300046522 Ga0495643_0055800 Ga0495643_0055800_353_1111 224
1662 3300046523 Ga0495644_0000075 Ga0495644_0000075_42203_42955 224
1663 3300046523 Ga0495644_0000076 Ga0495644_0000076_38615_39364 224
1664 3300046524 Ga0495648_0008857 Ga0495648_0008857_2346_3107 224
1665 3300046524 Ga0495648_0032458 Ga0495648_0032458_2644_3402 224
1666 3300046524 Ga0495648_0035850 Ga0495648_0035850_1651_2412 224
1667 3300046525 Ga0495663_0006646 Ga0495663_0006646_892_1650 224
1668 3300046528 Ga0495642_0071544 Ga0495642_0071544_106_855 224
1669 3300046528 Ga0495642_0074359 Ga0495642_0074359_618_1370 224
1670 3300046529 Ga0495652_0098415 Ga0495652_0098415_1280_2053 224
1671 3300046529 Ga0495652_0232866 Ga0495652_0232866_413_1162 224
1672 3300046530 Ga0495654_0000129 Ga0495654_0000129_30398_31162 224
1673 3300046535 Ga0495586_0292885 Ga0495586_0292885_114_866 224
1674 3300046536 Ga0495587_0047666 Ga0495587_0047666_1114_1863 224
1675 3300046538 Ga0495609_0001316 Ga0495609_0001316_1567_2325 224
1676 3300046543 Ga0495645_0005363 Ga0495645_0005363_6520_7269 224
1677 3300046543 Ga0495645_0047707 Ga0495645_0047707_553_1326 224
1678 3300046543 Ga0495645_0078181 Ga0495645_0078181_1504_2253 224
1679 3300046558 Ga0495633_0000027 Ga0495633_0000027_5290_6048 224
1680 3300046558 Ga0495633_0028707 Ga0495633_0028707_1111_1863 224
1681 3300046559 Ga0495667_0137514 Ga0495667_0137514_140_889 224
1682 3300046559 Ga0495667_0142268 Ga0495667_0142268_107_862 224
1683 3300046615 Ga0495656_0015261 Ga0495656_0015261_38_787 224
1684 3300046616 Ga0495668_0000010 Ga0495668_0000010_187178_187939 224
1685 3300046616 Ga0495668_0064646 Ga0495668_0064646_716_1507 224
1686 3300046648 Ga0495611_0000342 Ga0495611_0000342_21551_22309 224
1687 3300046648 Ga0495611_0217345 Ga0495611_0217345_72_821 224
1688 3300046660 Ga0495625_0000007 Ga0495625_0000007_139609_140358 224
1689 3300046660 Ga0495625_0000289 Ga0495625_0000289_58722_59471 224
1690 3300046660 Ga0495625_0000576 Ga0495625_0000576_51844_52605 224
1691 3300046660 Ga0495625_0015147 Ga0495625_0015147_3476_4234 224
1692 3300046660 Ga0495625_0026503 Ga0495625_0026503_1500_2249 224
1693 3300046660 Ga0495625_0030448 Ga0495625_0030448_3222_3971 224
1694 3300046660 Ga0495625_0031693 Ga0495625_0031693_566_1330 224
1695 3300046660 Ga0495625_0097532 Ga0495625_0097532_126_884 224
1696 3300046660 Ga0495625_0119709 Ga0495625_0119709_191_949 224
1697 3300046660 Ga0495625_0168013 Ga0495625_0168013_685_1443 224
1698 3300046660 Ga0495625_0383443 Ga0495625_0383443_105_860 224
1699 3300046665 Ga0495661_0004927 Ga0495661_0004927_904_1695 224
1700 3300046665 Ga0495661_0005579 Ga0495661_0005579_325_1083 224
1701 3300046665 Ga0495661_0012118 Ga0495661_0012118_3847_4605 224
1702 3300046665 Ga0495661_0099037 Ga0495661_0099037_581_1372 224
1703 3300046679 Ga0495623_0028098 Ga0495623_0028098_678_1427 224
1704 3300046679 Ga0495623_0054998 Ga0495623_0054998_838_1593 224
1705 3300046680 Ga0495646_0037602 Ga0495646_0037602_286_1035 224
