F495752
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1805 | 776 | 1574 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300006943|Ga0099822_1011366|Ga0099822_10113664 |
| Length | 212 |
| Sequence | MTLISEHNETDTRERILVVAERLFRQIGYQKTTVADIAKELRMSPANVYRFFDSKKSIHEGVARGLMGEVEVEAQRIARSEGPAAARLREMMTTINRMNTERYVGDSKLHEMVEIAMQEDWGVCVAHMELIARIIGEVIAQGAASGEFEVKDLQVASLCACTAMMRFFHPQMIAQCATKPGPTIDQMIDFVIAGLSPRVRANCAVSTDVFVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 28 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 29 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 30 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 31 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 32 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 33 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 34 | 2791355199 | |||
| 35 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 36 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 37 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 38 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 39 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 40 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 41 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 42 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 43 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 44 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 45 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 46 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 47 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 48 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 49 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 50 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 51 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 52 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 53 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 54 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 55 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 56 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 57 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 58 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 59 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 60 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 61 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 62 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 63 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 64 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 65 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 66 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 67 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 68 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 69 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 70 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 71 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 72 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 73 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 74 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 75 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 76 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 77 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 78 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 79 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 80 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 81 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 82 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 83 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 84 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 85 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 86 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 87 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 88 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 89 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 90 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 91 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 92 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 93 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 94 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 95 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 96 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 97 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 98 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 99 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 100 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 101 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 102 | 2904699407 | |||
| 103 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 104 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 105 | 2906610324 | |||
| 106 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 107 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 108 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 109 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 110 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 111 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 112 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 113 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 114 | 2922368715 | |||
| 115 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 116 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 117 | 2922425934 | |||
| 118 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 119 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 120 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 121 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 122 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 123 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 124 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 125 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 126 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 127 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 128 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 129 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 130 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 131 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 132 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 133 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 134 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 135 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 136 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 137 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 138 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 139 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 140 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 141 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 142 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 143 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 144 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 145 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 146 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 147 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 148 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 149 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 150 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 151 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 152 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 153 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 154 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 155 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 156 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 157 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 158 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 159 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 160 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 161 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 162 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 163 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 164 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 165 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 166 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 167 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 168 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 169 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 170 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 171 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 172 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 173 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 174 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 175 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 176 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 177 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 178 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 179 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 180 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 181 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 182 