F495954

General Info

Members Datasets Scaffolds Average Seq Length
1879 583 1778 428

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0004846|Ga0496104_0004846_3379_4902
Length 497
Sequence LARHPVWIDRFTRGAFSGKEARMGGRPRVKAFSMSISIRMPALSPTMEQGKLARWLVKPGDEVSSGDILAEIETDKATMEFEAIDEGTVQELLVPEGSEGVKVGTVIATISGEDGSEEKPAAAKTADTEPXXXAKAKESAPPMVDADGKQTAKLASEAKPAPDPEIPAGTALVATTVREALRDAMAEEMRADDRVFVMGEEVAQYQGAYKVTQGLLDEFGPKRVIDTPITEYGFAGIGTGAAMGGLRPVVEFMTFNFAMQAIDHIVNSAAKTNYMSGGQMRCPVVFRGPNGAAARVGAQHSQNYAPWYASVPGLVVIAPYDAADAKGLLKAAIRSEDPVVFLENELVYGRTFDVPQTDDFVLPIGKARVVREGTDVTIVSYSIGVGLALEAAETLAGEGILAEVVDLRTLRPLDKEAVLASLARTNRLIVAEEGWPVCSIASEIVALCMEEGFDLLDAPVLRVCNEDVPLPYAANLERAALVDAGRIVAAAKAVCYR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
5 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
6 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
7 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
8 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
9 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
10 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
11 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
12 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
13 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
14 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
15 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
16 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
17 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
18 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
19 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
20 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
21 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
22 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
23 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
24 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
25 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
26 2643221591 Devosia sp. Root685 Isolate Unclassified
27 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
28 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
29 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
30 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
31 2643221662 Devosia sp. Root413D1 Isolate Unclassified
32 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
33 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
34 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
35 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
36 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
37 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
38 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
39 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
40 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
41 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
42 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
43 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
44 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
45 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
46 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
47 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
48 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
49 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
50 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
51 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
52 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
53 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
54 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
55 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
56 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
57 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
58 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
59 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
60 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
61 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
62 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
63 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
64 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
65 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
66 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
67 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
68 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
69 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
70 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
71 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
72 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
73 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
74 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
75 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
76 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
77 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
78 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
79 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
80 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
81 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
82 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
83 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
84 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
85 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
86 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
87 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
88 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
89 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
90 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
91 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
92 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
93 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
94 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
95 3004167301 Mesorhizobium loti 582 Isolate Unclassified
96 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
97 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
98 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
99 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
100 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
101 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
102 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
103 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
104 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
105 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
106 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
107 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
108 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
109 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
110 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
111 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
112 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
113 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
114 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
115 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
116 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
117 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
118 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
119 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
120 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
121 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
122 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
123 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
124 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
125 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
126 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
127 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
128 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
129 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
130 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
131 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
132 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
133 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
134 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
135 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
136 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
137 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
138 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
139 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
140 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
141 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
142 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
143 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
144 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
145 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
146 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
147 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
148 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
149 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
150 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
151 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
152 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
153 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
154 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
155 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
156 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
157 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
158 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
159 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
160 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
161 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
162 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
163 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
164 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
165 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
166 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
167 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
168 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
169 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
170 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
171 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
172 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
173 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
174 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
175 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
176 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
177 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
178 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
179 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
180 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
181 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
182 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
183 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
184 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
185 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
186 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
187 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
188 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
189 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
190 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
191 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
192 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
193 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
194 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
195 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
196 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
197 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
198 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
199 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
200 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
201 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
202 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
203 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
204 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
205 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
206 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
207 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
208 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
209 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
210 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
211 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
212 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
213 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
214 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
215 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
216 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
217 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
218 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
219 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
220 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
221 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
222 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
223 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
224 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
225 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
226 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
227 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
228 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
229 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
230 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
231 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
232 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
233 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
234 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
235 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
236 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
237 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
238 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
239 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
240 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
241 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
242 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
243 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
244 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
245 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
246 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
247 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
248 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
249 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
250 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
251 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
252 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
253 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
254 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
255 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
256 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
257 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
258 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
259 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
260 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
261 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
262 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
266 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
267 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
269 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
270 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
273 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
274 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
276 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
277 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
280 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
344 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
345 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
346 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
348 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
350 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
354 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
355 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
356 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
357 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
358 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
359 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
360 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
361 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
362 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
363 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
364 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
365 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
366 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
367 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
368 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
369 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
370 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
371 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
372 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
373 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
374 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
375 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
376 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
377 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
378 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
379 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
380 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
381 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
382 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
383 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
384 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
385 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
386 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
388 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
389 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
390 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
391 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
392 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
393 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
394 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
395 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
396 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
397 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
398 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
399 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
400 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
401 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
402 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
403 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
404 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
405 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
406 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
407 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
408 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
409 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
410 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
411 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
412 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
413 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
414 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
415 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
416 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
417 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
418 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
419 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
420 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
421 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
422 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
423 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
424 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
425 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
426 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
427 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
428 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
429 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
430 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
431 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
432 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
433 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
434 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
435 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
436 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
437 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
438 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
439 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
440 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
441 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
442 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
443 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
444 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
445 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
446 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
447 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
448 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
449 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
450 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
451 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
452 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
453 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
454 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
455 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
456 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
457 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
458 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
459 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
460 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
461 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
462 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
463 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
464 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
465 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
466 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
467 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
468 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
469 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
470 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
471 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
472 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
473 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
474 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
475 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
476 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
477 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
478 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
479 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
480 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
481 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
482 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
483 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
484 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
485 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
486 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
487 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
488 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
489 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
490 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
491 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
492 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
493 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
494 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
499 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
502 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
510 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
511 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
512 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
513 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
514 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
515 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
516 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
517 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
518 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
519 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
520 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
521 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
522 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
523 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
524 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
525 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
526 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
527 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
528 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
529 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
530 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
531 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
532 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
533 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
534 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
535 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
536 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
537 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
538 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
539 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
540 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
541 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
542 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
543 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
544 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
545 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
546 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
547 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
548 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
549 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
550 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
551 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
552 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
553 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
554 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
555 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
556 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
557 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
558 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
559 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
560 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
561 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
562 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
563 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
564 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
565 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
566 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
567 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
568 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
569 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
570 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
571 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
572 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
573 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
574 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
580 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
581 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
582 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
583 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.25
Metatranscriptomes 0.37
Isolates 5.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 7.61
Nodule 1.22
Rhizoplane 2.34
Rhizosphere 83.02
Stem 0
Stem Tuber 0
Unclassified 5.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_726179 2162886007 Bacteria 2118
2 ARcpr5oldR_c000650 3300000041 Bacteria 4146
3 LJQas_1002470 3300000549 Bacteria 2562
4 JGI24736J21556_1000061 3300001904 Bacteria 17884
5 JGI24736J21556_1001782 3300001904 Bacteria 3876
6 JGI24736J21556_1005976 3300001904 Bacteria 2055
7 JGI24741J21665_1000109 3300001915 Bacteria 21994
8 JGI24741J21665_1000175 3300001915 Bacteria 18541
9 JGI24741J21665_1007146 3300001915 Bacteria 2184
10 JGI24752J21851_1000440 3300001976 Bacteria 5625
11 JGI24740J21852_10001857 3300001979 Bacteria 9671
12 JGI24740J21852_10008117 3300001979 Bacteria 4211
13 JGI24740J21852_10011883 3300001979 Bacteria 3302
14 JGI24740J21852_10021989 3300001979 Bacteria 2203
15 JGI24740J21852_10024023 3300001979 Bacteria 2073
16 JGI24739J22299_10001369 3300001989 Bacteria 9157
17 JGI24739J22299_10001433 3300001989 Bacteria 8982
18 JGI24739J22299_10006097 3300001989 Bacteria 4556
19 JGI24739J22299_10017599 3300001989 Bacteria 2576
20 JGI24739J22299_10023515 3300001989 Bacteria 2178
21 JGI24737J22298_10000016 3300001990 Bacteria 49280
22 JGI24737J22298_10001179 3300001990 Bacteria 9211
23 JGI24737J22298_10001375 3300001990 Bacteria 8630
24 JGI24737J22298_10002501 3300001990 Bacteria 6536
25 JGI24737J22298_10013513 3300001990 Bacteria 2656
26 JGI24737J22298_10021532 3300001990 Bacteria 2054
27 JGI24737J22298_10022389 3300001990 Bacteria 2009
28 JGI24737J22298_10026084 3300001990 Bacteria 1846
29 JGI24735J21928_10001799 3300002067 Bacteria 7523
30 JGI24735J21928_10007777 3300002067 Bacteria 3485
31 JGI24735J21928_10013115 3300002067 Bacteria 2610
32 JGI24735J21928_10032003 3300002067 Bacteria 1558
33 JGI24748J21848_1000230 3300002074 Bacteria 6783
34 JGI24738J21930_10000066 3300002075 Bacteria 21866
35 JGI24738J21930_10000976 3300002075 Bacteria 8189
36 JGI24738J21930_10001406 3300002075 Bacteria 6674
37 JGI24738J21930_10003885 3300002075 Bacteria 3731
38 JGI24749J21850_1000449 3300002076 Bacteria 6143
39 JGI24744J21845_10000093 3300002077 Bacteria 11838
40 JGI24744J21845_10002511 3300002077 Bacteria 3742
41 JGI24744J21845_10010944 3300002077 Bacteria 1857
42 JGI24034J26672_10000019 3300002239 Bacteria 125073
43 JGI24742J22300_10001708 3300002244 Bacteria 3498
44 JGI24742J22300_10002996 3300002244 Bacteria 2734
45 JGI24751J29686_10000062 3300002459 Bacteria 61661
46 JGI24751J29686_10000402 3300002459 Bacteria 13951
47 JGI25158J39367_1000027 3300002739 Bacteria 34154
48 JGI25152J39213_1000288 3300002773 Bacteria 33211
49 JGI25152J39213_1004957 3300002773 Bacteria 4030
50 JGI25152J39213_1008495 3300002773 Bacteria 2543
51 JGI25150J39212_1000010 3300002774 Bacteria 236260
52 JGI25150J39212_1009820 3300002774 Bacteria 1805
53 JGI25159J45721_1001619 3300002987 Bacteria 9173
54 JGI25151J46595_10000026 3300003187 Bacteria 211045
55 JGI25165J46597_1000003 3300003214 Bacteria 694080
56 JGI25165J46597_1000053 3300003214 Bacteria 235857
57 JGI25165J46597_1000165 3300003214 Bacteria 104009
58 JGI25153J46596_10000113 3300003215 Bacteria 92345
59 JGI25153J46596_10003116 3300003215 Bacteria 9351
60 JGI25153J46596_10004834 3300003215 Bacteria 7178
61 JGI25153J46596_10006081 3300003215 Bacteria 6199
62 JGI25153J46596_10024597 3300003215 Bacteria 2169
63 JGI25153J46596_10037864 3300003215 Bacteria 1528
64 JGI25161J50226_1000053 3300003374 Bacteria 106635
65 Ga0055525_1000051 3300003759 Bacteria 240942
66 Ga0055542_1000020 3300003762 Bacteria 335745
67 Ga0055529_1000016 3300003763 Bacteria 364775
68 Ga0055526_1000565 3300003771 Bacteria 29180
69 Ga0055526_1017219 3300003771 Bacteria 2775
70 Ga0055537_1005106 3300003773 Bacteria 3586
71 Ga0055524_1000088 3300003775 Bacteria 116065
72 Ga0055530_10000452 3300003791 Bacteria 36535
73 Ga0055531_10000016 3300003794 Bacteria 181898
74 Ga0055543_1000019 3300004625 Bacteria 161035
75 Ga0065165_1010170 3300005262 Bacteria 4106
76 Ga0065165_1014527 3300005262 Bacteria 3052
77 Ga0065704_10008923 3300005289 Bacteria 3201
78 Ga0065704_10070144 3300005289 Bacteria 333223
79 Ga0065704_10075907 3300005289 Bacteria 5359
80 Ga0065704_10080365 3300005289 Bacteria 3959
81 Ga0065715_10107166 3300005293 Bacteria 2786
82 Ga0065707_10081972 3300005295 Bacteria 26650
83 Ga0065707_10083195 3300005295 Bacteria 10067
84 Ga0070658_10000590 3300005327 Bacteria 31506
85 Ga0070658_10000697 3300005327 Bacteria 29129
86 Ga0070658_10007930 3300005327 Bacteria 8550
87 Ga0070658_10016724 3300005327 Bacteria 5871
88 Ga0070658_10019624 3300005327 Bacteria 5412
89 Ga0070658_10025146 3300005327 Bacteria 4773
90 Ga0070658_10038672 3300005327 Bacteria 3847
91 Ga0070658_10050801 3300005327 Bacteria 3361
92 Ga0070658_10056469 3300005327 Bacteria 3191
93 Ga0070658_10057283 3300005327 Bacteria 3170
94 Ga0070658_10059084 3300005327 Bacteria 3122
95 Ga0070658_10073518 3300005327 Bacteria 2803
96 Ga0070658_10075914 3300005327 Bacteria 2757
97 Ga0070658_10075977 3300005327 Bacteria 2756
98 Ga0070658_10086584 3300005327 Bacteria 2577
99 Ga0070658_10110557 3300005327 Bacteria 2276
100 Ga0070658_10117446 3300005327 Bacteria 2208
101 Ga0070676_10000161 3300005328 Bacteria 27014
102 Ga0070676_10001990 3300005328 Bacteria 10391
103 Ga0070676_10009231 3300005328 Bacteria 5329
104 Ga0070676_10020431 3300005328 Bacteria 3697
105 Ga0070683_100007358 3300005329 Bacteria 9301
106 Ga0070683_100017370 3300005329 Bacteria 6359
107 Ga0070683_100045583 3300005329 Bacteria 4047
108 Ga0070683_100045628 3300005329 Bacteria 4045
109 Ga0070683_100051504 3300005329 Bacteria 3812
110 Ga0070683_100058127 3300005329 Bacteria 3593
111 Ga0070683_100104886 3300005329 Bacteria 2664
112 Ga0070683_100106807 3300005329 Bacteria 2639
113 Ga0070683_100163504 3300005329 Bacteria 2112
114 Ga0070690_100051628 3300005330 Bacteria 2626
115 Ga0070690_100055749 3300005330 Bacteria 2532
116 Ga0070670_100000005 3300005331 Bacteria 351569
117 Ga0070670_100000075 3300005331 Bacteria 97494
118 Ga0070670_100000485 3300005331 Bacteria 31957
119 Ga0070670_100001146 3300005331 Bacteria 21026
120 Ga0070670_100001443 3300005331 Bacteria 19089
121 Ga0070670_100014565 3300005331 Bacteria 6752
122 Ga0070670_100021134 3300005331 Bacteria 5598
123 Ga0070670_100066495 3300005331 Bacteria 3093
124 Ga0070670_100093141 3300005331 Bacteria 2591
125 Ga0070670_100112386 3300005331 Bacteria 2348
126 Ga0070677_10000309 3300005333 Bacteria 16988
127 Ga0070677_10000392 3300005333 Bacteria 15280
128 Ga0070677_10000402 3300005333 Bacteria 15094
129 Ga0068869_100000842 3300005334 Bacteria 17572
130 Ga0070666_10003195 3300005335 Bacteria 9961
131 Ga0070666_10023999 3300005335 Bacteria 3971
132 Ga0070666_10036991 3300005335 Bacteria 3243
133 Ga0070666_10038569 3300005335 Bacteria 3180
134 Ga0070666_10165810 3300005335 Bacteria 1545
135 Ga0070680_100000336 3300005336 Bacteria 31461
136 Ga0070680_100003865 3300005336 Bacteria 11196
137 Ga0070680_100018696 3300005336 Bacteria 5481
138 Ga0070680_100044365 3300005336 Bacteria 3613
139 Ga0070682_100009658 3300005337 Bacteria 5461
140 Ga0070682_100015590 3300005337 Bacteria 4406
141 Ga0068868_100000057 3300005338 Bacteria 62946
142 Ga0068868_100000243 3300005338 Bacteria 36881
143 Ga0068868_100002232 3300005338 Bacteria 13389
144 Ga0068868_100008869 3300005338 Bacteria 7205
145 Ga0068868_100014478 3300005338 Bacteria 5813
146 Ga0068868_100030497 3300005338 Bacteria 4135
147 Ga0068868_100036403 3300005338 Bacteria 3809
148 Ga0068868_100052313 3300005338 Bacteria 3215
149 Ga0070660_100000033 3300005339 Bacteria 83079
150 Ga0070660_100001249 3300005339 Bacteria 17296
151 Ga0070660_100002222 3300005339 Bacteria 13374
152 Ga0070660_100003011 3300005339 Bacteria 11608
153 Ga0070660_100016009 3300005339 Bacteria 5431
154 Ga0070660_100025521 3300005339 Bacteria 4392
155 Ga0070660_100034582 3300005339 Bacteria 3819
156 Ga0070660_100056478 3300005339 Bacteria 3037
157 Ga0070660_100081326 3300005339 Bacteria 2543
158 Ga0070660_100110600 3300005339 Bacteria 2185
159 Ga0070660_100153366 3300005339 Bacteria 1853
160 Ga0070691_10000990 3300005341 Bacteria 11617
161 Ga0070661_100000010 3300005344 Bacteria 175777
162 Ga0070661_100000547 3300005344 Bacteria 28803
163 Ga0070661_100000861 3300005344 Bacteria 21787
164 Ga0070661_100004068 3300005344 Bacteria 10067
165 Ga0070661_100007139 3300005344 Bacteria 7702
166 Ga0070661_100014164 3300005344 Bacteria 5616
167 Ga0070661_100035732 3300005344 Bacteria 3610
168 Ga0070661_100070684 3300005344 Bacteria 2567
169 Ga0070661_100187705 3300005344 Bacteria 1575
170 Ga0070692_10019808 3300005345 Bacteria 3252
171 Ga0070668_100000362 3300005347 Bacteria 30045
172 Ga0070668_100001759 3300005347 Bacteria 15747
173 Ga0070668_100005096 3300005347 Bacteria 9731
174 Ga0070668_100005633 3300005347 Bacteria 9288
175 Ga0070668_100013222 3300005347 Bacteria 6156
176 Ga0070668_100027134 3300005347 Bacteria 4347
177 Ga0070668_100082118 3300005347 Bacteria 2527
178 Ga0070668_100153973 3300005347 Bacteria 1861
179 Ga0070669_100000057 3300005353 Bacteria 110803
180 Ga0070669_100000297 3300005353 Bacteria 38972
181 Ga0070669_100001775 3300005353 Bacteria 15533
182 Ga0070669_100002352 3300005353 Bacteria 13674
183 Ga0070669_100039059 3300005353 Bacteria 3448
184 Ga0070669_100043347 3300005353 Bacteria 3277
185 Ga0070669_100056125 3300005353 Bacteria 2887
186 Ga0070669_100088766 3300005353 Bacteria 2315
187 Ga0070675_100000876 3300005354 Bacteria 21415
188 Ga0070675_100000898 3300005354 Bacteria 21177
189 Ga0070675_100013237 3300005354 Bacteria 6483
190 Ga0070675_100017473 3300005354 Bacteria 5699
191 Ga0070675_100098188 3300005354 Bacteria 2463
192 Ga0070675_100172190 3300005354 Bacteria 1867
193 Ga0070671_100000090 3300005355 Bacteria 58174
194 Ga0070671_100000417 3300005355 Bacteria 29560
195 Ga0070671_100000546 3300005355 Bacteria 26609