1706 3300046680 Ga0495646_0196417 Ga0495646_0196417_82_837 224
1707 3300046683 Ga0495658_0298807 Ga0495658_0298807_89_844 224
1708 3300046684 Ga0495669_0002214 Ga0495669_0002214_4321_5070 224
1709 3300046684 Ga0495669_0016551 Ga0495669_0016551_654_1406 224
1710 3300046689 Ga0495613_0381204 Ga0495613_0381204_36_791 224
1711 3300046691 Ga0495670_0005705 Ga0495670_0005705_4488_5240 224
1712 3300046691 Ga0495670_0147092 Ga0495670_0147092_430_1179 224
1713 3300046694 Ga0495649_0000007 Ga0495649_0000007_295058_295807 224
1714 3300046809 Ga0495600_0202691 Ga0495600_0202691_458_1213 224
1715 3300046810 Ga0495660_0005538 Ga0495660_0005538_6337_7086 224
1716 3300047315 Ga0495581_0090808 Ga0495581_0090808_819_1568 224
1717 3300047315 Ga0495581_0129745 Ga0495581_0129745_416_1171 224
1718 3300047317 Ga0495604_0067498 Ga0495604_0067498_1449_2198 224
1719 3300047317 Ga0495604_0122828 Ga0495604_0122828_317_1072 224
1720 3300047318 Ga0495636_0014481 Ga0495636_0014481_802_1551 224
1721 3300047319 Ga0495674_0059924 Ga0495674_0059924_570_1343 224
1722 3300047320 Ga0495672_0074765 Ga0495672_0074765_986_1777 224
1723 3300047320 Ga0495672_0078528 Ga0495672_0078528_798_1625 224
1724 3300047323 Ga0495683_0020798 Ga0495683_0020798_2331_3080 224
1725 3300047323 Ga0495683_0104602 Ga0495683_0104602_38_787 224
1726 3300047443 Ga0495687_000960 Ga0495687_000960_9845_10636 224
1727 3300047469 Ga0495673_0030286 Ga0495673_0030286_1679_2428 224
1728 3300047470 Ga0495681_0089589 Ga0495681_0089589_183_941 224
1729 3300047471 Ga0495684_0005038 Ga0495684_0005038_5514_6266 224
1730 3300047471 Ga0495684_0056102 Ga0495684_0056102_1828_2583 224
1731 3300047471 Ga0495684_0071559 Ga0495684_0071559_1087_1836 224
1732 3300047471 Ga0495684_0120927 Ga0495684_0120927_679_1428 224
1733 3300047472 Ga0495686_0000064 Ga0495686_0000064_49278_50069 224
1734 3300047472 Ga0495686_0000277 Ga0495686_0000277_40726_41484 224
1735 3300047472 Ga0495686_0006195 Ga0495686_0006195_4943_5692 224
1736 3300047472 Ga0495686_0021029 Ga0495686_0021029_160_921 224
1737 3300047472 Ga0495686_0029470 Ga0495686_0029470_232_990 224
1738 3300047472 Ga0495686_0032401 Ga0495686_0032401_2220_2978 224
1739 3300047472 Ga0495686_0041117 Ga0495686_0041117_1338_2096 224
1740 3300047472 Ga0495686_0050475 Ga0495686_0050475_799_1587 224
1741 3300047472 Ga0495686_0120909 Ga0495686_0120909_121_918 224
1742 3300047472 Ga0495686_0175288 Ga0495686_0175288_187_939 224
1743 3300047472 Ga0495686_0183800 Ga0495686_0183800_325_1074 224
1744 3300048088 Ga0495602_0225993 Ga0495602_0225993_243_1016 224
1745 3300048903 Ga0496100_0004064 Ga0496100_0004064_1912_2667 224
1746 3300048903 Ga0496100_0043793 Ga0496100_0043793_1144_1929 224
1747 3300048903 Ga0496100_0126562 Ga0496100_0126562_718_1467 224
1748 3300048904 Ga0496101_0006160 Ga0496101_0006160_3947_4702 224
1749 3300048904 Ga0496101_0013899 Ga0496101_0013899_3403_4188 224
1750 3300048904 Ga0496101_0103500 Ga0496101_0103500_901_1707 224
1751 3300048904 Ga0496101_0201505 Ga0496101_0201505_45_836 224