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 183 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 184 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 185 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 186 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 187 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 188 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 189 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 190 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 191 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 192 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 193 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 194 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 195 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 196 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 197 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 199 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 200 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 201 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 202 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 203 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 204 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 207 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 208 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 209 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 210 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 211 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 212 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 214 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 215 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 223 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 225 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 226 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 227 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 230 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 231 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 236 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 237 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 238 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 239 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 240 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 242 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 243 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 244 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 245 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 247 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 251 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 252 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 254 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 255 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 256 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 258 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 259 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 260 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 261 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 262 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 263 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 264 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 265 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 266 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 267 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 268 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 269 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 270 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 271 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 272 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 274 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 275 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 276 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 277 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 278 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 279 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 280 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 281 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 282 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 283 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 284 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 286 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 287 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 288 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 289 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 290 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 291 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 292 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 294 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 295 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 296 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 297 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 298 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 299 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 300 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 301 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 303 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 312 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 314 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 315 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 318 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 321 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 322 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 325 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 326 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 329 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 333 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 335 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 336 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 337 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 338 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 339 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 340 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 341 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 342 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 343 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 344 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 345 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 346 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 347 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 348 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 351 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 352 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 353 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 355 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 356 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 357 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 358 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 423 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 424 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 425 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 426 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 429 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 433 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 434 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 435 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 436 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 437 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 438 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 439 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 440 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 441 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 442 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 443 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 444 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 445 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 446 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 447 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 448 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 449 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 450 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 451 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 452 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 453 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 454 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 455 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 456 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 457 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 458 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 459 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 460 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 461 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 462 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 