196 Ga0070671_100000929 3300005355 Bacteria 21432
197 Ga0070671_100002934 3300005355 Bacteria 13262
198 Ga0070671_100009973 3300005355 Bacteria 7626
199 Ga0070671_100016073 3300005355 Bacteria 6049
200 Ga0070671_100021733 3300005355 Bacteria 5241
201 Ga0070671_100030801 3300005355 Bacteria 4428
202 Ga0070671_100039152 3300005355 Bacteria 3935
203 Ga0070671_100062526 3300005355 Bacteria 3100
204 Ga0070674_100001097 3300005356 Bacteria 14204
205 Ga0070674_100013649 3300005356 Bacteria 5027
206 Ga0070674_100087182 3300005356 Bacteria 2244
207 Ga0070674_100107584 3300005356 Bacteria 2042
208 Ga0070673_100000005 3300005364 Bacteria 193513
209 Ga0070673_100000517 3300005364 Bacteria 20703
210 Ga0070673_100005792 3300005364 Bacteria 7956
211 Ga0070673_100052402 3300005364 Bacteria 3201
212 Ga0070673_100066813 3300005364 Bacteria 2873
213 Ga0070673_100073268 3300005364 Bacteria 2756
214 Ga0070673_100086280 3300005364 Bacteria 2557
215 Ga0070673_100107412 3300005364 Bacteria 2308
216 Ga0070688_100005327 3300005365 Bacteria 6760
217 Ga0070688_100066020 3300005365 Bacteria 2301
218 Ga0070659_100000419 3300005366 Bacteria 32241
219 Ga0070659_100000433 3300005366 Bacteria 31495
220 Ga0070659_100001375 3300005366 Bacteria 17524
221 Ga0070659_100017785 3300005366 Bacteria 5355
222 Ga0070659_100021963 3300005366 Bacteria 4868
223 Ga0070659_100022094 3300005366 Bacteria 4854
224 Ga0070659_100086615 3300005366 Bacteria 2507
225 Ga0070659_100091463 3300005366 Bacteria 2439
226 Ga0070659_100100948 3300005366 Bacteria 2322
227 Ga0070659_100113191 3300005366 Bacteria 2192
228 Ga0070667_100000039 3300005367 Bacteria 170228
229 Ga0070667_100000055 3300005367 Bacteria 151072
230 Ga0070667_100000067 3300005367 Bacteria 133023
231 Ga0070667_100000197 3300005367 Bacteria 71585
232 Ga0070667_100000489 3300005367 Bacteria 40211
233 Ga0070667_100004859 3300005367 Bacteria 11260
234 Ga0070667_100022581 3300005367 Bacteria 5217
235 Ga0070667_100022938 3300005367 Bacteria 5174
236 Ga0070667_100023789 3300005367 Bacteria 5085
237 Ga0070667_100144561 3300005367 Bacteria 2085
238 Ga0070667_100161469 3300005367 Bacteria 1974
239 Ga0070709_10002743 3300005434 Bacteria 9528
240 Ga0070709_10034288 3300005434 Bacteria 3076
241 Ga0070709_10061005 3300005434 Bacteria 2399
242 Ga0070714_100005308 3300005435 Bacteria 9821
243 Ga0070714_100073452 3300005435 Bacteria 2963
244 Ga0070714_100100568 3300005435 Bacteria 2547
245 Ga0070714_100115736 3300005435 Bacteria 2380
246 Ga0070713_100000008 3300005436 Bacteria 160153
247 Ga0070713_100003318 3300005436 Bacteria 10616
248 Ga0070710_10083309 3300005437 Bacteria 1871
249 Ga0070711_100085593 3300005439 Bacteria 2258
250 Ga0070705_100169627 3300005440 Bacteria 1467
251 Ga0070700_100012084 3300005441 Bacteria 4802
252 Ga0070694_100004307 3300005444 Bacteria 8552
253 Ga0070694_100117238 3300005444 Bacteria 1906
254 Ga0070708_100082549 3300005445 Bacteria 2911
255 Ga0070663_100024987 3300005455 Bacteria 4028
256 Ga0070663_100050353 3300005455 Bacteria 2962
257 Ga0070663_100059142 3300005455 Bacteria 2754
258 Ga0070678_100000174 3300005456 Bacteria 27635
259 Ga0070678_100012498 3300005456 Bacteria 5281
260 Ga0070678_100017201 3300005456 Bacteria 4648
261 Ga0070678_100106381 3300005456 Bacteria 2186
262 Ga0070662_100000475 3300005457 Bacteria 23818
263 Ga0070662_100000522 3300005457 Bacteria 23134
264 Ga0070662_100001233 3300005457 Bacteria 15724
265 Ga0070662_100003549 3300005457 Bacteria 9727
266 Ga0070662_100005040 3300005457 Bacteria 8405
267 Ga0070662_100007446 3300005457 Bacteria 7098
268 Ga0070662_100123715 3300005457 Bacteria 1985
269 Ga0070662_100162272 3300005457 Bacteria 1749
270 Ga0070681_10000014 3300005458 Bacteria 132528
271 Ga0070681_10030977 3300005458 Bacteria 5369
272 Ga0070681_10059208 3300005458 Bacteria 3809
273 Ga0068867_100000071 3300005459 Bacteria 61808
274 Ga0068867_100001398 3300005459 Bacteria 16681
275 Ga0068867_100054464 3300005459 Bacteria 2955
276 Ga0070685_10005245 3300005466 Bacteria 6573
277 Ga0070699_100064715 3300005518 Bacteria 3171
278 Ga0070679_100061243 3300005530 Bacteria 3751
279 Ga0070679_100092236 3300005530 Bacteria 3016
280 Ga0070679_100120983 3300005530 Bacteria 2602
281 Ga0070679_100155031 3300005530 Bacteria 2265
282 Ga0070679_100173652 3300005530 Bacteria 2128
283 Ga0070684_100010835 3300005535 Bacteria 7241
284 Ga0070684_100033071 3300005535 Bacteria 4412
285 Ga0070684_100161239 3300005535 Bacteria 2034
286 Ga0068853_100001422 3300005539 Bacteria 17279
287 Ga0068853_100020596 3300005539 Bacteria 5485
288 Ga0068853_100022708 3300005539 Bacteria 5243
289 Ga0068853_100030057 3300005539 Bacteria 4586
290 Ga0068853_100044179 3300005539 Bacteria 3814
291 Ga0068853_100044784 3300005539 Bacteria 3789
292 Ga0068853_100060220 3300005539 Bacteria 3280
293 Ga0068853_100065156 3300005539 Bacteria 3161
294 Ga0070672_100000284 3300005543 Bacteria 28813
295 Ga0070672_100006546 3300005543 Bacteria 7835
296 Ga0070672_100038881 3300005543 Bacteria 3639
297 Ga0070672_100054587 3300005543 Bacteria 3128
298 Ga0070686_100000391 3300005544 Bacteria 27757
299 Ga0070686_100033478 3300005544 Bacteria 3158
300 Ga0070696_100009154 3300005546 Bacteria 6629
301 Ga0070693_100003083 3300005547 Bacteria 7731
302 Ga0070665_100000044 3300005548 Bacteria 276702
303 Ga0070665_100000054 3300005548 Bacteria 244426
304 Ga0070665_100000162 3300005548 Bacteria 122048
305 Ga0070665_100000804 3300005548 Bacteria 41010
306 Ga0070665_100002360 3300005548 Bacteria 20873
307 Ga0070665_100008627 3300005548 Bacteria 10314
308 Ga0070665_100017292 3300005548 Bacteria 7237
309 Ga0070665_100020684 3300005548 Bacteria 6610
310 Ga0070665_100058110 3300005548 Bacteria 3878
311 Ga0070665_100059814 3300005548 Bacteria 3819
312 Ga0070665_100090453 3300005548 Bacteria 3066
313 Ga0070665_100149834 3300005548 Bacteria 2335
314 Ga0070665_100155398 3300005548 Bacteria 2289
315 Ga0068855_100000380 3300005563 Bacteria 54664
316 Ga0068855_100002806 3300005563 Bacteria 21445
317 Ga0068855_100003700 3300005563 Bacteria 18695
318 Ga0068855_100004993 3300005563 Bacteria 16185
319 Ga0068855_100040811 3300005563 Bacteria 5504
320 Ga0068855_100051637 3300005563 Bacteria 4843
321 Ga0068855_100057635 3300005563 Bacteria 4553
322 Ga0068855_100081507 3300005563 Bacteria 3750
323 Ga0068855_100107154 3300005563 Bacteria 3211
324 Ga0068855_100132091 3300005563 Bacteria 2851
325 Ga0068855_100207208 3300005563 Bacteria 2205
326 Ga0070664_100000822 3300005564 Bacteria 23916
327 Ga0070664_100014531 3300005564 Bacteria 6421
328 Ga0070664_100020950 3300005564 Bacteria 5386
329 Ga0070664_100032949 3300005564 Bacteria 4335
330 Ga0070664_100034660 3300005564 Bacteria 4234
331 Ga0070664_100058763 3300005564 Bacteria 3271
332 Ga0070664_100126032 3300005564 Bacteria 2246
333 Ga0070664_100209915 3300005564 Bacteria 1740
334 Ga0068857_100000989 3300005577 Bacteria 21801
335 Ga0068857_100004560 3300005577 Bacteria 11721
336 Ga0068857_100007874 3300005577 Bacteria 9192
337 Ga0068857_100039835 3300005577 Bacteria 4164
338 Ga0068857_100207839 3300005577 Bacteria 1785
339 Ga0068854_100000335 3300005578 Bacteria 30688
340 Ga0068854_100001813 3300005578 Bacteria 13001
341 Ga0068854_100005153 3300005578 Bacteria 8239
342 Ga0068854_100006446 3300005578 Bacteria 7464
343 Ga0068854_100050557 3300005578 Bacteria 2975
344 Ga0068854_100115397 3300005578 Bacteria 2031
345 Ga0068856_100000572 3300005614 Bacteria 40266
346 Ga0068856_100001471 3300005614 Bacteria 24671
347 Ga0068856_100004524 3300005614 Bacteria 13825
348 Ga0068856_100029789 3300005614 Bacteria 5333
349 Ga0068856_100091032 3300005614 Bacteria 3034
350 Ga0068856_100168378 3300005614 Bacteria 2202
351 Ga0068852_100002763 3300005616 Bacteria 12157
352 Ga0068852_100018027 3300005616 Bacteria 5553
353 Ga0068852_100027004 3300005616 Bacteria 4673
354 Ga0068852_100057861 3300005616 Bacteria 3355
355 Ga0068852_100058577 3300005616 Bacteria 3337
356 Ga0068852_100069915 3300005616 Bacteria 3078
357 Ga0068852_100102400 3300005616 Bacteria 2587
358 Ga0068859_100002380 3300005617 Bacteria 19152
359 Ga0068859_100009694 3300005617 Bacteria 9722
360 Ga0068859_100015571 3300005617 Bacteria 7642
361 Ga0068859_100028594 3300005617 Bacteria 5589
362 Ga0068859_100052236 3300005617 Bacteria 4109
363 Ga0068859_100055625 3300005617 Bacteria 3981
364 Ga0068859_100065198 3300005617 Bacteria 3677
365 Ga0068859_100065898 3300005617 Bacteria 3656
366 Ga0068864_100000011 3300005618 Bacteria 350056
367 Ga0068864_100000016 3300005618 Bacteria 292454
368 Ga0068864_100001412 3300005618 Bacteria 19835
369 Ga0068864_100001467 3300005618 Bacteria 19438
370 Ga0068864_100001715 3300005618 Bacteria 18004
371 Ga0068864_100020612 3300005618 Bacteria 5515
372 Ga0068864_100028005 3300005618 Bacteria 4762
373 Ga0068864_100074327 3300005618 Bacteria 2965
374 Ga0068864_100088509 3300005618 Bacteria 2727
375 Ga0068866_10055450 3300005718 Bacteria 2036
376 Ga0068861_100003657 3300005719 Bacteria 10251
377 Ga0068861_100008030 3300005719 Bacteria 7261
378 Ga0068851_10006598 3300005834 Bacteria 5305
379 Ga0068851_10011719 3300005834 Bacteria 4116
380 Ga0068870_10042109 3300005840 Bacteria 2376
381 Ga0068863_100000001 3300005841 Bacteria 581116
382 Ga0068863_100000033 3300005841 Bacteria 170238
383 Ga0068863_100000038 3300005841 Bacteria 161477
384 Ga0068863_100000085 3300005841 Bacteria 104154
385 Ga0068863_100001129 3300005841 Bacteria 26682
386 Ga0068863_100002331 3300005841 Bacteria 18862
387 Ga0068863_100004110 3300005841 Bacteria 14383
388 Ga0068863_100009577 3300005841 Bacteria 9448
389 Ga0068863_100025799 3300005841 Bacteria 5607
390 Ga0068863_100029664 3300005841 Bacteria 5222
391 Ga0068863_100032075 3300005841 Bacteria 5010
392 Ga0068858_100000208 3300005842 Bacteria 63552
393 Ga0068858_100000977 3300005842 Bacteria 29542
394 Ga0068858_100005919 3300005842 Bacteria 11935
395 Ga0068858_100009087 3300005842 Bacteria 9505
396 Ga0068858_100021748 3300005842 Bacteria 5992
397 Ga0068858_100029161 3300005842 Bacteria 5124
398 Ga0068858_100051878 3300005842 Bacteria 3795
399 Ga0068858_100061205 3300005842 Bacteria 3480
400 Ga0068858_100167837 3300005842 Bacteria 2069
401 Ga0068860_100000090 3300005843 Bacteria 151520
402 Ga0068860_100000290 3300005843 Bacteria 71562
403 Ga0068860_100002867 3300005843 Bacteria 17908
404 Ga0068860_100004238 3300005843 Bacteria 14691
405 Ga0068860_100007140 3300005843 Bacteria 11174
406 Ga0068860_100018215 3300005843 Bacteria 6835
407 Ga0068860_100036050 3300005843 Bacteria 4741
408 Ga0068860_100043917 3300005843 Bacteria 4261
409 Ga0068860_100059362 3300005843 Bacteria 3637
410 Ga0068860_100067735 3300005843 Bacteria 3392
411 Ga0068860_100090436 3300005843 Bacteria 2916
412 Ga0068860_100131474 3300005843 Bacteria 2402
413 Ga0068862_100000040 3300005844 Bacteria 167832
414 Ga0068862_100000104 3300005844 Bacteria 100182
415 Ga0068862_100000154 3300005844 Bacteria 78358
416 Ga0068862_100001580 3300005844 Bacteria 20757
417 Ga0068862_100014334 3300005844 Bacteria 6574
418 Ga0068862_100023143 3300005844 Bacteria 5202
419 Ga0081455_10000100 3300005937 Bacteria 95033
420 Ga0081455_10000570 3300005937 Bacteria 47997
421 Ga0081455_10000576 3300005937 Bacteria 47827
422 Ga0081455_10020170 3300005937 Bacteria 6288
423 Ga0081455_10024068 3300005937 Bacteria 5649
424 Ga0081455_10072297 3300005937 Bacteria 2856
425 Ga0081538_10041055 3300005981 Bacteria 2942
426 Ga0081540_1007532 3300005983 Bacteria 7747
427 Ga0081539_10028678 3300005985 Bacteria 3496
428 Ga0070717_10074323 3300006028 Bacteria 2841
429 Ga0075368_10000192 3300006042 Bacteria 16735
430 Ga0075368_10001864 3300006042 Bacteria 6771
431 Ga0075368_10005530 3300006042 Bacteria 4352
432 Ga0075368_10005738 3300006042 Bacteria 4291
433 Ga0075363_100005011 3300006048 Bacteria 5859
434 Ga0075363_100022728 3300006048 Bacteria 3173
435 Ga0075363_100036864 3300006048 Bacteria 2566
436 Ga0075364_10004423 3300006051 Bacteria 8085
437 Ga0070716_100024180 3300006173 Bacteria 3231
438 Ga0070712_100001396 3300006175 Bacteria 14677
439 Ga0075362_10000351 3300006177 Bacteria 13217
440 Ga0075362_10002251 3300006177 Bacteria 6423
441 Ga0075367_10000053 3300006178 Bacteria 27481
442 Ga0075367_10001452 3300006178 Bacteria 10212
443 Ga0075366_10062930 3300006195 Bacteria 2205
444 Ga0097621_100114476 3300006237 Bacteria 2282
445 Ga0097621_100175868 3300006237 Bacteria 1847
446 Ga0075370_10023608 3300006353 Bacteria 3388
447 Ga0068871_100076831 3300006358 Bacteria 2758
448 Ga0068871_100146579 3300006358 Bacteria 2010
449 Ga0068871_100182171 3300006358 Bacteria 1806
450 Ga0075428_100072280 3300006844 Bacteria 3768
451 Ga0075430_100046259 3300006846 Bacteria 3675
452 Ga0075430_100095690 3300006846 Bacteria 2482
453 Ga0075431_100009509 3300006847 Bacteria 9761
454 Ga0075431_100051176 3300006847 Bacteria 4261
455 Ga0075434_100049469 3300006871 Bacteria 4174
456 Ga0075434_100264610 3300006871 Bacteria 1739
457 Ga0068865_100000032 3300006881 Bacteria 88205
458 Ga0068865_100017121 3300006881 Bacteria 4655
459 Ga0068865_100035057 3300006881 Bacteria 3372
460 Ga0068865_100039658 3300006881 Bacteria 3195
461 Ga0075436_100000053 3300006914 Bacteria 69483
462 Ga0097620_100002380 3300006931 Bacteria 19152
463 Ga0097620_100009695 3300006931 Bacteria 9722
464 Ga0097620_100015570 3300006931 Bacteria 7642
465 Ga0097620_100028597 3300006931 Bacteria 5589
466 Ga0097620_100052236 3300006931 Bacteria 4109
467 Ga0097620_100055626 3300006931 Bacteria 3981
468 Ga0097620_100065197 3300006931 Bacteria 3677
469 Ga0097620_100065898 3300006931 Bacteria 3656
470 Ga0075435_100017875 3300007076 Bacteria 5375
471 Ga0105251_10000611 3300009011 Bacteria 32749
472 Ga0105251_10002579 3300009011 Bacteria 14058
473 Ga0105240_10000830 3300009093 Bacteria 55820
474 Ga0105240_10003194 3300009093 Bacteria 25746
475 Ga0105240_10005375 3300009093 Bacteria 19101
476 Ga0105240_10015925 3300009093 Bacteria 10199
477 Ga0105240_10041133 3300009093 Bacteria 5903
478 Ga0105240_10081683 3300009093 Bacteria 3971
479 Ga0105240_10086945 3300009093 Bacteria 3829
480 Ga0105240_10122393 3300009093 Bacteria 3131
481 Ga0105240_10257889 3300009093 Bacteria 2013
482 Ga0105240_10272051 3300009093 Bacteria 1950
483 Ga0111539_10012292 3300009094 Bacteria 10731
484 Ga0111539_10130136 3300009094 Bacteria 2947
485 Ga0111539_10220281 3300009094 Bacteria 2210
486 Ga0111539_10405882 3300009094 Bacteria 1587
487 Ga0105245_10001293 3300009098 Bacteria 22573
488 Ga0105245_10001374 3300009098 Bacteria 22022
489 Ga0105245_10011486 3300009098 Bacteria 7714
490 Ga0105245_10043390 3300009098 Bacteria 4011
491 Ga0105247_10007558 3300009101 Bacteria 6659
492 Ga0105247_10040387 3300009101 Bacteria 2852
493 Ga0114129_10030518 3300009147 Bacteria 7627
494 Ga0114129_10255698 3300009147 Bacteria 2350
495 Ga0105243_10001461 3300009148 Bacteria 20752
496 Ga0105243_10002022 3300009148 Bacteria 17230
497 Ga0105243_10004171 3300009148 Bacteria 11463
498 Ga0105241_10004536 3300009174 Bacteria 10276
499 Ga0105241_10009179 3300009174 Bacteria 7279
500 Ga0105241_10011934 3300009174 Bacteria 6382
501 Ga0105241_10059934 3300009174 Bacteria 2927
502 Ga0105242_10023742 3300009176 Bacteria 4836
503 Ga0105242_10124426 3300009176 Bacteria 2218
504 Ga0105248_10000001 3300009177 Bacteria 1881304
505 Ga0105248_10000021 3300009177 Bacteria 276159
506 Ga0105248_10000182 3300009177 Bacteria 73487
507 Ga0105248_10001396 3300009177 Bacteria 26955
508 Ga0105248_10011775 3300009177 Bacteria 9649
509 Ga0105248_10012999 3300009177 Bacteria 9176
510 Ga0105248_10029409 3300009177 Bacteria 6129
511 Ga0105248_10060849 3300009177 Bacteria 4239
512 Ga0105248_10072285 3300009177 Unclassified 3876
513 Ga0105248_10096669 3300009177 Bacteria 3327
514 Ga0105248_10118831 3300009177 Bacteria 2982
515 Ga0105248_10196378 3300009177 Bacteria 2273
516 Ga0105237_10000301 3300009545 Bacteria 68372
517 Ga0105237_10005537 3300009545 Bacteria 14237
518 Ga0105237_10006082 3300009545 Bacteria 13504
519 Ga0105237_10007150 3300009545 Bacteria 12267
520 Ga0105237_10017358 3300009545 Bacteria 7462
521 Ga0105237_10025425 3300009545 Bacteria 6055
522 Ga0105237_10039448 3300009545 Bacteria 4768
523 Ga0105237_10052555 3300009545 Bacteria 4089
524 Ga0105237_10073192 3300009545 Bacteria 3419
525 Ga0105238_10005536 3300009551 Bacteria 12472
526 Ga0105238_10009040 3300009551 Bacteria 9968
527 Ga0105238_10027942 3300009551 Bacteria 5748
528 Ga0105238_10044735 3300009551 Bacteria 4475
529 Ga0105238_10116002 3300009551 Bacteria 2657
530 Ga0105238_10165179 3300009551 Bacteria 2189
531 Ga0105238_10332599 3300009551 Bacteria 1506
532 Ga0105249_10000037 3300009553 Bacteria 197428
533 Ga0105249_10007160 3300009553 Bacteria 9739
534 Ga0105249_10032770 3300009553 Bacteria 4702
535 Ga0105249_10063277 3300009553 Bacteria 3398
536 Ga0105249_10109180 3300009553 Bacteria 2613
537 Ga0105148_100288 3300009978 Bacteria 6606
538 Ga0099796_10012795 3300010159 Bacteria 2379
539 Ga0105239_10000157 3300010375 Bacteria 98327
540 Ga0105239_10002505 3300010375 Bacteria 23379
541 Ga0105239_10009106 3300010375 Bacteria 11233
542 Ga0105239_10026186 3300010375 Bacteria 6419
543 Ga0105239_10111528 3300010375 Bacteria 3032
544 Ga0105239_10180205 3300010375 Bacteria 2364
545 Ga0105239_10209731 3300010375 Bacteria 2184
546 Ga0105239_10246433 3300010375 Bacteria 2006
547 Ga0105239_10312912 3300010375 Bacteria 1770
548 Ga0105246_10000103 3300011119 Bacteria 37033
549 Ga0105246_10014477 3300011119 Bacteria 4962
550 Ga0105246_10033426 3300011119 Bacteria 3419
551 Ga0105246_10061678 3300011119 Bacteria 2610
552 Ga0157326_1000640 3300012513 Bacteria 4109
553 Ga0157373_10019189 3300013100 Bacteria 4979
554 Ga0157373_10024632 3300013100 Bacteria 4359
555 Ga0157373_10042680 3300013100 Bacteria 3241
556 Ga0157373_10047319 3300013100 Bacteria 3068
557 Ga0157371_10000146 3300013102 Bacteria 103290
558 Ga0157371_10001754 3300013102 Bacteria 21989
559 Ga0157371_10006646 3300013102 Bacteria 9473
560 Ga0157371_10076427 3300013102 Bacteria 2371
561 Ga0157371_10168165 3300013102 Bacteria 1566
562 Ga0157370_10000096 3300013104 Bacteria 99163
563 Ga0157370_10001846 3300013104 Bacteria 26115
564 Ga0157370_10003024 3300013104 Bacteria 19956
565 Ga0157370_10008221 3300013104 Bacteria 11270
566 Ga0157370_10053285 3300013104 Bacteria 3858
567 Ga0157370_10110300 3300013104 Bacteria 2572
568 Ga0157370_10255724 3300013104 Bacteria 1619
569 Ga0157369_10006709 3300013105 Bacteria 13285
570 Ga0157369_10009826 3300013105 Bacteria 10938
571 Ga0157369_10013151 3300013105 Bacteria 9366
572 Ga0157369_10030950 3300013105 Bacteria 5897
573 Ga0157369_10041099 3300013105 Bacteria 5048
574 Ga0157369_10059338 3300013105 Bacteria 4126
575 Ga0157369_10117422 3300013105 Bacteria 2824
576 Ga0157369_10173071 3300013105 Bacteria 2274
577 Ga0157374_10001126 3300013296 Bacteria 22949
578 Ga0157374_10005567 3300013296 Bacteria 10607
579 Ga0157374_10038557 3300013296 Bacteria 4393
580 Ga0157374_10124445 3300013296 Bacteria 2491
581 Ga0157378_10002115 3300013297 Bacteria 17699
582 Ga0157378_10002231 3300013297 Bacteria 17188
583 Ga0163162_10090448 3300013306 Bacteria 3142
584 Ga0163162_10108809 3300013306 Bacteria 2868
585 Ga0157372_10048746 3300013307 Bacteria 4708
586 Ga0157372_10085065 3300013307 Bacteria 3587
587 Ga0157372_10096536 3300013307 Bacteria 3369
588 Ga0157372_10112403 3300013307 Bacteria 3121
589 Ga0157372_10124360 3300013307 Bacteria 2965
590 Ga0157372_10184094 3300013307 Bacteria 2419
591 Ga0157372_10240076 3300013307 Bacteria 2102
592 Ga0157375_10003871 3300013308 Bacteria 12989
593 Ga0157375_10045249 3300013308 Bacteria 4283
594 Ga0163163_10000002 3300014325 Bacteria 609846
595 Ga0163163_10000058 3300014325 Bacteria 123478
596 Ga0163163_10036200 3300014325 Bacteria 4794
597 Ga0163163_10070184 3300014325 Bacteria 3489
598 Ga0163163_10111020 3300014325 Bacteria 2771
599 Ga0163163_10172931 3300014325 Bacteria 2207
600 Ga0163163_10339123 3300014325 Bacteria 1558
601 Ga0163163_10345417 3300014325 Bacteria 1544
602 Ga0157380_10002753 3300014326 Bacteria 11937
603 Ga0157380_10003970 3300014326 Bacteria 10212
604 Ga0157380_10004695 3300014326 Bacteria 9515
605 Ga0157380_10006132 3300014326 Bacteria 8429
606 Ga0157380_10036160 3300014326 Bacteria 3819
607 Ga0157379_10000978 3300014968 Bacteria 23173
608 Ga0157379_10005461 3300014968 Bacteria 10919
609 Ga0157379_10011900 3300014968 Bacteria 7603
610 Ga0157379_10014640 3300014968 Bacteria 6878
611 Ga0157379_10061550 3300014968 Bacteria 3356
612 Ga0157379_10093050 3300014968 Bacteria 2704
613 Ga0157379_10102280 3300014968 Bacteria 2572
614 Ga0157379_10144174 3300014968 Bacteria 2148
615 Ga0157379_10170808 3300014968 Bacteria 1963
616 Ga0157379_10184998 3300014968 Bacteria 1882
617 Ga0157376_10000450 3300014969 Bacteria 26578
618 Ga0163161_10085643 3300017792 Bacteria 2325
619 Ga0213873_10000008 3300021358 Bacteria 263363
620 Ga0213872_10025119 3300021361 Bacteria 2739
621 Ga0213876_10000005 3300021384 Bacteria 727326
622 Ga0213876_10008466 3300021384 Bacteria 5569
623 Ga0213875_10000255 3300021388 Bacteria 53537
624 Ga0209436_100038 3300025208 Bacteria 76733
625 Ga0207672_1000994 3300025223 Bacteria 2736
626 Ga0209147_101318 3300025229 Bacteria 9534
627 Ga0209563_100019 3300025230 Bacteria 697828
628 Ga0207425_1000010 3300025245 Bacteria 572898
629 Ga0207425_1001734 3300025245 Bacteria 8600
630 Ga0207425_1008369 3300025245 Bacteria 2653
631 Ga0209646_1005918 3300025246 Bacteria 2092
632 Ga0209148_1000017 3300025254 Bacteria 787064
633 Ga0209148_1000355 3300025254 Bacteria 59062
634 Ga0209148_1006624 3300025254 Bacteria 2490
635 Ga0209129_1000099 3300025258 Bacteria 162471
636 Ga0209129_1001578 3300025258 Bacteria 12491
637 Ga0209129_1001721 3300025258 Bacteria 11801
638 Ga0209129_1002382 3300025258 Bacteria 9253
639 Ga0209233_1000015 3300025261 Bacteria 980563
640 Ga0209233_1000098 3300025261 Bacteria 294111
641 Ga0209233_1000119 3300025261 Bacteria 235924
642 Ga0209233_1015521 3300025261 Bacteria 2119
643 Ga0209565_1000010 3300025263 Bacteria 687724
644 Ga0209455_1000005 3300025272 Bacteria 1416756
645 Ga0209455_1000805 3300025272 Bacteria 17239
646 Ga0209673_1002825 3300025273 Bacteria 11175
647 Ga0209130_1000097 3300025284 Bacteria 143750
648 Ga0209676_1001390 3300025292 Bacteria 23412
649 Ga0209025_1000022 3300025294 Bacteria 574487
650 Ga0209025_1005123 3300025294 Bacteria 10878
651 Ga0209758_1000013 3300025297 Bacteria 873003
652 Ga0209758_1000035 3300025297 Bacteria 448190
653 Ga0209758_1000086 3300025297 Bacteria 254778
654 Ga0209758_1000587 3300025297 Bacteria 56803
655 Ga0209758_1002445 3300025297 Bacteria 18964
656 Ga0209758_1003566 3300025297 Bacteria 13988
657 Ga0209758_1007119 3300025297 Bacteria 7736
658 Ga0209050_1000026 3300025298 Bacteria 499134
659 Ga0209050_1004347 3300025298 Bacteria 9634
660 Ga0209256_1000034 3300025299 Bacteria 388475
661 Ga0209256_1022021 3300025299 Bacteria 1940
662 Ga0207426_1000003 3300025302 Bacteria 1063212
663 Ga0209051_1005771 3300025303 Bacteria 7136
664 Ga0209257_1000009 3300025304 Bacteria 1205047
665 Ga0209257_1001135 3300025304 Bacteria 34110
666 Ga0209257_1001786 3300025304 Bacteria 23674
667 Ga0207697_10000144 3300025315 Bacteria 34657
668 Ga0207697_10000845 3300025315 Bacteria 17297
669 Ga0207697_10023255 3300025315 Bacteria 2537
670 Ga0207656_10001050 3300025321 Bacteria 9047
671 Ga0207656_10018204 3300025321 Bacteria 2762
672 Ga0207656_10020794 3300025321 Bacteria 2612
673 Ga0207713_1004227 3300025735 Bacteria 9395
674 Ga0207682_10000389 3300025893 Bacteria 20256
675 Ga0207682_10002692 3300025893 Bacteria 7907
676 Ga0207682_10003319 3300025893 Bacteria 7022
677 Ga0207682_10044159 3300025893 Bacteria 1826
678 Ga0207642_10011259 3300025899 Bacteria 3183
679 Ga0207642_10039515 3300025899 Bacteria 2051
680 Ga0207642_10041018 3300025899 Bacteria 2024
681 Ga0207710_10019117 3300025900 Bacteria 2920
682 Ga0207688_10000184 3300025901 Bacteria 27851
683 Ga0207688_10035283 3300025901 Bacteria 2771
684 Ga0207688_10080458 3300025901 Bacteria 1860
685 Ga0207680_10004017 3300025903 Bacteria 6953
686 Ga0207680_10004430 3300025903 Bacteria 6663
687 Ga0207680_10033612 3300025903 Bacteria 2927
688 Ga0207680_10066589 3300025903 Bacteria 2216
689 Ga0207647_10000753 3300025904 Bacteria 25372
690 Ga0207647_10001723 3300025904 Bacteria 16770
691 Ga0207647_10002105 3300025904 Bacteria 15238
692 Ga0207647_10004468 3300025904 Bacteria 10367
693 Ga0207647_10005899 3300025904 Bacteria 8929
694 Ga0207647_10012809 3300025904 Bacteria 5826
695 Ga0207647_10044232 3300025904 Bacteria 2783
696 Ga0207647_10052410 3300025904 Bacteria 2518
697 Ga0207647_10072387 3300025904 Bacteria 2078
698 Ga0207647_10081409 3300025904 Bacteria 1940
699 Ga0207647_10094019 3300025904 Bacteria 1786
700 Ga0207699_10000115 3300025906 Bacteria 56719
701 Ga0207699_10022097 3300025906 Bacteria 3442
702 Ga0207645_10000752 3300025907 Bacteria 26968
703 Ga0207645_10047020 3300025907 Bacteria 2756
704 Ga0207643_10105621 3300025908 Bacteria 1655
705 Ga0207705_10000022 3300025909 Bacteria 302232
706 Ga0207705_10000054 3300025909 Bacteria 161842
707 Ga0207705_10000074 3300025909 Bacteria 123863
708 Ga0207705_10000220 3300025909 Bacteria 56835
709 Ga0207705_10000765 3300025909 Bacteria 26497
710 Ga0207705_10000960 3300025909 Bacteria 23561
711 Ga0207705_10004969 3300025909 Bacteria 9981
712 Ga0207705_10006820 3300025909 Bacteria 8440
713 Ga0207705_10007554 3300025909 Bacteria 7988
714 Ga0207705_10009971 3300025909 Bacteria 6918
715 Ga0207705_10016033 3300025909 Bacteria 5378
716 Ga0207705_10017545 3300025909 Bacteria 5124
717 Ga0207705_10019604 3300025909 Bacteria 4835
718 Ga0207705_10022112 3300025909 Bacteria 4537
719 Ga0207705_10058408 3300025909 Bacteria 2783
720 Ga0207705_10063500 3300025909 Bacteria 2668
721 Ga0207705_10071265 3300025909 Bacteria 2519
722 Ga0207705_10114635 3300025909 Bacteria 1994
723 Ga0207705_10197295 3300025909 Bacteria 1524
724 Ga0207654_10001751 3300025911 Bacteria 11271
725 Ga0207654_10001804 3300025911 Bacteria 11130
726 Ga0207654_10013524 3300025911 Bacteria 4200
727 Ga0207654_10018461 3300025911 Bacteria 3660
728 Ga0207654_10031658 3300025911 Bacteria 2915
729 Ga0207707_10000001 3300025912 Bacteria 1212482
730 Ga0207707_10068618 3300025912 Bacteria 3089
731 Ga0207695_10000004 3300025913 Bacteria 1288665
732 Ga0207695_10001011 3300025913 Bacteria 49697
733 Ga0207695_10001296 3300025913 Bacteria 42421
734 Ga0207695_10001926 3300025913 Bacteria 32252
735 Ga0207695_10003200 3300025913 Bacteria 23328
736 Ga0207695_10006315 3300025913 Bacteria 15418
737 Ga0207695_10008967 3300025913 Bacteria 12449
738 Ga0207695_10013430 3300025913 Bacteria 9768
739 Ga0207695_10014266 3300025913 Bacteria 9425
740 Ga0207695_10026665 3300025913 Bacteria 6447
741 Ga0207695_10052314 3300025913 Bacteria 4280
742 Ga0207695_10055903 3300025913 Bacteria 4110
743 Ga0207695_10083224 3300025913 Bacteria 3233
744 Ga0207695_10093400 3300025913 Bacteria 3018
745 Ga0207695_10169711 3300025913 Bacteria 2108
746 Ga0207695_10212492 3300025913 Bacteria 1844
747 Ga0207671_10000227 3300025914 Bacteria 84794
748 Ga0207671_10000319 3300025914 Bacteria 70977
749 Ga0207671_10005746 3300025914 Bacteria 11309
750 Ga0207671_10012272 3300025914 Bacteria 6902
751 Ga0207671_10020560 3300025914 Bacteria 5023
752 Ga0207671_10034330 3300025914 Bacteria 3769
753 Ga0207671_10061993 3300025914 Bacteria 2776
754 Ga0207693_10000149 3300025915 Bacteria 64155
755 Ga0207693_10000242 3300025915 Bacteria 50442
756 Ga0207693_10027638 3300025915 Bacteria 4484
757 Ga0207693_10036842 3300025915 Bacteria 3857
758 Ga0207693_10098381 3300025915 Bacteria 2294
759 Ga0207693_10124383 3300025915 Bacteria 2026
760 Ga0207693_10130025 3300025915 Bacteria 1979
761 Ga0207663_10125638 3300025916 Bacteria 1764
762 Ga0207660_10000221 3300025917 Bacteria 36706
763 Ga0207660_10014579 3300025917 Bacteria 5172
764 Ga0207660_10121858 3300025917 Bacteria 1976
765 Ga0207657_10000572 3300025919 Bacteria 39129
766 Ga0207657_10001125 3300025919 Bacteria 28389
767 Ga0207657_10001973 3300025919 Bacteria 22139
768 Ga0207657_10002982 3300025919 Bacteria 18145
769 Ga0207657_10003399 3300025919 Bacteria 17009
770 Ga0207657_10004423 3300025919 Bacteria 14873
771 Ga0207657_10005267 3300025919 Bacteria 13548
772 Ga0207657_10006466 3300025919 Bacteria 12142
773 Ga0207657_10009733 3300025919 Bacteria 9638
774 Ga0207657_10023725 3300025919 Bacteria 5705
775 Ga0207657_10027872 3300025919 Bacteria 5165
776 Ga0207657_10031951 3300025919 Bacteria 4761
777 Ga0207657_10044280 3300025919 Bacteria 3914
778 Ga0207657_10044858 3300025919 Bacteria 3884
779 Ga0207657_10047601 3300025919 Bacteria 3747
780 Ga0207657_10047806 3300025919 Bacteria 3738
781 Ga0207657_10050085 3300025919 Bacteria 3636
782 Ga0207657_10091068 3300025919 Bacteria 2544
783 Ga0207657_10162436 3300025919 Bacteria 1814
784 Ga0207649_10000235 3300025920 Bacteria 45363
785 Ga0207649_10000249 3300025920 Bacteria 43564
786 Ga0207649_10000701 3300025920 Bacteria 21986
787 Ga0207649_10000916 3300025920 Bacteria 18601
788 Ga0207649_10035944 3300025920 Bacteria 2980
789 Ga0207649_10038015 3300025920 Bacteria 2912
790 Ga0207649_10048348 3300025920 Bacteria 2623
791 Ga0207649_10058222 3300025920 Bacteria 2419
792 Ga0207649_10063032 3300025920 Bacteria 2339
793 Ga0207652_10007725 3300025921 Bacteria 8640
794 Ga0207652_10063589 3300025921 Bacteria 3191
795 Ga0207652_10124323 3300025921 Bacteria 2297
796 Ga0207652_10135823 3300025921 Bacteria 2196
797 Ga0207652_10189386 3300025921 Bacteria 1850
798 Ga0207681_10000001 3300025923 Bacteria 1105841
799 Ga0207681_10000242 3300025923 Bacteria 41825
800 Ga0207681_10002659 3300025923 Bacteria 11323
801 Ga0207681_10003001 3300025923 Bacteria 10603
802 Ga0207681_10005769 3300025923 Bacteria 7594
803 Ga0207681_10031733 3300025923 Bacteria 3452
804 Ga0207681_10032487 3300025923 Bacteria 3417
805 Ga0207681_10037753 3300025923 Bacteria 3195
806 Ga0207681_10132098 3300025923 Bacteria 1847
807 Ga0207694_10000014 3300025924 Bacteria 374435
808 Ga0207694_10004245 3300025924 Bacteria 11225
809 Ga0207694_10012149 3300025924 Bacteria 6494
810 Ga0207694_10025891 3300025924 Bacteria 4460
811 Ga0207694_10037722 3300025924 Bacteria 3713
812 Ga0207694_10041471 3300025924 Bacteria 3547
813 Ga0207694_10113614 3300025924 Bacteria 2156
814 Ga0207694_10123295 3300025924 Bacteria 2071
815 Ga0207650_10000018 3300025925 Bacteria 352120
816 Ga0207650_10000069 3300025925 Bacteria 138442
817 Ga0207650_10000537 3300025925 Bacteria 30997
818 Ga0207650_10001068 3300025925 Bacteria 20359
819 Ga0207650_10002090 3300025925 Bacteria 13962
820 Ga0207650_10008911 3300025925 Bacteria 6857
821 Ga0207650_10016144 3300025925 Bacteria 5214
822 Ga0207650_10017759 3300025925 Bacteria 4983
823 Ga0207650_10019107 3300025925 Bacteria 4815
824 Ga0207650_10049999 3300025925 Bacteria 3089
825 Ga0207650_10064027 3300025925 Bacteria 2751
826 Ga0207650_10089693 3300025925 Bacteria 2347
827 Ga0207659_10006280 3300025926 Bacteria 7271
828 Ga0207659_10009454 3300025926 Bacteria 6093
829 Ga0207659_10058713 3300025926 Bacteria 2762
830 Ga0207659_10065893 3300025926 Bacteria 2626
831 Ga0207659_10103826 3300025926 Bacteria 2148
832 Ga0207687_10034470 3300025927 Bacteria 3437
833 Ga0207687_10052020 3300025927 Bacteria 2857
834 Ga0207687_10064396 3300025927 Bacteria 2599
835 Ga0207700_10000011 3300025928 Bacteria 266323
836 Ga0207700_10038488 3300025928 Bacteria 3471
837 Ga0207700_10170122 3300025928 Bacteria 1817
838 Ga0207664_10005705 3300025929 Bacteria 8506
839 Ga0207664_10036241 3300025929 Bacteria 3812
840 Ga0207664_10065982 3300025929 Bacteria 2900
841 Ga0207664_10187876 3300025929 Bacteria 1777
842 Ga0207644_10000003 3300025931 Bacteria 585905
843 Ga0207644_10000046 3300025931 Bacteria 103962
844 Ga0207644_10000237 3300025931 Bacteria 37870
845 Ga0207644_10003327 3300025931 Bacteria 10372
846 Ga0207644_10003793 3300025931 Bacteria 9788
847 Ga0207644_10004164 3300025931 Bacteria 9378
848 Ga0207644_10011839 3300025931 Bacteria 5779
849 Ga0207644_10031561 3300025931 Bacteria 3692
850 Ga0207644_10032603 3300025931 Bacteria 3635
851 Ga0207644_10044941 3300025931 Bacteria 3140
852 Ga0207644_10092382 3300025931 Bacteria 2258
853 Ga0207690_10000001 3300025932 Bacteria 807539
854 Ga0207690_10000002 3300025932 Bacteria 807473
855 Ga0207690_10000003 3300025932 Bacteria 783011
856 Ga0207690_10000004 3300025932 Bacteria 746138
857 Ga0207690_10000336 3300025932 Bacteria 31366
858 Ga0207690_10001715 3300025932 Bacteria 13462
859 Ga0207690_10049459 3300025932 Bacteria 2803
860 Ga0207690_10067807 3300025932 Bacteria 2448
861 Ga0207690_10132230 3300025932 Bacteria 1828
862 Ga0207706_10000415 3300025933 Bacteria 45662
863 Ga0207706_10000467 3300025933 Bacteria 43202
864 Ga0207706_10000574 3300025933 Bacteria 39136
865 Ga0207706_10001849 3300025933 Bacteria 20744
866 Ga0207706_10003612 3300025933 Bacteria 14778
867 Ga0207706_10005568 3300025933 Bacteria 11745
868 Ga0207706_10006309 3300025933 Bacteria 11018
869 Ga0207706_10011480 3300025933 Bacteria 8067
870 Ga0207706_10012502 3300025933 Bacteria 7732
871 Ga0207706_10013018 3300025933 Bacteria 7571
872 Ga0207706_10034262 3300025933 Bacteria 4518
873 Ga0207706_10037729 3300025933 Bacteria 4289
874 Ga0207706_10065415 3300025933 Bacteria 3202
875 Ga0207706_10079586 3300025933 Bacteria 2882
876 Ga0207706_10156967 3300025933 Bacteria 2000
877 Ga0207706_10187179 3300025933 Bacteria 1818
878 Ga0207686_10000786 3300025934 Bacteria 19463
879 Ga0207709_10000031 3300025935 Bacteria 329046
880 Ga0207709_10015486 3300025935 Bacteria 4229
881 Ga0207670_10095331 3300025936 Bacteria 2113
882 Ga0207669_10000057 3300025937 Bacteria 56270
883 Ga0207669_10005341 3300025937 Bacteria 5755
884 Ga0207669_10018157 3300025937 Bacteria 3628
885 Ga0207669_10029902 3300025937 Bacteria 3020
886 Ga0207669_10052903 3300025937 Bacteria 2442
887 Ga0207704_10000034 3300025938 Bacteria 98810
888 Ga0207691_10000281 3300025940 Bacteria 50396
889 Ga0207691_10001641 3300025940 Bacteria 22196
890 Ga0207691_10004027 3300025940 Bacteria 14244
891 Ga0207691_10006974 3300025940 Bacteria 10901
892 Ga0207691_10008745 3300025940 Bacteria 9712
893 Ga0207691_10009210 3300025940 Bacteria 9476
894 Ga0207691_10047996 3300025940 Bacteria 3916
895 Ga0207691_10129147 3300025940 Bacteria 2234
896 Ga0207711_10000001 3300025941 Bacteria 1325674
897 Ga0207711_10000025 3300025941 Bacteria 289972
898 Ga0207711_10001345 3300025941 Bacteria 23197
899 Ga0207711_10001558 3300025941 Bacteria 21211
900 Ga0207711_10002590 3300025941 Bacteria 16088
901 Ga0207711_10006112 3300025941 Bacteria 10170
902 Ga0207711_10008775 3300025941 Bacteria 8454
903 Ga0207711_10010771 3300025941 Bacteria 7601
904 Ga0207711_10012158 3300025941 Bacteria 7156
905 Ga0207711_10025740 3300025941 Bacteria 4934
906 Ga0207711_10030082 3300025941 Bacteria 4580
907 Ga0207711_10031688 3300025941 Bacteria 4465
908 Ga0207711_10137837 3300025941 Bacteria 2193
909 Ga0207711_10165356 3300025941 Bacteria 2005
910 Ga0207689_10000212 3300025942 Bacteria 51394
911 Ga0207689_10008282 3300025942 Bacteria 9063
912 Ga0207661_10001741 3300025944 Bacteria 14901
913 Ga0207661_10020018 3300025944 Bacteria 4996
914 Ga0207661_10158115 3300025944 Bacteria 1964
915 Ga0207679_10000167 3300025945 Bacteria 54388
916 Ga0207679_10003483 3300025945 Bacteria 9730
917 Ga0207679_10008866 3300025945 Bacteria 6416
918 Ga0207679_10009041 3300025945 Bacteria 6366
919 Ga0207679_10009749 3300025945 Bacteria 6162
920 Ga0207679_10023685 3300025945 Bacteria 4202
921 Ga0207679_10029936 3300025945 Bacteria 3796
922 Ga0207679_10040346 3300025945 Bacteria 3341
923 Ga0207679_10073009 3300025945 Bacteria 2594
924 Ga0207679_10109863 3300025945 Bacteria 2174
925 Ga0207667_10000013 3300025949 Bacteria 435875
926 Ga0207667_10000116 3300025949 Bacteria 128218
927 Ga0207667_10001207 3300025949 Bacteria 32304
928 Ga0207667_10003070 3300025949 Bacteria 20700
929 Ga0207667_10003607 3300025949 Bacteria 19102
930 Ga0207667_10005234 3300025949 Bacteria 15825
931 Ga0207667_10012055 3300025949 Bacteria 9997
932 Ga0207667_10013061 3300025949 Bacteria 9533
933 Ga0207667_10014398 3300025949 Bacteria 9021
934 Ga0207667_10031284 3300025949 Bacteria 5745
935 Ga0207667_10032974 3300025949 Bacteria 5574
936 Ga0207667_10043481 3300025949 Bacteria 4767
937 Ga0207667_10117773 3300025949 Bacteria 2737
938 Ga0207667_10183483 3300025949 Bacteria 2148
939 Ga0207667_10194697 3300025949 Bacteria 2080
940 Ga0207667_10217775 3300025949 Bacteria 1956
941 Ga0207651_10000010 3300025960 Bacteria 193754
942 Ga0207651_10001964 3300025960 Bacteria 9672
943 Ga0207651_10003802 3300025960 Bacteria 7478
944 Ga0207651_10004363 3300025960 Bacteria 7116
945 Ga0207651_10005237 3300025960 Bacteria 6630
946 Ga0207651_10034344 3300025960 Bacteria 3283
947 Ga0207651_10060657 3300025960 Bacteria 2627
948 Ga0207651_10063275 3300025960 Bacteria 2583
949 Ga0207651_10073786 3300025960 Bacteria 2427
950 Ga0207712_10000035 3300025961 Bacteria 201152
951 Ga0207712_10001124 3300025961 Bacteria 18653
952 Ga0207712_10002409 3300025961 Bacteria 12098
953 Ga0207712_10006708 3300025961 Bacteria 7258
954 Ga0207712_10007538 3300025961 Bacteria 6874
955 Ga0207712_10015887 3300025961 Bacteria 4864
956 Ga0207712_10064639 3300025961 Bacteria 2609
957 Ga0207668_10000048 3300025972 Bacteria 100390
958 Ga0207668_10000140 3300025972 Bacteria 49509
959 Ga0207668_10000996 3300025972 Bacteria 16977
960 Ga0207668_10001709 3300025972 Bacteria 12839
961 Ga0207668_10004631 3300025972 Bacteria 8088
962 Ga0207668_10004909 3300025972 Bacteria 7867
963 Ga0207668_10138803 3300025972 Bacteria 1866
964 Ga0207640_10000330 3300025981 Bacteria 31573
965 Ga0207640_10000384 3300025981 Bacteria 28373
966 Ga0207640_10004386 3300025981 Bacteria 7645
967 Ga0207640_10019950 3300025981 Bacteria 3970
968 Ga0207640_10022255 3300025981 Bacteria 3790
969 Ga0207640_10026704 3300025981 Bacteria 3509
970 Ga0207640_10043987 3300025981 Bacteria 2858
971 Ga0207640_10047087 3300025981 Bacteria 2779
972 Ga0207640_10052471 3300025981 Bacteria 2656
973 Ga0207640_10062361 3300025981 Bacteria 2473
974 Ga0207640_10068567 3300025981 Bacteria 2378
975 Ga0207658_10000089 3300025986 Bacteria 100308
976 Ga0207658_10000090 3300025986 Bacteria 100143
977 Ga0207658_10000157 3300025986 Bacteria 71628
978 Ga0207658_10001309 3300025986 Bacteria 19635
979 Ga0207658_10001407 3300025986 Bacteria 18751
980 Ga0207658_10006176 3300025986 Bacteria 8179
981 Ga0207658_10009670 3300025986 Bacteria 6541
982 Ga0207658_10014510 3300025986 Bacteria 5395
983 Ga0207658_10024158 3300025986 Bacteria 4249
984 Ga0207658_10044734 3300025986 Bacteria 3224
985 Ga0207658_10048214 3300025986 Bacteria 3122
986 Ga0207658_10119433 3300025986 Bacteria 2099
987 Ga0207658_10161927 3300025986 Bacteria 1834
988 Ga0207658_10191654 3300025986 Bacteria 1700