1752 3300048904 Ga0496101_0710274 Ga0496101_0710274_24_776 224
1753 3300048905 Ga0496102_0000946 Ga0496102_0000946_22446_23282 224
1754 3300048905 Ga0496102_0139945 Ga0496102_0139945_289_1113 224
1755 3300048905 Ga0496102_0223781 Ga0496102_0223781_232_1041 224
1756 3300048905 Ga0496102_0322287 Ga0496102_0322287_196_945 224
1757 3300048905 Ga0496102_0540193 Ga0496102_0540193_97_867 224
1758 3300048906 Ga0496103_0010131 Ga0496103_0010131_3353_4108 224
1759 3300048906 Ga0496103_0040210 Ga0496103_0040210_772_1521 224
1760 3300048906 Ga0496103_0141636 Ga0496103_0141636_496_1245 224
1761 3300048907 Ga0496104_0000027 Ga0496104_0000027_144118_144867 224
1762 3300048907 Ga0496104_0011624 Ga0496104_0011624_2652_3401 224
1763 3300048907 Ga0496104_0021707 Ga0496104_0021707_1998_2783 224
1764 3300048907 Ga0496104_0084748 Ga0496104_0084748_1329_2084 224
1765 3300048908 Ga0496105_0002965 Ga0496105_0002965_4747_5526 224
1766 3300048908 Ga0496105_0038031 Ga0496105_0038031_1299_2048 224
1767 3300048908 Ga0496105_0339364 Ga0496105_0339364_119_874 224
1768 3300048909 Ga0496106_0005544 Ga0496106_0005544_3991_4776 224
1769 3300048909 Ga0496106_0007251 Ga0496106_0007251_5256_6011 224
1770 3300048909 Ga0496106_0244603 Ga0496106_0244603_391_1146 224
1771 3300048910 Ga0496107_0030961 Ga0496107_0030961_1247_2032 224
1772 3300048910 Ga0496107_0041881 Ga0496107_0041881_1592_2428 224
1773 3300048910 Ga0496107_0051037 Ga0496107_0051037_1751_2506 224
1774 3300048911 Ga0496108_0122283 Ga0496108_0122283_377_1132 224
1775 3300048912 Ga0496109_0017683 Ga0496109_0017683_796_1545 224
1776 3300048912 Ga0496109_0216891 Ga0496109_0216891_733_1518 224
1777 3300048912 Ga0496109_0668576 Ga0496109_0668576_38_787 224
1778 3300048913 Ga0496110_0049965 Ga0496110_0049965_156_905 224
1779 3300048913 Ga0496110_0283452 Ga0496110_0283452_602_1387 224
1780 3300048913 Ga0496110_0462548 Ga0496110_0462548_269_1018 224
1781 3300048913 Ga0496110_0580968 Ga0496110_0580968_181_939 224
1782 3300048913 Ga0496110_0684588 Ga0496110_0684588_53_892 224
1783 3300048914 Ga0496111_0297399 Ga0496111_0297399_312_1100 224
1784 3300048915 Ga0496112_0031173 Ga0496112_0031173_1239_1994 224
1785 3300048915 Ga0496112_0060874 Ga0496112_0060874_2276_3025 224
1786 3300048915 Ga0496112_0107454 Ga0496112_0107454_1090_1875 224
1787 3300048915 Ga0496112_0177829 Ga0496112_0177829_886_1635 224
1788 3300048915 Ga0496112_0585591 Ga0496112_0585591_192_1028 224
1789 3300048916 Ga0496113_0012323 Ga0496113_0012323_2413_3162 224
1790 3300048916 Ga0496113_0225434 Ga0496113_0225434_529_1278 224
1791 3300048916 Ga0496113_0243301 Ga0496113_0243301_410_1159 224
1792 3300048916 Ga0496113_0267995 Ga0496113_0267995_532_1317 224
1793 3300048916 Ga0496113_0351654 Ga0496113_0351654_53_808 224
1794 3300048917 Ga0496114_0075334 Ga0496114_0075334_1353_2108 224
1795 3300048918 Ga0496115_0009806 Ga0496115_0009806_1447_2202 224
1796 3300048918 Ga0496115_0020238 Ga0496115_0020238_1495_2280 224
1797 3300048918 Ga0496115_0219031 Ga0496115_0219031_272_1021 224