463 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 464 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 465 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 466 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 467 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 468 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 469 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 470 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 471 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 472 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 473 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 474 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 475 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 476 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 477 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 478 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 479 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 480 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 481 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 482 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 483 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 484 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 485 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 486 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 487 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 488 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 489 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 490 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 491 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 492 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 493 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 494 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 495 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 496 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 497 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 498 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 499 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 500 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 501 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 502 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 503 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 504 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 505 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 506 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 507 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 508 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 509 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 510 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 511 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 512 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 513 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 514 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 515 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 516 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 517 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 518 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 519 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 520 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 521 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 522 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 523 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 524 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 525 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 526 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 527 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 528 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 619 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 620 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 621 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 622 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 623 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 624 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 625 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 626 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 627 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 628 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 629 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 630 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 631 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 632 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 633 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 634 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 635 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 636 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 637 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 638 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 639 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 640 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 641 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 642 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 643 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 644 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 647 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 648 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 649 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 650 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 651 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 652 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 653 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 654 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 656 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 657 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 658 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 659 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 660 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 661 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 662 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 663 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 664 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 665 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 666 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 667 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 668 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 669 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 670 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 671 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 672 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 673 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 674 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 675 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 676 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 677 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 678 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 681 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 682 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 686 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 687 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 688 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 689 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 690 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 691 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 692 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 693 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 694 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 695 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 696 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 697 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 698 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 699 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 700 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 701 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 702 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 703 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 704 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 705 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 706 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 707 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 708 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 709 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 710 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 711 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 712 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 713 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 714 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 715 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 716 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 717 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 718 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 719 