989 Ga0207677_10000296 3300026023 Bacteria 37224
990 Ga0207677_10000463 3300026023 Bacteria 27031
991 Ga0207677_10001247 3300026023 Bacteria 13735
992 Ga0207677_10010021 3300026023 Bacteria 5347
993 Ga0207677_10056978 3300026023 Bacteria 2680
994 Ga0207677_10075534 3300026023 Bacteria 2395
995 Ga0207703_10000248 3300026035 Bacteria 60765
996 Ga0207703_10000765 3300026035 Bacteria 31688
997 Ga0207703_10001241 3300026035 Bacteria 23880
998 Ga0207703_10003893 3300026035 Bacteria 12395
999 Ga0207703_10027175 3300026035 Bacteria 4506
1000 Ga0207703_10107144 3300026035 Bacteria 2379
1001 Ga0207639_10000900 3300026041 Bacteria 20115
1002 Ga0207639_10001331 3300026041 Bacteria 16706
1003 Ga0207639_10001334 3300026041 Bacteria 16655
1004 Ga0207639_10002661 3300026041 Bacteria 11984
1005 Ga0207639_10003428 3300026041 Bacteria 10664
1006 Ga0207639_10008301 3300026041 Bacteria 7116
1007 Ga0207639_10010476 3300026041 Bacteria 6422
1008 Ga0207639_10013176 3300026041 Bacteria 5781
1009 Ga0207639_10027900 3300026041 Bacteria 4117
1010 Ga0207639_10033485 3300026041 Bacteria 3791
1011 Ga0207639_10034745 3300026041 Bacteria 3728
1012 Ga0207639_10042707 3300026041 Bacteria 3399
1013 Ga0207639_10047349 3300026041 Bacteria 3249
1014 Ga0207639_10253952 3300026041 Bacteria 1534
1015 Ga0207678_10000804 3300026067 Bacteria 28814
1016 Ga0207678_10001001 3300026067 Bacteria 25726
1017 Ga0207678_10002098 3300026067 Bacteria 18049
1018 Ga0207678_10004013 3300026067 Bacteria 13247
1019 Ga0207678_10006385 3300026067 Bacteria 10467
1020 Ga0207678_10010826 3300026067 Bacteria 8014
1021 Ga0207678_10016214 3300026067 Bacteria 6538
1022 Ga0207678_10022057 3300026067 Bacteria 5579
1023 Ga0207678_10040675 3300026067 Bacteria 4030
1024 Ga0207678_10056135 3300026067 Bacteria 3391
1025 Ga0207702_10000162 3300026078 Bacteria 79378
1026 Ga0207702_10001185 3300026078 Bacteria 26479
1027 Ga0207702_10001335 3300026078 Bacteria 24670
1028 Ga0207702_10001527 3300026078 Bacteria 22909
1029 Ga0207702_10002452 3300026078 Bacteria 17569
1030 Ga0207702_10006660 3300026078 Bacteria 9935
1031 Ga0207702_10011216 3300026078 Bacteria 7473
1032 Ga0207702_10013495 3300026078 Bacteria 6787
1033 Ga0207702_10031450 3300026078 Bacteria 4423
1034 Ga0207702_10046440 3300026078 Bacteria 3656
1035 Ga0207641_10000001 3300026088 Bacteria 1180841
1036 Ga0207641_10000002 3300026088 Bacteria 981004
1037 Ga0207641_10000060 3300026088 Bacteria 161514
1038 Ga0207641_10000064 3300026088 Bacteria 156652
1039 Ga0207641_10000142 3300026088 Bacteria 102850
1040 Ga0207641_10000642 3300026088 Bacteria 38108
1041 Ga0207641_10005615 3300026088 Bacteria 10688
1042 Ga0207641_10007096 3300026088 Bacteria 9357
1043 Ga0207641_10021958 3300026088 Bacteria 5248
1044 Ga0207641_10023445 3300026088 Bacteria 5085
1045 Ga0207641_10026161 3300026088 Bacteria 4814
1046 Ga0207641_10037383 3300026088 Bacteria 4055
1047 Ga0207641_10072595 3300026088 Bacteria 2964
1048 Ga0207641_10104379 3300026088 Bacteria 2502
1049 Ga0207641_10118276 3300026088 Bacteria 2360
1050 Ga0207648_10000219 3300026089 Bacteria 61792
1051 Ga0207648_10001054 3300026089 Bacteria 30851
1052 Ga0207648_10051229 3300026089 Bacteria 3608
1053 Ga0207648_10093428 3300026089 Bacteria 2630
1054 Ga0207676_10000004 3300026095 Bacteria 725417
1055 Ga0207676_10000353 3300026095 Bacteria 39309
1056 Ga0207676_10000691 3300026095 Bacteria 26590
1057 Ga0207676_10001458 3300026095 Bacteria 17577
1058 Ga0207676_10002351 3300026095 Bacteria 13511
1059 Ga0207676_10027960 3300026095 Bacteria 4207
1060 Ga0207676_10069153 3300026095 Bacteria 2827
1061 Ga0207676_10124820 3300026095 Bacteria 2178
1062 Ga0207674_10000501 3300026116 Bacteria 51694
1063 Ga0207674_10000507 3300026116 Bacteria 51182
1064 Ga0207674_10006084 3300026116 Bacteria 14260
1065 Ga0207674_10008398 3300026116 Bacteria 11937
1066 Ga0207674_10012203 3300026116 Bacteria 9610
1067 Ga0207674_10015326 3300026116 Bacteria 8424
1068 Ga0207674_10044805 3300026116 Bacteria 4556
1069 Ga0207674_10070467 3300026116 Bacteria 3515
1070 Ga0207674_10085244 3300026116 Bacteria 3155
1071 Ga0207674_10089440 3300026116 Bacteria 3072
1072 Ga0207674_10107521 3300026116 Bacteria 2766
1073 Ga0207675_100001468 3300026118 Bacteria 23648
1074 Ga0207675_100011175 3300026118 Bacteria 8406
1075 Ga0207675_100055806 3300026118 Bacteria 3686
1076 Ga0207675_100196210 3300026118 Bacteria 1938
1077 Ga0207675_100253903 3300026118 Bacteria 1702
1078 Ga0207683_10001180 3300026121 Bacteria 23639
1079 Ga0207683_10002743 3300026121 Bacteria 15379
1080 Ga0207683_10005377 3300026121 Bacteria 10976
1081 Ga0207683_10007088 3300026121 Bacteria 9609
1082 Ga0207683_10041328 3300026121 Bacteria 4026
1083 Ga0207698_10002806 3300026142 Bacteria 10410
1084 Ga0207698_10004493 3300026142 Bacteria 8513
1085 Ga0207698_10007072 3300026142 Bacteria 7029
1086 Ga0207698_10014605 3300026142 Bacteria 5227
1087 Ga0207698_10040685 3300026142 Bacteria 3457
1088 Ga0207698_10087316 3300026142 Bacteria 2540
1089 Ga0207698_10087353 3300026142 Bacteria 2539
1090 Ga0207698_10127682 3300026142 Bacteria 2166
1091 Ga0209389_1000132 3300027296 Bacteria 66230
1092 Ga0209489_105021 3300027361 Bacteria 23597
1093 Ga0209700_100281 3300027363 Bacteria 90519
1094 Ga0209588_1005743 3300027671 Bacteria 3569
1095 Ga0209813_10000119 3300027866 Bacteria 28404
1096 Ga0209813_10000250 3300027866 Bacteria 15607
1097 Ga0209974_10001816 3300027876 Bacteria 7781
1098 Ga0207428_10036990 3300027907 Bacteria 3975
1099 Ga0268266_10000002 3300028379 Bacteria 3059047
1100 Ga0268266_10000134 3300028379 Bacteria 143139
1101 Ga0268266_10000215 3300028379 Bacteria 100801
1102 Ga0268266_10000969 3300028379 Bacteria 36492
1103 Ga0268266_10002374 3300028379 Bacteria 20343
1104 Ga0268266_10008449 3300028379 Bacteria 9155
1105 Ga0268266_10020415 3300028379 Bacteria 5646
1106 Ga0268266_10057356 3300028379 Bacteria 3351
1107 Ga0268266_10109912 3300028379 Bacteria 2441
1108 Ga0268265_10000002 3300028380 Bacteria 1035381
1109 Ga0268265_10000003 3300028380 Bacteria 949201
1110 Ga0268265_10000169 3300028380 Bacteria 78493
1111 Ga0268265_10003680 3300028380 Bacteria 10937
1112 Ga0268265_10006540 3300028380 Bacteria 7893
1113 Ga0268265_10026231 3300028380 Bacteria 4143
1114 Ga0268265_10030454 3300028380 Bacteria 3886
1115 Ga0268265_10039895 3300028380 Bacteria 3463
1116 Ga0268264_10000018 3300028381 Bacteria 495324
1117 Ga0268264_10000075 3300028381 Bacteria 256011
1118 Ga0268264_10000274 3300028381 Bacteria 89144
1119 Ga0268264_10001549 3300028381 Bacteria 21312
1120 Ga0268264_10005833 3300028381 Bacteria 10433
1121 Ga0268264_10006690 3300028381 Bacteria 9689
1122 Ga0268264_10007172 3300028381 Bacteria 9335
1123 Ga0268264_10021649 3300028381 Bacteria 5249
1124 Ga0268264_10026533 3300028381 Bacteria 4734
1125 Ga0268264_10027334 3300028381 Bacteria 4660
1126 Ga0268264_10044369 3300028381 Bacteria 3688
1127 Ga0268264_10085211 3300028381 Bacteria 2712
1128 Ga0268264_10101726 3300028381 Bacteria 2499
1129 Ga0265318_10000082 3300028577 Bacteria 85943
1130 Ga0265318_10011734 3300028577 Bacteria 3756
1131 Ga0307517_10055456 3300028786 Bacteria 3891
1132 Ga0307515_10011427 3300028794 Bacteria 16850
1133 Ga0307515_10236952 3300028794 Bacteria 1604
1134 Ga0265338_10000006 3300028800 Bacteria 570804
1135 Ga0265338_10025716 3300028800 Bacteria 5965
1136 Ga0265320_10000042 3300031240 Bacteria 124844
1137 Ga0265325_10000023 3300031241 Bacteria 116475
1138 Ga0265325_10000184 3300031241 Bacteria 44728
1139 Ga0265325_10001137 3300031241 Bacteria 19096
1140 Ga0265325_10021757 3300031241 Bacteria 3517
1141 Ga0265325_10025932 3300031241 Bacteria 3179
1142 Ga0265329_10011161 3300031242 Bacteria 3271
1143 Ga0265340_10014718 3300031247 Bacteria 4080
1144 Ga0265339_10000074 3300031249 Bacteria 85897
1145 Ga0265339_10002234 3300031249 Bacteria 14003
1146 Ga0265339_10003258 3300031249 Bacteria 11376
1147 Ga0265339_10049373 3300031249 Bacteria 2305
1148 Ga0265339_10053586 3300031249 Bacteria 2194
1149 Ga0265331_10000003 3300031250 Bacteria 499358
1150 Ga0265331_10002325 3300031250 Bacteria 12960
1151 Ga0265331_10002768 3300031250 Bacteria 11643
1152 Ga0265327_10000453 3300031251 Bacteria 73806
1153 Ga0265327_10027971 3300031251 Bacteria 3235
1154 Ga0265327_10047844 3300031251 Bacteria 2253
1155 Ga0265316_10015406 3300031344 Bacteria 6685
1156 Ga0265316_10025772 3300031344 Bacteria 4901
1157 Ga0307513_10011652 3300031456 Bacteria 10912
1158 Ga0307408_100001417 3300031548 Bacteria 17845
1159 Ga0307408_100007705 3300031548 Bacteria 7124
1160 Ga0307408_100009847 3300031548 Bacteria 6300
1161 Ga0307408_100036325 3300031548 Bacteria 3463
1162 Ga0307408_100082434 3300031548 Bacteria 2407
1163 Ga0307408_100098883 3300031548 Bacteria 2219
1164 Ga0265313_10000033 3300031595 Bacteria 128053
1165 Ga0265313_10015408 3300031595 Bacteria 4452
1166 Ga0265313_10021916 3300031595 Bacteria 3482
1167 Ga0265313_10022760 3300031595 Bacteria 3391
1168 Ga0307508_10020890 3300031616 Bacteria 5948
1169 Ga0265314_10000270 3300031711 Bacteria 76077
1170 Ga0265314_10014047 3300031711 Bacteria 6433
1171 Ga0265314_10087022 3300031711 Bacteria 2044
1172 Ga0265314_10125502 3300031711 Bacteria 1608
1173 Ga0265342_10016674 3300031712 Bacteria 4794
1174 Ga0265342_10020269 3300031712 Bacteria 4269
1175 Ga0316578_10051124 3300031728 Bacteria 2419
1176 Ga0307516_10035732 3300031730 Bacteria 4981
1177 Ga0307516_10213759 3300031730 Bacteria 1641
1178 Ga0307405_10000808 3300031731 Bacteria 12312
1179 Ga0307405_10003202 3300031731 Bacteria 7458
1180 Ga0307405_10004395 3300031731 Bacteria 6659
1181 Ga0307405_10018651 3300031731 Bacteria 3833
1182 Ga0307405_10107072 3300031731 Bacteria 1887
1183 Ga0307405_10177112 3300031731 Bacteria 1527
1184 Ga0307413_10005919 3300031824 Bacteria 5525
1185 Ga0307413_10011988 3300031824 Bacteria 4293
1186 Ga0307413_10015065 3300031824 Bacteria 3952
1187 Ga0307413_10033318 3300031824 Bacteria 2931
1188 Ga0307413_10069395 3300031824 Bacteria 2211
1189 Ga0307413_10072634 3300031824 Bacteria 2172
1190 Ga0307410_10002073 3300031852 Bacteria 9488
1191 Ga0307410_10002503 3300031852 Bacteria 8878
1192 Ga0307410_10016054 3300031852 Bacteria 4455
1193 Ga0307410_10020617 3300031852 Bacteria 4036
1194 Ga0307410_10023816 3300031852 Bacteria 3814
1195 Ga0307410_10034604 3300031852 Bacteria 3273
1196 Ga0307410_10098835 3300031852 Bacteria 2088
1197 Ga0307410_10122370 3300031852 Bacteria 1899
1198 Ga0307410_10127893 3300031852 Bacteria 1862
1199 Ga0307410_10133524 3300031852 Bacteria 1826
1200 Ga0307410_10176679 3300031852 Bacteria 1613
1201 Ga0307406_10006067 3300031901 Bacteria 6640
1202 Ga0307406_10015051 3300031901 Bacteria 4466
1203 Ga0307406_10025651 3300031901 Bacteria 3531
1204 Ga0307406_10132907 3300031901 Bacteria 1750
1205 Ga0307407_10005186 3300031903 Bacteria 5624
1206 Ga0307407_10009389 3300031903 Bacteria 4553
1207 Ga0307407_10015762 3300031903 Bacteria 3747
1208 Ga0307407_10030602 3300031903 Bacteria 2905
1209 Ga0307407_10071981 3300031903 Bacteria 2060
1210 Ga0307407_10136115 3300031903 Bacteria 1578
1211 Ga0307412_10000374 3300031911 Bacteria 27876
1212 Ga0307412_10003243 3300031911 Bacteria 9043
1213 Ga0307412_10005338 3300031911 Bacteria 7212
1214 Ga0307412_10005834 3300031911 Bacteria 6929
1215 Ga0307412_10007434 3300031911 Bacteria 6214
1216 Ga0307412_10009553 3300031911 Bacteria 5570
1217 Ga0307412_10058050 3300031911 Bacteria 2586
1218 Ga0307412_10134391 3300031911 Bacteria 1802
1219 Ga0307409_100001476 3300031995 Bacteria 11593
1220 Ga0307409_100006481 3300031995 Bacteria 6884
1221 Ga0307409_100009610 3300031995 Bacteria 5954
1222 Ga0307409_100015591 3300031995 Bacteria 4993
1223 Ga0307409_100028303 3300031995 Bacteria 3989
1224 Ga0307409_100107503 3300031995 Bacteria 2331
1225 Ga0307409_100122213 3300031995 Bacteria 2207
1226 Ga0307409_100133511 3300031995 Bacteria 2125
1227 Ga0307416_100059985 3300032002 Bacteria 3095
1228 Ga0307416_100102333 3300032002 Bacteria 2497
1229 Ga0307416_100169980 3300032002 Bacteria 2027
1230 Ga0307414_10002439 3300032004 Bacteria 9723
1231 Ga0307414_10006194 3300032004 Bacteria 6650
1232 Ga0307414_10008796 3300032004 Bacteria 5759
1233 Ga0307414_10012266 3300032004 Bacteria 5060
1234 Ga0307414_10015212 3300032004 Bacteria 4640
1235 Ga0307414_10028032 3300032004 Bacteria 3647
1236 Ga0307414_10031568 3300032004 Bacteria 3477
1237 Ga0307414_10104556 3300032004 Bacteria 2139
1238 Ga0307414_10144385 3300032004 Bacteria 1868
1239 Ga0307414_10192980 3300032004 Bacteria 1650
1240 Ga0307411_10001036 3300032005 Bacteria 10741
1241 Ga0307411_10001396 3300032005 Bacteria 9813
1242 Ga0307411_10010063 3300032005 Bacteria 5018
1243 Ga0307411_10011062 3300032005 Bacteria 4848
1244 Ga0307411_10013948 3300032005 Bacteria 4455
1245 Ga0307411_10060454 3300032005 Bacteria 2516
1246 Ga0307411_10065795 3300032005 Bacteria 2432
1247 Ga0307411_10116641 3300032005 Bacteria 1922
1248 Ga0307411_10128550 3300032005 Bacteria 1847
1249 Ga0307411_10161955 3300032005 Bacteria 1677
1250 Ga0307415_100004390 3300032126 Bacteria 7311
1251 Ga0307415_100007564 3300032126 Bacteria 5949
1252 Ga0307415_100037453 3300032126 Bacteria 3188
1253 Ga0307415_100041953 3300032126 Bacteria 3041
1254 Ga0307415_100043123 3300032126 Bacteria 3007
1255 Ga0307415_100045864 3300032126 Bacteria 2933
1256 Ga0307415_100059702 3300032126 Bacteria 2631
1257 Ga0307415_100071835 3300032126 Bacteria 2435
1258 Ga0307415_100126925 3300032126 Bacteria 1924
1259 Ga0316583_10022457 3300032133 Bacteria 2258
1260 Ga0307510_10065528 3300033180 Bacteria 3678
1261 Ga0316587_1006795 3300033529 Bacteria 1760
1262 Ga0373923_0003496 3300035111 Bacteria 5044
1263 Ga0373923_0023014 3300035111 Bacteria 2448
1264 Ga0373956_0008339 3300035119 Bacteria 4192
1265 Ga0373956_0022669 3300035119 Bacteria 2689
1266 Ga0373960_0015263 3300035121 Bacteria 1958
1267 Ga0373943_0001178 3300035170 Bacteria 11675
1268 Ga0373942_0012916 3300035207 Bacteria 2002
1269 Ga0373931_0017709 3300035691 Bacteria 3529
1270 Ga0373931_0082780 3300035691 Bacteria 1774
1271 Ga0373935_0007929 3300035692 Bacteria 6370
1272 Ga0373935_0023197 3300035692 Bacteria 3812
1273 Ga0373935_0047460 3300035692 Bacteria 2716
1274 Ga0373927_0000055 3300035695 Bacteria 81098
1275 Ga0373927_0004550 3300035695 Bacteria 9690
1276 Ga0373937_0002251 3300036401 Bacteria 16098
1277 Ga0373937_0007070 3300036401 Bacteria 9697
1278 Ga0373937_0008501 3300036401 Bacteria 8918
1279 Ga0373937_0097257 3300036401 Bacteria 2730
1280 Ga0316584_0065251 3300036712 Bacteria 2727
1281 Ga0373925_0002489 3300037068 Bacteria 14724
1282 Ga0395899_0001653 3300037312 Bacteria 18590
1283 Ga0395899_0001731 3300037312 Bacteria 18144
1284 Ga0395899_0003563 3300037312 Bacteria 12327
1285 Ga0395899_0006503 3300037312 Bacteria 9053
1286 Ga0395899_0011515 3300037312 Bacteria 6770
1287 Ga0395899_0014844 3300037312 Bacteria 5945
1288 Ga0395899_0026950 3300037312 Bacteria 4335
1289 Ga0395899_0034664 3300037312 Bacteria 3790
1290 Ga0395899_0036566 3300037312 Bacteria 3683
1291 Ga0395899_0046547 3300037312 Bacteria 3231
1292 Ga0395899_0052863 3300037312 Bacteria 3009
1293 Ga0395899_0067787 3300037312 Bacteria 2618
1294 Ga0395899_0074254 3300037312 Bacteria 2484
1295 Ga0395899_0103322 3300037312 Bacteria 2055
1296 Ga0395899_0150206 3300037312 Bacteria 1651
1297 Ga0395899_0160654 3300037312 Bacteria 1588
1298 Ga0395900_0000238 3300037418 Bacteria 86469
1299 Ga0395900_0000949 3300037418 Bacteria 37825
1300 Ga0395900_0001814 3300037418 Bacteria 24441
1301 Ga0395900_0002178 3300037418 Bacteria 21899
1302 Ga0395900_0007827 3300037418 Bacteria 11015
1303 Ga0395900_0008110 3300037418 Bacteria 10813
1304 Ga0395900_0018477 3300037418 Bacteria 7109
1305 Ga0395900_0019728 3300037418 Bacteria 6872
1306 Ga0395900_0043593 3300037418 Bacteria 4624
1307 Ga0395900_0064725 3300037418 Bacteria 3756
1308 Ga0395900_0065733 3300037418 Bacteria 3725
1309 Ga0395900_0091572 3300037418 Bacteria 3124
1310 Ga0395900_0098968 3300037418 Bacteria 2996
1311 Ga0395900_0129344 3300037418 Bacteria 2588
1312 Ga0395900_0203746 3300037418 Bacteria 2000
1313 Ga0395900_0348157 3300037418 Bacteria 1456
1314 Ga0395898_0000245 3300037466 Bacteria 136315
1315 Ga0395898_0001652 3300037466 Bacteria 30116
1316 Ga0395898_0013404 3300037466 Bacteria 8443
1317 Ga0395898_0058520 3300037466 Bacteria 3751
1318 Ga0395898_0060826 3300037466 Bacteria 3669
1319 Ga0395898_0077867 3300037466 Bacteria 3200
1320 Ga0395898_0082522 3300037466 Bacteria 3098
1321 Ga0395898_0101842 3300037466 Bacteria 2757
1322 Ga0395898_0104593 3300037466 Bacteria 2715
1323 Ga0395898_0119806 3300037466 Bacteria 2521
1324 Ga0395898_0127269 3300037466 Bacteria 2440
1325 Ga0395898_0285462 3300037466 Bacteria 1574
1326 Ga0395905_0000006 3300037471 Bacteria 549428
1327 Ga0395905_0000325 3300037471 Bacteria 68813
1328 Ga0395905_0000523 3300037471 Bacteria 52635
1329 Ga0395905_0001434 3300037471 Bacteria 28687
1330 Ga0395905_0002090 3300037471 Bacteria 22699
1331 Ga0395905_0002647 3300037471 Bacteria 19652
1332 Ga0395905_0003593 3300037471 Bacteria 16500
1333 Ga0395905_0003695 3300037471 Bacteria 16195
1334 Ga0395905_0005557 3300037471 Bacteria 12851
1335 Ga0395905_0006244 3300037471 Bacteria 12031
1336 Ga0395905_0008536 3300037471 Bacteria 10103
1337 Ga0395905_0008978 3300037471 Bacteria 9811
1338 Ga0395905_0009273 3300037471 Bacteria 9626
1339 Ga0395905_0029866 3300037471 Bacteria 5138
1340 Ga0395905_0037315 3300037471 Bacteria 4563
1341 Ga0395905_0056628 3300037471 Bacteria 3667
1342 Ga0395905_0145321 3300037471 Bacteria 2231
1343 Ga0395905_0152632 3300037471 Bacteria 2173
1344 Ga0395905_0167362 3300037471 Bacteria 2065
1345 Ga0395905_0178564 3300037471 Bacteria 1993
1346 Ga0395905_0205756 3300037471 Bacteria 1844
1347 Ga0395905_0232770 3300037471 Bacteria 1722
1348 Ga0436364_0167314 3300037853 Bacteria 105007
1349 Ga0436364_0188498 3300037853 Bacteria 7225
1350 Ga0436364_0502927 3300037853 Bacteria 1333
1351 Ga0436364_0634282 3300037853 Bacteria 3794
1352 Ga0436364_1421444 3300037853 Bacteria 1734
1353 Ga0395901_0000156 3300038443 Bacteria 88513
1354 Ga0395901_0000707 3300038443 Bacteria 38127
1355 Ga0395901_0001052 3300038443 Bacteria 29727
1356 Ga0395901_0003263 3300038443 Bacteria 16327
1357 Ga0395901_0010819 3300038443 Bacteria 9248
1358 Ga0395901_0015936 3300038443 Bacteria 7657
1359 Ga0395901_0019054 3300038443 Bacteria 7016
1360 Ga0395901_0019269 3300038443 Bacteria 6975
1361 Ga0395901_0032654 3300038443 Bacteria 5369
1362 Ga0395901_0034715 3300038443 Bacteria 5209
1363 Ga0395901_0040896 3300038443 Bacteria 4802
1364 Ga0395901_0050792 3300038443 Bacteria 4307
1365 Ga0395901_0066478 3300038443 Bacteria 3755
1366 Ga0395901_0067173 3300038443 Bacteria 3734
1367 Ga0395901_0068017 3300038443 Bacteria 3710
1368 Ga0395901_0068935 3300038443 Bacteria 3684
1369 Ga0395901_0074178 3300038443 Bacteria 3549
1370 Ga0395901_0109507 3300038443 Bacteria 2900
1371 Ga0395901_0112918 3300038443 Bacteria 2853
1372 Ga0395901_0114683 3300038443 Bacteria 2830
1373 Ga0395901_0139683 3300038443 Bacteria 2546
1374 Ga0395901_0214859 3300038443 Bacteria 2011
1375 Ga0395901_0316494 3300038443 Bacteria 1615
1376 Ga0237819_01227 3300038705 Bacteria 7106
1377 Ga0400485_06930 3300038735 Bacteria 4653
1378 Ga0400485_08616 3300038735 Bacteria 1555
1379 Ga0400483_173519 3300039062 Bacteria 3288
1380 Ga0400487_19903 3300039110 Bacteria 4580
1381 Ga0400487_40677 3300039110 Bacteria 2268
1382 Ga0436365_0182422 3300039437 Bacteria 8645
1383 Ga0436365_0991473 3300039437 Bacteria 77252
1384 Ga0436365_1026053 3300039437 Bacteria 5976
1385 Ga0436365_1476024 3300039437 Bacteria 12711
1386 Ga0436365_1556367 3300039437 Bacteria 6848
1387 Ga0436365_1841498 3300039437 Bacteria 2946
1388 Ga0436361_0182799 3300039447 Bacteria 9299
1389 Ga0436361_0767562 3300039447 Bacteria 3062
1390 Ga0439465_0000793 3300041413 Bacteria 9883
1391 Ga0439465_0008551 3300041413 Bacteria 3229
1392 Ga0451802_0873263 3300041460 Bacteria 3607
1393 Ga0451806_029968 3300041462 Bacteria 6683
1394 Ga0439445_0002850 3300042004 Bacteria 3862
1395 Ga0439448_0004042 3300042005 Bacteria 4122
1396 Ga0450905_000302 3300042142 Bacteria 5878
1397 Ga0439458_0001153 3300042157 Bacteria 6692
1398 Ga0439458_0003677 3300042157 Bacteria 3561
1399 Ga0439460_0011315 3300042461 Bacteria 2299
1400 Ga0466966_0000001 3300044684 Bacteria 410376
1401 Ga0466966_0030765 3300044684 Bacteria 3482
1402 Ga0466966_0116469 3300044684 Bacteria 1645
1403 Ga0466961_0017587 3300044693 Bacteria 4593
1404 Ga0466963_0001409 3300044694 Bacteria 12914
1405 Ga0466963_0013855 3300044694 Bacteria 4965
1406 Ga0466971_0002841 3300044719 Bacteria 7341
1407 Ga0466968_0046344 3300044735 Bacteria 1846
1408 Ga0466970_0009309 3300044765 Bacteria 4960
1409 Ga0466957_0001128 3300044842 Bacteria 13843
1410 Ga0466959_0023580 3300045049 Bacteria 4553
1411 Ga0451576_0001206 3300045051 Bacteria 46141
1412 Ga0466967_0000368 3300045976 Bacteria 20984
1413 Ga0466967_0004158 3300045976 Bacteria 9684
1414 Ga0466967_0049956 3300045976 Bacteria 3660
1415 Ga0466967_0136785 3300045976 Bacteria 2279
1416 Ga0495627_000099 3300046453 Bacteria 107062
1417 Ga0495627_000234 3300046453 Bacteria 58786
1418 Ga0495627_033023 3300046453 Bacteria 1625
1419 Ga0495603_0027104 3300046455 Bacteria 3460
1420 Ga0495603_0055411 3300046455 Bacteria 2349
1421 Ga0495638_0000022 3300046460 Bacteria 364765
1422 Ga0495638_0028998 3300046460 Bacteria 3570
1423 Ga0495650_0000058 3300046471 Bacteria 302308
1424 Ga0495650_0005633 3300046471 Bacteria 8055
1425 Ga0495580_0097080 3300046472 Bacteria 2049
1426 Ga0495580_0137571 3300046472 Bacteria 1693
1427 Ga0495585_0067211 3300046492 Bacteria 1961
1428 Ga0495596_0029817 3300046500 Bacteria 2186
1429 Ga0495583_0000154 3300046506 Bacteria 115360
1430 Ga0495583_0000304 3300046506 Bacteria 78348
1431 Ga0495583_0000673 3300046506 Bacteria 44600
1432 Ga0495606_0000434 3300046507 Bacteria 69495
1433 Ga0495606_0012046 3300046507 Bacteria 6978
1434 Ga0495606_0022261 3300046507 Bacteria 4621
1435 Ga0495610_0000018 3300046512 Bacteria 355044
1436 Ga0495616_0000007 3300046513 Bacteria 227689
1437 Ga0495632_0000060 3300046519 Bacteria 120480
1438 Ga0495637_0001488 3300046520 Bacteria 13753
1439 Ga0495643_0000014 3300046522 Bacteria 314632
1440 Ga0495643_0002795 3300046522 Bacteria 13339
1441 Ga0495643_0009254 3300046522 Bacteria 6138
1442 Ga0495643_0069666 3300046522 Bacteria 1848
1443 Ga0495648_0000051 3300046524 Bacteria 162502
1444 Ga0495648_0000698 3300046524 Bacteria 35854
1445 Ga0495663_0000007 3300046525 Bacteria 262438
1446 Ga0495663_0004654 3300046525 Bacteria 3845
1447 Ga0495663_0006387 3300046525 Bacteria 3254
1448 Ga0495663_0011684 3300046525 Bacteria 2443
1449 Ga0495654_0001063 3300046530 Bacteria 20076
1450 Ga0495665_0042300 3300046531 Bacteria 2425
1451 Ga0495598_0007529 3300046537 Bacteria 2501
1452 Ga0495609_0029562 3300046538 Bacteria 2495
1453 Ga0495609_0039388 3300046538 Bacteria 2128
1454 Ga0495621_0000635 3300046539 Bacteria 8827
1455 Ga0495621_0003960 3300046539 Bacteria 4120
1456 Ga0495621_0010519 3300046539 Bacteria 2833
1457 Ga0495597_0051332 3300046542 Bacteria 1819
1458 Ga0495622_0017521 3300046557 Bacteria 3335
1459 Ga0495633_0001483 3300046558 Bacteria 18187
1460 Ga0495633_0005852 3300046558 Bacteria 7401
1461 Ga0495633_0013767 3300046558 Bacteria 4250
1462 Ga0495633_0014558 3300046558 Bacteria 4107
1463 Ga0495668_0000007 3300046616 Bacteria 552902
1464 Ga0495668_0010866 3300046616 Bacteria 5482
1465 Ga0495625_0000167 3300046660 Bacteria 102783
1466 Ga0495625_0091368 3300046660 Bacteria 2104
1467 Ga0495625_0098305 3300046660 Bacteria 2013
1468 Ga0495658_0000430 3300046683 Bacteria 23449
1469 Ga0495669_0000197 3300046684 Bacteria 37314
1470 Ga0495671_0000004 3300046692 Bacteria 545630
1471 Ga0495671_0000032 3300046692 Bacteria 201185
1472 Ga0495671_0018156 3300046692 Bacteria 3736
1473 Ga0495600_0001013 3300046809 Bacteria 15168
1474 Ga0495683_0009083 3300047323 Bacteria 5295
1475 Ga0495687_000178 3300047443 Bacteria 93234
1476 Ga0495687_001431 3300047443 Bacteria 21965
1477 Ga0495677_0006560 3300047445 Bacteria 4395
1478 Ga0495673_0000021 3300047469 Bacteria 545523
1479 Ga0495681_0000020 3300047470 Bacteria 170007
1480 Ga0495684_0066824 3300047471 Bacteria 2734
1481 Ga0495686_0000183 3300047472 Bacteria 119585
1482 Ga0495686_0002709 3300047472 Bacteria 16219
1483 Ga0495686_0004545 3300047472 Bacteria 11372
1484 Ga0495686_0097146 3300047472 Bacteria 1781
1485 Ga0496101_0043134 3300048904 Bacteria 3222
1486 Ga0496102_0000117 3300048905 Bacteria 114037
1487 Ga0496102_0034902 3300048905 Bacteria 4527
1488 Ga0496103_0000076 3300048906 Bacteria 113209
1489 Ga0496103_0020440 3300048906 Bacteria 3976
1490 Ga0496104_0004846 3300048907 Bacteria 11728
1491 Ga0496104_0005699 3300048907 Bacteria 10902
1492 Ga0496104_0087084 3300048907 Bacteria 2982
1493 Ga0496105_0000664 3300048908 Bacteria 23097
1494 Ga0496105_0060742 3300048908 Bacteria 3119
1495 Ga0496106_0023529 3300048909 Bacteria 4576
1496 Ga0496106_0139556 3300048909 Bacteria 1906
1497 Ga0496107_0001821 3300048910 Bacteria 13444
1498 Ga0496108_0037630 3300048911 Bacteria 4031
1499 Ga0496108_0045593 3300048911 Bacteria 3662
1500 Ga0496108_0079106 3300048911 Bacteria 2783
1501 Ga0496108_0128461 3300048911 Bacteria 2177
1502 Ga0496109_0006531 3300048912 Bacteria 9817
1503 Ga0496109_0007378 3300048912 Bacteria 9304
1504 Ga0496109_0013929 3300048912 Bacteria 6992
1505 Ga0496109_0109528 3300048912 Bacteria 2567
1506 Ga0496110_0006847 3300048913 Bacteria 9058
1507 Ga0496110_0017351 3300048913 Bacteria 6021
1508 Ga0496110_0021549 3300048913 Bacteria 5459
1509 Ga0496111_0021551 3300048914 Bacteria 4502
1510 Ga0496111_0056889 3300048914 Bacteria 2830
1511 Ga0496111_0061362 3300048914 Bacteria 2725
1512 Ga0496111_0070255 3300048914 Bacteria 2546
1513 Ga0496111_0111894 3300048914 Bacteria 2011
1514 Ga0496112_0007303 3300048915 Bacteria 9797
1515 Ga0496112_0011451 3300048915 Bacteria 8100
1516 Ga0496112_0100919 3300048915 Bacteria 2855
1517 Ga0496113_0000446 3300048916 Bacteria 20036
1518 Ga0496113_0006263 3300048916 Bacteria 7519
1519 Ga0496113_0021888 3300048916 Bacteria 4514
1520 Ga0496113_0058301 3300048916 Bacteria 2905
1521 Ga0496114_0000021 3300048917 Bacteria 227038
1522 Ga0496114_0009456 3300048917 Bacteria 7737
1523 Ga0496114_0037140 3300048917 Bacteria 4029
1524 Ga0496115_0004413 3300048918 Bacteria 10192
1525 Ga0496116_0000888 3300048919 Bacteria 37285
1526 Ga0496116_0056289 3300048919 Bacteria 2578
1527 Ga0496117_0000201 3300048920 Bacteria 117679
1528 Ga0496117_0008225 3300048920 Bacteria 9943
1529 Ga0496117_0017815 3300048920 Bacteria 5920
1530 Ga0496117_0081627 3300048920 Bacteria 2121
1531 Ga0496118_0000097 3300048921 Bacteria 160837
1532 Ga0496118_0000580 3300048921 Bacteria 60421
1533 Ga0496118_0001409 3300048921 Bacteria 36243
1534 Ga0496118_0028213 3300048921 Bacteria 4734
1535 Ga0496118_0076095 3300048921 Bacteria 2389
1536 Ga0496119_0000407 3300048922 Bacteria 59063
1537 Ga0496121_0000206 3300048924 Bacteria 130071
1538 Ga0496121_0000913 3300048924 Bacteria 53289
1539 Ga0496121_0001577 3300048924 Bacteria 37973
1540 Ga0496121_0053413 3300048924 Bacteria 3385
1541 Ga0496122_0001020 3300048925 Bacteria 49521
1542 Ga0496122_0043049 3300048925 Bacteria 3542
1543 Ga0496123_0002266 3300048926 Bacteria 24245
1544 Ga0496123_0005929 3300048926 Bacteria 12038
1545 Ga0496123_0074261 3300048926 Bacteria 2105
1546 Ga0496123_0078284 3300048926 Bacteria 2026
1547 Ga0496124_0000202 3300048927 Bacteria 117650
1548 Ga0496124_0000626 3300048927 Bacteria 58823
1549 Ga0496124_0034377 3300048927 Bacteria 4450
1550 Ga0496125_0000989 3300048928 Bacteria 44313
1551 Ga0496125_0054763 3300048928 Bacteria 3257
1552 Ga0496125_0077223 3300048928 Bacteria 2568
1553 Ga0496125_0086946 3300048928 Bacteria 2362
1554 Ga0496126_0000752 3300048929 Bacteria 58828
1555 Ga0496126_0001896 3300048929 Bacteria 30149
1556 Ga0496126_0010694 3300048929 Bacteria 9588
1557 Ga0496126_0025927 3300048929 Bacteria 5629
1558 Ga0495682_0003063 3300049460 Bacteria 7599
1559 Ga0501290_000164 3300049513 Bacteria 10659
1560 Ga0501292_000005 3300049515 Bacteria 147536
1561 Ga0501294_000019 3300049517 Bacteria 16656
1562 Ga0501031_0000014 3300049568 Bacteria 127199
1563 Ga0501031_0020439 3300049568 Bacteria 4315
1564 Ga0501032_0000015 3300049569 Bacteria 176755
1565 Ga0501032_0000064 3300049569 Bacteria 91971
1566 Ga0501032_0011642 3300049569 Bacteria 6307
1567 Ga0501033_0000023 3300049570 Bacteria 176725
1568 Ga0501033_0000286 3300049570 Bacteria 48628
1569 Ga0501033_0009129 3300049570 Bacteria 7646
1570 Ga0501033_0011983 3300049570 Bacteria 6622
1571 Ga0501033_0024235 3300049570 Bacteria 4578
1572 Ga0501033_0052810 3300049570 Bacteria 3012
1573 Ga0501033_0065854 3300049570 Bacteria 2665
1574 Ga0501033_0080894 3300049570 Bacteria 2383
1575 Ga0501033_0097866 3300049570 Bacteria 2143
1576 Ga0501033_0108308 3300049570 Bacteria 2024
1577 Ga0501034_0000073 3300049571 Bacteria 176737
1578 Ga0501034_0000174 3300049571 Bacteria 119615
1579 Ga0501034_0001140 3300049571 Bacteria 37002
1580 Ga0501034_0001254 3300049571 Bacteria 34448
1581 Ga0501034_0004755 3300049571 Bacteria 15033
1582 Ga0501034_0015208 3300049571 Bacteria 7909
1583 Ga0501034_0045607 3300049571 Bacteria 4429
1584 Ga0501034_0094347 3300049571 Bacteria 2989
1585 Ga0501034_0103070 3300049571 Bacteria 2847
1586 Ga0501034_0294401 3300049571 Bacteria 1561
1587 Ga0501036_0000002 3300049572 Bacteria 293106
1588 Ga0501036_0000436 3300049572 Bacteria 29639
1589 Ga0501036_0009088 3300049572 Bacteria 8174
1590 Ga0501036_0011420 3300049572 Bacteria 7352
1591 Ga0501036_0026088 3300049572 Bacteria 4932
1592 Ga0501036_0107278 3300049572 Bacteria 2361
1593 Ga0501037_0000147 3300049573 Bacteria 65415
1594 Ga0501037_0000158 3300049573 Bacteria 63431
1595 Ga0501037_0009152 3300049573 Bacteria 7255
1596 Ga0501038_0000002 3300049574 Bacteria 330446
1597 Ga0501038_0000031 3300049574 Bacteria 132231
1598 Ga0501038_0065954 3300049574 Bacteria 3084
1599 Ga0501038_0138394 3300049574 Bacteria 1993
1600 Ga0501039_0000002 3300049575 Bacteria 375152
1601 Ga0501039_0000057 3300049575 Bacteria 89756
1602 Ga0501039_0022860 3300049575 Bacteria 4796
1603 Ga0501040_0003321 3300049576 Bacteria 10403
1604 Ga0501040_0103305 3300049576 Bacteria 1989
1605 Ga0501041_0002432 3300049577 Bacteria 10560
1606 Ga0501042_0016431 3300049578 Bacteria 5078
1607 Ga0501043_0000041 3300049579 Bacteria 116876
1608 Ga0501043_0000048 3300049579 Bacteria 109146
1609 Ga0501043_0000582 3300049579 Bacteria 32425
1610 Ga0501043_0008193 3300049579 Bacteria 8239
1611 Ga0501043_0048638 3300049579 Bacteria 3334
1612 Ga0501043_0114437 3300049579 Bacteria 2118
1613 Ga0501046_0003122 3300049580 Bacteria 15293
1614 Ga0501046_0025774 3300049580 Bacteria 4808
1615 Ga0501046_0028567 3300049580 Bacteria 4541
1616 Ga0501046_0094501 3300049580 Bacteria 2298
1617 Ga0501047_0000010 3300049581 Bacteria 429357
1618 Ga0501047_0043746 3300049581 Bacteria 4326
1619 Ga0501047_0071636 3300049581 Bacteria 3335
1620 Ga0501047_0128940 3300049581 Bacteria 2410
1621 Ga0501047_0153444 3300049581 Bacteria 2178
1622 Ga0501047_0157663 3300049581 Bacteria 2143
1623 Ga0501047_0174553 3300049581 Bacteria 2017
1624 Ga0501047_0198693 3300049581 Bacteria 1866
1625 Ga0501047_0245622 3300049581 Bacteria 1639
1626 Ga0501048_0001840 3300049582 Bacteria 16103
1627 Ga0501048_0051843 3300049582 Bacteria 2920
1628 Ga0501048_0101509 3300049582 Bacteria 2030
1629 Ga0501067_0002732 3300049583 Bacteria 9702
1630 Ga0501068_0008788 3300049584 Bacteria 5636
1631 Ga0501069_0000018 3300049585 Bacteria 133550
1632 Ga0501069_0002410 3300049585 Bacteria 9505
1633 Ga0501070_0000048 3300049586 Bacteria 105951
1634 Ga0501070_0023329 3300049586 Bacteria 5183
1635 Ga0501070_0034925 3300049586 Bacteria 4202
1636 Ga0501070_0035259 3300049586 Bacteria 4182
1637 Ga0501070_0046374 3300049586 Bacteria 3614
1638 Ga0501070_0111914 3300049586 Bacteria 2256
1639 Ga0501071_0063763 3300049587 Bacteria 2672
1640 Ga0501072_0076902 3300049588 Bacteria 2641
1641 Ga0501072_0128104 3300049588 Bacteria 2022
1642 Ga0501073_0017249 3300049589 Bacteria 5230
1643 Ga0501073_0077099 3300049589 Bacteria 2320
1644 Ga0501073_0081428 3300049589 Bacteria 2252
1645 Ga0501073_0094205 3300049589 Bacteria 2080
1646 Ga0501074_0000001 3300049590 Bacteria 123588
1647 Ga0501074_0021121 3300049590 Bacteria 4728
1648 Ga0501074_0039011 3300049590 Bacteria 3440
1649 Ga0501074_0054588 3300049590 Bacteria 2881
1650 Ga0501075_0011925 3300049591 Bacteria 6165
1651 Ga0501075_0285509 3300049591 Bacteria 1257
1652 Ga0501076_0070570 3300049592 Bacteria 2793
1653 Ga0501077_0014772 3300049593 Bacteria 4906
1654 Ga0501211_001754 3300049658 Bacteria 2319
1655 Ga0501222_001812 3300049662 Bacteria 2963
1656 Ga0501223_000048 3300049663 Bacteria 41037
1657 Ga0501223_004615 3300049663 Bacteria 2934
1658 Ga0501223_010649 3300049663 Bacteria 1848
1659 Ga0501235_000894 3300049669 Bacteria 6133
1660 Ga0501257_000089 3300049686 Bacteria 22034
1661 Ga0501225_0000416 3300049705 Bacteria 13410
1662 Ga0501225_0000701 3300049705 Bacteria 10489
1663 Ga0501225_0010664 3300049705 Bacteria 2600
1664 Ga0501079_0003578 3300049741 Bacteria 11426
1665 Ga0501079_0025841 3300049741 Bacteria 4504
1666 Ga0501079_0133615 3300049741 Bacteria 1931
1667 Ga0501080_0000197 3300049742 Bacteria 44169
1668 Ga0501080_0000720 3300049742 Bacteria 26690
1669 Ga0501080_0001912 3300049742 Bacteria 17957
1670 Ga0501080_0089270 3300049742 Bacteria 2863
1671 Ga0501081_0002653 3300049743 Bacteria 11314
1672 Ga0501083_0018713 3300049744 Bacteria 4823
1673 Ga0501083_0030681 3300049744 Bacteria 3691
1674 Ga0501280_000062 3300049776 Bacteria 31222
1675 Ga0501281_00227 3300049777 Bacteria 6212
1676 Ga0501035_0000022 3300049822 Bacteria 208622
1677 Ga0501035_0000048 3300049822 Bacteria 146466
1678 Ga0501035_0000118 3300049822 Bacteria 95482
1679 Ga0501035_0007212 3300049822 Bacteria 10400
1680 Ga0501035_0011996 3300049822 Bacteria 8015
1681 Ga0501035_0013874 3300049822 Bacteria 7435
1682 Ga0501035_0105355 3300049822 Bacteria 2472
1683 Ga0501035_0138136 3300049822 Bacteria 2120
1684 Ga0501035_0222984 3300049822 Bacteria 1609
1685 Ga0501044_0000002 3300049823 Bacteria 375152
1686 Ga0501044_0000003 3300049823 Bacteria 345647
1687 Ga0501044_0001838 3300049823 Bacteria 24686
1688 Ga0501044_0002391 3300049823 Bacteria 21398
1689 Ga0501044_0013708 3300049823 Bacteria 8761
1690 Ga0501044_0016766 3300049823 Bacteria 7862
1691 Ga0501044_0020203 3300049823 Bacteria 7109
1692 Ga0501044_0044176 3300049823 Bacteria 4626
1693 Ga0501044_0055784 3300049823 Bacteria 4057
1694 Ga0501044_0066081 3300049823 Bacteria 3688
1695 Ga0501044_0123701 3300049823 Bacteria 2585
1696 Ga0501044_0131933 3300049823 Bacteria 2492
1697 Ga0501044_0168021 3300049823 Bacteria 2166
1698 Ga0501044_0177885 3300049823 Bacteria 2096
1699 Ga0501045_0028699 3300049824 Bacteria 4015
1700 nmdc:mga03683_2931_c1 3300050489 Bacteria 5388
1701 nmdc:mga03683_341_c1 3300050489 Bacteria 13583
1702 nmdc:mga03n38_3794_c1 3300050490 Bacteria 4907
1703 nmdc:mga0yw44_139852_c1 3300050492 Bacteria 1573
1704 nmdc:mga0yw44_74214_c1 3300050492 Bacteria 2118
1705 nmdc:mga06z11_1551_c1 3300050494 Bacteria 8541
1706 nmdc:mga06z11_80_c1 3300050494 Bacteria 40560
1707 nmdc:mga06z11_840_c1 3300050494 Bacteria 11240
1708 nmdc:mga04h51_212_c1 3300050495 Bacteria 15607
1709 nmdc:mga04h51_5929_c1 3300050495 Bacteria 3137
1710 nmdc:mga07m45_65_c1 3300050496 Bacteria 41011
1711 nmdc:mga05p37_101714_c1 3300050507 Bacteria 3538
1712 nmdc:mga05p37_249788_c1 3300050507 Bacteria 2128
1713 nmdc:mga0n895_290334_c1 3300050512 Bacteria 1658
1714 nmdc:mga0rr50_159259_c1 3300050513 Bacteria 1831
1715 nmdc:mga08x19_15653_c1 3300050514 Bacteria 4615
1716 nmdc:mga08x19_82_c1 3300050514 Bacteria 86410
1717 nmdc:mga0a205_201816_c1 3300050515 Bacteria 1879
1718 nmdc:mga0sz30_20237_c1 3300050516 Bacteria 2683
1719 nmdc:mga0sz30_286_c1 3300050516 Bacteria 19407
1720 Ga0500610_0000162 3300053079 Bacteria 19903
1721 Ga0495595_0020126 3300053084 Bacteria 2902
1722 Ga0500643_000004 3300053087 Bacteria 857484
1723 Ga0500643_000139 3300053087 Bacteria 73348
1724 Ga0500643_000710 3300053087 Bacteria 22095
1725 Ga0500643_000970 3300053087 Bacteria 17789
1726 Ga0500643_002518 3300053087 Bacteria 9383
1727 Ga0500643_002544 3300053087 Bacteria 9304
1728 Ga0500643_022576 3300053087 Bacteria 2023
1729 Ga0500647_0050873 3300053091 Bacteria 1993
1730 Ga0500556_0000552 3300053104 Bacteria 25172
1731 Ga0500592_000317 3300053116 Bacteria 8277
1732 Ga0500595_000992 3300053119 Bacteria 15933
1733 Ga0500595_001637 3300053119 Bacteria 11764
1734 Ga0500607_002571 3300053121 Bacteria 14459
1735 Ga0500608_000128 3300053122 Bacteria 30980
1736 Ga0500618_003360 3300053125 Bacteria 5527
1737 Ga0500618_026618 3300053125 Bacteria 1380
1738 Ga0500642_0000216 3300053130 Bacteria 22916
1739 Ga0500658_0000029 3300053134 Bacteria 99170
1740 Ga0500559_0003821 3300053136 Bacteria 7287
1741 Ga0500573_0000008 3300053140 Bacteria 237795
1742 Ga0500588_0008049 3300053146 Bacteria 2448
1743 Ga0500590_000159 3300053148 Bacteria 19562
1744 Ga0500604_0000023 3300053151 Bacteria 70298
1745 Ga0500616_0000417 3300053153 Bacteria 57047
1746 Ga0500616_0003288 3300053153 Bacteria 12474
1747 Ga0500622_0000381 3300053156 Bacteria 42820
1748 Ga0500622_0001861 3300053156 Bacteria 15966
1749 Ga0500622_0005692 3300053156 Bacteria 7407
1750 Ga0500624_000015 3300053157 Bacteria 161928
1751 Ga0500624_000022 3300053157 Bacteria 116892
1752 Ga0500624_000200 3300053157 Bacteria 23534
1753 Ga0500627_0004972 3300053158 Bacteria 4352
1754 Ga0500627_0010238 3300053158 Bacteria 3412
1755 Ga0500637_0000043 3300053178 Bacteria 45898
1756 Ga0500637_0013054 3300053178 Bacteria 4342
1757 Ga0500567_000941 3300053723 Bacteria 11122
1758 Ga0500570_000434 3300053724 Bacteria 16045
1759 Ga0500625_000051 3300053729 Bacteria 24610
1760 Ga0500645_000011 3300053730 Bacteria 169616
1761 Ga0500645_008030 3300053730 Bacteria 3633
1762 Ga0500645_013696 3300053730 Bacteria 2598
1763 Ga0500645_034318 3300053730 Bacteria 1515
1764 Ga0501084_0000594 3300054114 Bacteria 27663
1765 Ga0501084_0001552 3300054114 Bacteria 18248
1766 Ga0501084_0003821 3300054114 Bacteria 12248
1767 Ga0501084_0066802 3300054114 Bacteria 3009
1768 Ga0587083_0001552 3300059505 Bacteria 2621
1769 Ga0587090_001105 3300059510 Bacteria 2616
1770 Ga0587090_002462 3300059510 Bacteria 2044
1771 Ga0587075_001033 3300059644 Bacteria 2559
1772 Ga0587079_008176 3300059647 Bacteria 1591
1773 Ga0587071_002170 3300060344 Bacteria 2618
1774 Ga0501082_0031067 3300060353 Bacteria 4603
1775 Ga0501082_0085262 3300060353 Bacteria 2724
1776 Ga0501082_0348195 3300060353 Bacteria 1291
1777 Ga0530510_0085908 3300061734 Bacteria 2292
1778 Ga0530510_0130658 3300061734 Bacteria 1847