1798 3300048920 Ga0496117_0174248 Ga0496117_0174248_184_933 224
1799 3300048924 Ga0496121_0000011 Ga0496121_0000011_699745_700512 224
1800 3300048924 Ga0496121_0333166 Ga0496121_0333166_156_917 224
1801 3300048925 Ga0496122_0003747 Ga0496122_0003747_17798_18556 224
1802 3300048926 Ga0496123_0058130 Ga0496123_0058130_634_1392 224
1803 3300048928 Ga0496125_0023369 Ga0496125_0023369_3092_3847 224
1804 3300048929 Ga0496126_0000111 Ga0496126_0000111_10022_10771 224
1805 3300048929 Ga0496126_0002726 Ga0496126_0002726_7888_8637 224
1806 3300048929 Ga0496126_0005234 Ga0496126_0005234_8659_9408 224
1807 3300048929 Ga0496126_0014583 Ga0496126_0014583_5090_5839 224
1808 3300049161 Ga0501305_031555 Ga0501305_031555_55_816 224
1809 3300049460 Ga0495682_0047733 Ga0495682_0047733_377_1168 224
1810 3300049523 Ga0501300_003229 Ga0501300_003229_177_926 224
1811 3300049571 Ga0501034_0038204 Ga0501034_0038204_2123_2875 224
1812 3300049571 Ga0501034_0275220 Ga0501034_0275220_705_1463 224
1813 3300049574 Ga0501038_0111914 Ga0501038_0111914_1221_1970 224
1814 3300049577 Ga0501041_0099402 Ga0501041_0099402_846_1595 224
1815 3300049579 Ga0501043_0023087 Ga0501043_0023087_3834_4583 224
1816 3300049581 Ga0501047_0238654 Ga0501047_0238654_157_915 224
1817 3300049582 Ga0501048_0467870 Ga0501048_0467870_71_829 224
1818 3300049584 Ga0501068_0428089 Ga0501068_0428089_59_808 224
1819 3300049587 Ga0501071_0039815 Ga0501071_0039815_745_1494 224
1820 3300049591 Ga0501075_0048900 Ga0501075_0048900_428_1177 224
1821 3300049665 Ga0501227_000581 Ga0501227_000581_5374_6129 224
1822 3300049677 Ga0501247_000834 Ga0501247_000834_1496_2329 224
1823 3300049679 Ga0501249_007668 Ga0501249_007668_1388_2143 224
1824 3300049679 Ga0501249_043169 Ga0501249_043169_93_848 224
1825 3300049742 Ga0501080_0504107 Ga0501080_0504107_317_1066 224
1826 3300049743 Ga0501081_0001799 Ga0501081_0001799_11569_12318 224
1827 3300049823 Ga0501044_0083833 Ga0501044_0083833_223_981 224
1828 3300049823 Ga0501044_0205328 Ga0501044_0205328_14_769 224
1829 3300050493 nmdc:mga0k408_142881_c1 nmdc:mga0k408_142881_c1_57_809 224
1830 3300050493 nmdc:mga0k408_166_c1 nmdc:mga0k408_166_c1_19239_19997 224
1831 3300050493 nmdc:mga0k408_5196_c1 nmdc:mga0k408_5196_c1_4134_4883 224
1832 3300050493 nmdc:mga0k408_82778_c1 nmdc:mga0k408_82778_c1_620_1402 224
1833 3300050494 nmdc:mga06z11_249297_c1 nmdc:mga06z11_249297_c1_118_870 224
1834 3300050507 nmdc:mga05p37_104492_c1 nmdc:mga05p37_104492_c1_1379_2140 224
1835 3300050507 nmdc:mga05p37_17846_c1 nmdc:mga05p37_17846_c1_825_1577 224
1836 3300050507 nmdc:mga05p37_294687_c1 nmdc:mga05p37_294687_c1_705_1454 224
1837 3300050507 nmdc:mga05p37_2967_c1 nmdc:mga05p37_2967_c1_12966_13727 224
1838 3300050507 nmdc:mga05p37_594328_c1 nmdc:mga05p37_594328_c1_18_773 224
1839 3300050507 nmdc:mga05p37_97754_c1 nmdc:mga05p37_97754_c1_1144_1905 224
1840 3300050508 nmdc:mga09592_138225_c1 nmdc:mga09592_138225_c1_158_910 224