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 720 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 721 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 722 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 723 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 724 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 725 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 726 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 727 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 728 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 729 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 730 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 731 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 732 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 733 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 734 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 735 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 736 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 737 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 738 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 739 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 740 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 741 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 742 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 743 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 744 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 745 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 746 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 747 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 748 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 749 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 750 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 751 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 752 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 753 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 754 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 755 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 756 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 757 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 758 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 759 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 760 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 761 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 762 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 763 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 764 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 765 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 766 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 767 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 768 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 769 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 770 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 771 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 772 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 773 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 774 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 775 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 776 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.17 |
| Metatranscriptomes | 0.28 |
| Isolates | 12.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.08 |
| Nodule | 10.25 |
| Rhizoplane | 7.04 |
| Rhizosphere | 61.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014946 | 3300001979 | Bacteria | 2848 |
| 2 | JGI24740J21852_10093049 | 3300001979 | Bacteria | 776 |
| 3 | JGI24739J22299_10073834 | 3300001989 | Bacteria | 1057 |
| 4 | JGI24737J22298_10020398 | 3300001990 | Bacteria | 2116 |
| 5 | JGI24735J21928_10056643 | 3300002067 | Bacteria | 1128 |
| 6 | JGI25406J46586_10000042 | 3300003203 | Bacteria | 56211 |
| 7 | JGI25165J46597_1004815 | 3300003214 | Bacteria | 2760 |
| 8 | JGI25153J46596_10008025 | 3300003215 | Bacteria | 5103 |
| 9 | JGI25153J46596_10021145 | 3300003215 | Bacteria | 2433 |
| 10 | JGI25153J46596_10087656 | 3300003215 | Bacteria | 760 |
| 11 | JGI25160J50197_1002006 | 3300003354 | Bacteria | 9716 |
| 12 | JGI25160J50197_1020040 | 3300003354 | Bacteria | 2031 |
| 13 | JGI25404J52841_10006334 | 3300003659 | Bacteria | 2473 |
| 14 | JGI25404J52841_10034536 | 3300003659 | Bacteria | 1077 |
| 15 | JGI25404J52841_10041845 | 3300003659 | Bacteria | 969 |
| 16 | Ga0055539_1001331 | 3300003752 | Bacteria | 4790 |
| 17 | Ga0055525_1005132 | 3300003759 | Bacteria | 1115 |
| 18 | Ga0055526_1032557 | 3300003771 | Bacteria | 1468 |
| 19 | Ga0055526_1053039 | 3300003771 | Bacteria | 911 |
| 20 | Ga0055524_1043256 | 3300003775 | Bacteria | 1110 |
| 21 | Ga0055531_10008593 | 3300003794 | Bacteria | 5356 |
| 22 | Ga0065165_1002451 | 3300005262 | Bacteria | 15679 |
| 23 | Ga0065165_1002611 | 3300005262 | Bacteria | 14729 |
| 24 | Ga0065165_1003698 | 3300005262 | Bacteria | 10374 |
| 25 | Ga0065165_1032389 | 3300005262 | Bacteria | 1639 |
| 26 | Ga0065707_10038970 | 3300005295 | Bacteria | 1022 |
| 27 | Ga0070658_10135114 | 3300005327 | Bacteria | 2057 |
| 28 | Ga0070658_10282156 | 3300005327 | Bacteria | 1414 |
| 29 | Ga0070658_10395391 | 3300005327 | Bacteria | 1187 |
| 30 | Ga0070676_10154307 | 3300005328 | Bacteria | 1472 |
| 31 | Ga0070676_10246739 | 3300005328 | Bacteria | 1190 |
| 32 | Ga0070683_100109347 | 3300005329 | Bacteria | 2607 |
| 33 | Ga0070690_100085021 | 3300005330 | Bacteria | 2075 |
| 34 | Ga0068869_100066490 | 3300005334 | Bacteria | 2656 |
| 35 | Ga0068869_100068209 | 3300005334 | Bacteria | 2626 |
| 36 | Ga0068869_100112284 | 3300005334 | Bacteria | 2074 |
| 37 | Ga0070680_100088958 | 3300005336 | Bacteria | 2555 |
| 38 | Ga0070680_100850116 | 3300005336 | Bacteria | 787 |
| 39 | Ga0070682_100163478 | 3300005337 | Bacteria | 1540 |
| 40 | Ga0070682_100188729 | 3300005337 | Bacteria | 1446 |
| 41 | Ga0068868_100058744 | 3300005338 | Bacteria | 3040 |
| 42 | Ga0068868_100180111 | 3300005338 | Bacteria | 1753 |
| 43 | Ga0070660_100030069 | 3300005339 | Bacteria | 4072 |
| 44 | Ga0070689_100701727 | 3300005340 | Bacteria | 884 |
| 45 | Ga0070691_10192339 | 3300005341 | Bacteria | 1068 |
| 46 | Ga0070661_100035244 | 3300005344 | Bacteria | 3633 |
| 47 | Ga0070661_100149211 | 3300005344 | Bacteria | 1767 |
| 48 | Ga0070668_100043305 | 3300005347 | Bacteria | 3452 |
| 49 | Ga0070668_100370558 | 3300005347 | Bacteria | 1216 |
| 50 | Ga0070668_100664503 | 3300005347 | Bacteria | 916 |
| 51 | Ga0070668_100944900 | 3300005347 | Bacteria | 772 |
| 52 | Ga0070675_100927245 | 3300005354 | Bacteria | 799 |
| 53 | Ga0070671_100115480 | 3300005355 | Bacteria | 2257 |
| 54 | Ga0070671_100283396 | 3300005355 | Bacteria | 1410 |
| 55 | Ga0070671_100470937 | 3300005355 | Bacteria | 1079 |
| 56 | Ga0070671_100664784 | 3300005355 | Bacteria | 902 |
| 57 | Ga0070671_101282978 | 3300005355 | Bacteria | 646 |
| 58 | Ga0070674_100064690 | 3300005356 | Bacteria | 2564 |
| 59 | Ga0070674_100206666 | 3300005356 | Bacteria | 1519 |
| 60 | Ga0070674_100688739 | 3300005356 | Bacteria | 872 |
| 61 | Ga0070674_100798562 | 3300005356 | Bacteria | 815 |
| 62 | Ga0070659_100501538 | 3300005366 | Bacteria | 1034 |
| 63 | Ga0070659_100663637 | 3300005366 | Bacteria | 900 |
| 64 | Ga0070659_100745771 | 3300005366 | Bacteria | 849 |
| 65 | Ga0070667_100303983 | 3300005367 | Bacteria | 1437 |
| 66 | Ga0070667_100549321 | 3300005367 | Bacteria | 1062 |
| 67 | Ga0070709_10000380 | 3300005434 | Bacteria | 27434 |
| 68 | Ga0070709_10004357 | 3300005434 | Bacteria | 7629 |
| 69 | Ga0070709_10011774 | 3300005434 | Bacteria | 4884 |
| 70 | Ga0070709_10017233 | 3300005434 | Bacteria | 4139 |
| 71 | Ga0070709_10202467 | 3300005434 | Bacteria | 1407 |
| 72 | Ga0070709_10394478 | 3300005434 | Bacteria | 1032 |
| 73 | Ga0070709_10447408 | 3300005434 | Bacteria | 973 |
| 74 | Ga0070709_10771121 | 3300005434 | Bacteria | 753 |
| 75 | Ga0070714_100011779 | 3300005435 | Bacteria | 6949 |
| 76 | Ga0070714_100043286 | 3300005435 | Bacteria | 3808 |
| 77 | Ga0070714_100051414 | 3300005435 | Bacteria | 3512 |
| 78 | Ga0070714_100106539 | 3300005435 | Bacteria | 2477 |
| 79 | Ga0070714_100508149 | 3300005435 | Bacteria | 1150 |
| 80 | Ga0070714_100572839 | 3300005435 | Bacteria | 1083 |
| 81 | Ga0070714_101053565 | 3300005435 | Bacteria | 792 |
| 82 | Ga0070713_100002836 | 3300005436 | Bacteria | 11341 |
| 83 | Ga0070713_100004693 | 3300005436 | Bacteria | 9229 |
| 84 | Ga0070713_100014512 | 3300005436 | Bacteria | 5855 |
| 85 | Ga0070713_100028325 | 3300005436 | Bacteria | 4423 |
| 86 | Ga0070713_100036343 | 3300005436 | Bacteria | 3974 |
| 87 | Ga0070713_100200837 | 3300005436 | Bacteria | 1800 |
| 88 | Ga0070713_100209153 | 3300005436 | Bacteria | 1765 |
| 89 | Ga0070713_100305526 | 3300005436 | Bacteria | 1465 |
| 90 | Ga0070710_10000933 | 3300005437 | Bacteria | 13902 |
| 91 | Ga0070710_10001211 | 3300005437 | Bacteria | 12205 |
| 92 | Ga0070710_10261085 | 3300005437 | Bacteria | 1117 |
| 93 | Ga0070701_10250245 | 3300005438 | Bacteria | 1070 |
| 94 | Ga0070711_100004399 | 3300005439 | Bacteria | 8310 |