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0285509 Ga0501075_0285509_195_1229 317
2 3300060353 Ga0501082_0348195 Ga0501082_0348195_72_1055 320
3 3300025941 Ga0207711_10000001 Ga0207711_100000011225 324
4 3300054114 Ga0501084_0066802 Ga0501084_0066802_82_1116 328
5 3300037853 Ga0436364_0502927 Ga0436364_0502927_17_1288 345
6 3300048917 Ga0496114_0009456 Ga0496114_0009456_6558_7724 345
7 3300049570 Ga0501033_0024235 Ga0501033_0024235_2225_3574 345
8 3300049822 Ga0501035_0007212 Ga0501035_0007212_7482_8831 345
9 3300002067 JGI24735J21928_10007777 JGI24735J21928_100077773 348
10 3300037471 Ga0395905_0152632 Ga0395905_0152632_389_1873 348
11 3300001979 JGI24740J21852_10008117 JGI24740J21852_100081171 349
12 3300005336 Ga0070680_100044365 Ga0070680_1000443654 349
13 3300013104 Ga0157370_10053285 Ga0157370_100532852 349
14 3300025921 Ga0207652_10135823 Ga0207652_101358231 349
15 3300026067 Ga0207678_10002098 Ga0207678_1000209818 349
16 3300037312 Ga0395899_0001653 Ga0395899_0001653_5673_7103 349
17 3300037418 Ga0395900_0001814 Ga0395900_0001814_7572_9002 349
18 3300037466 Ga0395898_0001652 Ga0395898_0001652_395_1825 349
19 3300037471 Ga0395905_0005557 Ga0395905_0005557_6030_7460 349
20 3300038443 Ga0395901_0000707 Ga0395901_0000707_10852_12282 349
21 3300005331 Ga0070670_100066495 Ga0070670_1000664953 356
22 3300025901 Ga0207688_10080458 Ga0207688_100804581 356
23 3300025925 Ga0207650_10064027 Ga0207650_100640272 356
24 3300025940 Ga0207691_10047996 Ga0207691_100479964 356
25 3300005564 Ga0070664_100126032 Ga0070664_1001260322 357
26 3300026067 Ga0207678_10022057 Ga0207678_100220575 357
27 3300026142 Ga0207698_10014605 Ga0207698_100146056 357
28 3300025321 Ga0207656_10018204 Ga0207656_100182042 360
29 3300037418 Ga0395900_0000238 Ga0395900_0000238_65787_67220 360
30 3300037466 Ga0395898_0000245 Ga0395898_0000245_45600_47033 360
31 3300037471 Ga0395905_0000006 Ga0395905_0000006_125664_127097 360
32 3300038443 Ga0395901_0000156 Ga0395901_0000156_18432_19865 360
33 3300048908 Ga0496105_0060742 Ga0496105_0060742_472_1908 360
34 3300048911 Ga0496108_0079106 Ga0496108_0079106_150_1586 360
35 3300048912 Ga0496109_0109528 Ga0496109_0109528_320_1756 360
36 3300048914 Ga0496111_0021551 Ga0496111_0021551_501_1937 360
37 3300025945 Ga0207679_10023685 Ga0207679_100236853 361
38 3300025986 Ga0207658_10009670 Ga0207658_100096704 361
39 3300048913 Ga0496110_0021549 Ga0496110_0021549_2715_4151 361
40 3300053125 Ga0500618_026618 Ga0500618_026618_83_1360 361
41 3300005327 Ga0070658_10025146 Ga0070658_100251463 362
42 3300005327 Ga0070658_10050801 Ga0070658_100508014 362
43 3300005364 Ga0070673_100073268 Ga0070673_1000732682 362
44 3300005543 Ga0070672_100038881 Ga0070672_1000388814 362
45 3300005548 Ga0070665_100002360 Ga0070665_10000236014 362
46 3300006237 Ga0097621_100114476 Ga0097621_1001144762 362
47 3300013296 Ga0157374_10038557 Ga0157374_100385572 362
48 3300025315 Ga0207697_10023255 Ga0207697_100232552 362
49 3300025909 Ga0207705_10016033 Ga0207705_100160332 362
50 3300025909 Ga0207705_10114635 Ga0207705_101146352 362
51 3300025933 Ga0207706_10065415 Ga0207706_100654152 362
52 3300025940 Ga0207691_10129147 Ga0207691_101291472 362
53 3300025960 Ga0207651_10034344 Ga0207651_100343443 362
54 3300026041 Ga0207639_10034745 Ga0207639_100347452 362
55 3300026041 Ga0207639_10253952 Ga0207639_102539521 362
56 3300026067 Ga0207678_10016214 Ga0207678_100162145 362
57 3300026121 Ga0207683_10041328 Ga0207683_100413282 362
58 3300028379 Ga0268266_10008449 Ga0268266_1000844911 362
59 3300039437 Ga0436365_1026053 Ga0436365_1026053_2643_4058 362
60 3300048915 Ga0496112_0100919 Ga0496112_0100919_288_1721 362
61 3300005355 Ga0070671_100009973 Ga0070671_1000099732 364
62 3300005444 Ga0070694_100004307 Ga0070694_10000430710 364
63 3300005543 Ga0070672_100006546 Ga0070672_1000065467 364
64 3300005563 Ga0068855_100057635 Ga0068855_1000576354 364
65 3300005843 Ga0068860_100043917 Ga0068860_1000439173 364
66 3300009553 Ga0105249_10007160 Ga0105249_1000716010 364
67 3300025904 Ga0207647_10005899 Ga0207647_100058994 364
68 3300025919 Ga0207657_10091068 Ga0207657_100910682 364
69 3300025933 Ga0207706_10003612 Ga0207706_1000361211 364
70 3300025940 Ga0207691_10008745 Ga0207691_100087454 364
71 3300025949 Ga0207667_10014398 Ga0207667_100143984 364
72 3300025961 Ga0207712_10001124 Ga0207712_100011244 364
73 3300025961 Ga0207712_10002409 Ga0207712_100024094 364
74 3300025961 Ga0207712_10007538 Ga0207712_100075384 364
75 3300028381 Ga0268264_10006690 Ga0268264_100066904 364
76 3300037312 Ga0395899_0046547 Ga0395899_0046547_1278_2711 364
77 3300044684 Ga0466966_0030765 Ga0466966_0030765_468_1895 364
78 3300048918 Ga0496115_0004413 Ga0496115_0004413_5724_7154 364
79 3300046616 Ga0495668_0010866 Ga0495668_0010866_2977_4419 365
80 3300053134 Ga0500658_0000029 Ga0500658_0000029_1541_2983 365
81 3300002074 JGI24748J21848_1000230 JGI24748J21848_10002303 368
82 3300002239 JGI24034J26672_10000019 JGI24034J26672_100000198 368
83 3300002244 JGI24742J22300_10002996 JGI24742J22300_100029962 368
84 3300005841 Ga0068863_100000085 Ga0068863_10000008575 368
85 3300025223 Ga0207672_1000994 Ga0207672_10009943 368
86 3300026088 Ga0207641_10000142 Ga0207641_1000014236 368
87 3300035111 Ga0373923_0003496 Ga0373923_0003496_3725_5020 368
88 3300037471 Ga0395905_0006244 Ga0395905_0006244_2079_3512 368
89 3300038443 Ga0395901_0019054 Ga0395901_0019054_4232_5665 368
90 3300048915 Ga0496112_0011451 Ga0496112_0011451_2539_3972 368
91 3300037418 Ga0395900_0348157 Ga0395900_0348157_256_1446 370
92 3300005327 Ga0070658_10007930 Ga0070658_100079301 372
93 3300005327 Ga0070658_10117446 Ga0070658_101174462 372
94 3300005455 Ga0070663_100050353 Ga0070663_1000503534 372
95 3300005578 Ga0068854_100000335 Ga0068854_10000033535 372
96 3300025909 Ga0207705_10000022 Ga0207705_10000022286 372
97 3300025981 Ga0207640_10000384 Ga0207640_1000038417 372
98 3300026067 Ga0207678_10056135 Ga0207678_100561352 372
99 3300038443 Ga0395901_0067173 Ga0395901_0067173_2372_3724 372
100 3300046558 Ga0495633_0001483 Ga0495633_0001483_16295_17665 373
101 3300009177 Ga0105248_10000001 Ga0105248_10000001646 374
102 3300009545 Ga0105237_10073192 Ga0105237_100731922 375
103 3300025914 Ga0207671_10034330 Ga0207671_100343302 375
104 3300026041 Ga0207639_10027900 Ga0207639_100279002 375
105 3300035691 Ga0373931_0082780 Ga0373931_0082780_297_1670 375
106 3300025254 Ga0209148_1000355 Ga0209148_10003554 376
107 3300037471 Ga0395905_0002647 Ga0395905_0002647_1692_3119 376
108 3300044735 Ga0466968_0046344 Ga0466968_0046344_468_1832 376
109 3300049686 Ga0501257_000089 Ga0501257_000089_12385_13782 376
110 3300013306 Ga0163162_10108809 Ga0163162_101088093 377
111 3300026078 Ga0207702_10006660 Ga0207702_100066604 377
112 3300003214 JGI25165J46597_1000165 JGI25165J46597_1000165119 378
113 3300003791 Ga0055530_10000452 Ga0055530_1000045235 378
114 3300003794 Ga0055531_10000016 Ga0055531_10000016177 378
115 3300005614 Ga0068856_100091032 Ga0068856_1000910321 378
116 3300005843 Ga0068860_100131474 Ga0068860_1001314742 378
117 3300009174 Ga0105241_10011934 Ga0105241_100119342 378
118 3300011119 Ga0105246_10033426 Ga0105246_100334262 378
119 3300013104 Ga0157370_10000096 Ga0157370_10000096102 378
120 3300013105 Ga0157369_10013151 Ga0157369_100131514 378
121 3300025261 Ga0209233_1000098 Ga0209233_1000098280 378
122 3300025298 Ga0209050_1000026 Ga0209050_1000026278 378
123 3300025304 Ga0209257_1000009 Ga0209257_1000009278 378
124 3300025911 Ga0207654_10018461 Ga0207654_100184612 378
125 3300025913 Ga0207695_10013430 Ga0207695_100134307 378
126 3300037418 Ga0395900_0098968 Ga0395900_0098968_38_1444 378
127 3300002077 JGI24744J21845_10002511 JGI24744J21845_100025111 379
128 3300005336 Ga0070680_100000336 Ga0070680_10000033630 379
129 3300005354 Ga0070675_100013237 Ga0070675_1000132372 379
130 3300005458 Ga0070681_10059208 Ga0070681_100592085 379
131 3300005563 Ga0068855_100000380 Ga0068855_10000038062 379
132 3300025246 Ga0209646_1005918 Ga0209646_10059182 379
133 3300025917 Ga0207660_10000221 Ga0207660_1000022132 379
134 3300025921 Ga0207652_10189386 Ga0207652_101893862 379
135 3300025926 Ga0207659_10065893 Ga0207659_100658932 379
136 3300025949 Ga0207667_10000013 Ga0207667_10000013148 379
137 3300031852 Ga0307410_10016054 Ga0307410_100160544 379
138 3300046507 Ga0495606_0022261 Ga0495606_0022261_2792_4207 379
139 3300048905 Ga0496102_0000117 Ga0496102_0000117_37165_38604 379
140 3300048906 Ga0496103_0000076 Ga0496103_0000076_37172_38611 379
141 3300048919 Ga0496116_0000888 Ga0496116_0000888_27846_29285 379
142 3300048920 Ga0496117_0000201 Ga0496117_0000201_36979_38418 379
143 3300048921 Ga0496118_0000097 Ga0496118_0000097_79262_80701 379
144 3300048927 Ga0496124_0000202 Ga0496124_0000202_36950_38389 379
145 3300049590 Ga0501074_0054588 Ga0501074_0054588_1222_2628 379
146 3300049742 Ga0501080_0001912 Ga0501080_0001912_174_1511 379
147 3300049744 Ga0501083_0018713 Ga0501083_0018713_1582_2919 379
148 3300005327 Ga0070658_10110557 Ga0070658_101105572 380
149 3300005345 Ga0070692_10019808 Ga0070692_100198082 380
150 3300013105 Ga0157369_10117422 Ga0157369_101174222 380
151 3300021384 Ga0213876_10008466 Ga0213876_100084664 380
152 3300025913 Ga0207695_10212492 Ga0207695_102124922 380
153 3300028800 Ga0265338_10000006 Ga0265338_10000006241 380
154 3300031241 Ga0265325_10000023 Ga0265325_1000002310 380
155 3300031242 Ga0265329_10011161 Ga0265329_100111613 380
156 3300031249 Ga0265339_10002234 Ga0265339_100022346 380
157 3300031250 Ga0265331_10002768 Ga0265331_100027689 380
158 3300031595 Ga0265313_10015408 Ga0265313_100154081 380
159 3300031711 Ga0265314_10125502 Ga0265314_101255022 380
160 3300031995 Ga0307409_100107503 Ga0307409_1001075032 380
161 3300039437 Ga0436365_1556367 Ga0436365_1556367_1288_2727 380
162 3300042005 Ga0439448_0004042 Ga0439448_0004042_1498_2910 380
163 3300042157 Ga0439458_0003677 Ga0439458_0003677_1213_2625 380
164 3300044694 Ga0466963_0013855 Ga0466963_0013855_3556_4950 380
165 3300048917 Ga0496114_0000021 Ga0496114_0000021_61888_63303 380
166 3300048921 Ga0496118_0076095 Ga0496118_0076095_560_1969 380
167 3300049571 Ga0501034_0103070 Ga0501034_0103070_992_2344 380
168 3300054114 Ga0501084_0000594 Ga0501084_0000594_21255_22634 380
169 3300001915 JGI24741J21665_1000109 JGI24741J21665_10001092 381
170 3300002067 JGI24735J21928_10032003 JGI24735J21928_100320031 381
171 3300003759 Ga0055525_1000051 Ga0055525_1000051195 381
172 3300005336 Ga0070680_100003865 Ga0070680_1000038658 381
173 3300005344 Ga0070661_100004068 Ga0070661_1000040687 381
174 3300009174 Ga0105241_10009179 Ga0105241_100091798 381
175 3300013104 Ga0157370_10003024 Ga0157370_100030246 381
176 3300025230 Ga0209563_100019 Ga0209563_100019311 381
177 3300025911 Ga0207654_10001751 Ga0207654_100017518 381
178 3300025949 Ga0207667_10001207 Ga0207667_1000120722 381
179 3300026041 Ga0207639_10001334 Ga0207639_1000133413 381
180 3300026067 Ga0207678_10006385 Ga0207678_100063859 381
181 3300026078 Ga0207702_10001185 Ga0207702_1000118519 381
182 3300026116 Ga0207674_10089440 Ga0207674_100894402 381
183 3300031824 Ga0307413_10005919 Ga0307413_100059193 381
184 3300031852 Ga0307410_10020617 Ga0307410_100206172 381
185 3300031901 Ga0307406_10132907 Ga0307406_101329071 381
186 3300031995 Ga0307409_100006481 Ga0307409_1000064815 381
187 3300032002 Ga0307416_100102333 Ga0307416_1001023333 381
188 3300032004 Ga0307414_10031568 Ga0307414_100315683 381
189 3300032005 Ga0307411_10011062 Ga0307411_100110622 381
190 3300032005 Ga0307411_10060454 Ga0307411_100604542 381
191 3300039437 Ga0436365_1841498 Ga0436365_1841498_1413_2915 381
192 3300046507 Ga0495606_0000434 Ga0495606_0000434_5244_6671 381
193 3300061734 Ga0530510_0085908 Ga0530510_0085908_329_1684 381
194 3300001990 JGI24737J22298_10022389 JGI24737J22298_100223892 382
195 3300005327 Ga0070658_10016724 Ga0070658_100167247 382
196 3300005327 Ga0070658_10019624 Ga0070658_100196244 382
197 3300005333 Ga0070677_10000309 Ga0070677_100003097 382
198 3300005344 Ga0070661_100000010 Ga0070661_10000001017 382
199 3300005353 Ga0070669_100039059 Ga0070669_1000390592 382
200 3300005356 Ga0070674_100107584 Ga0070674_1001075842 382
201 3300005456 Ga0070678_100106381 Ga0070678_1001063812 382
202 3300005457 Ga0070662_100123715 Ga0070662_1001237152 382
203 3300005843 Ga0068860_100002867 Ga0068860_10000286718 382
204 3300005844 Ga0068862_100000154 Ga0068862_10000015464 382
205 3300005983 Ga0081540_1007532 Ga0081540_10075329 382
206 3300009101 Ga0105247_10007558 Ga0105247_100075582 382
207 3300009553 Ga0105249_10000037 Ga0105249_10000037160 382
208 3300014326 Ga0157380_10036160 Ga0157380_100361603 382
209 3300025893 Ga0207682_10003319 Ga0207682_100033195 382
210 3300025900 Ga0207710_10019117 Ga0207710_100191172 382
211 3300025909 Ga0207705_10000054 Ga0207705_100000544 382
212 3300025919 Ga0207657_10002982 Ga0207657_100029829 382
213 3300025920 Ga0207649_10000235 Ga0207649_1000023515 382
214 3300025923 Ga0207681_10031733 Ga0207681_100317332 382
215 3300025925 Ga0207650_10017759 Ga0207650_100177592 382
216 3300025933 Ga0207706_10187179 Ga0207706_101871792 382
217 3300025937 Ga0207669_10018157 Ga0207669_100181574 382
218 3300025961 Ga0207712_10000035 Ga0207712_10000035160 382
219 3300028380 Ga0268265_10000169 Ga0268265_1000016963 382
220 3300028381 Ga0268264_10001549 Ga0268264_1000154922 382
221 3300031852 Ga0307410_10002503 Ga0307410_100025039 382
222 3300031903 Ga0307407_10030602 Ga0307407_100306022 382
223 3300031995 Ga0307409_100001476 Ga0307409_1000014765 382
224 3300032004 Ga0307414_10028032 Ga0307414_100280321 382
225 3300032005 Ga0307411_10001396 Ga0307411_100013969 382
226 3300032126 Ga0307415_100126925 Ga0307415_1001269252 382
227 3300037466 Ga0395898_0119806 Ga0395898_0119806_1108_2502 382
228 3300037853 Ga0436364_0188498 Ga0436364_0188498_3741_5165 382
229 3300038443 Ga0395901_0114683 Ga0395901_0114683_1364_2746 382
230 3300039437 Ga0436365_0991473 Ga0436365_0991473_1313_2674 382
231 3300047443 Ga0495687_000178 Ga0495687_000178_54579_55991 382
232 3300003215 JGI25153J46596_10000113 JGI25153J46596_1000011332 383
233 3300005344 Ga0070661_100070684 Ga0070661_1000706842 383
234 3300005344 Ga0070661_100187705 Ga0070661_1001877051 383
235 3300005354 Ga0070675_100017473 Ga0070675_1000174732 383
236 3300005616 Ga0068852_100027004 Ga0068852_1000270044 383
237 3300005841 Ga0068863_100029664 Ga0068863_1000296644 383
238 3300014325 Ga0163163_10036200 Ga0163163_100362004 383
239 3300025297 Ga0209758_1000035 Ga0209758_1000035411 383
240 3300025909 Ga0207705_10009971 Ga0207705_100099717 383
241 3300025919 Ga0207657_10027872 Ga0207657_100278724 383
242 3300026088 Ga0207641_10021958 Ga0207641_100219584 383
243 3300031731 Ga0307405_10018651 Ga0307405_100186513 383
244 3300031852 Ga0307410_10034604 Ga0307410_100346044 383
245 3300031852 Ga0307410_10133524 Ga0307410_101335242 383
246 3300031903 Ga0307407_10009389 Ga0307407_100093893 383
247 3300031903 Ga0307407_10071981 Ga0307407_100719812 383
248 3300031995 Ga0307409_100009610 Ga0307409_1000096104 383
249 3300032002 Ga0307416_100059985 Ga0307416_1000599853 383
250 3300032005 Ga0307411_10001036 Ga0307411_1000103610 383
251 3300032126 Ga0307415_100004390 Ga0307415_1000043904 383
252 3300037471 Ga0395905_0003593 Ga0395905_0003593_12646_14064 383
253 3300037471 Ga0395905_0037315 Ga0395905_0037315_1067_2470 383
254 3300037471 Ga0395905_0056628 Ga0395905_0056628_451_1884 383
255 3300037471 Ga0395905_0178564 Ga0395905_0178564_124_1539 383
256 3300038443 Ga0395901_0139683 Ga0395901_0139683_103_1506 383
257 3300041413 Ga0439465_0000793 Ga0439465_0000793_7927_9339 383
258 3300042004 Ga0439445_0002850 Ga0439445_0002850_665_2077 383
259 3300046455 Ga0495603_0055411 Ga0495603_0055411_185_1492 383
260 3300047445 Ga0495677_0006560 Ga0495677_0006560_2607_4019 383
261 3300053116 Ga0500592_000317 Ga0500592_000317_6297_7670 383
262 3300001990 JGI24737J22298_10000016 JGI24737J22298_1000001638 384
263 3300001990 JGI24737J22298_10001375 JGI24737J22298_100013752 384
264 3300001990 JGI24737J22298_10013513 JGI24737J22298_100135132 384
265 3300002075 JGI24738J21930_10000066 JGI24738J21930_1000006612 384
266 3300005328 Ga0070676_10009231 Ga0070676_100092314 384
267 3300005330 Ga0070690_100051628 Ga0070690_1000516282 384
268 3300005331 Ga0070670_100014565 Ga0070670_1000145654 384
269 3300005334 Ga0068869_100000842 Ga0068869_10000084218 384
270 3300005335 Ga0070666_10036991 Ga0070666_100369912 384
271 3300005338 Ga0068868_100002232 Ga0068868_1000022326 384
272 3300005339 Ga0070660_100003011 Ga0070660_10000301112 384
273 3300005339 Ga0070660_100056478 Ga0070660_1000564782 384
274 3300005347 Ga0070668_100082118 Ga0070668_1000821182 384
275 3300005347 Ga0070668_100153973 Ga0070668_1001539732 384
276 3300005353 Ga0070669_100001775 Ga0070669_10000177515 384
277 3300005356 Ga0070674_100087182 Ga0070674_1000871822 384
278 3300005364 Ga0070673_100000517 Ga0070673_10000051718 384
279 3300005366 Ga0070659_100001375 Ga0070659_1000013758 384
280 3300005367 Ga0070667_100023789 Ga0070667_1000237892 384
281 3300005367 Ga0070667_100161469 Ga0070667_1001614692 384
282 3300005457 Ga0070662_100000475 Ga0070662_10000047515 384
283 3300005458 Ga0070681_10000014 Ga0070681_1000001437 384
284 3300005459 Ga0068867_100001398 Ga0068867_1000013988 384
285 3300005539 Ga0068853_100044179 Ga0068853_1000441792 384
286 3300005539 Ga0068853_100060220 Ga0068853_1000602202 384
287 3300005543 Ga0070672_100000284 Ga0070672_10000028428 384
288 3300005563 Ga0068855_100002806 Ga0068855_1000028062 384
289 3300005563 Ga0068855_100081507 Ga0068855_1000815073 384
290 3300005564 Ga0070664_100032949 Ga0070664_1000329494 384
291 3300005564 Ga0070664_100209915 Ga0070664_1002099152 384
292 3300005577 Ga0068857_100004560 Ga0068857_10000456010 384
293 3300005578 Ga0068854_100005153 Ga0068854_1000051539 384
294 3300005616 Ga0068852_100018027 Ga0068852_1000180274 384
295 3300005618 Ga0068864_100020612 Ga0068864_1000206125 384
296 3300005841 Ga0068863_100001129 Ga0068863_10000112920 384
297 3300005843 Ga0068860_100007140 Ga0068860_1000071409 384
298 3300005937 Ga0081455_10000570 Ga0081455_100005706 384
299 3300006881 Ga0068865_100035057 Ga0068865_1000350572 384
300 3300009093 Ga0105240_10015925 Ga0105240_100159258 384
301 3300009098 Ga0105245_10001374 Ga0105245_1000137410 384
302 3300009148 Ga0105243_10004171 Ga0105243_100041717 384
303 3300009177 Ga0105248_10001396 Ga0105248_1000139612 384
304 3300010375 Ga0105239_10111528 Ga0105239_101115282 384
305 3300013102 Ga0157371_10006646 Ga0157371_100066469 384
306 3300013102 Ga0157371_10076427 Ga0157371_100764272 384
307 3300013297 Ga0157378_10002115 Ga0157378_1000211512 384
308 3300013307 Ga0157372_10085065 Ga0157372_100850654 384
309 3300014968 Ga0157379_10061550 Ga0157379_100615502 384
310 3300025315 Ga0207697_10000144 Ga0207697_1000014420 384
311 3300025321 Ga0207656_10001050 Ga0207656_100010502 384
312 3300025899 Ga0207642_10039515 Ga0207642_100395152 384
313 3300025901 Ga0207688_10000184 Ga0207688_100001842 384
314 3300025904 Ga0207647_10000753 Ga0207647_1000075317 384
315 3300025904 Ga0207647_10044232 Ga0207647_100442321 384
316 3300025912 Ga0207707_10000001 Ga0207707_10000001697 384
317 3300025913 Ga0207695_10008967 Ga0207695_100089677 384
318 3300025913 Ga0207695_10014266 Ga0207695_100142668 384
319 3300025919 Ga0207657_10009733 Ga0207657_100097332 384
320 3300025919 Ga0207657_10047806 Ga0207657_100478062 384
321 3300025923 Ga0207681_10002659 Ga0207681_100026596 384
322 3300025924 Ga0207694_10041471 Ga0207694_100414712 384
323 3300025926 Ga0207659_10103826 Ga0207659_101038262 384
324 3300025927 Ga0207687_10034470 Ga0207687_100344703 384
325 3300025931 Ga0207644_10011839 Ga0207644_100118395 384
326 3300025931 Ga0207644_10092382 Ga0207644_100923822 384
327 3300025932 Ga0207690_10001715 Ga0207690_100017158 384
328 3300025933 Ga0207706_10001849 Ga0207706_1000184912 384
329 3300025937 Ga0207669_10029902 Ga0207669_100299022 384
330 3300025940 Ga0207691_10000281 Ga0207691_1000028112 384
331 3300025941 Ga0207711_10006112 Ga0207711_100061124 384
332 3300025942 Ga0207689_10000212 Ga0207689_1000021218 384
333 3300025945 Ga0207679_10109863 Ga0207679_101098632 384
334 3300025949 Ga0207667_10013061 Ga0207667_100130613 384
335 3300025949 Ga0207667_10032974 Ga0207667_100329745 384
336 3300025960 Ga0207651_10005237 Ga0207651_100052377 384
337 3300025972 Ga0207668_10138803 Ga0207668_101388032 384
338 3300025981 Ga0207640_10004386 Ga0207640_1000438610 384
339 3300025981 Ga0207640_10043987 Ga0207640_100439872 384
340 3300025986 Ga0207658_10048214 Ga0207658_100482142 384
341 3300026023 Ga0207677_10010021 Ga0207677_100100216 384
342 3300026041 Ga0207639_10000900 Ga0207639_100009002 384
343 3300026041 Ga0207639_10010476 Ga0207639_100104762 384
344 3300026088 Ga0207641_10005615 Ga0207641_1000561510 384
345 3300026089 Ga0207648_10001054 Ga0207648_1000105429 384
346 3300026089 Ga0207648_10093428 Ga0207648_100934282 384
347 3300026095 Ga0207676_10002351 Ga0207676_100023519 384
348 3300026116 Ga0207674_10008398 Ga0207674_100083989 384
349 3300026142 Ga0207698_10007072 Ga0207698_100070724 384
350 3300026142 Ga0207698_10127682 Ga0207698_101276821 384
351 3300028381 Ga0268264_10027334 Ga0268264_100273344 384
352 3300028381 Ga0268264_10085211 Ga0268264_100852112 384
353 3300028577 Ga0265318_10000082 Ga0265318_1000008232 384
354 3300031251 Ga0265327_10027971 Ga0265327_100279711 384
355 3300031344 Ga0265316_10015406 Ga0265316_100154067 384
356 3300031548 Ga0307408_100098883 Ga0307408_1000988831 384
357 3300031911 Ga0307412_10000374 Ga0307412_100003749 384
358 3300038735 Ga0400485_08616 Ga0400485_08616_125_1501 384
359 3300047472 Ga0495686_0000183 Ga0495686_0000183_465_1868 384
360 3300047472 Ga0495686_0004545 Ga0495686_0004545_168_1571 384
361 3300053153 Ga0500616_0003288 Ga0500616_0003288_3569_4948 384
362 3300001904 JGI24736J21556_1005976 JGI24736J21556_10059762 385
363 3300001989 JGI24739J22299_10017599 JGI24739J22299_100175992 385
364 3300001990 JGI24737J22298_10021532 JGI24737J22298_100215322 385
365 3300002067 JGI24735J21928_10013115 JGI24735J21928_100131152 385
366 3300002075 JGI24738J21930_10003885 JGI24738J21930_100038854 385
367 3300005289 Ga0065704_10070144 Ga0065704_1007014428 385
368 3300005329 Ga0070683_100045583 Ga0070683_1000455834 385
369 3300005331 Ga0070670_100093141 Ga0070670_1000931411 385
370 3300005364 Ga0070673_100107412 Ga0070673_1001074122 385
371 3300005365 Ga0070688_100005327 Ga0070688_1000053274 385
372 3300005365 Ga0070688_100066020 Ga0070688_1000660202 385
373 3300005367 Ga0070667_100144561 Ga0070667_1001445612 385
374 3300005434 Ga0070709_10034288 Ga0070709_100342883 385
375 3300005435 Ga0070714_100073452 Ga0070714_1000734522 385
376 3300005436 Ga0070713_100003318 Ga0070713_1000033181 385
377 3300005457 Ga0070662_100007446 Ga0070662_1000074463 385
378 3300005466 Ga0070685_10005245 Ga0070685_100052452 385
379 3300005548 Ga0070665_100000054 Ga0070665_10000005441 385
380 3300005548 Ga0070665_100059814 Ga0070665_1000598143 385
381 3300005578 Ga0068854_100050557 Ga0068854_1000505572 385
382 3300005616 Ga0068852_100058577 Ga0068852_1000585772 385
383 3300005843 Ga0068860_100067735 Ga0068860_1000677353 385
384 3300006173 Ga0070716_100024180 Ga0070716_1000241802 385
385 3300013102 Ga0157371_10168165 Ga0157371_101681651 385
386 3300013307 Ga0157372_10184094 Ga0157372_101840942 385
387 3300014968 Ga0157379_10144174 Ga0157379_101441742 385
388 3300017792 Ga0163161_10085643 Ga0163161_100856432 385
389 3300025901 Ga0207688_10035283 Ga0207688_100352832 385
390 3300025904 Ga0207647_10072387 Ga0207647_100723872 385
391 3300025906 Ga0207699_10022097 Ga0207699_100220974 385
392 3300025915 Ga0207693_10124383 Ga0207693_101243832 385
393 3300025919 Ga0207657_10044858 Ga0207657_100448582 385
394 3300025925 Ga0207650_10089693 Ga0207650_100896932 385
395 3300025933 Ga0207706_10037729 Ga0207706_100377293 385
396 3300025981 Ga0207640_10047087 Ga0207640_100470872 385
397 3300025986 Ga0207658_10191654 Ga0207658_101916542 385
398 3300026118 Ga0207675_100253903 Ga0207675_1002539031 385
399 3300028379 Ga0268266_10000134 Ga0268266_1000013489 385
400 3300031852 Ga0307410_10176679 Ga0307410_101766792 385
401 3300035692 Ga0373935_0023197 Ga0373935_0023197_36_1472 385
402 3300036712 Ga0316584_0065251 Ga0316584_0065251_866_2287 385
403 3300037418 Ga0395900_0007827 Ga0395900_0007827_4612_6015 385
404 3300037418 Ga0395900_0019728 Ga0395900_0019728_4301_5722 385
405 3300037471 Ga0395905_0003695 Ga0395905_0003695_8434_9855 385
406 3300038443 Ga0395901_0010819 Ga0395901_0010819_1151_2572 385
407 3300041462 Ga0451806_029968 Ga0451806_029968_878_2305 385
408 3300044719 Ga0466971_0002841 Ga0466971_0002841_663_2078 385
409 3300046684 Ga0495669_0000197 Ga0495669_0000197_464_1876 385
410 3300048914 Ga0496111_0056889 Ga0496111_0056889_865_2190 385
411 3300048916 Ga0496113_0058301 Ga0496113_0058301_1371_2696 385
412 3300049581 Ga0501047_0198693 Ga0501047_0198693_207_1574 385
413 3300049588 Ga0501072_0128104 Ga0501072_0128104_41_1408 385
414 3300053079 Ga0500610_0000162 Ga0500610_0000162_7579_8991 385
415 3300053121 Ga0500607_002571 Ga0500607_002571_2829_4277 385
416 3300053157 Ga0500624_000015 Ga0500624_000015_41517_42896 385
417 3300053730 Ga0500645_000011 Ga0500645_000011_129235_130647 385
418 3300005329 Ga0070683_100106807 Ga0070683_1001068072 386
419 3300005544 Ga0070686_100000391 Ga0070686_10000039114 386
420 3300005548 Ga0070665_100149834 Ga0070665_1001498342 386
421 3300005617 Ga0068859_100065198 Ga0068859_1000651982 386
422 3300005842 Ga0068858_100005919 Ga0068858_1000059192 386
423 3300005843 Ga0068860_100004238 Ga0068860_1000042385 386
424 3300006931 Ga0097620_100065197 Ga0097620_1000651974 386
425 3300009177 Ga0105248_10000021 Ga0105248_10000021191 386
426 3300009545 Ga0105237_10039448 Ga0105237_100394484 386
427 3300013307 Ga0157372_10112403 Ga0157372_101124032 386
428 3300025254 Ga0209148_1006624 Ga0209148_10066242 386
429 3300025272 Ga0209455_1000805 Ga0209455_100080513 386
430 3300025904 Ga0207647_10004468 Ga0207647_100044685 386
431 3300025909 Ga0207705_10007554 Ga0207705_100075546 386
432 3300025914 Ga0207671_10061993 Ga0207671_100619932 386
433 3300025941 Ga0207711_10000025 Ga0207711_10000025105 386
434 3300025986 Ga0207658_10001309 Ga0207658_1000130918 386
435 3300026041 Ga0207639_10013176 Ga0207639_100131764 386
436 3300026067 Ga0207678_10001001 Ga0207678_100010013 386
437 3300028379 Ga0268266_10057356 Ga0268266_100573562 386
438 3300031548 Ga0307408_100036325 Ga0307408_1000363252 386
439 3300031731 Ga0307405_10177112 Ga0307405_101771121 386
440 3300031824 Ga0307413_10069395 Ga0307413_100693952 386
441 3300031852 Ga0307410_10098835 Ga0307410_100988352 386
442 3300031852 Ga0307410_10127893 Ga0307410_101278932 386
443 3300031995 Ga0307409_100122213 Ga0307409_1001222132 386
444 3300031995 Ga0307409_100133511 Ga0307409_1001335112 386
445 3300032005 Ga0307411_10116641 Ga0307411_101166412 386
446 3300032005 Ga0307411_10161955 Ga0307411_101619552 386
447 3300032126 Ga0307415_100041953 Ga0307415_1000419534 386
448 3300032126 Ga0307415_100071835 Ga0307415_1000718353 386
449 3300037312 Ga0395899_0011515 Ga0395899_0011515_1445_2878 386
450 3300037466 Ga0395898_0060826 Ga0395898_0060826_1032_2465 386
451 3300037471 Ga0395905_0008536 Ga0395905_0008536_7226_8659 386
452 3300038443 Ga0395901_0015936 Ga0395901_0015936_4851_6284 386
453 3300041460 Ga0451802_0873263 Ga0451802_0873263_868_2295 386
454 3300046538 Ga0495609_0029562 Ga0495609_0029562_69_1454 386
455 3300046539 Ga0495621_0010519 Ga0495621_0010519_667_2076 386
456 3300046616 Ga0495668_0000007 Ga0495668_0000007_37540_38958 386
457 3300047323 Ga0495683_0009083 Ga0495683_0009083_213_1625 386
458 3300048921 Ga0496118_0000580 Ga0496118_0000580_19750_21168 386
459 3300048924 Ga0496121_0001577 Ga0496121_0001577_20544_21962 386
460 3300048927 Ga0496124_0000626 Ga0496124_0000626_19758_21176 386
461 3300048929 Ga0496126_0000752 Ga0496126_0000752_19769_21187 386
462 3300049571 Ga0501034_0294401 Ga0501034_0294401_83_1492 386
463 3300049663 Ga0501223_010649 Ga0501223_010649_482_1837 386
464 3300053130 Ga0500642_0000216 Ga0500642_0000216_20414_21826 386
465 3300001904 JGI24736J21556_1000061 JGI24736J21556_10000615 387
466 3300003762 Ga0055542_1000020 Ga0055542_1000020313 387
467 3300003763 Ga0055529_1000016 Ga0055529_100001633 387
468 3300005327 Ga0070658_10038672 Ga0070658_100386724 387
469 3300005328 Ga0070676_10000161 Ga0070676_1000016127 387
470 3300005335 Ga0070666_10023999 Ga0070666_100239994 387