1841 3300050510 nmdc:mga06r32_320973_c1 nmdc:mga06r32_320973_c1_283_1032 224
1842 3300050510 nmdc:mga06r32_906622_c1 nmdc:mga06r32_906622_c1_51_803 224
1843 3300050511 nmdc:mga08y16_367293_c1 nmdc:mga08y16_367293_c1_506_1258 224
1844 3300050511 nmdc:mga08y16_55335_c1 nmdc:mga08y16_55335_c1_1270_2019 224
1845 3300050512 nmdc:mga0n895_526520_c1 nmdc:mga0n895_526520_c1_11_781 224
1846 3300050512 nmdc:mga0n895_70428_c1 nmdc:mga0n895_70428_c1_2135_2884 224
1847 3300050512 nmdc:mga0n895_71563_c1 nmdc:mga0n895_71563_c1_1310_2080 224
1848 3300050513 nmdc:mga0rr50_218078_c1 nmdc:mga0rr50_218078_c1_285_1034 224
1849 3300050513 nmdc:mga0rr50_635343_c1 nmdc:mga0rr50_635343_c1_58_864 224
1850 3300050513 nmdc:mga0rr50_658680_c1 nmdc:mga0rr50_658680_c1_61_849 224
1851 3300050513 nmdc:mga0rr50_678294_c1 nmdc:mga0rr50_678294_c1_69_824 224
1852 3300050515 nmdc:mga0a205_105939_c1 nmdc:mga0a205_105939_c1_953_1705 224
1853 3300050515 nmdc:mga0a205_153371_c1 nmdc:mga0a205_153371_c1_895_1656 224
1854 3300050515 nmdc:mga0a205_217946_c1 nmdc:mga0a205_217946_c1_280_1032 224
1855 3300050515 nmdc:mga0a205_47524_c1 nmdc:mga0a205_47524_c1_2100_2861 224
1856 3300050515 nmdc:mga0a205_649607_c1 nmdc:mga0a205_649607_c1_103_873 224
1857 3300050515 nmdc:mga0a205_6645_c1 nmdc:mga0a205_6645_c1_4923_5693 224
1858 3300053077 Ga0495601_0071977 Ga0495601_0071977_669_1418 224
1859 3300053077 Ga0495601_0152183 Ga0495601_0152183_677_1426 224
1860 3300053078 Ga0495612_0127115 Ga0495612_0127115_95_850 224
1861 3300053086 Ga0500578_0000003 Ga0500578_0000003_164403_165161 224
1862 3300053087 Ga0500643_000021 Ga0500643_000021_137705_138460 224
1863 3300053088 Ga0500644_0013203 Ga0500644_0013203_426_1184 224
1864 3300053092 Ga0500583_0000132 Ga0500583_0000132_32177_32935 224
1865 3300053092 Ga0500583_0149451 Ga0500583_0149451_160_918 224
1866 3300053096 Ga0500641_0000014 Ga0500641_0000014_34639_35397 224
1867 3300053096 Ga0500641_0082126 Ga0500641_0082126_385_1137 224
1868 3300053098 Ga0500650_0180041 Ga0500650_0180041_121_879 224
1869 3300053103 Ga0500555_000024 Ga0500555_000024_133115_133882 224
1870 3300053103 Ga0500555_000113 Ga0500555_000113_35378_36142 224
1871 3300053103 Ga0500555_036128 Ga0500555_036128_26_775 224
1872 3300053104 Ga0500556_0003987 Ga0500556_0003987_11_760 224
1873 3300053104 Ga0500556_0010957 Ga0500556_0010957_947_1708 224
1874 3300053108 Ga0500562_000083 Ga0500562_000083_3993_4751 224
1875 3300053108 Ga0500562_001999 Ga0500562_001999_1724_2482 224
1876 3300053109 Ga0500569_000255 Ga0500569_000255_213_971 224
1877 3300053125 Ga0500618_000050 Ga0500618_000050_12379_13137 224
1878 3300053130 Ga0500642_0028512 Ga0500642_0028512_287_1045 224
1879 3300053131 Ga0500652_010533 Ga0500652_010533_402_1160 224
1880 3300053134 Ga0500658_0034491 Ga0500658_0034491_281_1039 224
1881 3300053139 Ga0500568_0012736 Ga0500568_0012736_2464_3222 224
1882 3300053139 Ga0500568_0125562 Ga0500568_0125562_147_908 224
1883 3300053140 Ga0500573_0153878 Ga0500573_0153878_124_879 224