| 95 | Ga0070711_100007412 | 3300005439 | Bacteria | 6673 |
| 96 | Ga0070711_100009990 | 3300005439 | Bacteria | 5856 |
| 97 | Ga0070711_100222809 | 3300005439 | Bacteria | 1467 |
| 98 | Ga0070711_100231149 | 3300005439 | Bacteria | 1442 |
| 99 | Ga0070711_100455851 | 3300005439 | Bacteria | 1047 |
| 100 | Ga0070711_100540110 | 3300005439 | Bacteria | 966 |
| 101 | Ga0070705_100206883 | 3300005440 | Bacteria | 1350 |
| 102 | Ga0070700_100071377 | 3300005441 | Bacteria | 2217 |
| 103 | Ga0070694_100257396 | 3300005444 | Bacteria | 1322 |
| 104 | Ga0070708_100522450 | 3300005445 | Bacteria | 1120 |
| 105 | Ga0070663_100089893 | 3300005455 | Bacteria | 2273 |
| 106 | Ga0070663_100123601 | 3300005455 | Bacteria | 1957 |
| 107 | Ga0070663_100149178 | 3300005455 | Bacteria | 1792 |
| 108 | Ga0070663_100225602 | 3300005455 | Bacteria | 1473 |
| 109 | Ga0070663_100258536 | 3300005455 | Bacteria | 1380 |
| 110 | Ga0070663_100341193 | 3300005455 | Bacteria | 1210 |
| 111 | Ga0070663_100372050 | 3300005455 | Bacteria | 1162 |
| 112 | Ga0070663_100816585 | 3300005455 | Bacteria | 800 |
| 113 | Ga0070663_100883963 | 3300005455 | Bacteria | 771 |
| 114 | Ga0070678_100181322 | 3300005456 | Bacteria | 1724 |
| 115 | Ga0070678_100282665 | 3300005456 | Bacteria | 1404 |
| 116 | Ga0070678_100303358 | 3300005456 | Bacteria | 1358 |
| 117 | Ga0070662_100057253 | 3300005457 | Bacteria | 2832 |
| 118 | Ga0070662_100097475 | 3300005457 | Bacteria | 2219 |
| 119 | Ga0070681_10041826 | 3300005458 | Bacteria | 4593 |
| 120 | Ga0070681_10117787 | 3300005458 | Bacteria | 2592 |
| 121 | Ga0070681_10188605 | 3300005458 | Bacteria | 1982 |
| 122 | Ga0070681_10435840 | 3300005458 | Bacteria | 1222 |
| 123 | Ga0070681_10583189 | 3300005458 | Bacteria | 1032 |
| 124 | Ga0070685_10520085 | 3300005466 | Bacteria | 845 |
| 125 | Ga0070706_100131890 | 3300005467 | Bacteria | 2332 |
| 126 | Ga0070707_100121925 | 3300005468 | Bacteria | 2531 |
| 127 | Ga0070707_100674806 | 3300005468 | Bacteria | 996 |
| 128 | Ga0070698_100256842 | 3300005471 | Bacteria | 1680 |
| 129 | Ga0070698_100896333 | 3300005471 | Bacteria | 832 |
| 130 | Ga0070699_100068026 | 3300005518 | Bacteria | 3093 |
| 131 | Ga0070679_100020904 | 3300005530 | Bacteria | 6385 |
| 132 | Ga0070679_100055132 | 3300005530 | Bacteria | 3959 |
| 133 | Ga0070679_100223109 | 3300005530 | Bacteria | 1845 |
| 134 | Ga0070679_100466946 | 3300005530 | Bacteria | 1206 |
| 135 | Ga0070679_100581139 | 3300005530 | Bacteria | 1064 |
| 136 | Ga0070684_100030973 | 3300005535 | Bacteria | 4550 |
| 137 | Ga0070684_100043585 | 3300005535 | Bacteria | 3875 |
| 138 | Ga0070684_101032896 | 3300005535 | Bacteria | 772 |
| 139 | Ga0070697_100034848 | 3300005536 | Bacteria | 4060 |
| 140 | Ga0070697_101055700 | 3300005536 | Bacteria | 723 |
| 141 | Ga0068853_100025492 | 3300005539 | Bacteria | 4962 |
| 142 | Ga0068853_100043569 | 3300005539 | Bacteria | 3839 |
| 143 | Ga0068853_100081244 | 3300005539 | Bacteria | 2837 |
| 144 | Ga0068853_100308800 | 3300005539 | Bacteria | 1463 |
| 145 | Ga0068853_100866771 | 3300005539 | Bacteria | 866 |
| 146 | Ga0068853_100991364 | 3300005539 | Bacteria | 809 |
| 147 | Ga0070672_100029567 | 3300005543 | Bacteria | 4110 |
| 148 | Ga0070672_100875699 | 3300005543 | Bacteria | 793 |
| 149 | Ga0070695_100181288 | 3300005545 | Bacteria | 1492 |
| 150 | Ga0070696_100217077 | 3300005546 | Bacteria | 1433 |
| 151 | Ga0070693_100028629 | 3300005547 | Bacteria | 3031 |
| 152 | Ga0070693_100042510 | 3300005547 | Bacteria | 2561 |
| 153 | Ga0070693_100099385 | 3300005547 | Bacteria | 1770 |
| 154 | Ga0070665_100030244 | 3300005548 | Bacteria | 5450 |
| 155 | Ga0070665_100038083 | 3300005548 | Bacteria | 4834 |
| 156 | Ga0070665_100144019 | 3300005548 | Bacteria | 2386 |
| 157 | Ga0070665_100250045 | 3300005548 | Bacteria | 1773 |
| 158 | Ga0070665_100326616 | 3300005548 | Bacteria | 1538 |
| 159 | Ga0070665_100393302 | 3300005548 | Bacteria | 1394 |
| 160 | Ga0070665_100430402 | 3300005548 | Bacteria | 1328 |
| 161 | Ga0070665_100769820 | 3300005548 | Bacteria | 975 |
| 162 | Ga0070665_100844626 | 3300005548 | Bacteria | 929 |
| 163 | Ga0070665_100922947 | 3300005548 | Bacteria | 886 |
| 164 | Ga0070704_100808971 | 3300005549 | Bacteria | 838 |
| 165 | Ga0068855_100027933 | 3300005563 | Bacteria | 6749 |
| 166 | Ga0068855_100049446 | 3300005563 | Bacteria | 4959 |
| 167 | Ga0068855_100068968 | 3300005563 | Bacteria | 4115 |
| 168 | Ga0068855_100186192 | 3300005563 | Bacteria | 2344 |
| 169 | Ga0068855_100398121 | 3300005563 | Bacteria | 1509 |
| 170 | Ga0070664_100202018 | 3300005564 | Bacteria | 1774 |
| 171 | Ga0070664_100288344 | 3300005564 | Bacteria | 1481 |
| 172 | Ga0068857_100010524 | 3300005577 | Bacteria | 8041 |
| 173 | Ga0068857_100084190 | 3300005577 | Bacteria | 2842 |
| 174 | Ga0068857_100095363 | 3300005577 | Bacteria | 2665 |
| 175 | Ga0068857_100134916 | 3300005577 | Bacteria | 2228 |
| 176 | Ga0068857_100173848 | 3300005577 | Bacteria | 1959 |
| 177 | Ga0068854_100144658 | 3300005578 | Bacteria | 1828 |
| 178 | Ga0068854_100184670 | 3300005578 | Bacteria | 1631 |
| 179 | Ga0068854_100324336 | 3300005578 | Bacteria | 1253 |
| 180 | Ga0068856_100000217 | 3300005614 | Bacteria | 61831 |
| 181 | Ga0068856_100003953 | 3300005614 | Bacteria | 14841 |
| 182 | Ga0068856_100033390 | 3300005614 | Bacteria | 5038 |
| 183 | Ga0068856_100514096 | 3300005614 | Bacteria | 1219 |
| 184 | Ga0068856_100607455 | 3300005614 | Bacteria | 1115 |
| 185 | Ga0070702_100016652 | 3300005615 | Bacteria | 3775 |
| 186 | Ga0068852_100005393 | 3300005616 | Bacteria | 9145 |
| 187 | Ga0068852_100032679 | 3300005616 | Bacteria | 4311 |
| 188 | Ga0068852_100118243 | 3300005616 | Bacteria | 2422 |
| 189 | Ga0068852_100828087 | 3300005616 | Bacteria | 940 |
| 190 | Ga0068852_100875035 | 3300005616 | Bacteria | 915 |
| 191 | Ga0068859_100026003 | 3300005617 | Bacteria | 5872 |
| 192 | Ga0068859_100068312 | 3300005617 | Bacteria | 3588 |
| 193 | Ga0068859_100272587 | 3300005617 | Bacteria | 1784 |
| 194 | Ga0068859_100325615 | 3300005617 | Bacteria | 1630 |
| 195 | Ga0068864_100118727 | 3300005618 | Bacteria | 2362 |
| 196 | Ga0068864_100771107 | 3300005618 | Bacteria | 943 |
| 197 | Ga0068866_10057212 | 3300005718 | Bacteria | 2008 |
| 198 | Ga0068861_100079783 | 3300005719 | Bacteria | 2559 |
| 199 | Ga0068861_100139587 | 3300005719 | Bacteria | 1977 |
| 200 | Ga0068861_100320045 | 3300005719 | Bacteria | 1350 |
| 201 | Ga0068861_100668591 | 3300005719 | Bacteria | 961 |
| 202 | Ga0068861_100880465 | 3300005719 | Bacteria | 846 |
| 203 | Ga0068851_10089407 | 3300005834 | Bacteria | 1620 |
| 204 | Ga0068851_10437577 | 3300005834 | Bacteria | 775 |
| 205 | Ga0068870_10173473 | 3300005840 | Bacteria | 1288 |
| 206 | Ga0068870_10497570 | 3300005840 | Bacteria | 812 |
| 207 | Ga0068863_100246090 | 3300005841 | Bacteria | 1726 |
| 208 | Ga0068863_100278770 | 3300005841 | Bacteria | 1619 |
| 209 | Ga0068863_100293003 | 3300005841 | Bacteria | 1577 |
| 210 | Ga0068863_100988687 | 3300005841 | Bacteria | 844 |
| 211 | Ga0068863_101017083 | 3300005841 | Bacteria | 832 |
| 212 | Ga0068858_100057906 | 3300005842 | Bacteria | 3581 |
| 213 | Ga0068858_100078178 | 3300005842 | Bacteria | 3074 |
| 214 | Ga0068858_100126924 | 3300005842 | Bacteria | 2389 |
| 215 | Ga0068858_100264428 | 3300005842 | Bacteria | 1636 |
| 216 | Ga0068858_100441351 | 3300005842 | Bacteria | 1253 |
| 217 | Ga0068858_100590804 | 3300005842 | Bacteria | 1077 |
| 218 | Ga0068860_100000280 | 3300005843 | Bacteria | 72849 |
| 219 | Ga0068860_100298239 | 3300005843 | Bacteria | 1578 |
| 220 | Ga0068860_100789512 | 3300005843 | Bacteria | 963 |
| 221 | Ga0068862_100138012 | 3300005844 | Bacteria | 2162 |
| 222 | Ga0068862_100454852 | 3300005844 | Bacteria | 1208 |
| 223 | Ga0081455_10360995 | 3300005937 | Bacteria | 1021 |
| 224 | Ga0081538_10030517 | 3300005981 | Bacteria | 3658 |
| 225 | Ga0081540_1000914 | 3300005983 | Bacteria | 26584 |
| 226 | Ga0081540_1002541 | 3300005983 | Bacteria | 14800 |
| 227 | Ga0081540_1004331 | 3300005983 | Bacteria | 10872 |
| 228 | Ga0081540_1006771 | 3300005983 | Bacteria | 8286 |
| 229 | Ga0081540_1011082 | 3300005983 | Bacteria | 6053 |
| 230 | Ga0081540_1012457 | 3300005983 | Bacteria | 5596 |
| 231 | Ga0081540_1032224 | 3300005983 | Bacteria | 2866 |
| 232 | Ga0081540_1035306 | 3300005983 | Bacteria | 2683 |
| 233 | Ga0081540_1064864 | 3300005983 | Bacteria | 1721 |
| 234 | Ga0081540_1107981 | 3300005983 | Bacteria | 1184 |
| 235 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 236 | Ga0081539_10001660 | 3300005985 | Bacteria | 36067 |
| 237 | Ga0081539_10050340 | 3300005985 | Bacteria | 2358 |
| 238 | Ga0070717_10000851 | 3300006028 | Bacteria | 20235 |
| 239 | Ga0070717_10007189 | 3300006028 | Bacteria | 8252 |
| 240 | Ga0070717_10109964 | 3300006028 | Bacteria | 2350 |
| 241 | Ga0070717_10218673 | 3300006028 | Bacteria | 1674 |
| 242 | Ga0070717_10604749 | 3300006028 | Bacteria | 995 |
| 243 | Ga0070717_10610335 | 3300006028 | Bacteria | 990 |
| 244 | Ga0075365_10036550 | 3300006038 | Bacteria | 3182 |
| 245 | Ga0075365_10038304 | 3300006038 | Bacteria | 3115 |
| 246 | Ga0075365_10095420 | 3300006038 | Bacteria | 2031 |