471 3300005335 Ga0070666_10165810 Ga0070666_101658101 387
472 3300005338 Ga0068868_100000057 Ga0068868_1000000574 387
473 3300005338 Ga0068868_100014478 Ga0068868_1000144786 387
474 3300005338 Ga0068868_100030497 Ga0068868_1000304974 387
475 3300005354 Ga0070675_100098188 Ga0070675_1000981882 387
476 3300005355 Ga0070671_100000417 Ga0070671_10000041720 387
477 3300005356 Ga0070674_100013649 Ga0070674_1000136492 387
478 3300005364 Ga0070673_100000005 Ga0070673_1000000054 387
479 3300005364 Ga0070673_100086280 Ga0070673_1000862802 387
480 3300005441 Ga0070700_100012084 Ga0070700_1000120841 387
481 3300005455 Ga0070663_100024987 Ga0070663_1000249872 387
482 3300005456 Ga0070678_100012498 Ga0070678_1000124982 387
483 3300005456 Ga0070678_100017201 Ga0070678_1000172012 387
484 3300005457 Ga0070662_100003549 Ga0070662_1000035494 387
485 3300005459 Ga0068867_100000071 Ga0068867_10000007166 387
486 3300005539 Ga0068853_100065156 Ga0068853_1000651562 387
487 3300005543 Ga0070672_100054587 Ga0070672_1000545874 387
488 3300005548 Ga0070665_100017292 Ga0070665_1000172925 387
489 3300005563 Ga0068855_100207208 Ga0068855_1002072082 387
490 3300005564 Ga0070664_100058763 Ga0070664_1000587634 387
491 3300005577 Ga0068857_100039835 Ga0068857_1000398352 387
492 3300005618 Ga0068864_100001467 Ga0068864_10000146711 387
493 3300005834 Ga0068851_10011719 Ga0068851_100117192 387
494 3300006237 Ga0097621_100175868 Ga0097621_1001758682 387
495 3300006881 Ga0068865_100000032 Ga0068865_10000003294 387
496 3300006881 Ga0068865_100017121 Ga0068865_1000171214 387
497 3300009098 Ga0105245_10011486 Ga0105245_100114862 387
498 3300009148 Ga0105243_10002022 Ga0105243_1000202215 387
499 3300009176 Ga0105242_10023742 Ga0105242_100237425 387
500 3300009545 Ga0105237_10052555 Ga0105237_100525554 387
501 3300009551 Ga0105238_10116002 Ga0105238_101160022 387
502 3300009553 Ga0105249_10063277 Ga0105249_100632773 387
503 3300010375 Ga0105239_10180205 Ga0105239_101802052 387
504 3300010375 Ga0105239_10312912 Ga0105239_103129122 387
505 3300013104 Ga0157370_10008221 Ga0157370_100082219 387
506 3300013296 Ga0157374_10001126 Ga0157374_1000112622 387
507 3300013297 Ga0157378_10002231 Ga0157378_1000223115 387
508 3300013308 Ga0157375_10003871 Ga0157375_100038714 387
509 3300013308 Ga0157375_10045249 Ga0157375_100452492 387
510 3300014325 Ga0163163_10070184 Ga0163163_100701844 387
511 3300014325 Ga0163163_10172931 Ga0163163_101729312 387
512 3300014968 Ga0157379_10184998 Ga0157379_101849982 387
513 3300014969 Ga0157376_10000450 Ga0157376_100004504 387
514 3300021358 Ga0213873_10000008 Ga0213873_1000000831 387
515 3300021384 Ga0213876_10000005 Ga0213876_10000005573 387
516 3300021388 Ga0213875_10000255 Ga0213875_1000025513 387
517 3300025254 Ga0209148_1000017 Ga0209148_1000017714 387
518 3300025272 Ga0209455_1000005 Ga0209455_1000005714 387
519 3300025321 Ga0207656_10020794 Ga0207656_100207941 387
520 3300025899 Ga0207642_10011259 Ga0207642_100112592 387
521 3300025903 Ga0207680_10033612 Ga0207680_100336122 387
522 3300025903 Ga0207680_10066589 Ga0207680_100665892 387
523 3300025904 Ga0207647_10001723 Ga0207647_100017234 387
524 3300025907 Ga0207645_10000752 Ga0207645_100007524 387
525 3300025908 Ga0207643_10105621 Ga0207643_101056212 387
526 3300025909 Ga0207705_10019604 Ga0207705_100196042 387
527 3300025911 Ga0207654_10001804 Ga0207654_1000180413 387
528 3300025913 Ga0207695_10001926 Ga0207695_1000192624 387
529 3300025914 Ga0207671_10000319 Ga0207671_1000031913 387
530 3300025919 Ga0207657_10044280 Ga0207657_100442802 387
531 3300025920 Ga0207649_10063032 Ga0207649_100630322 387
532 3300025931 Ga0207644_10003327 Ga0207644_100033274 387
533 3300025931 Ga0207644_10003793 Ga0207644_100037939 387
534 3300025933 Ga0207706_10000467 Ga0207706_100004676 387
535 3300025933 Ga0207706_10006309 Ga0207706_1000630913 387
536 3300025933 Ga0207706_10079586 Ga0207706_100795863 387
537 3300025934 Ga0207686_10000786 Ga0207686_100007862 387
538 3300025935 Ga0207709_10015486 Ga0207709_100154862 387
539 3300025936 Ga0207670_10095331 Ga0207670_100953312 387
540 3300025938 Ga0207704_10000034 Ga0207704_100000344 387
541 3300025940 Ga0207691_10004027 Ga0207691_100040274 387
542 3300025940 Ga0207691_10006974 Ga0207691_100069749 387
543 3300025941 Ga0207711_10008775 Ga0207711_1000877510 387
544 3300025941 Ga0207711_10010771 Ga0207711_100107715 387
545 3300025942 Ga0207689_10008282 Ga0207689_100082826 387
546 3300025945 Ga0207679_10040346 Ga0207679_100403464 387
547 3300025949 Ga0207667_10003607 Ga0207667_100036074 387
548 3300025960 Ga0207651_10000010 Ga0207651_100000104 387
549 3300025960 Ga0207651_10003802 Ga0207651_100038028 387
550 3300025961 Ga0207712_10015887 Ga0207712_100158872 387
551 3300025986 Ga0207658_10006176 Ga0207658_100061769 387
552 3300026023 Ga0207677_10000296 Ga0207677_100002964 387
553 3300026078 Ga0207702_10002452 Ga0207702_100024524 387
554 3300026088 Ga0207641_10037383 Ga0207641_100373833 387
555 3300026088 Ga0207641_10118276 Ga0207641_101182762 387
556 3300026089 Ga0207648_10000219 Ga0207648_1000021965 387
557 3300026095 Ga0207676_10027960 Ga0207676_100279603 387
558 3300026116 Ga0207674_10012203 Ga0207674_100122032 387
559 3300026121 Ga0207683_10002743 Ga0207683_1000274312 387
560 3300026121 Ga0207683_10005377 Ga0207683_100053779 387
561 3300026142 Ga0207698_10002806 Ga0207698_100028068 387
562 3300028379 Ga0268266_10020415 Ga0268266_100204155 387
563 3300032005 Ga0307411_10128550 Ga0307411_101285502 387
564 3300033180 Ga0307510_10065528 Ga0307510_100655283 387
565 3300035207 Ga0373942_0012916 Ga0373942_0012916_145_1560 387
566 3300037853 Ga0436364_0167314 Ga0436364_0167314_85674_87116 387
567 3300039437 Ga0436365_1476024 Ga0436365_1476024_9201_10688 387
568 3300046453 Ga0495627_000099 Ga0495627_000099_70168_71559 387
569 3300046471 Ga0495650_0005633 Ga0495650_0005633_4218_5609 387
570 3300046660 Ga0495625_0000167 Ga0495625_0000167_83087_84514 387
571 3300047470 Ga0495681_0000020 Ga0495681_0000020_76843_78234 387
572 3300048904 Ga0496101_0043134 Ga0496101_0043134_333_1748 387
573 3300048911 Ga0496108_0037630 Ga0496108_0037630_64_1479 387
574 3300048912 Ga0496109_0007378 Ga0496109_0007378_2134_3561 387
575 3300048914 Ga0496111_0061362 Ga0496111_0061362_139_1554 387
576 3300048916 Ga0496113_0021888 Ga0496113_0021888_218_1633 387
577 3300049582 Ga0501048_0101509 Ga0501048_0101509_118_1602 387
578 3300049586 Ga0501070_0111914 Ga0501070_0111914_825_2246 387
579 3300053087 Ga0500643_000139 Ga0500643_000139_61682_63052 387
580 3300001976 JGI24752J21851_1000440 JGI24752J21851_10004402 388
581 3300001989 JGI24739J22299_10006097 JGI24739J22299_100060974 388
582 3300002077 JGI24744J21845_10000093 JGI24744J21845_1000009314 388
583 3300003215 JGI25153J46596_10003116 JGI25153J46596_100031162 388
584 3300005327 Ga0070658_10000697 Ga0070658_1000069715 388
585 3300005331 Ga0070670_100000075 Ga0070670_100000075107 388
586 3300005338 Ga0068868_100000243 Ga0068868_10000024331 388
587 3300005338 Ga0068868_100036403 Ga0068868_1000364035 388
588 3300005364 Ga0070673_100066813 Ga0070673_1000668132 388
589 3300005367 Ga0070667_100000039 Ga0070667_10000003981 388
590 3300005367 Ga0070667_100022938 Ga0070667_1000229382 388
591 3300005548 Ga0070665_100090453 Ga0070665_1000904533 388
592 3300005564 Ga0070664_100020950 Ga0070664_1000209504 388
593 3300005578 Ga0068854_100115397 Ga0068854_1001153972 388
594 3300005616 Ga0068852_100057861 Ga0068852_1000578612 388
595 3300005618 Ga0068864_100000016 Ga0068864_100000016222 388
596 3300005718 Ga0068866_10055450 Ga0068866_100554502 388
597 3300005840 Ga0068870_10042109 Ga0068870_100421092 388
598 3300005841 Ga0068863_100000033 Ga0068863_10000003375 388
599 3300005842 Ga0068858_100000977 Ga0068858_10000097719 388
600 3300005844 Ga0068862_100000040 Ga0068862_10000004074 388
601 3300005937 Ga0081455_10000576 Ga0081455_1000057638 388
602 3300006358 Ga0068871_100076831 Ga0068871_1000768312 388
603 3300006358 Ga0068871_100146579 Ga0068871_1001465792 388
604 3300009011 Ga0105251_10000611 Ga0105251_1000061121 388
605 3300009177 Ga0105248_10011775 Ga0105248_100117752 388
606 3300014968 Ga0157379_10102280 Ga0157379_101022802 388
607 3300025297 Ga0209758_1000013 Ga0209758_1000013449 388
608 3300025735 Ga0207713_1004227 Ga0207713_10042277 388
609 3300025899 Ga0207642_10041018 Ga0207642_100410182 388
610 3300025903 Ga0207680_10004017 Ga0207680_100040173 388
611 3300025909 Ga0207705_10000220 Ga0207705_1000022034 388
612 3300025925 Ga0207650_10000069 Ga0207650_10000069147 388
613 3300025931 Ga0207644_10044941 Ga0207644_100449412 388
614 3300025941 Ga0207711_10001558 Ga0207711_1000155821 388
615 3300025945 Ga0207679_10073009 Ga0207679_100730092 388
616 3300025949 Ga0207667_10117773 Ga0207667_101177732 388
617 3300025960 Ga0207651_10001964 Ga0207651_1000196411 388
618 3300025981 Ga0207640_10026704 Ga0207640_100267042 388
619 3300025986 Ga0207658_10024158 Ga0207658_100241585 388
620 3300025986 Ga0207658_10161927 Ga0207658_101619272 388
621 3300026023 Ga0207677_10000463 Ga0207677_1000046311 388
622 3300026023 Ga0207677_10001247 Ga0207677_100012476 388
623 3300026023 Ga0207677_10056978 Ga0207677_100569782 388
624 3300026035 Ga0207703_10003893 Ga0207703_100038938 388
625 3300026088 Ga0207641_10000002 Ga0207641_1000000274 388
626 3300026089 Ga0207648_10051229 Ga0207648_100512294 388
627 3300026095 Ga0207676_10000353 Ga0207676_1000035324 388
628 3300026121 Ga0207683_10007088 Ga0207683_1000708810 388
629 3300028380 Ga0268265_10000003 Ga0268265_10000003917 388
630 3300028786 Ga0307517_10055456 Ga0307517_100554562 388
631 3300032004 Ga0307414_10144385 Ga0307414_101443852 388
632 3300037471 Ga0395905_0232770 Ga0395905_0232770_72_1535 388
633 3300038443 Ga0395901_0050792 Ga0395901_0050792_485_1891 388
634 3300045976 Ga0466967_0049956 Ga0466967_0049956_145_1542 388
635 3300048907 Ga0496104_0005699 Ga0496104_0005699_7266_8633 388
636 3300048912 Ga0496109_0006531 Ga0496109_0006531_1969_3336 388
637 3300048913 Ga0496110_0006847 Ga0496110_0006847_1074_2441 388
638 3300048915 Ga0496112_0007303 Ga0496112_0007303_6796_8163 388
639 3300048920 Ga0496117_0008225 Ga0496117_0008225_2858_4288 388
640 3300048921 Ga0496118_0001409 Ga0496118_0001409_26355_27785 388
641 3300049460 Ga0495682_0003063 Ga0495682_0003063_5387_6790 388
642 3300053087 Ga0500643_002544 Ga0500643_002544_7183_8559 388
643 3300000549 LJQas_1002470 LJQas_10024701 389
644 3300005329 Ga0070683_100045628 Ga0070683_1000456284 389
645 3300005339 Ga0070660_100001249 Ga0070660_10000124916 389
646 3300005339 Ga0070660_100081326 Ga0070660_1000813262 389
647 3300005353 Ga0070669_100088766 Ga0070669_1000887662 389
648 3300005354 Ga0070675_100172190 Ga0070675_1001721901 389
649 3300005355 Ga0070671_100062526 Ga0070671_1000625263 389
650 3300005366 Ga0070659_100000419 Ga0070659_10000041918 389
651 3300005459 Ga0068867_100054464 Ga0068867_1000544642 389
652 3300005518 Ga0070699_100064715 Ga0070699_1000647152 389
653 3300005535 Ga0070684_100033071 Ga0070684_1000330713 389
654 3300005535 Ga0070684_100161239 Ga0070684_1001612392 389
655 3300005614 Ga0068856_100029789 Ga0068856_1000297896 389
656 3300005618 Ga0068864_100088509 Ga0068864_1000885092 389
657 3300005842 Ga0068858_100021748 Ga0068858_1000217484 389
658 3300006881 Ga0068865_100039658 Ga0068865_1000396583 389
659 3300009093 Ga0105240_10272051 Ga0105240_102720512 389
660 3300014968 Ga0157379_10000978 Ga0157379_100009784 389
661 3300025261 Ga0209233_1015521 Ga0209233_10155212 389
662 3300025919 Ga0207657_10003399 Ga0207657_100033992 389
663 3300025919 Ga0207657_10023725 Ga0207657_100237256 389
664 3300025931 Ga0207644_10031561 Ga0207644_100315612 389
665 3300025932 Ga0207690_10000001 Ga0207690_10000001231 389
666 3300025932 Ga0207690_10000002 Ga0207690_10000002231 389
667 3300025932 Ga0207690_10000003 Ga0207690_10000003231 389
668 3300025932 Ga0207690_10000004 Ga0207690_10000004231 389
669 3300025941 Ga0207711_10165356 Ga0207711_101653562 389
670 3300025944 Ga0207661_10158115 Ga0207661_101581152 389
671 3300025960 Ga0207651_10063275 Ga0207651_100632753 389
672 3300026067 Ga0207678_10000804 Ga0207678_1000080416 389
673 3300026078 Ga0207702_10011216 Ga0207702_100112168 389
674 3300027363 Ga0209700_100281 Ga0209700_10028122 389
675 3300031548 Ga0307408_100009847 Ga0307408_1000098475 389
676 3300031731 Ga0307405_10003202 Ga0307405_100032025 389
677 3300031852 Ga0307410_10122370 Ga0307410_101223702 389
678 3300031901 Ga0307406_10006067 Ga0307406_100060676 389
679 3300031903 Ga0307407_10136115 Ga0307407_101361151 389
680 3300031911 Ga0307412_10005338 Ga0307412_100053387 389
681 3300031995 Ga0307409_100015591 Ga0307409_1000155912 389
682 3300032002 Ga0307416_100169980 Ga0307416_1001699802 389
683 3300032004 Ga0307414_10006194 Ga0307414_100061949 389
684 3300032126 Ga0307415_100045864 Ga0307415_1000458642 389
685 3300037471 Ga0395905_0029866 Ga0395905_0029866_745_2166 389
686 3300048926 Ga0496123_0002266 Ga0496123_0002266_608_2002 389
687 3300049570 Ga0501033_0097866 Ga0501033_0097866_674_2086 389
688 3300049741 Ga0501079_0133615 Ga0501079_0133615_396_1781 389
689 3300049822 Ga0501035_0105355 Ga0501035_0105355_67_1470 389
690 3300049823 Ga0501044_0044176 Ga0501044_0044176_271_1656 389
691 3300053087 Ga0500643_002518 Ga0500643_002518_5458_6867 389
692 iso_pu_bacteria 2922185730 2922189011 389
693 3300005295 Ga0065707_10081972 Ga0065707_1008197227 390
694 3300005366 Ga0070659_100086615 Ga0070659_1000866152 390
695 3300005548 Ga0070665_100000162 Ga0070665_10000016251 390
696 3300005563 Ga0068855_100040811 Ga0068855_1000408112 390
697 3300005617 Ga0068859_100052236 Ga0068859_1000522363 390
698 3300005841 Ga0068863_100025799 Ga0068863_1000257996 390
699 3300006931 Ga0097620_100052236 Ga0097620_1000522363 390
700 3300009101 Ga0105247_10040387 Ga0105247_100403872 390
701 3300009551 Ga0105238_10027942 Ga0105238_100279422 390
702 3300010375 Ga0105239_10246433 Ga0105239_102464332 390
703 3300013104 Ga0157370_10255724 Ga0157370_102557242 390
704 3300014326 Ga0157380_10003970 Ga0157380_100039704 390
705 3300025909 Ga0207705_10004969 Ga0207705_100049698 390
706 3300025915 Ga0207693_10098381 Ga0207693_100983812 390
707 3300025924 Ga0207694_10000014 Ga0207694_1000001410 390
708 3300025924 Ga0207694_10123295 Ga0207694_101232952 390
709 3300025940 Ga0207691_10009210 Ga0207691_100092105 390
710 3300025949 Ga0207667_10194697 Ga0207667_101946971 390
711 3300026088 Ga0207641_10072595 Ga0207641_100725952 390
712 3300028379 Ga0268266_10000969 Ga0268266_1000096927 390
713 3300028380 Ga0268265_10006540 Ga0268265_100065406 390
714 3300031241 Ga0265325_10001137 Ga0265325_1000113718 390
715 3300031730 Ga0307516_10035732 Ga0307516_100357323 390
716 3300035119 Ga0373956_0022669 Ga0373956_0022669_1040_2386 390
717 3300037312 Ga0395899_0034664 Ga0395899_0034664_1366_2799 390
718 3300037466 Ga0395898_0101842 Ga0395898_0101842_338_1771 390
719 3300037466 Ga0395898_0285462 Ga0395898_0285462_89_1549 390
720 3300037471 Ga0395905_0002090 Ga0395905_0002090_16240_17700 390
721 3300038443 Ga0395901_0001052 Ga0395901_0001052_13213_14673 390
722 3300038443 Ga0395901_0074178 Ga0395901_0074178_1102_2535 390
723 3300042157 Ga0439458_0001153 Ga0439458_0001153_1793_3214 390
724 3300042461 Ga0439460_0011315 Ga0439460_0011315_550_1974 390
725 3300044694 Ga0466963_0001409 Ga0466963_0001409_7397_8830 390
726 3300044765 Ga0466970_0009309 Ga0466970_0009309_1575_3002 390
727 3300045976 Ga0466967_0000368 Ga0466967_0000368_15728_17161 390
728 3300046530 Ga0495654_0001063 Ga0495654_0001063_10136_11503 390
729 3300047443 Ga0495687_001431 Ga0495687_001431_3562_4974 390
730 3300049571 Ga0501034_0001140 Ga0501034_0001140_14997_16400 390
731 3300049581 Ga0501047_0157663 Ga0501047_0157663_576_1976 390
732 3300049590 Ga0501074_0039011 Ga0501074_0039011_778_2211 390
733 3300053158 Ga0500627_0010238 Ga0500627_0010238_1282_2649 390
734 3300053730 Ga0500645_034318 Ga0500645_034318_51_1418 390
735 3300005356 Ga0070674_100001097 Ga0070674_1000010972 391
736 3300005366 Ga0070659_100100948 Ga0070659_1001009482 391
737 3300005539 Ga0068853_100020596 Ga0068853_1000205962 391
738 3300005578 Ga0068854_100001813 Ga0068854_10000181310 391
739 3300005843 Ga0068860_100090436 Ga0068860_1000904363 391
740 3300005937 Ga0081455_10072297 Ga0081455_100722972 391
741 3300006042 Ga0075368_10001864 Ga0075368_100018647 391
742 3300006042 Ga0075368_10005738 Ga0075368_100057383 391
743 3300006048 Ga0075363_100036864 Ga0075363_1000368642 391
744 3300009093 Ga0105240_10086945 Ga0105240_100869455 391
745 3300009093 Ga0105240_10257889 Ga0105240_102578892 391
746 3300009177 Ga0105248_10072285 Ga0105248_100722852 391
747 3300014968 Ga0157379_10170808 Ga0157379_101708082 391
748 3300025929 Ga0207664_10036241 Ga0207664_100362412 391
749 3300025937 Ga0207669_10005341 Ga0207669_100053412 391
750 3300025981 Ga0207640_10000330 Ga0207640_1000033013 391
751 3300026118 Ga0207675_100196210 Ga0207675_1001962102 391
752 3300027296 Ga0209389_1000132 Ga0209389_100013222 391
753 3300027361 Ga0209489_105021 Ga0209489_1050218 391
754 3300028381 Ga0268264_10101726 Ga0268264_101017263 391
755 3300031250 Ga0265331_10000003 Ga0265331_1000000326 391
756 3300031251 Ga0265327_10047844 Ga0265327_100478442 391
757 3300031595 Ga0265313_10021916 Ga0265313_100219161 391
758 3300036401 Ga0373937_0097257 Ga0373937_0097257_57_1445 391
759 3300037466 Ga0395898_0082522 Ga0395898_0082522_1177_2583 391
760 3300038443 Ga0395901_0068017 Ga0395901_0068017_288_1721 391
761 3300038443 Ga0395901_0109507 Ga0395901_0109507_343_1734 391
762 3300045976 Ga0466967_0136785 Ga0466967_0136785_772_2205 391
763 3300046472 Ga0495580_0137571 Ga0495580_0137571_20_1408 391
764 3300046522 Ga0495643_0009254 Ga0495643_0009254_4458_5852 391
765 3300046524 Ga0495648_0000698 Ga0495648_0000698_30054_31466 391
766 3300050489 nmdc:mga03683_2931_c1 nmdc:mga03683_2931_c1_3023_4354 391
767 3300050492 nmdc:mga0yw44_74214_c1 nmdc:mga0yw44_74214_c1_457_1818 391
768 3300050494 nmdc:mga06z11_1551_c1 nmdc:mga06z11_1551_c1_1924_3291 391
769 3300050495 nmdc:mga04h51_5929_c1 nmdc:mga04h51_5929_c1_366_1745 391
770 3300050513 nmdc:mga0rr50_159259_c1 nmdc:mga0rr50_159259_c1_20_1393 391
771 3300050515 nmdc:mga0a205_201816_c1 nmdc:mga0a205_201816_c1_51_1445 391
772 3300005333 Ga0070677_10000402 Ga0070677_100004028 392
773 3300005366 Ga0070659_100113191 Ga0070659_1001131912 392
774 3300005440 Ga0070705_100169627 Ga0070705_1001696271 392
775 3300005577 Ga0068857_100207839 Ga0068857_1002078392 392
776 3300005618 Ga0068864_100074327 Ga0068864_1000743273 392
777 3300005937 Ga0081455_10000100 Ga0081455_1000010059 392
778 3300006353 Ga0075370_10023608 Ga0075370_100236082 392
779 3300006844 Ga0075428_100072280 Ga0075428_1000722803 392
780 3300006846 Ga0075430_100095690 Ga0075430_1000956903 392
781 3300006871 Ga0075434_100264610 Ga0075434_1002646102 392
782 3300009094 Ga0111539_10405882 Ga0111539_104058821 392
783 3300009177 Ga0105248_10096669 Ga0105248_100966693 392
784 3300009551 Ga0105238_10165179 Ga0105238_101651792 392
785 3300009553 Ga0105249_10109180 Ga0105249_101091802 392
786 3300013100 Ga0157373_10042680 Ga0157373_100426804 392
787 3300013105 Ga0157369_10041099 Ga0157369_100410992 392
788 3300013307 Ga0157372_10096536 Ga0157372_100965362 392
789 3300025893 Ga0207682_10002692 Ga0207682_100026925 392
790 3300025933 Ga0207706_10005568 Ga0207706_1000556813 392
791 3300026035 Ga0207703_10001241 Ga0207703_1000124119 392
792 3300026041 Ga0207639_10008301 Ga0207639_100083014 392
793 3300026116 Ga0207674_10015326 Ga0207674_1001532610 392
794 3300026118 Ga0207675_100055806 Ga0207675_1000558063 392
795 3300032004 Ga0307414_10002439 Ga0307414_100024394 392
796 3300037312 Ga0395899_0103322 Ga0395899_0103322_519_1952 392
797 3300037418 Ga0395900_0091572 Ga0395900_0091572_50_1483 392
798 3300037466 Ga0395898_0058520 Ga0395898_0058520_403_1836 392
799 3300037471 Ga0395905_0009273 Ga0395905_0009273_324_1754 392
800 3300037471 Ga0395905_0145321 Ga0395905_0145321_529_1962 392
801 3300037471 Ga0395905_0167362 Ga0395905_0167362_529_1962 392
802 3300038443 Ga0395901_0066478 Ga0395901_0066478_774_2204 392
803 3300038443 Ga0395901_0214859 Ga0395901_0214859_50_1483 392
804 3300048924 Ga0496121_0000913 Ga0496121_0000913_43467_44873 392
805 3300049568 Ga0501031_0020439 Ga0501031_0020439_493_1884 392
806 3300049571 Ga0501034_0001254 Ga0501034_0001254_22013_23383 392
807 3300049571 Ga0501034_0015208 Ga0501034_0015208_5426_6817 392
808 3300049572 Ga0501036_0000436 Ga0501036_0000436_24703_26073 392
809 3300049572 Ga0501036_0009088 Ga0501036_0009088_730_2121 392
810 3300049574 Ga0501038_0138394 Ga0501038_0138394_12_1403 392
811 3300049575 Ga0501039_0022860 Ga0501039_0022860_2290_3681 392
812 3300049578 Ga0501042_0016431 Ga0501042_0016431_2207_3598 392
813 3300049579 Ga0501043_0000582 Ga0501043_0000582_18516_19886 392
814 3300049580 Ga0501046_0003122 Ga0501046_0003122_12623_14074 392
815 3300049580 Ga0501046_0025774 Ga0501046_0025774_1189_2580 392
816 3300049580 Ga0501046_0028567 Ga0501046_0028567_1054_2424 392
817 3300049581 Ga0501047_0000010 Ga0501047_0000010_35724_37094 392
818 3300049581 Ga0501047_0071636 Ga0501047_0071636_1687_3078 392
819 3300049582 Ga0501048_0001840 Ga0501048_0001840_3435_4826 392
820 3300049583 Ga0501067_0002732 Ga0501067_0002732_1392_2783 392
821 3300049584 Ga0501068_0008788 Ga0501068_0008788_387_1778 392
822 3300049585 Ga0501069_0002410 Ga0501069_0002410_7378_8769 392
823 3300049586 Ga0501070_0023329 Ga0501070_0023329_1428_2798 392
824 3300049589 Ga0501073_0017249 Ga0501073_0017249_1368_2759 392
825 3300049589 Ga0501073_0077099 Ga0501073_0077099_928_2298 392
826 3300049590 Ga0501074_0021121 Ga0501074_0021121_1235_2626 392
827 3300049741 Ga0501079_0025841 Ga0501079_0025841_434_1825 392
828 3300049742 Ga0501080_0000720 Ga0501080_0000720_5616_6986 392
829 3300049822 Ga0501035_0013874 Ga0501035_0013874_5424_6815 392
830 3300049823 Ga0501044_0001838 Ga0501044_0001838_12729_14099 392
831 3300053119 Ga0500595_000992 Ga0500595_000992_6645_8033 392
832 3300053122 Ga0500608_000128 Ga0500608_000128_14214_15587 392
833 3300053729 Ga0500625_000051 Ga0500625_000051_8157_9530 392
834 3300054114 Ga0501084_0001552 Ga0501084_0001552_4683_6074 392
835 3300060353 Ga0501082_0031067 Ga0501082_0031067_1977_3368 392
836 3300001979 JGI24740J21852_10011883 JGI24740J21852_100118834 393
837 3300002077 JGI24744J21845_10010944 JGI24744J21845_100109441 393
838 3300002244 JGI24742J22300_10001708 JGI24742J22300_100017081 393
839 3300005327 Ga0070658_10086584 Ga0070658_100865842 393
840 3300005328 Ga0070676_10020431 Ga0070676_100204312 393
841 3300005329 Ga0070683_100104886 Ga0070683_1001048862 393
842 3300005329 Ga0070683_100163504 Ga0070683_1001635042 393
843 3300005331 Ga0070670_100000485 Ga0070670_1000004858 393
844 3300005339 Ga0070660_100034582 Ga0070660_1000345822 393
845 3300005339 Ga0070660_100153366 Ga0070660_1001533662 393
846 3300005347 Ga0070668_100000362 Ga0070668_10000036217 393
847 3300005355 Ga0070671_100000546 Ga0070671_10000054619 393
848 3300005366 Ga0070659_100017785 Ga0070659_1000177852 393
849 3300005367 Ga0070667_100000055 Ga0070667_10000005587 393
850 3300005456 Ga0070678_100000174 Ga0070678_10000017417 393
851 3300005563 Ga0068855_100003700 Ga0068855_1000037004 393
852 3300005614 Ga0068856_100168378 Ga0068856_1001683781 393
853 3300005617 Ga0068859_100009694 Ga0068859_1000096942 393
854 3300005842 Ga0068858_100000208 Ga0068858_10000020844 393
855 3300005842 Ga0068858_100029161 Ga0068858_1000291612 393
856 3300005843 Ga0068860_100000090 Ga0068860_10000009088 393
857 3300005844 Ga0068862_100001580 Ga0068862_1000015806 393
858 3300006042 Ga0075368_10000192 Ga0075368_1000019217 393
859 3300006048 Ga0075363_100022728 Ga0075363_1000227282 393
860 3300006178 Ga0075367_10000053 Ga0075367_1000005317 393
861 3300006846 Ga0075430_100046259 Ga0075430_1000462592 393
862 3300006847 Ga0075431_100009509 Ga0075431_1000095099 393
863 3300006931 Ga0097620_100009695 Ga0097620_1000096952 393
864 3300009093 Ga0105240_10000830 Ga0105240_100008304 393
865 3300009147 Ga0114129_10030518 Ga0114129_100305189 393
866 3300009148 Ga0105243_10001461 Ga0105243_100014619 393
867 3300009545 Ga0105237_10025425 Ga0105237_100254254 393
868 3300009551 Ga0105238_10009040 Ga0105238_100090406 393
869 3300009551 Ga0105238_10044735 Ga0105238_100447354 393
870 3300011119 Ga0105246_10014477 Ga0105246_100144771 393
871 3300013102 Ga0157371_10000146 Ga0157371_1000014678 393
872 3300013105 Ga0157369_10006709 Ga0157369_1000670910 393
873 3300013307 Ga0157372_10240076 Ga0157372_102400762 393
874 3300014325 Ga0163163_10000002 Ga0163163_1000000215 393
875 3300025904 Ga0207647_10012809 Ga0207647_100128092 393
876 3300025904 Ga0207647_10081409 Ga0207647_100814092 393
877 3300025909 Ga0207705_10022112 Ga0207705_100221122 393
878 3300025912 Ga0207707_10068618 Ga0207707_100686182 393
879 3300025913 Ga0207695_10000004 Ga0207695_10000004950 393
880 3300025913 Ga0207695_10052314 Ga0207695_100523144 393
881 3300025919 Ga0207657_10006466 Ga0207657_100064665 393
882 3300025919 Ga0207657_10047601 Ga0207657_100476012 393
883 3300025920 Ga0207649_10038015 Ga0207649_100380152 393
884 3300025920 Ga0207649_10058222 Ga0207649_100582222 393
885 3300025923 Ga0207681_10005769 Ga0207681_100057696 393
886 3300025924 Ga0207694_10037722 Ga0207694_100377222 393
887 3300025924 Ga0207694_10113614 Ga0207694_101136142 393
888 3300025925 Ga0207650_10016144 Ga0207650_100161446 393
889 3300025931 Ga0207644_10000237 Ga0207644_1000023711 393
890 3300025933 Ga0207706_10034262 Ga0207706_100342624 393
891 3300025935 Ga0207709_10000031 Ga0207709_10000031293 393
892 3300025937 Ga0207669_10000057 Ga0207669_1000005714 393
893 3300025945 Ga0207679_10008866 Ga0207679_100088663 393
894 3300025949 Ga0207667_10000116 Ga0207667_1000011631 393
895 3300025949 Ga0207667_10031284 Ga0207667_100312844 393
896 3300025972 Ga0207668_10000048 Ga0207668_1000004833 393
897 3300025981 Ga0207640_10019950 Ga0207640_100199502 393
898 3300025986 Ga0207658_10000090 Ga0207658_1000009074 393
899 3300025986 Ga0207658_10119433 Ga0207658_101194332 393
900 3300026035 Ga0207703_10000765 Ga0207703_1000076526 393
901 3300026078 Ga0207702_10013495 Ga0207702_100134954 393
902 3300026088 Ga0207641_10007096 Ga0207641_1000709611 393
903 3300026121 Ga0207683_10001180 Ga0207683_1000118010 393
904 3300026142 Ga0207698_10040685 Ga0207698_100406852 393
905 3300027866 Ga0209813_10000119 Ga0209813_100001195 393
906 3300028379 Ga0268266_10109912 Ga0268266_101099121 393
907 3300028380 Ga0268265_10003680 Ga0268265_100036805 393
908 3300028381 Ga0268264_10000075 Ga0268264_1000007574 393
909 3300028794 Ga0307515_10236952 Ga0307515_102369522 393
910 3300031903 Ga0307407_10005186 Ga0307407_100051865 393
911 3300032004 Ga0307414_10104556 Ga0307414_101045562 393
912 3300032126 Ga0307415_100037453 Ga0307415_1000374534 393
913 3300035691 Ga0373931_0017709 Ga0373931_0017709_30_1412 393
914 3300037312 Ga0395899_0014844 Ga0395899_0014844_3319_4752 393
915 3300037312 Ga0395899_0026950 Ga0395899_0026950_2527_3960 393
916 3300037418 Ga0395900_0018477 Ga0395900_0018477_5330_6760 393
917 3300037418 Ga0395900_0043593 Ga0395900_0043593_1906_3303 393
918 3300037466 Ga0395898_0104593 Ga0395898_0104593_1193_2590 393
919 3300038443 Ga0395901_0019269 Ga0395901_0019269_3211_4641 393
920 3300038443 Ga0395901_0032654 Ga0395901_0032654_2621_4054 393
921 3300039110 Ga0400487_40677 Ga0400487_40677_163_1581 393
922 3300046506 Ga0495583_0000154 Ga0495583_0000154_79169_80599 393
923 3300046542 Ga0495597_0051332 Ga0495597_0051332_62_1459 393
924 3300048926 Ga0496123_0078284 Ga0496123_0078284_516_1934 393
925 3300049513 Ga0501290_000164 Ga0501290_000164_4069_5400 393
926 3300049570 Ga0501033_0052810 Ga0501033_0052810_138_1526 393
927 3300049570 Ga0501033_0065854 Ga0501033_0065854_99_1496 393
928 3300049572 Ga0501036_0026088 Ga0501036_0026088_2882_4255 393
929 3300049572 Ga0501036_0107278 Ga0501036_0107278_190_1584 393
930 3300049574 Ga0501038_0065954 Ga0501038_0065954_1483_2877 393
931 3300049576 Ga0501040_0003321 Ga0501040_0003321_6626_8020 393
932 3300049577 Ga0501041_0002432 Ga0501041_0002432_3977_5371 393
933 3300049579 Ga0501043_0114437 Ga0501043_0114437_467_1861 393
934 3300049581 Ga0501047_0043746 Ga0501047_0043746_1102_2499 393
935 3300049581 Ga0501047_0174553 Ga0501047_0174553_544_1917 393
936 3300049581 Ga0501047_0245622 Ga0501047_0245622_17_1417 393
937 3300049582 Ga0501048_0051843 Ga0501048_0051843_476_1870 393
938 3300049586 Ga0501070_0035259 Ga0501070_0035259_1578_2969 393
939 3300049587 Ga0501071_0063763 Ga0501071_0063763_1289_2656 393