1884 3300053142 Ga0500577_0012747 Ga0500577_0012747_1596_2354 224
1885 3300053147 Ga0500589_094521 Ga0500589_094521_302_1060 224
1886 3300053151 Ga0500604_0006781 Ga0500604_0006781_1836_2594 224
1887 3300053151 Ga0500604_0065662 Ga0500604_0065662_35_793 224
1888 3300053153 Ga0500616_0000445 Ga0500616_0000445_37503_38261 224
1889 3300053153 Ga0500616_0035110 Ga0500616_0035110_121_879 224
1890 3300053156 Ga0500622_0000002 Ga0500622_0000002_219669_220424 224
1891 3300053156 Ga0500622_0000027 Ga0500622_0000027_88330_89088 224
1892 3300053156 Ga0500622_0000062 Ga0500622_0000062_14469_15227 224
1893 3300053156 Ga0500622_0000072 Ga0500622_0000072_41347_42105 224
1894 3300053156 Ga0500622_0005528 Ga0500622_0005528_2309_3067 224
1895 3300053156 Ga0500622_0007076 Ga0500622_0007076_4976_5734 224
1896 3300053156 Ga0500622_0008291 Ga0500622_0008291_4881_5639 224
1897 3300053156 Ga0500622_0180889 Ga0500622_0180889_42_800 224
1898 3300053158 Ga0500627_0011694 Ga0500627_0011694_1810_2568 224
1899 3300053161 Ga0500634_0030694 Ga0500634_0030694_1213_1971 224
1900 3300053178 Ga0500637_0198025 Ga0500637_0198025_41_799 224
1901 3300053727 Ga0500611_001231 Ga0500611_001231_39_797 224
1902 3300053730 Ga0500645_000021 Ga0500645_000021_38547_39305 224
1903 3300053730 Ga0500645_003997 Ga0500645_003997_2483_3241 224
1904 3300055283 Ga0500661_003527 Ga0500661_003527_2095_2844 224
1905 3300055283 Ga0500661_006156 Ga0500661_006156_17_775 224
1906 3300055283 Ga0500661_011182 Ga0500661_011182_742_1500 224
1907 3300055283 Ga0500661_013044 Ga0500661_013044_400_1149 224
1908 3300061734 Ga0530510_0083862 Ga0530510_0083862_667_1416 224
1909 iso_pu_bacteria 2599185184 2599481201 224
1910 iso_pu_bacteria 2643221583 2643925256 224
1911 iso_pu_bacteria 2643221667 2644373493 224
1912 iso_pu_bacteria 2738541283 2738755081 224
1913 iso_pu_bacteria 2818991442 2819575401 224
1914 iso_pu_bacteria 2821136567 2821138812 224
1915 iso_pu_bacteria 2821136567 2821141559 224
1916 iso_pu_bacteria 2838029111 2838034100 224
1917 iso_pu_bacteria 2842475841 2842480932 224
1918 iso_pu_bacteria 2842502639 2842507457 224
1919 iso_pu_bacteria 2856342000 2856344272 224
1920 iso_pu_bacteria 2884215851 2884217720 224
1921 iso_pu_bacteria 2904467357 2904470027 224
1922 iso_pu_bacteria 2904467357 2904472607 224
1923 iso_pu_bacteria 2919437846 2919438392 224
1924 iso_pu_bacteria 2924754689 2924758396 224
1925 iso_pu_bacteria 2928078545 2928081796 224
1926 iso_pu_bacteria 2928147474 2928151823 224
1927 iso_pu_bacteria 2929177148 2929179557 224
1928 iso_pu_bacteria 2929239360 2929245088 224
1929 iso_pu_bacteria 2932082852 2932087130 224
1930 iso_pu_bacteria 2939669807 2939674000 224
1931 iso_pu_bacteria 2945924605 2945928301 224
1932 iso_pu_bacteria 2945977869 2945981971 224
1933 iso_pu_bacteria 2946013367 2946018632 224
1934 iso_pu_bacteria 3005416602 3005416908 224
1935 iso_pu_bacteria 8004395343 8004400359 224
1936 iso_pu_bacteria 8005314921 8005315888 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