| 247 | Ga0075365_10137806 | 3300006038 | Bacteria | 1692 |
| 248 | Ga0075365_10343482 | 3300006038 | Bacteria | 1052 |
| 249 | Ga0075365_10458362 | 3300006038 | Bacteria | 900 |
| 250 | Ga0075368_10018984 | 3300006042 | Bacteria | 2591 |
| 251 | Ga0075363_100073623 | 3300006048 | Bacteria | 1859 |
| 252 | Ga0075363_100087120 | 3300006048 | Bacteria | 1715 |
| 253 | Ga0075363_100090134 | 3300006048 | Bacteria | 1687 |
| 254 | Ga0075363_100144620 | 3300006048 | Bacteria | 1340 |
| 255 | Ga0075363_100180615 | 3300006048 | Bacteria | 1200 |
| 256 | Ga0075364_10017356 | 3300006051 | Bacteria | 4495 |
| 257 | Ga0075364_10083514 | 3300006051 | Bacteria | 2114 |
| 258 | Ga0075364_10102762 | 3300006051 | Bacteria | 1903 |
| 259 | Ga0075364_10266151 | 3300006051 | Bacteria | 1165 |
| 260 | Ga0070715_10003420 | 3300006163 | Bacteria | 5045 |
| 261 | Ga0070715_10287884 | 3300006163 | Bacteria | 874 |
| 262 | Ga0070715_10297031 | 3300006163 | Bacteria | 863 |
| 263 | Ga0070716_100006081 | 3300006173 | Bacteria | 5885 |
| 264 | Ga0070716_100022965 | 3300006173 | Bacteria | 3302 |
| 265 | Ga0070716_100189762 | 3300006173 | Bacteria | 1357 |
| 266 | Ga0070716_100347908 | 3300006173 | Bacteria | 1048 |
| 267 | Ga0070712_100037108 | 3300006175 | Bacteria | 3319 |
| 268 | Ga0070712_100077589 | 3300006175 | Bacteria | 2394 |
| 269 | Ga0070712_100956264 | 3300006175 | Bacteria | 740 |
| 270 | Ga0075362_10275439 | 3300006177 | Bacteria | 831 |
| 271 | Ga0075367_10030061 | 3300006178 | Bacteria | 3111 |
| 272 | Ga0075367_10040767 | 3300006178 | Bacteria | 2712 |
| 273 | Ga0075367_10151055 | 3300006178 | Bacteria | 1441 |
| 274 | Ga0075367_10172004 | 3300006178 | Bacteria | 1349 |
| 275 | Ga0075369_10018979 | 3300006186 | Bacteria | 2804 |
| 276 | Ga0075369_10021022 | 3300006186 | Bacteria | 2677 |
| 277 | Ga0075369_10035188 | 3300006186 | Bacteria | 2128 |
| 278 | Ga0075369_10274705 | 3300006186 | Bacteria | 784 |
| 279 | Ga0075366_10069831 | 3300006195 | Bacteria | 2091 |
| 280 | Ga0075366_10081157 | 3300006195 | Bacteria | 1937 |
| 281 | Ga0075366_10134751 | 3300006195 | Bacteria | 1491 |
| 282 | Ga0075366_10135136 | 3300006195 | Bacteria | 1489 |
| 283 | Ga0075366_10169494 | 3300006195 | Bacteria | 1325 |
| 284 | Ga0075366_10181274 | 3300006195 | Bacteria | 1279 |
| 285 | Ga0075366_10278812 | 3300006195 | Bacteria | 1021 |
| 286 | Ga0097621_100023922 | 3300006237 | Bacteria | 4762 |
| 287 | Ga0097621_100999238 | 3300006237 | Bacteria | 782 |
| 288 | Ga0075370_10033798 | 3300006353 | Bacteria | 2864 |
| 289 | Ga0075370_10077347 | 3300006353 | Bacteria | 1909 |
| 290 | Ga0075370_10255625 | 3300006353 | Bacteria | 1038 |
| 291 | Ga0075370_10349343 | 3300006353 | Bacteria | 883 |
| 292 | Ga0075370_10381482 | 3300006353 | Bacteria | 844 |
| 293 | Ga0068871_100121740 | 3300006358 | Bacteria | 2204 |
| 294 | Ga0068871_100245021 | 3300006358 | Bacteria | 1559 |
| 295 | Ga0068871_100621906 | 3300006358 | Bacteria | 984 |
| 296 | Ga0068871_100796548 | 3300006358 | Bacteria | 871 |
| 297 | Ga0075428_100652061 | 3300006844 | Bacteria | 1123 |
| 298 | Ga0075431_100665681 | 3300006847 | Bacteria | 1021 |
| 299 | Ga0075434_100023687 | 3300006871 | Bacteria | 5988 |
| 300 | Ga0075434_100093534 | 3300006871 | Bacteria | 3010 |
| 301 | Ga0075434_100130919 | 3300006871 | Bacteria | 2527 |
| 302 | Ga0075434_100249421 | 3300006871 | Bacteria | 1794 |
| 303 | Ga0068865_100004347 | 3300006881 | Bacteria | 8548 |
| 304 | Ga0068865_100150935 | 3300006881 | Bacteria | 1763 |
| 305 | Ga0068865_100404314 | 3300006881 | Bacteria | 1119 |
| 306 | Ga0068865_100571982 | 3300006881 | Bacteria | 952 |
| 307 | Ga0075436_100102897 | 3300006914 | Bacteria | 1990 |
| 308 | Ga0097620_100026006 | 3300006931 | Bacteria | 5872 |
| 309 | Ga0097620_100068312 | 3300006931 | Bacteria | 3588 |
| 310 | Ga0097620_100272574 | 3300006931 | Bacteria | 1784 |
| 311 | Ga0097620_100325598 | 3300006931 | Bacteria | 1630 |
| 312 | Ga0099825_1015919 | 3300006941 | Bacteria | 6609 |
| 313 | Ga0099824_1028363 | 3300006942 | Bacteria | 2554 |
| 314 | Ga0099824_1030197 | 3300006942 | Bacteria | 2203 |
| 315 | Ga0099822_1011366 | 3300006943 | Bacteria | 10857 |
| 316 | Ga0099823_1063315 | 3300006944 | Bacteria | 1851 |
| 317 | Ga0075435_100260755 | 3300007076 | Bacteria | 1477 |
| 318 | Ga0075435_100649584 | 3300007076 | Bacteria | 916 |
| 319 | Ga0099794_10053926 | 3300007265 | Bacteria | 1940 |
| 320 | Ga0099794_10134058 | 3300007265 | Bacteria | 1252 |
| 321 | Ga0099794_10213087 | 3300007265 | Bacteria | 991 |
| 322 | Ga0099795_10011772 | 3300007788 | Bacteria | 2629 |
| 323 | Ga0099795_10018762 | 3300007788 | Bacteria | 2228 |
| 324 | Ga0099795_10150480 | 3300007788 | Bacteria | 953 |
| 325 | Ga0105244_10130491 | 3300009036 | Bacteria | 1213 |
| 326 | Ga0105250_10038359 | 3300009092 | Bacteria | 1921 |
| 327 | Ga0105250_10186600 | 3300009092 | Bacteria | 871 |
| 328 | Ga0105240_10005613 | 3300009093 | Bacteria | 18626 |
| 329 | Ga0105240_10018407 | 3300009093 | Bacteria | 9379 |
| 330 | Ga0105240_10093752 | 3300009093 | Bacteria | 3664 |
| 331 | Ga0105240_10183196 | 3300009093 | Bacteria | 2470 |
| 332 | Ga0105240_10261289 | 3300009093 | Bacteria | 1997 |
| 333 | Ga0105240_11129475 | 3300009093 | Bacteria | 833 |
| 334 | Ga0111539_10405041 | 3300009094 | Bacteria | 1589 |
| 335 | Ga0111539_10997827 | 3300009094 | Bacteria | 973 |
| 336 | Ga0105245_10143282 | 3300009098 | Bacteria | 2253 |
| 337 | Ga0105245_10241082 | 3300009098 | Bacteria | 1752 |
| 338 | Ga0105245_10282136 | 3300009098 | Bacteria | 1624 |
| 339 | Ga0105245_10300323 | 3300009098 | Bacteria | 1575 |
| 340 | Ga0105245_10718052 | 3300009098 | Bacteria | 1033 |
| 341 | Ga0105245_10728216 | 3300009098 | Bacteria | 1026 |
| 342 | Ga0105247_10040165 | 3300009101 | Bacteria | 2859 |
| 343 | Ga0105247_10181498 | 3300009101 | Bacteria | 1405 |
| 344 | Ga0105247_10203963 | 3300009101 | Bacteria | 1330 |
| 345 | Ga0114129_10203191 | 3300009147 | Bacteria | 2682 |
| 346 | Ga0105243_10126375 | 3300009148 | Bacteria | 2164 |
| 347 | Ga0105243_10334231 | 3300009148 | Bacteria | 1385 |
| 348 | Ga0105243_10386232 | 3300009148 | Bacteria | 1296 |
| 349 | Ga0105243_11399399 | 3300009148 | Bacteria | 720 |
| 350 | Ga0105241_10009918 | 3300009174 | Bacteria | 7000 |
| 351 | Ga0105241_10057681 | 3300009174 | Bacteria | 2980 |
| 352 | Ga0105241_10148190 | 3300009174 | Bacteria | 1917 |
| 353 | Ga0105241_10178213 | 3300009174 | Bacteria | 1761 |
| 354 | Ga0105241_10461296 | 3300009174 | Bacteria | 1126 |
| 355 | Ga0105241_10750691 | 3300009174 | Bacteria | 895 |
| 356 | Ga0105242_10057151 | 3300009176 | Bacteria | 3194 |
| 357 | Ga0105242_10110621 | 3300009176 | Bacteria | 2341 |
| 358 | Ga0105242_10273389 | 3300009176 | Bacteria | 1531 |
| 359 | Ga0105248_10108895 | 3300009177 | Bacteria | 3124 |
| 360 | Ga0105248_10194704 | 3300009177 | Bacteria | 2284 |
| 361 | Ga0105248_10258573 | 3300009177 | Bacteria | 1960 |
| 362 | Ga0105248_10549999 | 3300009177 | Bacteria | 1302 |
| 363 | Ga0105248_10664245 | 3300009177 | Bacteria | 1176 |
| 364 | Ga0105248_10726179 | 3300009177 | Bacteria | 1121 |
| 365 | Ga0105248_10753057 | 3300009177 | Bacteria | 1099 |
| 366 | Ga0105248_11071797 | 3300009177 | Bacteria | 911 |
| 367 | Ga0105248_11739186 | 3300009177 | Bacteria | 707 |
| 368 | Ga0105237_10016328 | 3300009545 | Bacteria | 7718 |
| 369 | Ga0105237_10049985 | 3300009545 | Bacteria | 4202 |
| 370 | Ga0105237_10081699 | 3300009545 | Bacteria | 3222 |
| 371 | Ga0105237_10234989 | 3300009545 | Bacteria | 1834 |
| 372 | Ga0105237_10235500 | 3300009545 | Bacteria | 1832 |
| 373 | Ga0105237_10262921 | 3300009545 | Bacteria | 1728 |
| 374 | Ga0105237_10396181 | 3300009545 | Bacteria | 1385 |
| 375 | Ga0105237_10414071 | 3300009545 | Bacteria | 1353 |
| 376 | Ga0105237_11133239 | 3300009545 | Bacteria | 789 |
| 377 | Ga0105238_10000577 | 3300009551 | Bacteria | 38524 |
| 378 | Ga0105238_10021436 | 3300009551 | Bacteria | 6581 |
| 379 | Ga0105238_10114871 | 3300009551 | Bacteria | 2671 |
| 380 | Ga0105238_10170267 | 3300009551 | Bacteria | 2154 |
| 381 | Ga0105238_10439031 | 3300009551 | Bacteria | 1301 |
| 382 | Ga0105238_10600758 | 3300009551 | Bacteria | 1108 |
| 383 | Ga0105249_10472924 | 3300009553 | Bacteria | 1295 |
| 384 | Ga0105249_10721690 | 3300009553 | Bacteria | 1058 |
| 385 | Ga0099796_10037817 | 3300010159 | Bacteria | 1616 |
| 386 | Ga0099796_10071598 | 3300010159 | Bacteria | 1253 |
| 387 | Ga0099796_10125134 | 3300010159 | Bacteria | 992 |
| 388 | Ga0099796_10148153 | 3300010159 | Bacteria | 922 |
| 389 | Ga0099796_10226005 | 3300010159 | Bacteria | 769 |
| 390 | Ga0105239_10020532 | 3300010375 | Bacteria | 7286 |
| 391 | Ga0105239_10117394 | 3300010375 | Bacteria | 2953 |
| 392 | Ga0105239_10123302 | 3300010375 | Bacteria | 2879 |
| 393 | Ga0105239_10125916 | 3300010375 | Bacteria | 2847 |
| 394 | Ga0105239_10139090 | 3300010375 | Bacteria | 2705 |
| 395 | Ga0105239_10160857 | 3300010375 | Bacteria | 2508 |
| 396 | Ga0105239_10164521 | 3300010375 | Bacteria | 2480 |
| 397 | Ga0105239_10201246 | 3300010375 | Bacteria | 2231 |
| 398 | Ga0105239_10377607 | 3300010375 | Bacteria | 1602 |
| 399 | Ga0105239_10493715 | 3300010375 | Bacteria | 1391 |