940 3300049588 Ga0501072_0076902 Ga0501072_0076902_134_1528 393
941 3300049591 Ga0501075_0011925 Ga0501075_0011925_4283_5677 393
942 3300049592 Ga0501076_0070570 Ga0501076_0070570_392_1786 393
943 3300049593 Ga0501077_0014772 Ga0501077_0014772_249_1643 393
944 3300049662 Ga0501222_001812 Ga0501222_001812_794_2125 393
945 3300049663 Ga0501223_004615 Ga0501223_004615_1006_2337 393
946 3300049741 Ga0501079_0003578 Ga0501079_0003578_6316_7710 393
947 3300049742 Ga0501080_0089270 Ga0501080_0089270_1298_2692 393
948 3300049743 Ga0501081_0002653 Ga0501081_0002653_9053_10447 393
949 3300049776 Ga0501280_000062 Ga0501280_000062_20087_21418 393
950 3300049822 Ga0501035_0222984 Ga0501035_0222984_74_1465 393
951 3300049823 Ga0501044_0002391 Ga0501044_0002391_2818_4191 393
952 3300049823 Ga0501044_0168021 Ga0501044_0168021_84_1463 393
953 3300049824 Ga0501045_0028699 Ga0501045_0028699_726_2120 393
954 3300050494 nmdc:mga06z11_80_c1 nmdc:mga06z11_80_c1_9197_10564 393
955 3300050507 nmdc:mga05p37_101714_c1 nmdc:mga05p37_101714_c1_1699_3081 393
956 3300053091 Ga0500647_0050873 Ga0500647_0050873_494_1891 393
957 3300053125 Ga0500618_003360 Ga0500618_003360_329_1726 393
958 3300053148 Ga0500590_000159 Ga0500590_000159_9899_11296 393
959 3300053724 Ga0500570_000434 Ga0500570_000434_506_1903 393
960 3300054114 Ga0501084_0003821 Ga0501084_0003821_9228_10622 393
961 3300060353 Ga0501082_0085262 Ga0501082_0085262_938_2332 393
962 3300001979 JGI24740J21852_10024023 JGI24740J21852_100240232 394
963 3300005355 Ga0070671_100039152 Ga0070671_1000391525 394
964 3300005530 Ga0070679_100061243 Ga0070679_1000612432 394
965 3300005981 Ga0081538_10041055 Ga0081538_100410552 394
966 3300009098 Ga0105245_10043390 Ga0105245_100433902 394
967 3300009177 Ga0105248_10118831 Ga0105248_101188312 394
968 3300013105 Ga0157369_10173071 Ga0157369_101730713 394
969 3300014325 Ga0163163_10345417 Ga0163163_103454172 394
970 3300025292 Ga0209676_1001390 Ga0209676_100139012 394
971 3300025907 Ga0207645_10047020 Ga0207645_100470202 394
972 3300025921 Ga0207652_10007725 Ga0207652_100077257 394
973 3300025927 Ga0207687_10052020 Ga0207687_100520202 394
974 3300037418 Ga0395900_0000949 Ga0395900_0000949_29773_31170 394
975 3300037471 Ga0395905_0000523 Ga0395905_0000523_42239_43636 394
976 3300038443 Ga0395901_0003263 Ga0395901_0003263_10410_11807 394
977 3300038443 Ga0395901_0068935 Ga0395901_0068935_549_1964 394
978 3300048929 Ga0496126_0001896 Ga0496126_0001896_24011_25414 394
979 3300053723 Ga0500567_000941 Ga0500567_000941_2658_4031 394
980 3300005327 Ga0070658_10073518 Ga0070658_100735182 395
981 3300005338 Ga0068868_100052313 Ga0068868_1000523132 395
982 3300005339 Ga0070660_100002222 Ga0070660_1000022223 395
983 3300005344 Ga0070661_100014164 Ga0070661_1000141641 395
984 3300005364 Ga0070673_100005792 Ga0070673_1000057922 395
985 3300005367 Ga0070667_100000489 Ga0070667_1000004898 395
986 3300005530 Ga0070679_100155031 Ga0070679_1001550312 395
987 3300005535 Ga0070684_100010835 Ga0070684_1000108354 395
988 3300005539 Ga0068853_100001422 Ga0068853_10000142218 395
989 3300005563 Ga0068855_100004993 Ga0068855_1000049937 395
990 3300005616 Ga0068852_100102400 Ga0068852_1001024002 395
991 3300005842 Ga0068858_100167837 Ga0068858_1001678372 395
992 3300005843 Ga0068860_100059362 Ga0068860_1000593624 395
993 3300009176 Ga0105242_10124426 Ga0105242_101244262 395
994 3300013307 Ga0157372_10124360 Ga0157372_101243603 395
995 3300025893 Ga0207682_10044159 Ga0207682_100441592 395
996 3300025909 Ga0207705_10071265 Ga0207705_100712652 395
997 3300025917 Ga0207660_10121858 Ga0207660_101218581 395
998 3300025919 Ga0207657_10005267 Ga0207657_100052673 395
999 3300025919 Ga0207657_10050085 Ga0207657_100500853 395
1000 3300025933 Ga0207706_10012502 Ga0207706_100125027 395
1001 3300025941 Ga0207711_10031688 Ga0207711_100316884 395
1002 3300025949 Ga0207667_10012055 Ga0207667_100120555 395
1003 3300025986 Ga0207658_10001407 Ga0207658_100014075 395
1004 3300026023 Ga0207677_10075534 Ga0207677_100755342 395
1005 3300026041 Ga0207639_10042707 Ga0207639_100427072 395
1006 3300026067 Ga0207678_10040675 Ga0207678_100406754 395
1007 3300026095 Ga0207676_10124820 Ga0207676_101248202 395
1008 3300026142 Ga0207698_10087353 Ga0207698_100873533 395
1009 3300028381 Ga0268264_10044369 Ga0268264_100443692 395
1010 3300031711 Ga0265314_10014047 Ga0265314_100140477 395
1011 3300032133 Ga0316583_10022457 Ga0316583_100224572 395
1012 3300035692 Ga0373935_0007929 Ga0373935_0007929_4308_5756 395
1013 3300037068 Ga0373925_0002489 Ga0373925_0002489_4834_6282 395
1014 3300037853 Ga0436364_1421444 Ga0436364_1421444_239_1636 395
1015 3300046472 Ga0495580_0097080 Ga0495580_0097080_553_1995 395
1016 3300046683 Ga0495658_0000430 Ga0495658_0000430_17014_18456 395
1017 3300047471 Ga0495684_0066824 Ga0495684_0066824_140_1582 395
1018 3300048909 Ga0496106_0139556 Ga0496106_0139556_388_1779 395
1019 3300048928 Ga0496125_0054763 Ga0496125_0054763_205_1623 395
1020 3300049570 Ga0501033_0009129 Ga0501033_0009129_884_2263 395
1021 3300053104 Ga0500556_0000552 Ga0500556_0000552_14603_15991 395
1022 3300002459 JGI24751J29686_10000402 JGI24751J29686_1000040210 396
1023 3300005328 Ga0070676_10001990 Ga0070676_1000199012 396
1024 3300005329 Ga0070683_100058127 Ga0070683_1000581273 396
1025 3300005331 Ga0070670_100001146 Ga0070670_10000114619 396
1026 3300005333 Ga0070677_10000392 Ga0070677_1000039216 396
1027 3300005347 Ga0070668_100013222 Ga0070668_1000132222 396
1028 3300005353 Ga0070669_100002352 Ga0070669_10000235212 396
1029 3300005354 Ga0070675_100000876 Ga0070675_10000087620 396
1030 3300005355 Ga0070671_100030801 Ga0070671_1000308014 396
1031 3300005364 Ga0070673_100052402 Ga0070673_1000524024 396
1032 3300005457 Ga0070662_100001233 Ga0070662_1000012338 396
1033 3300005530 Ga0070679_100120983 Ga0070679_1001209832 396
1034 3300005548 Ga0070665_100008627 Ga0070665_1000086279 396
1035 3300005564 Ga0070664_100034660 Ga0070664_1000346604 396
1036 3300005617 Ga0068859_100015571 Ga0068859_1000155715 396
1037 3300005844 Ga0068862_100014334 Ga0068862_1000143347 396
1038 3300006931 Ga0097620_100015570 Ga0097620_1000155705 396
1039 3300009094 Ga0111539_10012292 Ga0111539_100122927 396
1040 3300009553 Ga0105249_10032770 Ga0105249_100327702 396
1041 3300012513 Ga0157326_1000640 Ga0157326_10006403 396
1042 3300014326 Ga0157380_10002753 Ga0157380_1000275310 396
1043 3300014326 Ga0157380_10006132 Ga0157380_100061324 396
1044 3300025229 Ga0209147_101318 Ga0209147_10131812 396
1045 3300025299 Ga0209256_1022021 Ga0209256_10220212 396
1046 3300025315 Ga0207697_10000845 Ga0207697_100008457 396
1047 3300025893 Ga0207682_10000389 Ga0207682_1000038919 396
1048 3300025915 Ga0207693_10130025 Ga0207693_101300252 396
1049 3300025923 Ga0207681_10003001 Ga0207681_100030015 396
1050 3300025925 Ga0207650_10000537 Ga0207650_100005373 396
1051 3300025925 Ga0207650_10008911 Ga0207650_100089116 396
1052 3300025926 Ga0207659_10006280 Ga0207659_100062802 396
1053 3300025933 Ga0207706_10000415 Ga0207706_1000041529 396
1054 3300025940 Ga0207691_10001641 Ga0207691_1000164110 396
1055 3300025945 Ga0207679_10009749 Ga0207679_100097494 396
1056 3300025960 Ga0207651_10073786 Ga0207651_100737863 396
1057 3300025961 Ga0207712_10064639 Ga0207712_100646392 396
1058 3300025972 Ga0207668_10000996 Ga0207668_100009965 396
1059 3300027907 Ga0207428_10036990 Ga0207428_100369903 396
1060 3300028380 Ga0268265_10026231 Ga0268265_100262312 396
1061 3300031728 Ga0316578_10051124 Ga0316578_100511242 396
1062 3300031730 Ga0307516_10213759 Ga0307516_102137592 396
1063 3300031824 Ga0307413_10015065 Ga0307413_100150652 396
1064 3300032005 Ga0307411_10013948 Ga0307411_100139484 396
1065 3300046460 Ga0495638_0000022 Ga0495638_0000022_134790_136172 396
1066 3300046500 Ga0495596_0029817 Ga0495596_0029817_166_1575 396
1067 3300046512 Ga0495610_0000018 Ga0495610_0000018_67686_69077 396
1068 3300046522 Ga0495643_0002795 Ga0495643_0002795_11466_12875 396
1069 3300046524 Ga0495648_0000051 Ga0495648_0000051_26331_27713 396
1070 3300046525 Ga0495663_0006387 Ga0495663_0006387_1715_3121 396
1071 3300046525 Ga0495663_0011684 Ga0495663_0011684_688_2094 396
1072 3300046538 Ga0495609_0039388 Ga0495609_0039388_207_1616 396
1073 3300046539 Ga0495621_0000635 Ga0495621_0000635_727_2133 396
1074 3300046660 Ga0495625_0091368 Ga0495625_0091368_543_1952 396
1075 3300046692 Ga0495671_0018156 Ga0495671_0018156_1296_2672 396
1076 3300049569 Ga0501032_0000064 Ga0501032_0000064_28718_30148 396
1077 3300049570 Ga0501033_0000286 Ga0501033_0000286_5279_6709 396
1078 3300049571 Ga0501034_0000174 Ga0501034_0000174_33312_34742 396
1079 3300049572 Ga0501036_0011420 Ga0501036_0011420_696_2126 396
1080 3300049573 Ga0501037_0009152 Ga0501037_0009152_5233_6663 396
1081 3300049574 Ga0501038_0000031 Ga0501038_0000031_121772_123202 396
1082 3300049575 Ga0501039_0000057 Ga0501039_0000057_26503_27933 396
1083 3300049579 Ga0501043_0000048 Ga0501043_0000048_33312_34742 396
1084 3300049581 Ga0501047_0153444 Ga0501047_0153444_101_1531 396
1085 3300049822 Ga0501035_0000118 Ga0501035_0000118_91034_92464 396
1086 3300049822 Ga0501035_0138136 Ga0501035_0138136_578_1990 396
1087 3300050512 nmdc:mga0n895_290334_c1 nmdc:mga0n895_290334_c1_144_1403 396
1088 3300053119 Ga0500595_001637 Ga0500595_001637_7041_8432 396
1089 3300053146 Ga0500588_0008049 Ga0500588_0008049_504_1895 396
1090 iso_pu_bacteria 2889914905 2889917068 396
1091 3300001915 JGI24741J21665_1007146 JGI24741J21665_10071462 397
1092 3300001990 JGI24737J22298_10026084 JGI24737J22298_100260842 397
1093 3300005293 Ga0065715_10107166 Ga0065715_101071662 397
1094 3300005327 Ga0070658_10059084 Ga0070658_100590842 397
1095 3300005329 Ga0070683_100017370 Ga0070683_1000173705 397
1096 3300005347 Ga0070668_100005096 Ga0070668_10000509611 397
1097 3300005354 Ga0070675_100000898 Ga0070675_1000008985 397
1098 3300005355 Ga0070671_100016073 Ga0070671_1000160733 397
1099 3300005457 Ga0070662_100005040 Ga0070662_10000504010 397
1100 3300005530 Ga0070679_100092236 Ga0070679_1000922362 397
1101 3300005563 Ga0068855_100051637 Ga0068855_1000516373 397
1102 3300009098 Ga0105245_10001293 Ga0105245_1000129326 397
1103 3300009177 Ga0105248_10012999 Ga0105248_100129999 397
1104 3300010375 Ga0105239_10002505 Ga0105239_1000250516 397
1105 3300011119 Ga0105246_10000103 Ga0105246_1000010320 397
1106 3300013104 Ga0157370_10110300 Ga0157370_101103002 397
1107 3300013307 Ga0157372_10048746 Ga0157372_100487466 397
1108 3300025904 Ga0207647_10052410 Ga0207647_100524103 397
1109 3300025904 Ga0207647_10094019 Ga0207647_100940192 397
1110 3300025909 Ga0207705_10063500 Ga0207705_100635003 397
1111 3300025919 Ga0207657_10001125 Ga0207657_1000112514 397
1112 3300025919 Ga0207657_10004423 Ga0207657_100044235 397
1113 3300025920 Ga0207649_10035944 Ga0207649_100359441 397
1114 3300025920 Ga0207649_10048348 Ga0207649_100483483 397
1115 3300025923 Ga0207681_10037753 Ga0207681_100377531 397
1116 3300025925 Ga0207650_10001068 Ga0207650_1000106819 397
1117 3300025926 Ga0207659_10009454 Ga0207659_100094545 397
1118 3300025927 Ga0207687_10064396 Ga0207687_100643962 397
1119 3300025931 Ga0207644_10032603 Ga0207644_100326033 397
1120 3300025932 Ga0207690_10067807 Ga0207690_100678072 397
1121 3300025932 Ga0207690_10132230 Ga0207690_101322301 397
1122 3300025933 Ga0207706_10011480 Ga0207706_1001148010 397
1123 3300025937 Ga0207669_10052903 Ga0207669_100529032 397
1124 3300025941 Ga0207711_10030082 Ga0207711_100300824 397
1125 3300025944 Ga0207661_10020018 Ga0207661_100200182 397
1126 3300025945 Ga0207679_10003483 Ga0207679_1000348313 397
1127 3300025949 Ga0207667_10217775 Ga0207667_102177751 397
1128 3300025960 Ga0207651_10004363 Ga0207651_100043634 397
1129 3300025972 Ga0207668_10004909 Ga0207668_100049094 397
1130 3300025981 Ga0207640_10022255 Ga0207640_100222553 397
1131 3300026041 Ga0207639_10047349 Ga0207639_100473493 397
1132 3300026078 Ga0207702_10046440 Ga0207702_100464402 397
1133 3300026116 Ga0207674_10006084 Ga0207674_100060842 397
1134 3300026116 Ga0207674_10070467 Ga0207674_100704672 397
1135 3300026142 Ga0207698_10004493 Ga0207698_100044935 397
1136 3300031901 Ga0307406_10025651 Ga0307406_100256512 397
1137 3300031911 Ga0307412_10134391 Ga0307412_101343911 397
1138 3300032126 Ga0307415_100059702 Ga0307415_1000597022 397
1139 3300035119 Ga0373956_0008339 Ga0373956_0008339_1910_3340 397
1140 3300035692 Ga0373935_0047460 Ga0373935_0047460_34_1464 397
1141 3300036401 Ga0373937_0008501 Ga0373937_0008501_7162_8592 397
1142 3300037312 Ga0395899_0036566 Ga0395899_0036566_1842_3275 397
1143 3300037312 Ga0395899_0074254 Ga0395899_0074254_949_2415 397
1144 3300037312 Ga0395899_0160654 Ga0395899_0160654_40_1491 397
1145 3300046453 Ga0495627_000234 Ga0495627_000234_55712_57076 397
1146 3300046471 Ga0495650_0000058 Ga0495650_0000058_194555_195973 397
1147 3300046506 Ga0495583_0000304 Ga0495583_0000304_76316_77698 397
1148 3300046506 Ga0495583_0000673 Ga0495583_0000673_40530_41948 397
1149 3300046558 Ga0495633_0013767 Ga0495633_0013767_2285_3703 397
1150 3300046692 Ga0495671_0000004 Ga0495671_0000004_323381_324763 397
1151 3300046809 Ga0495600_0001013 Ga0495600_0001013_3026_4444 397
1152 3300047469 Ga0495673_0000021 Ga0495673_0000021_323381_324763 397
1153 3300048911 Ga0496108_0045593 Ga0496108_0045593_446_1861 397
1154 3300048917 Ga0496114_0037140 Ga0496114_0037140_367_1782 397
1155 3300053140 Ga0500573_0000008 Ga0500573_0000008_71698_73062 397
1156 3300001989 JGI24739J22299_10001369 JGI24739J22299_100013694 398
1157 3300001989 JGI24739J22299_10023515 JGI24739J22299_100235152 398
1158 3300001990 JGI24737J22298_10001179 JGI24737J22298_100011794 398
1159 3300002075 JGI24738J21930_10000976 JGI24738J21930_100009764 398
1160 3300002773 JGI25152J39213_1000288 JGI25152J39213_100028819 398
1161 3300002774 JGI25150J39212_1000010 JGI25150J39212_100001041 398
1162 3300003187 JGI25151J46595_10000026 JGI25151J46595_1000002621 398
1163 3300003215 JGI25153J46596_10004834 JGI25153J46596_100048346 398
1164 3300005327 Ga0070658_10000590 Ga0070658_1000059019 398
1165 3300005327 Ga0070658_10075914 Ga0070658_100759142 398
1166 3300005329 Ga0070683_100007358 Ga0070683_10000735811 398
1167 3300005331 Ga0070670_100021134 Ga0070670_1000211342 398
1168 3300005331 Ga0070670_100112386 Ga0070670_1001123862 398
1169 3300005336 Ga0070680_100018696 Ga0070680_1000186962 398
1170 3300005337 Ga0070682_100009658 Ga0070682_1000096582 398
1171 3300005337 Ga0070682_100015590 Ga0070682_1000155904 398
1172 3300005339 Ga0070660_100000033 Ga0070660_10000003367 398
1173 3300005344 Ga0070661_100000547 Ga0070661_10000054718 398
1174 3300005344 Ga0070661_100000861 Ga0070661_10000086124 398
1175 3300005344 Ga0070661_100007139 Ga0070661_1000071395 398
1176 3300005353 Ga0070669_100056125 Ga0070669_1000561252 398
1177 3300005355 Ga0070671_100021733 Ga0070671_1000217335 398
1178 3300005366 Ga0070659_100000433 Ga0070659_10000043319 398
1179 3300005366 Ga0070659_100022094 Ga0070659_1000220942 398
1180 3300005366 Ga0070659_100091463 Ga0070659_1000914632 398
1181 3300005367 Ga0070667_100000197 Ga0070667_10000019746 398
1182 3300005434 Ga0070709_10002743 Ga0070709_100027438 398
1183 3300005436 Ga0070713_100000008 Ga0070713_10000000885 398
1184 3300005457 Ga0070662_100000522 Ga0070662_10000052219 398
1185 3300005458 Ga0070681_10030977 Ga0070681_100309772 398
1186 3300005539 Ga0068853_100022708 Ga0068853_1000227083 398
1187 3300005546 Ga0070696_100009154 Ga0070696_1000091544 398
1188 3300005547 Ga0070693_100003083 Ga0070693_1000030834 398
1189 3300005563 Ga0068855_100107154 Ga0068855_1001071543 398
1190 3300005563 Ga0068855_100132091 Ga0068855_1001320913 398
1191 3300005564 Ga0070664_100000822 Ga0070664_10000082219 398
1192 3300005577 Ga0068857_100007874 Ga0068857_1000078749 398
1193 3300005614 Ga0068856_100000572 Ga0068856_1000005723 398
1194 3300005614 Ga0068856_100001471 Ga0068856_10000147119 398
1195 3300005616 Ga0068852_100002763 Ga0068852_1000027635 398
1196 3300005617 Ga0068859_100055625 Ga0068859_1000556254 398
1197 3300005841 Ga0068863_100004110 Ga0068863_1000041102 398
1198 3300005842 Ga0068858_100051878 Ga0068858_1000518782 398
1199 3300005842 Ga0068858_100061205 Ga0068858_1000612052 398
1200 3300005843 Ga0068860_100000290 Ga0068860_10000029049 398
1201 3300006358 Ga0068871_100182171 Ga0068871_1001821711 398
1202 3300006914 Ga0075436_100000053 Ga0075436_10000005310 398
1203 3300006931 Ga0097620_100055626 Ga0097620_1000556264 398
1204 3300007076 Ga0075435_100017875 Ga0075435_1000178753 398
1205 3300009094 Ga0111539_10130136 Ga0111539_101301363 398
1206 3300009177 Ga0105248_10000182 Ga0105248_1000018259 398
1207 3300011119 Ga0105246_10061678 Ga0105246_100616782 398
1208 3300013100 Ga0157373_10024632 Ga0157373_100246325 398
1209 3300013100 Ga0157373_10047319 Ga0157373_100473192 398
1210 3300013102 Ga0157371_10001754 Ga0157371_1000175412 398
1211 3300014325 Ga0163163_10000058 Ga0163163_10000058103 398
1212 3300025245 Ga0207425_1000010 Ga0207425_1000010370 398
1213 3300025258 Ga0209129_1000099 Ga0209129_1000099131 398
1214 3300025294 Ga0209025_1000022 Ga0209025_1000022212 398
1215 3300025297 Ga0209758_1000086 Ga0209758_100008646 398
1216 3300025906 Ga0207699_10000115 Ga0207699_1000011550 398
1217 3300025909 Ga0207705_10000074 Ga0207705_1000007440 398
1218 3300025909 Ga0207705_10006820 Ga0207705_100068206 398
1219 3300025909 Ga0207705_10017545 Ga0207705_100175452 398
1220 3300025915 Ga0207693_10000149 Ga0207693_1000014914 398
1221 3300025917 Ga0207660_10014579 Ga0207660_100145792 398
1222 3300025919 Ga0207657_10000572 Ga0207657_1000057221 398
1223 3300025920 Ga0207649_10000249 Ga0207649_100002492 398
1224 3300025920 Ga0207649_10000701 Ga0207649_1000070119 398
1225 3300025921 Ga0207652_10124323 Ga0207652_101243232 398
1226 3300025923 Ga0207681_10132098 Ga0207681_101320982 398
1227 3300025924 Ga0207694_10025891 Ga0207694_100258913 398
1228 3300025925 Ga0207650_10019107 Ga0207650_100191075 398
1229 3300025925 Ga0207650_10049999 Ga0207650_100499992 398
1230 3300025928 Ga0207700_10000011 Ga0207700_1000001127 398
1231 3300025932 Ga0207690_10000336 Ga0207690_1000033638 398
1232 3300025932 Ga0207690_10049459 Ga0207690_100494593 398
1233 3300025933 Ga0207706_10000574 Ga0207706_1000057421 398
1234 3300025941 Ga0207711_10001345 Ga0207711_100013455 398
1235 3300025944 Ga0207661_10001741 Ga0207661_100017415 398
1236 3300025945 Ga0207679_10000167 Ga0207679_1000016749 398
1237 3300025949 Ga0207667_10043481 Ga0207667_100434812 398
1238 3300025960 Ga0207651_10060657 Ga0207651_100606573 398
1239 3300025981 Ga0207640_10068567 Ga0207640_100685672 398
1240 3300025986 Ga0207658_10000157 Ga0207658_1000015746 398
1241 3300026035 Ga0207703_10027175 Ga0207703_100271754 398
1242 3300026035 Ga0207703_10107144 Ga0207703_101071441 398
1243 3300026041 Ga0207639_10001331 Ga0207639_1000133114 398
1244 3300026067 Ga0207678_10010826 Ga0207678_100108264 398
1245 3300026078 Ga0207702_10000162 Ga0207702_1000016256 398
1246 3300026078 Ga0207702_10001335 Ga0207702_1000133519 398
1247 3300026088 Ga0207641_10026161 Ga0207641_100261613 398
1248 3300026116 Ga0207674_10000501 Ga0207674_1000050118 398
1249 3300026116 Ga0207674_10085244 Ga0207674_100852442 398
1250 3300026142 Ga0207698_10087316 Ga0207698_100873162 398
1251 3300028381 Ga0268264_10000274 Ga0268264_1000027434 398
1252 3300031250 Ga0265331_10002325 Ga0265331_1000232512 398
1253 3300031251 Ga0265327_10000453 Ga0265327_1000045348 398
1254 3300031731 Ga0307405_10004395 Ga0307405_100043955 398
1255 3300031731 Ga0307405_10107072 Ga0307405_101070722 398
1256 3300031824 Ga0307413_10011988 Ga0307413_100119884 398
1257 3300031824 Ga0307413_10033318 Ga0307413_100333182 398
1258 3300031852 Ga0307410_10023816 Ga0307410_100238162 398
1259 3300031901 Ga0307406_10015051 Ga0307406_100150514 398
1260 3300031903 Ga0307407_10015762 Ga0307407_100157622 398
1261 3300031911 Ga0307412_10009553 Ga0307412_100095535 398
1262 3300031911 Ga0307412_10058050 Ga0307412_100580502 398
1263 3300031995 Ga0307409_100028303 Ga0307409_1000283034 398
1264 3300032004 Ga0307414_10192980 Ga0307414_101929802 398
1265 3300032005 Ga0307411_10065795 Ga0307411_100657952 398
1266 3300032126 Ga0307415_100007564 Ga0307415_1000075641 398
1267 3300035121 Ga0373960_0015263 Ga0373960_0015263_207_1640 398
1268 3300035170 Ga0373943_0001178 Ga0373943_0001178_849_2270 398
1269 3300037312 Ga0395899_0001731 Ga0395899_0001731_7123_8544 398
1270 3300037312 Ga0395899_0150206 Ga0395899_0150206_168_1583 398
1271 3300037418 Ga0395900_0008110 Ga0395900_0008110_3697_5118 398
1272 3300037418 Ga0395900_0064725 Ga0395900_0064725_1365_2780 398
1273 3300037418 Ga0395900_0129344 Ga0395900_0129344_1078_2493 398
1274 3300037418 Ga0395900_0203746 Ga0395900_0203746_119_1534 398
1275 3300037471 Ga0395905_0000325 Ga0395905_0000325_15558_16946 398
1276 3300037471 Ga0395905_0008978 Ga0395905_0008978_5294_6715 398
1277 3300037471 Ga0395905_0205756 Ga0395905_0205756_262_1677 398
1278 3300038443 Ga0395901_0112918 Ga0395901_0112918_410_1843 398
1279 3300038443 Ga0395901_0316494 Ga0395901_0316494_168_1583 398
1280 3300042142 Ga0450905_000302 Ga0450905_000302_2690_4162 398
1281 3300044693 Ga0466961_0017587 Ga0466961_0017587_446_1879 398
1282 3300044842 Ga0466957_0001128 Ga0466957_0001128_477_1910 398
1283 3300046455 Ga0495603_0027104 Ga0495603_0027104_1310_2674 398
1284 3300046557 Ga0495622_0017521 Ga0495622_0017521_1233_2597 398
1285 3300048925 Ga0496122_0043049 Ga0496122_0043049_17_1399 398
1286 3300048926 Ga0496123_0074261 Ga0496123_0074261_523_1905 398
1287 3300048928 Ga0496125_0086946 Ga0496125_0086946_215_1597 398
1288 3300049589 Ga0501073_0094205 Ga0501073_0094205_398_1804 398
1289 3300050514 nmdc:mga08x19_15653_c1 nmdc:mga08x19_15653_c1_2565_3950 398
1290 3300050514 nmdc:mga08x19_82_c1 nmdc:mga08x19_82_c1_60120_61502 398
1291 3300053136 Ga0500559_0003821 Ga0500559_0003821_2052_3434 398
1292 3300053178 Ga0500637_0013054 Ga0500637_0013054_1734_3098 398
1293 3300001979 JGI24740J21852_10021989 JGI24740J21852_100219892 399
1294 3300003214 JGI25165J46597_1000053 JGI25165J46597_1000053209 399
1295 3300005327 Ga0070658_10075977 Ga0070658_100759772 399
1296 3300005329 Ga0070683_100051504 Ga0070683_1000515043 399
1297 3300005367 Ga0070667_100004859 Ga0070667_1000048599 399
1298 3300005435 Ga0070714_100005308 Ga0070714_1000053083 399
1299 3300005435 Ga0070714_100100568 Ga0070714_1001005683 399
1300 3300005444 Ga0070694_100117238 Ga0070694_1001172381 399
1301 3300005445 Ga0070708_100082549 Ga0070708_1000825492 399
1302 3300005457 Ga0070662_100162272 Ga0070662_1001622722 399
1303 3300005539 Ga0068853_100030057 Ga0068853_1000300574 399
1304 3300005539 Ga0068853_100044784 Ga0068853_1000447842 399
1305 3300005548 Ga0070665_100058110 Ga0070665_1000581102 399
1306 3300005564 Ga0070664_100014531 Ga0070664_1000145314 399
1307 3300005937 Ga0081455_10020170 Ga0081455_100201703 399
1308 3300005985 Ga0081539_10028678 Ga0081539_100286783 399
1309 3300009093 Ga0105240_10122393 Ga0105240_101223931 399
1310 3300009545 Ga0105237_10005537 Ga0105237_100055377 399
1311 3300010375 Ga0105239_10026186 Ga0105239_100261862 399
1312 3300013105 Ga0157369_10059338 Ga0157369_100593384 399
1313 3300025261 Ga0209233_1000119 Ga0209233_100011925 399
1314 3300025914 Ga0207671_10012272 Ga0207671_100122724 399
1315 3300025921 Ga0207652_10063589 Ga0207652_100635893 399
1316 3300025929 Ga0207664_10005705 Ga0207664_100057052 399
1317 3300025929 Ga0207664_10187876 Ga0207664_101878761 399
1318 3300025933 Ga0207706_10156967 Ga0207706_101569672 399
1319 3300025945 Ga0207679_10009041 Ga0207679_100090415 399
1320 3300025945 Ga0207679_10029936 Ga0207679_100299362 399
1321 3300026041 Ga0207639_10003428 Ga0207639_100034283 399
1322 3300026088 Ga0207641_10104379 Ga0207641_101043791 399
1323 3300028381 Ga0268264_10000018 Ga0268264_10000018100 399
1324 3300031548 Ga0307408_100082434 Ga0307408_1000824342 399
1325 3300031712 Ga0265342_10016674 Ga0265342_100166744 399
1326 3300031824 Ga0307413_10072634 Ga0307413_100726342 399
1327 3300031852 Ga0307410_10002073 Ga0307410_100020732 399
1328 3300031911 Ga0307412_10003243 Ga0307412_100032432 399
1329 3300032004 Ga0307414_10015212 Ga0307414_100152122 399
1330 3300032126 Ga0307415_100043123 Ga0307415_1000431232 399
1331 3300037418 Ga0395900_0065733 Ga0395900_0065733_2005_3438 399
1332 3300038705 Ga0237819_01227 Ga0237819_01227_2203_3612 399
1333 3300049705 Ga0501225_0010664 Ga0501225_0010664_14_1381 399
1334 3300053156 Ga0500622_0000381 Ga0500622_0000381_2125_3522 399
1335 3300005338 Ga0068868_100008869 Ga0068868_1000088692 400
1336 3300005339 Ga0070660_100110600 Ga0070660_1001106002 400
1337 3300005344 Ga0070661_100035732 Ga0070661_1000357322 400
1338 3300005355 Ga0070671_100002934 Ga0070671_10000293411 400
1339 3300005548 Ga0070665_100000044 Ga0070665_100000044235 400
1340 3300005578 Ga0068854_100006446 Ga0068854_1000064467 400
1341 3300005617 Ga0068859_100028594 Ga0068859_1000285944 400
1342 3300005617 Ga0068859_100065898 Ga0068859_1000658982 400
1343 3300005719 Ga0068861_100003657 Ga0068861_10000365711 400
1344 3300005841 Ga0068863_100000001 Ga0068863_10000000135 400
1345 3300005843 Ga0068860_100018215 Ga0068860_1000182153 400
1346 3300006931 Ga0097620_100028597 Ga0097620_1000285975 400
1347 3300006931 Ga0097620_100065898 Ga0097620_1000658984 400
1348 3300014968 Ga0157379_10005461 Ga0157379_100054617 400
1349 3300025909 Ga0207705_10000960 Ga0207705_1000096010 400
1350 3300025913 Ga0207695_10026665 Ga0207695_100266657 400
1351 3300025913 Ga0207695_10083224 Ga0207695_100832243 400
1352 3300025919 Ga0207657_10031951 Ga0207657_100319514 400
1353 3300025919 Ga0207657_10162436 Ga0207657_101624362 400
1354 3300025920 Ga0207649_10000916 Ga0207649_100009164 400
1355 3300025931 Ga0207644_10000046 Ga0207644_1000004674 400
1356 3300025981 Ga0207640_10062361 Ga0207640_100623612 400
1357 3300026088 Ga0207641_10000001 Ga0207641_10000001376 400
1358 3300026118 Ga0207675_100001468 Ga0207675_1000014684 400
1359 3300028379 Ga0268266_10000002 Ga0268266_100000022122 400
1360 3300028381 Ga0268264_10026533 Ga0268264_100265333 400
1361 3300028800 Ga0265338_10025716 Ga0265338_100257165 400
1362 3300031456 Ga0307513_10011652 Ga0307513_100116524 400
1363 3300037312 Ga0395899_0003563 Ga0395899_0003563_577_2013 400
1364 3300037312 Ga0395899_0052863 Ga0395899_0052863_822_2255 400
1365 3300037312 Ga0395899_0067787 Ga0395899_0067787_251_1681 400
1366 3300037418 Ga0395900_0002178 Ga0395900_0002178_16650_18071 400
1367 3300037466 Ga0395898_0013404 Ga0395898_0013404_4574_6004 400
1368 3300037466 Ga0395898_0127269 Ga0395898_0127269_471_1904 400
1369 3300037471 Ga0395905_0001434 Ga0395905_0001434_12020_13441 400
1370 3300038443 Ga0395901_0034715 Ga0395901_0034715_1149_2558 400
1371 3300038443 Ga0395901_0040896 Ga0395901_0040896_3131_4552 400
1372 3300045049 Ga0466959_0023580 Ga0466959_0023580_2131_3558 400
1373 3300045976 Ga0466967_0004158 Ga0466967_0004158_6484_7941 400
1374 3300046492 Ga0495585_0067211 Ga0495585_0067211_144_1517 400
1375 3300049744 Ga0501083_0030681 Ga0501083_0030681_1762_3132 400
1376 3300049823 Ga0501044_0020203 Ga0501044_0020203_2199_3608 400
1377 3300053087 Ga0500643_000710 Ga0500643_000710_9181_10593 400
1378 3300053087 Ga0500643_000970 Ga0500643_000970_11554_12972 400
1379 iso_pu_bacteria 2885429604 2885431232 400
1380 3300005331 Ga0070670_100001443 Ga0070670_10000144319 401
1381 3300005341 Ga0070691_10000990 Ga0070691_100009905 401
1382 3300005347 Ga0070668_100001759 Ga0070668_1000017597 401
1383 3300005548 Ga0070665_100020684 Ga0070665_1000206845 401
1384 3300005577 Ga0068857_100000989 Ga0068857_1000009893 401
1385 3300005614 Ga0068856_100004524 Ga0068856_10000452411 401
1386 3300005616 Ga0068852_100069915 Ga0068852_1000699153 401
1387 3300005618 Ga0068864_100001412 Ga0068864_10000141214 401
1388 3300005841 Ga0068863_100009577 Ga0068863_1000095772 401
1389 3300006028 Ga0070717_10074323 Ga0070717_100743233 401
1390 3300009093 Ga0105240_10005375 Ga0105240_100053755 401
1391 3300009174 Ga0105241_10059934 Ga0105241_100599343 401
1392 3300009545 Ga0105237_10007150 Ga0105237_100071503 401
1393 3300009551 Ga0105238_10005536 Ga0105238_100055362 401
1394 3300010159 Ga0099796_10012795 Ga0099796_100127952 401
1395 3300013104 Ga0157370_10001846 Ga0157370_1000184614 401
1396 3300013296 Ga0157374_10124445 Ga0157374_101244452 401
1397 3300014325 Ga0163163_10339123 Ga0163163_103391232 401
1398 3300014968 Ga0157379_10014640 Ga0157379_100146407 401
1399 3300025298 Ga0209050_1004347 Ga0209050_10043478 401
1400 3300025304 Ga0209257_1001135 Ga0209257_10011356 401