45

235

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

51

285

0.96

PF08643

DUF1776

Fungal family of unknown function (DUF1776)

113

241

0.9

PF08659

KR

KR domain

45

228

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v0h-assembly1.cif.gz_B crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with nadp and a potential reaction product 0.983 3 224
4mow-assembly1.cif.gz_C crystal structure of a putative glucose 1-dehydrogenase from burkholderia cenocepacia j2315 0.9828 3 224
4mow-assembly1.cif.gz_D crystal structure of a putative glucose 1-dehydrogenase from burkholderia cenocepacia j2315 0.9678 3 224
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9677 8 223
7v0h-assembly1.cif.gz_B crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with nadp and a potential reaction product 0.9657 3 224
ID Description Score Start End Superfamily
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9678 3 224 3.40.50.720
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9648 6 222 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9567 3 222 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9559 3 222 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9537 3 161 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A519VEW8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.997 6 155 GO:0016491
AF-A0A1Q7UZ49-F1-model_v4 Oxidoreductase 0.9961 3 224 GO:0016491
AF-A0A3E2NXJ3-F1-model_v4 SDR family oxidoreductase 0.9953 6 224 GO:0016491
AF-A0A2N8M6S6-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase 0.9943 63 224 GO:0016491
AF-A0A841K1G0-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) 0.9936 6 222 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.54 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map