| 400 | Ga0105239_10661704 | 3300010375 | Bacteria | 1193 |
| 401 | Ga0105239_10729951 | 3300010375 | Bacteria | 1133 |
| 402 | Ga0105239_11222313 | 3300010375 | Bacteria | 866 |
| 403 | Ga0105246_10003035 | 3300011119 | Bacteria | 10189 |
| 404 | Ga0105246_10035006 | 3300011119 | Bacteria | 3352 |
| 405 | Ga0105246_10094802 | 3300011119 | Bacteria | 2159 |
| 406 | Ga0105246_10112304 | 3300011119 | Bacteria | 2004 |
| 407 | Ga0105246_10339635 | 3300011119 | Bacteria | 1227 |
| 408 | Ga0105246_10400002 | 3300011119 | Bacteria | 1140 |
| 409 | Ga0105246_10549288 | 3300011119 | Bacteria | 990 |
| 410 | Ga0157337_1013156 | 3300012483 | Bacteria | 677 |
| 411 | Ga0157373_10495387 | 3300013100 | Bacteria | 882 |
| 412 | Ga0157370_10063235 | 3300013104 | Bacteria | 3507 |
| 413 | Ga0157370_10072033 | 3300013104 | Bacteria | 3260 |
| 414 | Ga0157370_10097521 | 3300013104 | Bacteria | 2757 |
| 415 | Ga0157370_11017251 | 3300013104 | Bacteria | 750 |
| 416 | Ga0157369_10010776 | 3300013105 | Bacteria | 10408 |
| 417 | Ga0157369_10083426 | 3300013105 | Bacteria | 3418 |
| 418 | Ga0157369_10426866 | 3300013105 | Bacteria | 1374 |
| 419 | Ga0157369_10865464 | 3300013105 | Bacteria | 927 |
| 420 | Ga0157374_10007618 | 3300013296 | Bacteria | 9240 |
| 421 | Ga0157374_10213862 | 3300013296 | Bacteria | 1891 |
| 422 | Ga0157374_10379073 | 3300013296 | Bacteria | 1409 |
| 423 | Ga0157374_10395252 | 3300013296 | Bacteria | 1378 |
| 424 | Ga0157374_10481947 | 3300013296 | Bacteria | 1244 |
| 425 | Ga0157374_10737787 | 3300013296 | Bacteria | 999 |
| 426 | Ga0157378_10028135 | 3300013297 | Bacteria | 4957 |
| 427 | Ga0157378_10174818 | 3300013297 | Bacteria | 2016 |
| 428 | Ga0157378_10235317 | 3300013297 | Bacteria | 1747 |
| 429 | Ga0157378_10275117 | 3300013297 | Bacteria | 1621 |
| 430 | Ga0157378_10371609 | 3300013297 | Bacteria | 1402 |
| 431 | Ga0157378_10829708 | 3300013297 | Bacteria | 952 |
| 432 | Ga0163162_10038265 | 3300013306 | Bacteria | 4787 |
| 433 | Ga0163162_10077090 | 3300013306 | Bacteria | 3397 |
| 434 | Ga0163162_10187116 | 3300013306 | Bacteria | 2198 |
| 435 | Ga0163162_10313269 | 3300013306 | Bacteria | 1702 |
| 436 | Ga0163162_10364985 | 3300013306 | Bacteria | 1577 |
| 437 | Ga0163162_10548363 | 3300013306 | Bacteria | 1284 |
| 438 | Ga0163162_11180599 | 3300013306 | Bacteria | 868 |
| 439 | Ga0163162_11517043 | 3300013306 | Bacteria | 764 |
| 440 | Ga0157372_10144125 | 3300013307 | Bacteria | 2747 |
| 441 | Ga0157372_10700413 | 3300013307 | Bacteria | 1179 |
| 442 | Ga0157375_10730746 | 3300013308 | Bacteria | 1142 |
| 443 | Ga0157375_11204890 | 3300013308 | Bacteria | 888 |
| 444 | Ga0157375_11269099 | 3300013308 | Bacteria | 865 |
| 445 | Ga0157375_11359337 | 3300013308 | Bacteria | 836 |
| 446 | Ga0163163_10019430 | 3300014325 | Bacteria | 6382 |
| 447 | Ga0163163_10127341 | 3300014325 | Bacteria | 2585 |
| 448 | Ga0157380_10054606 | 3300014326 | Bacteria | 3171 |
| 449 | Ga0157380_10080105 | 3300014326 | Bacteria | 2669 |
| 450 | Ga0157380_10766140 | 3300014326 | Bacteria | 978 |
| 451 | Ga0182008_10145084 | 3300014497 | Bacteria | 1189 |
| 452 | Ga0157377_10166455 | 3300014745 | Bacteria | 1375 |
| 453 | Ga0157377_10330358 | 3300014745 | Bacteria | 1016 |
| 454 | Ga0157379_10049039 | 3300014968 | Bacteria | 3770 |
| 455 | Ga0157379_10059103 | 3300014968 | Bacteria | 3428 |
| 456 | Ga0157379_10240892 | 3300014968 | Bacteria | 1641 |
| 457 | Ga0157379_11496434 | 3300014968 | Bacteria | 657 |
| 458 | Ga0157376_10009146 | 3300014969 | Bacteria | 7185 |
| 459 | Ga0157376_10091881 | 3300014969 | Bacteria | 2630 |
| 460 | Ga0157376_10460283 | 3300014969 | Bacteria | 1243 |
| 461 | Ga0157376_10672891 | 3300014969 | Bacteria | 1038 |
| 462 | Ga0157376_10680553 | 3300014969 | Bacteria | 1032 |
| 463 | Ga0182006_1118523 | 3300015261 | Bacteria | 922 |
| 464 | Ga0163161_10016201 | 3300017792 | Bacteria | 5202 |
| 465 | Ga0163161_10326252 | 3300017792 | Bacteria | 1215 |
| 466 | Ga0163161_10362385 | 3300017792 | Bacteria | 1155 |
| 467 | Ga0163161_10410958 | 3300017792 | Bacteria | 1087 |
| 468 | Ga0163161_10831299 | 3300017792 | Bacteria | 778 |
| 469 | Ga0206356_10310093 | 3300020070 | Bacteria | 1186 |
| 470 | Ga0206354_10849355 | 3300020081 | Bacteria | 867 |
| 471 | Ga0206353_11784540 | 3300020082 | Bacteria | 1729 |
| 472 | Ga0214544_1000136 | 3300021320 | Bacteria | 107814 |
| 473 | Ga0214542_1000127 | 3300021321 | Bacteria | 107829 |
| 474 | Ga0214545_1000063 | 3300021324 | Bacteria | 107829 |
| 475 | Ga0214543_1014866 | 3300021327 | Bacteria | 8916 |
| 476 | Ga0213872_10061429 | 3300021361 | Bacteria | 1699 |
| 477 | Ga0213872_10201526 | 3300021361 | Bacteria | 853 |
| 478 | Ga0213874_10010634 | 3300021377 | Bacteria | 2309 |
| 479 | Ga0213874_10020432 | 3300021377 | Bacteria | 1815 |
| 480 | Ga0213876_10003500 | 3300021384 | Bacteria | 8967 |
| 481 | Ga0213876_10069173 | 3300021384 | Bacteria | 1865 |
| 482 | Ga0213876_10272938 | 3300021384 | Bacteria | 899 |
| 483 | Ga0213876_10345555 | 3300021384 | Bacteria | 791 |
| 484 | Ga0213875_10019412 | 3300021388 | Bacteria | 3270 |
| 485 | Ga0213871_10012173 | 3300021441 | Bacteria | 1991 |
| 486 | Ga0224712_10083188 | 3300022467 | Bacteria | 1326 |
| 487 | Ga0209563_109501 | 3300025230 | Bacteria | 1465 |
| 488 | Ga0209677_102922 | 3300025253 | Bacteria | 5978 |
| 489 | Ga0209677_108643 | 3300025253 | Bacteria | 1940 |
| 490 | Ga0209148_1000879 | 3300025254 | Bacteria | 20675 |
| 491 | Ga0209148_1020491 | 3300025254 | Bacteria | 1086 |
| 492 | Ga0209233_1000753 | 3300025261 | Bacteria | 14662 |
| 493 | Ga0209233_1002427 | 3300025261 | Bacteria | 6882 |
| 494 | Ga0209233_1014216 | 3300025261 | Bacteria | 2250 |
| 495 | Ga0209233_1016287 | 3300025261 | Bacteria | 2050 |
| 496 | Ga0209455_1001366 | 3300025272 | Bacteria | 11167 |
| 497 | Ga0209455_1004258 | 3300025272 | Bacteria | 4756 |
| 498 | Ga0209455_1018520 | 3300025272 | Bacteria | 1428 |
| 499 | Ga0209673_1019322 | 3300025273 | Bacteria | 2450 |
| 500 | Ga0209130_1046517 | 3300025284 | Bacteria | 810 |
| 501 | Ga0209564_1000602 | 3300025295 | Bacteria | 56176 |
| 502 | Ga0209564_1006952 | 3300025295 | Bacteria | 5943 |
| 503 | Ga0209564_1026798 | 3300025295 | Bacteria | 1892 |
| 504 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 505 | Ga0209758_1000455 | 3300025297 | Bacteria | 68279 |
| 506 | Ga0209758_1007373 | 3300025297 | Bacteria | 7519 |
| 507 | Ga0209758_1010431 | 3300025297 | Bacteria | 5561 |
| 508 | Ga0209758_1011599 | 3300025297 | Bacteria | 5076 |
| 509 | Ga0209758_1035461 | 3300025297 | Bacteria | 1966 |
| 510 | Ga0209758_1045155 | 3300025297 | Bacteria | 1602 |
| 511 | Ga0209256_1002822 | 3300025299 | Bacteria | 13270 |
| 512 | Ga0209256_1035913 | 3300025299 | Bacteria | 1304 |
| 513 | Ga0207426_1000505 | 3300025302 | Bacteria | 57583 |
| 514 | Ga0207426_1000551 | 3300025302 | Bacteria | 51985 |
| 515 | Ga0207426_1001912 | 3300025302 | Bacteria | 15063 |
| 516 | Ga0207426_1112932 | 3300025302 | Bacteria | 682 |
| 517 | Ga0209051_1094255 | 3300025303 | Bacteria | 823 |
| 518 | Ga0209257_1003002 | 3300025304 | Bacteria | 15298 |
| 519 | Ga0209257_1019280 | 3300025304 | Bacteria | 2577 |
| 520 | Ga0209257_1069568 | 3300025304 | Bacteria | 932 |
| 521 | Ga0207697_10090967 | 3300025315 | Bacteria | 1293 |
| 522 | Ga0207697_10114127 | 3300025315 | Bacteria | 1158 |
| 523 | Ga0207656_10072619 | 3300025321 | Bacteria | 1532 |
| 524 | Ga0207692_10000726 | 3300025898 | Bacteria | 11627 |
| 525 | Ga0207692_10028535 | 3300025898 | Bacteria | 2641 |
| 526 | Ga0207692_10199355 | 3300025898 | Bacteria | 1176 |
| 527 | Ga0207710_10030771 | 3300025900 | Bacteria | 2343 |
| 528 | Ga0207710_10075752 | 3300025900 | Bacteria | 1551 |
| 529 | Ga0207710_10175022 | 3300025900 | Bacteria | 1051 |
| 530 | Ga0207688_10066881 | 3300025901 | Bacteria | 2033 |
| 531 | Ga0207688_10237010 | 3300025901 | Bacteria | 1103 |
| 532 | Ga0207688_10544015 | 3300025901 | Bacteria | 729 |
| 533 | Ga0207680_10077450 | 3300025903 | Bacteria | 2080 |
| 534 | Ga0207680_10140852 | 3300025903 | Bacteria | 1599 |
| 535 | Ga0207647_10003320 | 3300025904 | Bacteria | 12087 |
| 536 | Ga0207647_10015241 | 3300025904 | Bacteria | 5278 |
| 537 | Ga0207647_10211861 | 3300025904 | Bacteria | 1119 |
| 538 | Ga0207647_10285561 | 3300025904 | Bacteria | 941 |
| 539 | Ga0207685_10013389 | 3300025905 | Bacteria | 2536 |
| 540 | Ga0207685_10077657 | 3300025905 | Bacteria | 1365 |
| 541 | Ga0207699_10008623 | 3300025906 | Bacteria | 5041 |
| 542 | Ga0207699_10012451 | 3300025906 | Bacteria | 4328 |
| 543 | Ga0207699_10052098 | 3300025906 | Bacteria | 2421 |
| 544 | Ga0207699_10052507 | 3300025906 | Bacteria | 2413 |
| 545 | Ga0207699_10052724 | 3300025906 | Bacteria | 2409 |
| 546 | Ga0207699_10128526 | 3300025906 | Bacteria | 1649 |
| 547 | Ga0207699_10238831 | 3300025906 | Bacteria | 1247 |
| 548 | Ga0207699_10391886 | 3300025906 | Bacteria | 988 |
| 549 | Ga0207699_10596127 | 3300025906 | Bacteria | 804 |
| 550 | Ga0207645_10066938 | 3300025907 | Bacteria | 2296 |
| 551 | Ga0207643_10155034 | 3300025908 | Bacteria | 1375 |
| 552 | Ga0207643_10314459 | 3300025908 | Bacteria | 977 |
| 553 | Ga0207705_10039590 | 3300025909 | Bacteria | 3379 |