1401 3300025911 Ga0207654_10031658 Ga0207654_100316582 401
1402 3300025913 Ga0207695_10169711 Ga0207695_101697112 401
1403 3300025914 Ga0207671_10005746 Ga0207671_100057463 401
1404 3300025915 Ga0207693_10036842 Ga0207693_100368423 401
1405 3300025924 Ga0207694_10004245 Ga0207694_1000424510 401
1406 3300025925 Ga0207650_10002090 Ga0207650_1000209015 401
1407 3300025949 Ga0207667_10005234 Ga0207667_100052345 401
1408 3300025972 Ga0207668_10000140 Ga0207668_1000014040 401
1409 3300026041 Ga0207639_10033485 Ga0207639_100334853 401
1410 3300026078 Ga0207702_10001527 Ga0207702_1000152721 401
1411 3300026088 Ga0207641_10000642 Ga0207641_1000064234 401
1412 3300026095 Ga0207676_10001458 Ga0207676_1000145811 401
1413 3300026116 Ga0207674_10000507 Ga0207674_1000050732 401
1414 3300028381 Ga0268264_10007172 Ga0268264_100071724 401
1415 3300031249 Ga0265339_10000074 Ga0265339_1000007431 401
1416 3300031595 Ga0265313_10000033 Ga0265313_1000003335 401
1417 3300032004 Ga0307414_10008796 Ga0307414_100087964 401
1418 3300035695 Ga0373927_0004550 Ga0373927_0004550_796_2202 401
1419 3300037312 Ga0395899_0006503 Ga0395899_0006503_6706_8112 401
1420 3300037466 Ga0395898_0077867 Ga0395898_0077867_1141_2547 401
1421 3300037853 Ga0436364_0634282 Ga0436364_0634282_212_1588 401
1422 3300039110 Ga0400487_19903 Ga0400487_19903_2686_4056 401
1423 3300048925 Ga0496122_0001020 Ga0496122_0001020_3111_4529 401
1424 3300048926 Ga0496123_0005929 Ga0496123_0005929_270_1688 401
1425 3300048929 Ga0496126_0010694 Ga0496126_0010694_4165_5559 401
1426 3300049568 Ga0501031_0000014 Ga0501031_0000014_833_2227 401
1427 3300049569 Ga0501032_0000015 Ga0501032_0000015_833_2227 401
1428 3300049570 Ga0501033_0000023 Ga0501033_0000023_833_2227 401
1429 3300049571 Ga0501034_0000073 Ga0501034_0000073_174511_175905 401
1430 3300049572 Ga0501036_0000002 Ga0501036_0000002_833_2227 401
1431 3300049573 Ga0501037_0000158 Ga0501037_0000158_61205_62599 401
1432 3300049574 Ga0501038_0000002 Ga0501038_0000002_264242_265636 401
1433 3300049575 Ga0501039_0000002 Ga0501039_0000002_82877_84271 401
1434 3300049576 Ga0501040_0103305 Ga0501040_0103305_59_1453 401
1435 3300049579 Ga0501043_0008193 Ga0501043_0008193_6185_7579 401
1436 3300049586 Ga0501070_0046374 Ga0501070_0046374_68_1462 401
1437 3300049822 Ga0501035_0000022 Ga0501035_0000022_183634_185028 401
1438 3300049823 Ga0501044_0000002 Ga0501044_0000002_290882_292276 401
1439 3300053084 Ga0495595_0020126 Ga0495595_0020126_478_1884 401
1440 3300053157 Ga0500624_000022 Ga0500624_000022_38689_40032 401
1441 3300053178 Ga0500637_0000043 Ga0500637_0000043_10348_11691 401
1442 3300053730 Ga0500645_008030 Ga0500645_008030_1205_2599 401
1443 3300053730 Ga0500645_013696 Ga0500645_013696_1079_2491 401
1444 iso_pu_bacteria 2582581305 2585261934 401
1445 iso_pu_bacteria 2643221591 2643963363 401
1446 iso_pu_bacteria 2643221662 2644347128 401
1447 iso_pu_bacteria 2738541301 2738848568 401
1448 iso_pu_bacteria 2738541304 2738864297 401
1449 iso_pu_bacteria 2738543022 2739296815 401
1450 iso_pu_bacteria 2738543033 2739358493 401
1451 iso_pu_bacteria 2739367664 2739649904 401
1452 iso_pu_bacteria 2739367865 2740028377 401
1453 iso_pu_bacteria 2883291878 2883294425 401
1454 iso_pu_bacteria 2897803580 2897804302 401
1455 iso_pu_bacteria 2928100450 2928101790 401
1456 iso_pu_bacteria 2928959182 2928959880 401
1457 3300003214 JGI25165J46597_1000003 JGI25165J46597_1000003145 402
1458 3300005289 Ga0065704_10075907 Ga0065704_100759075 402
1459 3300005289 Ga0065704_10080365 Ga0065704_100803655 402
1460 3300005295 Ga0065707_10083195 Ga0065707_100831957 402
1461 3300005327 Ga0070658_10056469 Ga0070658_100564692 402
1462 3300005330 Ga0070690_100055749 Ga0070690_1000557492 402
1463 3300005347 Ga0070668_100027134 Ga0070668_1000271344 402
1464 3300005353 Ga0070669_100000297 Ga0070669_10000029734 402
1465 3300005353 Ga0070669_100043347 Ga0070669_1000433473 402
1466 3300005355 Ga0070671_100000090 Ga0070671_10000009035 402
1467 3300005355 Ga0070671_100000929 Ga0070671_10000092916 402
1468 3300005544 Ga0070686_100033478 Ga0070686_1000334782 402
1469 3300005548 Ga0070665_100000804 Ga0070665_1000008044 402
1470 3300005548 Ga0070665_100155398 Ga0070665_1001553981 402
1471 3300005618 Ga0068864_100028005 Ga0068864_1000280052 402
1472 3300005841 Ga0068863_100032075 Ga0068863_1000320752 402
1473 3300005842 Ga0068858_100009087 Ga0068858_1000090873 402
1474 3300005843 Ga0068860_100036050 Ga0068860_1000360504 402
1475 3300006175 Ga0070712_100001396 Ga0070712_10000139612 402
1476 3300009011 Ga0105251_10002579 Ga0105251_1000257917 402
1477 3300009093 Ga0105240_10041133 Ga0105240_100411332 402
1478 3300009177 Ga0105248_10060849 Ga0105248_100608494 402
1479 3300009545 Ga0105237_10000301 Ga0105237_1000030150 402
1480 3300009545 Ga0105237_10006082 Ga0105237_100060822 402
1481 3300009551 Ga0105238_10332599 Ga0105238_103325991 402
1482 3300014325 Ga0163163_10111020 Ga0163163_101110202 402
1483 3300014968 Ga0157379_10011900 Ga0157379_100119004 402
1484 3300014968 Ga0157379_10093050 Ga0157379_100930502 402
1485 3300025261 Ga0209233_1000015 Ga0209233_1000015635 402
1486 3300025909 Ga0207705_10197295 Ga0207705_101972952 402
1487 3300025913 Ga0207695_10055903 Ga0207695_100559032 402
1488 3300025914 Ga0207671_10000227 Ga0207671_100002274 402
1489 3300025914 Ga0207671_10020560 Ga0207671_100205603 402
1490 3300025915 Ga0207693_10000242 Ga0207693_100002422 402
1491 3300025923 Ga0207681_10000242 Ga0207681_1000024233 402
1492 3300025923 Ga0207681_10032487 Ga0207681_100324873 402
1493 3300025928 Ga0207700_10170122 Ga0207700_101701222 402
1494 3300025931 Ga0207644_10000003 Ga0207644_10000003187 402
1495 3300025931 Ga0207644_10004164 Ga0207644_100041642 402
1496 3300025941 Ga0207711_10012158 Ga0207711_100121582 402
1497 3300025949 Ga0207667_10003070 Ga0207667_1000307017 402
1498 3300025961 Ga0207712_10006708 Ga0207712_100067084 402
1499 3300025972 Ga0207668_10001709 Ga0207668_100017099 402
1500 3300025986 Ga0207658_10044734 Ga0207658_100447342 402
1501 3300026088 Ga0207641_10023445 Ga0207641_100234452 402
1502 3300026095 Ga0207676_10069153 Ga0207676_100691532 402
1503 3300028379 Ga0268266_10000215 Ga0268266_1000021597 402
1504 3300028379 Ga0268266_10002374 Ga0268266_1000237416 402
1505 3300028380 Ga0268265_10039895 Ga0268265_100398953 402
1506 3300028381 Ga0268264_10005833 Ga0268264_100058333 402
1507 3300028381 Ga0268264_10021649 Ga0268264_100216496 402
1508 3300028794 Ga0307515_10011427 Ga0307515_100114278 402
1509 3300031240 Ga0265320_10000042 Ga0265320_1000004246 402
1510 3300031241 Ga0265325_10021757 Ga0265325_100217573 402
1511 3300031616 Ga0307508_10020890 Ga0307508_100208906 402
1512 3300035695 Ga0373927_0000055 Ga0373927_0000055_78836_80206 402
1513 3300036401 Ga0373937_0002251 Ga0373937_0002251_8094_9482 402
1514 3300046453 Ga0495627_033023 Ga0495627_033023_157_1536 402
1515 3300046531 Ga0495665_0042300 Ga0495665_0042300_1024_2412 402
1516 3300048905 Ga0496102_0034902 Ga0496102_0034902_1073_2488 402
1517 3300048906 Ga0496103_0020440 Ga0496103_0020440_1996_3429 402
1518 3300048907 Ga0496104_0087084 Ga0496104_0087084_733_2115 402
1519 3300048910 Ga0496107_0001821 Ga0496107_0001821_10712_12094 402
1520 3300048911 Ga0496108_0128461 Ga0496108_0128461_623_2005 402
1521 3300048914 Ga0496111_0070255 Ga0496111_0070255_298_1680 402
1522 3300048916 Ga0496113_0000446 Ga0496113_0000446_797_2179 402
1523 3300048920 Ga0496117_0017815 Ga0496117_0017815_3706_5139 402
1524 3300048921 Ga0496118_0028213 Ga0496118_0028213_2757_4190 402
1525 3300048922 Ga0496119_0000407 Ga0496119_0000407_1105_2517 402
1526 3300048927 Ga0496124_0034377 Ga0496124_0034377_973_2364 402
1527 3300048928 Ga0496125_0077223 Ga0496125_0077223_877_2310 402
1528 3300048929 Ga0496126_0025927 Ga0496126_0025927_699_2132 402
1529 3300049823 Ga0501044_0055784 Ga0501044_0055784_2261_3625 402
1530 3300053087 Ga0500643_022576 Ga0500643_022576_203_1582 402
1531 3300053156 Ga0500622_0001861 Ga0500622_0001861_520_1893 402
1532 iso_pu_bacteria 2510917021 2511129927 402
1533 iso_pu_bacteria 2510917028 2511182757 402
1534 iso_pu_bacteria 2510917030 2511198260 402
1535 iso_pu_bacteria 2513237138 2513869362 402
1536 iso_pu_bacteria 2513237146 2513926551 402
1537 iso_pu_bacteria 2513237305 2514422017 402
1538 iso_pu_bacteria 2524023209 2524460383 402
1539 iso_pu_bacteria 2582581298 2585225888 402
1540 iso_pu_bacteria 2582581304 2585254370 402
1541 iso_pu_bacteria 2582581867 2585400723 402
1542 iso_pu_bacteria 2585427529 2585546848 402
1543 iso_pu_bacteria 2585427590 2585819717 402
1544 iso_pu_bacteria 2585427594 2585845786 402
1545 iso_pu_bacteria 2588253730 2588516283 402
1546 iso_pu_bacteria 2597490356 2599106438 402
1547 iso_pu_bacteria 2599185170 2599418018 402
1548 iso_pu_bacteria 2599185354 2600200467 402
1549 iso_pu_bacteria 2599185359 2600226276 402
1550 iso_pu_bacteria 2643221547 2643756336 402
1551 iso_pu_bacteria 2643221550 2643771610 402
1552 iso_pu_bacteria 2643221551 2643775655 402
1553 iso_pu_bacteria 2643221555 2643794102 402
1554 iso_pu_bacteria 2643221588 2643949181 402
1555 iso_pu_bacteria 2643221606 2644044895 402
1556 iso_pu_bacteria 2643221608 2644056374 402
1557 iso_pu_bacteria 2643221622 2644126407 402
1558 iso_pu_bacteria 2643221634 2644193099 402
1559 iso_pu_bacteria 2643221671 2644391068 402
1560 iso_pu_bacteria 2721755686 2723576132 402
1561 iso_pu_bacteria 2751185897 2753763753 402
1562 iso_pu_bacteria 2808606401 2809062023 402
1563 iso_pu_bacteria 2808606404 2809077987 402
1564 iso_pu_bacteria 2808606405 2809082305 402
1565 iso_pu_bacteria 2818991438 2819553975 402
1566 iso_pu_bacteria 2818991466 2819712679 402
1567 iso_pu_bacteria 2830075706 2830077867 402
1568 iso_pu_bacteria 2838035591 2838040956 402
1569 iso_pu_bacteria 2838661181 2838666198 402
1570 iso_pu_bacteria 2842298080 2842301864 402
1571 iso_pu_bacteria 2842357229 2842362338 402
1572 iso_pu_bacteria 2846952575 2846956236 402
1573 iso_pu_bacteria 2848858292 2848861872 402
1574 iso_pu_bacteria 2852653556 2852655045 402
1575 iso_pu_bacteria 2852680915 2852681477 402
1576 iso_pu_bacteria 2876392853 2876395197 402
1577 iso_pu_bacteria 2879163058 2879166803 402
1578 iso_pu_bacteria 2880518877 2880519792 402
1579 iso_pu_bacteria 2881161766 2881168565 402
1580 iso_pu_bacteria 2882632389 2882633129 402
1581 iso_pu_bacteria 2895880812 2895882461 402
1582 iso_pu_bacteria 2896184354 2896184913 402
1583 iso_pu_bacteria 2904659560 2904661828 402
1584 iso_pu_bacteria 2919100787 2919107783 402
1585 iso_pu_bacteria 2919138771 2919139809 402
1586 iso_pu_bacteria 2919450847 2919451234 402
1587 iso_pu_bacteria 2923556063 2923558156 402
1588 iso_pu_bacteria 2924762789 2924763895 402
1589 iso_pu_bacteria 2928027323 2928027905 402
1590 iso_pu_bacteria 2928526807 2928527278 402
1591 iso_pu_bacteria 2928968154 2928969239 402
1592 iso_pu_bacteria 2933016740 2933021518 402
1593 iso_pu_bacteria 2937822353 2937827004 402
1594 iso_pu_bacteria 2937848649 2937853696 402
1595 iso_pu_bacteria 2939669807 2939670888 402
1596 iso_pu_bacteria 2961114664 2961116981 402
1597 iso_pu_bacteria 2968110612 2968112889 402
1598 iso_pu_bacteria 2970524798 2970530074 402
1599 iso_pu_bacteria 2977864932 2977872024 402
1600 iso_pu_bacteria 2977922695 2977929148 402
1601 iso_pu_bacteria 2984555340 2984558719 402
1602 iso_pu_bacteria 2984564862 2984566775 402
1603 iso_pu_bacteria 2987666974 2987670363 402
1604 iso_pu_bacteria 2990265787 2990269365 402
1605 iso_pu_bacteria 2993356040 2993357963 402
1606 iso_pu_bacteria 2993693658 2993694372 402
1607 iso_pu_bacteria 2996336353 2996341802 402
1608 iso_pu_bacteria 3000865235 3000866123 402
1609 iso_pu_bacteria 3004167301 3004170121 402
1610 iso_pu_bacteria 3004211236 3004212684 402
1611 iso_pu_bacteria 3004218560 3004222739 402
1612 iso_pu_bacteria 3005445848 3005447233 402
1613 iso_pu_bacteria 3005452660 3005453944 402
1614 iso_pu_bacteria 8001845381 8001848698 402
1615 iso_pu_bacteria 8054302542 8054305948 402
1616 iso_pu_bacteria 8057101203 8057104463 402
1617 3300002076 JGI24749J21850_1000449 JGI24749J21850_10004494 403
1618 3300002459 JGI24751J29686_10000062 JGI24751J29686_1000006214 403
1619 3300005331 Ga0070670_100000005 Ga0070670_100000005249 403
1620 3300005335 Ga0070666_10038569 Ga0070666_100385693 403
1621 3300005339 Ga0070660_100016009 Ga0070660_1000160092 403
1622 3300005353 Ga0070669_100000057 Ga0070669_100000057102 403
1623 3300005367 Ga0070667_100022581 Ga0070667_1000225815 403
1624 3300005434 Ga0070709_10061005 Ga0070709_100610052 403
1625 3300005437 Ga0070710_10083309 Ga0070710_100833091 403
1626 3300005439 Ga0070711_100085593 Ga0070711_1000855932 403
1627 3300005617 Ga0068859_100002380 Ga0068859_10000238013 403
1628 3300005618 Ga0068864_100000011 Ga0068864_100000011246 403
1629 3300005719 Ga0068861_100008030 Ga0068861_1000080308 403
1630 3300005841 Ga0068863_100002331 Ga0068863_1000023315 403
1631 3300005844 Ga0068862_100000104 Ga0068862_10000010492 403
1632 3300006177 Ga0075362_10002251 Ga0075362_100022516 403
1633 3300006847 Ga0075431_100051176 Ga0075431_1000511763 403
1634 3300006871 Ga0075434_100049469 Ga0075434_1000494693 403
1635 3300006931 Ga0097620_100002380 Ga0097620_10000238013 403
1636 3300009177 Ga0105248_10196378 Ga0105248_101963782 403
1637 3300014326 Ga0157380_10004695 Ga0157380_100046952 403
1638 3300025909 Ga0207705_10000765 Ga0207705_1000076511 403
1639 3300025913 Ga0207695_10001011 Ga0207695_1000101126 403
1640 3300025913 Ga0207695_10006315 Ga0207695_100063156 403
1641 3300025916 Ga0207663_10125638 Ga0207663_101256382 403
1642 3300025923 Ga0207681_10000001 Ga0207681_10000001411 403
1643 3300025925 Ga0207650_10000018 Ga0207650_10000018246 403
1644 3300025929 Ga0207664_10065982 Ga0207664_100659822 403
1645 3300025941 Ga0207711_10002590 Ga0207711_1000259015 403
1646 3300025986 Ga0207658_10014510 Ga0207658_100145102 403
1647 3300026088 Ga0207641_10000064 Ga0207641_1000006463 403
1648 3300026095 Ga0207676_10000004 Ga0207676_10000004639 403
1649 3300026118 Ga0207675_100011175 Ga0207675_1000111753 403
1650 3300027876 Ga0209974_10001816 Ga0209974_100018165 403
1651 3300028380 Ga0268265_10000002 Ga0268265_10000002418 403
1652 3300031247 Ga0265340_10014718 Ga0265340_100147183 403
1653 3300038735 Ga0400485_06930 Ga0400485_06930_1181_2572 403
1654 3300045051 Ga0451576_0001206 Ga0451576_0001206_8580_9935 403
1655 3300050507 nmdc:mga05p37_249788_c1 nmdc:mga05p37_249788_c1_556_1917 403
1656 3300053087 Ga0500643_000004 Ga0500643_000004_825752_827122 403
1657 3300002739 JGI25158J39367_1000027 JGI25158J39367_100002714 404
1658 3300002773 JGI25152J39213_1008495 JGI25152J39213_10084952 404
1659 3300002987 JGI25159J45721_1001619 JGI25159J45721_10016195 404
1660 3300003215 JGI25153J46596_10006081 JGI25153J46596_100060812 404
1661 3300003374 JGI25161J50226_1000053 JGI25161J50226_1000053116 404
1662 3300004625 Ga0055543_1000019 Ga0055543_100001942 404
1663 3300005262 Ga0065165_1014527 Ga0065165_10145272 404
1664 3300005335 Ga0070666_10003195 Ga0070666_1000319510 404
1665 3300005347 Ga0070668_100005633 Ga0070668_10000563311 404
1666 3300005367 Ga0070667_100000067 Ga0070667_100000067120 404
1667 3300005530 Ga0070679_100173652 Ga0070679_1001736522 404
1668 3300005618 Ga0068864_100001715 Ga0068864_1000017158 404
1669 3300005841 Ga0068863_100000038 Ga0068863_100000038120 404
1670 3300013306 Ga0163162_10090448 Ga0163162_100904482 404
1671 3300025208 Ga0209436_100038 Ga0209436_10003860 404
1672 3300025245 Ga0207425_1008369 Ga0207425_10083692 404
1673 3300025258 Ga0209129_1001721 Ga0209129_10017215 404
1674 3300025284 Ga0209130_1000097 Ga0209130_100009746 404
1675 3300025294 Ga0209025_1005123 Ga0209025_10051232 404
1676 3300025297 Ga0209758_1007119 Ga0209758_10071196 404
1677 3300025302 Ga0207426_1000003 Ga0207426_1000003819 404
1678 3300025903 Ga0207680_10004430 Ga0207680_100044302 404
1679 3300025928 Ga0207700_10038488 Ga0207700_100384884 404
1680 3300025941 Ga0207711_10137837 Ga0207711_101378372 404
1681 3300025972 Ga0207668_10004631 Ga0207668_100046311 404
1682 3300025986 Ga0207658_10000089 Ga0207658_1000008911 404
1683 3300026035 Ga0207703_10000248 Ga0207703_1000024812 404
1684 3300026088 Ga0207641_10000060 Ga0207641_1000006041 404
1685 3300026095 Ga0207676_10000691 Ga0207676_1000069111 404
1686 3300031711 Ga0265314_10087022 Ga0265314_100870222 404
1687 3300046460 Ga0495638_0028998 Ga0495638_0028998_516_1907 404
1688 3300048913 Ga0496110_0017351 Ga0496110_0017351_528_1940 404
1689 3300049581 Ga0501047_0128940 Ga0501047_0128940_952_2355 404
1690 3300049823 Ga0501044_0131933 Ga0501044_0131933_654_2057 404
1691 3300053151 Ga0500604_0000023 Ga0500604_0000023_68377_69786 404
1692 3300061734 Ga0530510_0130658 Ga0530510_0130658_164_1684 404
1693 3300001904 JGI24736J21556_1001782 JGI24736J21556_10017824 405
1694 3300001915 JGI24741J21665_1000175 JGI24741J21665_10001757 405
1695 3300001979 JGI24740J21852_10001857 JGI24740J21852_1000185710 405
1696 3300001989 JGI24739J22299_10001433 JGI24739J22299_100014338 405
1697 3300001990 JGI24737J22298_10002501 JGI24737J22298_100025012 405
1698 3300002067 JGI24735J21928_10001799 JGI24735J21928_100017992 405
1699 3300002075 JGI24738J21930_10001406 JGI24738J21930_100014062 405
1700 3300005327 Ga0070658_10057283 Ga0070658_100572833 405
1701 3300005339 Ga0070660_100025521 Ga0070660_1000255214 405
1702 3300005366 Ga0070659_100021963 Ga0070659_1000219632 405
1703 3300005435 Ga0070714_100115736 Ga0070714_1001157362 405
1704 3300005455 Ga0070663_100059142 Ga0070663_1000591423 405
1705 3300005834 Ga0068851_10006598 Ga0068851_100065984 405
1706 3300005937 Ga0081455_10024068 Ga0081455_100240684 405
1707 3300009147 Ga0114129_10255698 Ga0114129_102556982 405
1708 3300009174 Ga0105241_10004536 Ga0105241_100045366 405
1709 3300009545 Ga0105237_10017358 Ga0105237_100173584 405
1710 3300009978 Ga0105148_100288 Ga0105148_1002884 405
1711 3300010375 Ga0105239_10009106 Ga0105239_100091065 405
1712 3300010375 Ga0105239_10209731 Ga0105239_102097312 405
1713 3300013100 Ga0157373_10019189 Ga0157373_100191895 405
1714 3300021361 Ga0213872_10025119 Ga0213872_100251192 405
1715 3300025904 Ga0207647_10002105 Ga0207647_100021058 405
1716 3300025909 Ga0207705_10058408 Ga0207705_100584081 405
1717 3300025911 Ga0207654_10013524 Ga0207654_100135244 405
1718 3300025913 Ga0207695_10093400 Ga0207695_100934003 405
1719 3300025915 Ga0207693_10027638 Ga0207693_100276383 405
1720 3300025919 Ga0207657_10001973 Ga0207657_1000197320 405
1721 3300025924 Ga0207694_10012149 Ga0207694_100121496 405
1722 3300025926 Ga0207659_10058713 Ga0207659_100587134 405
1723 3300025933 Ga0207706_10013018 Ga0207706_1001301810 405
1724 3300025981 Ga0207640_10052471 Ga0207640_100524712 405
1725 3300026041 Ga0207639_10002661 Ga0207639_1000266111 405
1726 3300026067 Ga0207678_10004013 Ga0207678_1000401312 405
1727 3300026078 Ga0207702_10031450 Ga0207702_100314502 405
1728 3300026116 Ga0207674_10044805 Ga0207674_100448054 405
1729 3300028577 Ga0265318_10011734 Ga0265318_100117342 405
1730 3300031241 Ga0265325_10025932 Ga0265325_100259322 405
1731 3300031249 Ga0265339_10049373 Ga0265339_100493732 405
1732 3300031249 Ga0265339_10053586 Ga0265339_100535862 405
1733 3300031548 Ga0307408_100001417 Ga0307408_10000141715 405
1734 3300031711 Ga0265314_10000270 Ga0265314_1000027022 405
1735 3300031712 Ga0265342_10020269 Ga0265342_100202693 405
1736 3300031911 Ga0307412_10007434 Ga0307412_100074345 405
1737 3300032005 Ga0307411_10010063 Ga0307411_100100634 405
1738 3300039437 Ga0436365_0182422 Ga0436365_0182422_55_1464 405
1739 3300039447 Ga0436361_0182799 Ga0436361_0182799_6060_7472 405
1740 3300039447 Ga0436361_0767562 Ga0436361_0767562_1297_2646 405
1741 3300041413 Ga0439465_0008551 Ga0439465_0008551_223_1602 405
1742 3300044684 Ga0466966_0116469 Ga0466966_0116469_197_1603 405
1743 3300046525 Ga0495663_0004654 Ga0495663_0004654_424_1827 405
1744 3300046537 Ga0495598_0007529 Ga0495598_0007529_573_1976 405
1745 3300046539 Ga0495621_0003960 Ga0495621_0003960_1120_2523 405
1746 3300046558 Ga0495633_0014558 Ga0495633_0014558_880_2283 405
1747 3300048912 Ga0496109_0013929 Ga0496109_0013929_133_1518 405
1748 3300048914 Ga0496111_0111894 Ga0496111_0111894_604_1989 405
1749 3300048916 Ga0496113_0006263 Ga0496113_0006263_848_2233 405
1750 3300048928 Ga0496125_0000989 Ga0496125_0000989_18420_19805 405
1751 3300049570 Ga0501033_0080894 Ga0501033_0080894_671_2092 405
1752 3300049571 Ga0501034_0004755 Ga0501034_0004755_494_1888 405
1753 3300049579 Ga0501043_0048638 Ga0501043_0048638_1618_3012 405
1754 3300049580 Ga0501046_0094501 Ga0501046_0094501_556_1956 405
1755 3300049586 Ga0501070_0034925 Ga0501070_0034925_1494_2915 405
1756 3300049589 Ga0501073_0081428 Ga0501073_0081428_87_1496 405
1757 3300049658 Ga0501211_001754 Ga0501211_001754_897_2282 405
1758 3300049663 Ga0501223_000048 Ga0501223_000048_29672_31057 405
1759 3300049669 Ga0501235_000894 Ga0501235_000894_4175_5560 405
1760 3300049705 Ga0501225_0000416 Ga0501225_0000416_9742_11127 405
1761 3300049705 Ga0501225_0000701 Ga0501225_0000701_6913_8298 405
1762 3300049822 Ga0501035_0011996 Ga0501035_0011996_1782_3203 405
1763 3300049823 Ga0501044_0013708 Ga0501044_0013708_4586_5980 405
1764 3300049823 Ga0501044_0016766 Ga0501044_0016766_1385_2806 405
1765 3300049823 Ga0501044_0066081 Ga0501044_0066081_125_1525 405
1766 3300059510 Ga0587090_002462 Ga0587090_002462_487_1881 405
1767 2162886007 SwRhRL2b_contig_726179 SwRhRL2b_0014.00004330 406
1768 3300000041 ARcpr5oldR_c000650 ARcpr5oldR_0006501 406
1769 3300002773 JGI25152J39213_1004957 JGI25152J39213_10049571 406
1770 3300002774 JGI25150J39212_1009820 JGI25150J39212_10098202 406
1771 3300003215 JGI25153J46596_10024597 JGI25153J46596_100245972 406
1772 3300003215 JGI25153J46596_10037864 JGI25153J46596_100378641 406
1773 3300003771 Ga0055526_1000565 Ga0055526_10005654 406
1774 3300003771 Ga0055526_1017219 Ga0055526_10172192 406
1775 3300003773 Ga0055537_1005106 Ga0055537_10051062 406
1776 3300003775 Ga0055524_1000088 Ga0055524_1000088106 406
1777 3300005262 Ga0065165_1010170 Ga0065165_10101701 406
1778 3300005289 Ga0065704_10008923 Ga0065704_100089232 406
1779 3300005844 Ga0068862_100023143 Ga0068862_1000231434 406
1780 3300006042 Ga0075368_10005530 Ga0075368_100055304 406
1781 3300006048 Ga0075363_100005011 Ga0075363_1000050114 406
1782 3300006051 Ga0075364_10004423 Ga0075364_100044232 406
1783 3300006177 Ga0075362_10000351 Ga0075362_100003511 406
1784 3300006178 Ga0075367_10001452 Ga0075367_100014524 406
1785 3300006195 Ga0075366_10062930 Ga0075366_100629302 406
1786 3300009093 Ga0105240_10003194 Ga0105240_1000319411 406
1787 3300009093 Ga0105240_10081683 Ga0105240_100816832 406
1788 3300009094 Ga0111539_10220281 Ga0111539_102202812 406
1789 3300009177 Ga0105248_10029409 Ga0105248_100294097 406
1790 3300010375 Ga0105239_10000157 Ga0105239_1000015715 406
1791 3300013105 Ga0157369_10009826 Ga0157369_1000982615 406
1792 3300013105 Ga0157369_10030950 Ga0157369_100309504 406
1793 3300013296 Ga0157374_10005567 Ga0157374_1000556711 406
1794 3300025245 Ga0207425_1001734 Ga0207425_10017349 406
1795 3300025258 Ga0209129_1001578 Ga0209129_100157810 406
1796 3300025258 Ga0209129_1002382 Ga0209129_10023829 406
1797 3300025263 Ga0209565_1000010 Ga0209565_1000010484 406
1798 3300025273 Ga0209673_1002825 Ga0209673_10028253 406
1799 3300025297 Ga0209758_1000587 Ga0209758_100058722 406
1800 3300025297 Ga0209758_1002445 Ga0209758_100244518 406
1801 3300025297 Ga0209758_1003566 Ga0209758_100356612 406
1802 3300025299 Ga0209256_1000034 Ga0209256_1000034340 406
1803 3300025303 Ga0209051_1005771 Ga0209051_10057714 406
1804 3300025304 Ga0209257_1001786 Ga0209257_100178617 406
1805 3300025913 Ga0207695_10001296 Ga0207695_1000129626 406
1806 3300025913 Ga0207695_10003200 Ga0207695_1000320021 406
1807 3300025941 Ga0207711_10025740 Ga0207711_100257405 406
1808 3300025949 Ga0207667_10183483 Ga0207667_101834832 406
1809 3300026116 Ga0207674_10107521 Ga0207674_101075211 406
1810 3300027671 Ga0209588_1005743 Ga0209588_10057432 406
1811 3300027866 Ga0209813_10000250 Ga0209813_100002507 406
1812 3300028380 Ga0268265_10030454 Ga0268265_100304543 406
1813 3300031241 Ga0265325_10000184 Ga0265325_1000018438 406
1814 3300031249 Ga0265339_10003258 Ga0265339_100032585 406
1815 3300031344 Ga0265316_10025772 Ga0265316_100257723 406
1816 3300031548 Ga0307408_100007705 Ga0307408_1000077052 406
1817 3300031595 Ga0265313_10022760 Ga0265313_100227601 406
1818 3300031731 Ga0307405_10000808 Ga0307405_100008088 406
1819 3300031911 Ga0307412_10005834 Ga0307412_100058348 406
1820 3300032004 Ga0307414_10012266 Ga0307414_100122665 406
1821 3300033529 Ga0316587_1006795 Ga0316587_10067952 406
1822 3300035111 Ga0373923_0023014 Ga0373923_0023014_785_2170 406
1823 3300036401 Ga0373937_0007070 Ga0373937_0007070_6710_8095 406
1824 3300039062 Ga0400483_173519 Ga0400483_173519_1861_3213 406
1825 3300044684 Ga0466966_0000001 Ga0466966_0000001_319556_320986 406
1826 3300046507 Ga0495606_0012046 Ga0495606_0012046_5014_6411 406
1827 3300046513 Ga0495616_0000007 Ga0495616_0000007_92851_94251 406
1828 3300046519 Ga0495632_0000060 Ga0495632_0000060_58050_59420 406
1829 3300046520 Ga0495637_0001488 Ga0495637_0001488_11678_13048 406
1830 3300046522 Ga0495643_0000014 Ga0495643_0000014_152565_153935 406
1831 3300046522 Ga0495643_0069666 Ga0495643_0069666_62_1450 406
1832 3300046525 Ga0495663_0000007 Ga0495663_0000007_101106_102476 406
1833 3300046558 Ga0495633_0005852 Ga0495633_0005852_5486_6856 406
1834 3300046660 Ga0495625_0098305 Ga0495625_0098305_24_1421 406
1835 3300046692 Ga0495671_0000032 Ga0495671_0000032_39118_40488 406
1836 3300047472 Ga0495686_0002709 Ga0495686_0002709_14170_15582 406
1837 3300047472 Ga0495686_0097146 Ga0495686_0097146_67_1437 406
1838 3300048907 Ga0496104_0004846 Ga0496104_0004846_3379_4902 406
1839 3300048908 Ga0496105_0000664 Ga0496105_0000664_17091_18614 406
1840 3300048909 Ga0496106_0023529 Ga0496106_0023529_1214_2611 406
1841 3300048919 Ga0496116_0056289 Ga0496116_0056289_1023_2411 406
1842 3300048920 Ga0496117_0081627 Ga0496117_0081627_455_1855 406
1843 3300048924 Ga0496121_0000206 Ga0496121_0000206_44410_45810 406
1844 3300048924 Ga0496121_0053413 Ga0496121_0053413_1145_2533 406
1845 3300049515 Ga0501292_000005 Ga0501292_000005_136838_138208 406
1846 3300049517 Ga0501294_000019 Ga0501294_000019_402_1772 406
1847 3300049569 Ga0501032_0011642 Ga0501032_0011642_820_2226 406
1848 3300049570 Ga0501033_0011983 Ga0501033_0011983_4525_5931 406
1849 3300049570 Ga0501033_0108308 Ga0501033_0108308_46_1452 406
1850 3300049571 Ga0501034_0045607 Ga0501034_0045607_2475_3938 406
1851 3300049571 Ga0501034_0094347 Ga0501034_0094347_21_1460 406
1852 3300049573 Ga0501037_0000147 Ga0501037_0000147_5695_7101 406
1853 3300049579 Ga0501043_0000041 Ga0501043_0000041_110257_111663 406
1854 3300049585 Ga0501069_0000018 Ga0501069_0000018_17389_18795 406
1855 3300049586 Ga0501070_0000048 Ga0501070_0000048_6386_7792 406
1856 3300049590 Ga0501074_0000001 Ga0501074_0000001_62555_63961 406
1857 3300049742 Ga0501080_0000197 Ga0501080_0000197_22111_23517 406
1858 3300049777 Ga0501281_00227 Ga0501281_00227_2523_3890 406
1859 3300049822 Ga0501035_0000048 Ga0501035_0000048_18143_19549 406
1860 3300049823 Ga0501044_0000003 Ga0501044_0000003_234429_235835 406
1861 3300049823 Ga0501044_0123701 Ga0501044_0123701_620_2020 406
1862 3300049823 Ga0501044_0177885 Ga0501044_0177885_278_1684 406
1863 3300050489 nmdc:mga03683_341_c1 nmdc:mga03683_341_c1_7887_9293 406
1864 3300050490 nmdc:mga03n38_3794_c1 nmdc:mga03n38_3794_c1_1159_2565 406
1865 3300050492 nmdc:mga0yw44_139852_c1 nmdc:mga0yw44_139852_c1_65_1471 406
1866 3300050494 nmdc:mga06z11_840_c1 nmdc:mga06z11_840_c1_1286_2692 406
1867 3300050495 nmdc:mga04h51_212_c1 nmdc:mga04h51_212_c1_7465_8871 406
1868 3300050496 nmdc:mga07m45_65_c1 nmdc:mga07m45_65_c1_16109_17515 406
1869 3300050516 nmdc:mga0sz30_20237_c1 nmdc:mga0sz30_20237_c1_780_2171 406
1870 3300050516 nmdc:mga0sz30_286_c1 nmdc:mga0sz30_286_c1_14670_16076 406
1871 3300053153 Ga0500616_0000417 Ga0500616_0000417_897_2294 406
1872 3300053156 Ga0500622_0005692 Ga0500622_0005692_977_2365 406
1873 3300053157 Ga0500624_000200 Ga0500624_000200_135_1514 406
1874 3300053158 Ga0500627_0004972 Ga0500627_0004972_268_1668 406
1875 3300059505 Ga0587083_0001552 Ga0587083_0001552_136_1533 406
1876 3300059510 Ga0587090_001105 Ga0587090_001105_136_1533 406
1877 3300059644 Ga0587075_001033 Ga0587075_001033_1087_2484 406
1878 3300059647 Ga0587079_008176 Ga0587079_008176_79_1476 406
1879 3300060344 Ga0587071_002170 Ga0587071_002170_137_1534 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02780

Transketolase_C

Transketolase, C-terminal domain

365

487

0.99

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

36

110

0.98

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

173

350

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cer-assembly1.cif.gz_D human pyruvate dehydrogenase complex e1 component v138m mutation 0.9676 87 406
1umd-assembly1.cif.gz_D branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate 0.9574 89 406
1w88-assembly2.cif.gz_F the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9549 89 406
1w88-assembly2.cif.gz_H the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9545 86 406
3duf-assembly2.cif.gz_H snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex 0.9517 86 406
ID Description Score Start End Superfamily
af_B4FUC1_232_362_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9809 273 404 3.40.50.920
af_E5RPJ6_273_405_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9783 273 404 3.40.50.920
af_Q8IL09_280_409_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9747 273 400 3.40.50.920
1ni4D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9732 273 403 3.40.50.920
af_Q2FY53_193_326_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.97 273 404 3.40.50.920
ID Description Score Start End GO Terms
AF-D3JWS9-F1-model_v4 Pyruvate dehydrogenase (EC 1.2.4.1) 0.9937 271 343 GO:0004739
AF-A0A7X6EMC4-F1-model_v4 deleted 0.9933 270 360
AF-A0A3C0G697-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9928 300 406 GO:0003824
AF-A0A2V5JRR9-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9911 290 406 GO:0004739
AF-A0A7C6VEZ8-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9904 277 403 GO:0003824

Feature Viewer

pLDDT pTM Quality
80.79 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map