| 554 | Ga0207705_10302883 | 3300025909 | Bacteria | 1226 |
| 555 | Ga0207684_10337259 | 3300025910 | Bacteria | 1298 |
| 556 | Ga0207654_10000358 | 3300025911 | Bacteria | 26923 |
| 557 | Ga0207654_10042854 | 3300025911 | Bacteria | 2563 |
| 558 | Ga0207654_10059283 | 3300025911 | Bacteria | 2232 |
| 559 | Ga0207654_10102165 | 3300025911 | Bacteria | 1768 |
| 560 | Ga0207654_10110845 | 3300025911 | Bacteria | 1707 |
| 561 | Ga0207654_10325079 | 3300025911 | Bacteria | 1052 |
| 562 | Ga0207707_10000183 | 3300025912 | Bacteria | 65793 |
| 563 | Ga0207707_10052912 | 3300025912 | Bacteria | 3534 |
| 564 | Ga0207707_10071470 | 3300025912 | Bacteria | 3024 |
| 565 | Ga0207707_10183103 | 3300025912 | Bacteria | 1828 |
| 566 | Ga0207707_10592111 | 3300025912 | Bacteria | 939 |
| 567 | Ga0207695_10000157 | 3300025913 | Bacteria | 204140 |
| 568 | Ga0207695_10002150 | 3300025913 | Bacteria | 29851 |
| 569 | Ga0207695_10321131 | 3300025913 | Bacteria | 1438 |
| 570 | Ga0207695_10508089 | 3300025913 | Bacteria | 1087 |
| 571 | Ga0207671_10009946 | 3300025914 | Bacteria | 7903 |
| 572 | Ga0207671_10014366 | 3300025914 | Bacteria | 6263 |
| 573 | Ga0207671_10179830 | 3300025914 | Bacteria | 1646 |
| 574 | Ga0207671_10208073 | 3300025914 | Bacteria | 1530 |
| 575 | Ga0207671_10370424 | 3300025914 | Bacteria | 1137 |
| 576 | Ga0207671_10431940 | 3300025914 | Bacteria | 1048 |
| 577 | Ga0207693_10000269 | 3300025915 | Bacteria | 47979 |
| 578 | Ga0207693_10015868 | 3300025915 | Bacteria | 6032 |
| 579 | Ga0207693_10032441 | 3300025915 | Bacteria | 4123 |
| 580 | Ga0207693_10136401 | 3300025915 | Bacteria | 1929 |
| 581 | Ga0207693_10387227 | 3300025915 | Bacteria | 1093 |
| 582 | Ga0207663_10000096 | 3300025916 | Bacteria | 41229 |
| 583 | Ga0207663_10002855 | 3300025916 | Bacteria | 8348 |
| 584 | Ga0207663_10028303 | 3300025916 | Bacteria | 3279 |
| 585 | Ga0207663_10037012 | 3300025916 | Bacteria | 2939 |
| 586 | Ga0207663_10043990 | 3300025916 | Bacteria | 2738 |
| 587 | Ga0207663_10062505 | 3300025916 | Bacteria | 2367 |
| 588 | Ga0207663_10459399 | 3300025916 | Bacteria | 983 |
| 589 | Ga0207660_10604613 | 3300025917 | Bacteria | 893 |
| 590 | Ga0207662_10202162 | 3300025918 | Bacteria | 1286 |
| 591 | Ga0207662_10490002 | 3300025918 | Bacteria | 845 |
| 592 | Ga0207657_10006462 | 3300025919 | Bacteria | 12146 |
| 593 | Ga0207657_10136834 | 3300025919 | Bacteria | 2004 |
| 594 | Ga0207657_10458734 | 3300025919 | Bacteria | 1000 |
| 595 | Ga0207657_10612208 | 3300025919 | Bacteria | 849 |
| 596 | Ga0207649_10026710 | 3300025920 | Bacteria | 3380 |
| 597 | Ga0207649_10090245 | 3300025920 | Bacteria | 2005 |
| 598 | Ga0207649_10148623 | 3300025920 | Bacteria | 1611 |
| 599 | Ga0207652_10153229 | 3300025921 | Bacteria | 2064 |
| 600 | Ga0207652_10189329 | 3300025921 | Bacteria | 1851 |
| 601 | Ga0207652_10228921 | 3300025921 | Bacteria | 1675 |
| 602 | Ga0207652_10402680 | 3300025921 | Bacteria | 1235 |
| 603 | Ga0207652_10912363 | 3300025921 | Bacteria | 776 |
| 604 | Ga0207646_10034318 | 3300025922 | Bacteria | 4585 |
| 605 | Ga0207646_10179696 | 3300025922 | Bacteria | 1911 |
| 606 | Ga0207681_10060393 | 3300025923 | Bacteria | 2602 |
| 607 | Ga0207681_10082915 | 3300025923 | Bacteria | 2268 |
| 608 | Ga0207694_10000491 | 3300025924 | Bacteria | 35820 |
| 609 | Ga0207694_10025055 | 3300025924 | Bacteria | 4533 |
| 610 | Ga0207694_10109801 | 3300025924 | Bacteria | 2194 |
| 611 | Ga0207694_10248776 | 3300025924 | Bacteria | 1454 |
| 612 | Ga0207694_10422724 | 3300025924 | Bacteria | 1110 |
| 613 | Ga0207694_10518528 | 3300025924 | Bacteria | 999 |
| 614 | Ga0207694_10577760 | 3300025924 | Bacteria | 944 |
| 615 | Ga0207650_10442919 | 3300025925 | Bacteria | 1080 |
| 616 | Ga0207650_10518086 | 3300025925 | Bacteria | 998 |
| 617 | Ga0207687_10060872 | 3300025927 | Bacteria | 2664 |
| 618 | Ga0207687_10101422 | 3300025927 | Bacteria | 2119 |
| 619 | Ga0207700_10004115 | 3300025928 | Bacteria | 8533 |
| 620 | Ga0207700_10020194 | 3300025928 | Bacteria | 4518 |
| 621 | Ga0207700_10026105 | 3300025928 | Bacteria | 4069 |
| 622 | Ga0207700_10052150 | 3300025928 | Bacteria | 3057 |
| 623 | Ga0207700_10053842 | 3300025928 | Bacteria | 3017 |
| 624 | Ga0207700_10172234 | 3300025928 | Bacteria | 1806 |
| 625 | Ga0207700_10189647 | 3300025928 | Bacteria | 1727 |
| 626 | Ga0207700_10223738 | 3300025928 | Bacteria | 1597 |
| 627 | Ga0207664_10027009 | 3300025929 | Bacteria | 4347 |
| 628 | Ga0207664_10047125 | 3300025929 | Bacteria | 3385 |
| 629 | Ga0207664_10051997 | 3300025929 | Bacteria | 3238 |
| 630 | Ga0207664_10055299 | 3300025929 | Bacteria | 3149 |
| 631 | Ga0207664_10137539 | 3300025929 | Bacteria | 2063 |
| 632 | Ga0207664_10247549 | 3300025929 | Bacteria | 1554 |
| 633 | Ga0207664_10569118 | 3300025929 | Bacteria | 1017 |
| 634 | Ga0207644_10058382 | 3300025931 | Bacteria | 2789 |
| 635 | Ga0207644_10081518 | 3300025931 | Bacteria | 2391 |
| 636 | Ga0207690_10359279 | 3300025932 | Bacteria | 1153 |
| 637 | Ga0207690_10719975 | 3300025932 | Bacteria | 821 |
| 638 | Ga0207706_10029379 | 3300025933 | Bacteria | 4907 |
| 639 | Ga0207706_10078177 | 3300025933 | Bacteria | 2910 |
| 640 | Ga0207706_10154987 | 3300025933 | Bacteria | 2015 |
| 641 | Ga0207706_10281857 | 3300025933 | Bacteria | 1449 |
| 642 | Ga0207706_11145142 | 3300025933 | Bacteria | 648 |
| 643 | Ga0207709_10030496 | 3300025935 | Bacteria | 3137 |
| 644 | Ga0207709_10171538 | 3300025935 | Bacteria | 1523 |
| 645 | Ga0207669_11020477 | 3300025937 | Bacteria | 696 |
| 646 | Ga0207704_10266735 | 3300025938 | Bacteria | 1294 |
| 647 | Ga0207704_10423169 | 3300025938 | Bacteria | 1056 |
| 648 | Ga0207665_10000104 | 3300025939 | Bacteria | 55188 |
| 649 | Ga0207665_10408302 | 3300025939 | Bacteria | 1035 |
| 650 | Ga0207691_10013516 | 3300025940 | Bacteria | 7808 |
| 651 | Ga0207691_10178168 | 3300025940 | Bacteria | 1858 |
| 652 | Ga0207691_10290112 | 3300025940 | Bacteria | 1407 |
| 653 | Ga0207691_10577453 | 3300025940 | Bacteria | 952 |
| 654 | Ga0207711_10084823 | 3300025941 | Bacteria | 2774 |
| 655 | Ga0207711_10584149 | 3300025941 | Bacteria | 1042 |
| 656 | Ga0207689_10012148 | 3300025942 | Bacteria | 7371 |
| 657 | Ga0207689_10098371 | 3300025942 | Bacteria | 2403 |
| 658 | Ga0207661_10026657 | 3300025944 | Bacteria | 4406 |
| 659 | Ga0207679_10252345 | 3300025945 | Bacteria | 1500 |
| 660 | Ga0207679_10407203 | 3300025945 | Bacteria | 1198 |
| 661 | Ga0207667_10026442 | 3300025949 | Bacteria | 6340 |
| 662 | Ga0207667_10035571 | 3300025949 | Bacteria | 5342 |
| 663 | Ga0207667_10045712 | 3300025949 | Bacteria | 4636 |
| 664 | Ga0207667_10227765 | 3300025949 | Bacteria | 1909 |
| 665 | Ga0207667_10332090 | 3300025949 | Bacteria | 1552 |
| 666 | Ga0207667_10708850 | 3300025949 | Bacteria | 1008 |
| 667 | Ga0207651_10140997 | 3300025960 | Bacteria | 1862 |
| 668 | Ga0207712_10110047 | 3300025961 | Bacteria | 2065 |
| 669 | Ga0207712_10592788 | 3300025961 | Bacteria | 958 |
| 670 | Ga0207712_10707759 | 3300025961 | Bacteria | 879 |
| 671 | Ga0207668_10037232 | 3300025972 | Bacteria | 3254 |
| 672 | Ga0207668_10047986 | 3300025972 | Bacteria | 2927 |
| 673 | Ga0207668_10110094 | 3300025972 | Bacteria | 2064 |
| 674 | Ga0207668_10498579 | 3300025972 | Bacteria | 1047 |
| 675 | Ga0207640_10010167 | 3300025981 | Bacteria | 5289 |
| 676 | Ga0207640_10050789 | 3300025981 | Bacteria | 2693 |
| 677 | Ga0207640_10094168 | 3300025981 | Bacteria | 2083 |
| 678 | Ga0207640_10229379 | 3300025981 | Bacteria | 1427 |
| 679 | Ga0207640_10381057 | 3300025981 | Bacteria | 1143 |
| 680 | Ga0207640_10540992 | 3300025981 | Bacteria | 977 |
| 681 | Ga0207658_10189965 | 3300025986 | Bacteria | 1706 |
| 682 | Ga0207677_10046125 | 3300026023 | Bacteria | 2916 |
| 683 | Ga0207677_10321373 | 3300026023 | Bacteria | 1286 |
| 684 | Ga0207677_10456695 | 3300026023 | Bacteria | 1096 |
| 685 | Ga0207677_10606578 | 3300026023 | Bacteria | 961 |
| 686 | Ga0207703_10220030 | 3300026035 | Bacteria | 1697 |
| 687 | Ga0207703_10448590 | 3300026035 | Bacteria | 1205 |
| 688 | Ga0207703_10782073 | 3300026035 | Bacteria | 910 |
| 689 | Ga0207703_10855369 | 3300026035 | Bacteria | 870 |
| 690 | Ga0207703_10959786 | 3300026035 | Bacteria | 820 |
| 691 | Ga0207639_10003195 | 3300026041 | Bacteria | 11016 |
| 692 | Ga0207639_10041161 | 3300026041 | Bacteria | 3455 |
| 693 | Ga0207639_10127953 | 3300026041 | Bacteria | 2098 |
| 694 | Ga0207639_10424083 | 3300026041 | Bacteria | 1203 |
| 695 | Ga0207639_11268578 | 3300026041 | Bacteria | 691 |
| 696 | Ga0207678_10014065 | 3300026067 | Bacteria | 7037 |
| 697 | Ga0207678_10030744 | 3300026067 | Bacteria | 4688 |
| 698 | Ga0207678_10094920 | 3300026067 | Bacteria | 2549 |
| 699 | Ga0207678_10128929 | 3300026067 | Bacteria | 2157 |
| 700 | Ga0207678_10166968 | 3300026067 | Bacteria | 1879 |
| 701 | Ga0207678_10198446 | 3300026067 | Bacteria | 1715 |
| 702 | Ga0207678_10218996 | 3300026067 | Bacteria | 1629 |
| 703 | Ga0207678_10313947 | 3300026067 | Bacteria | 1348 |
| 704 | Ga0207708_10075619 | 3300026075 | Bacteria | 2583 |
| 705 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 706 | Ga0207702_10004131 | 3300026078 | Bacteria | 13017 |
| 707 | Ga0207702_10032268 | 3300026078 | Bacteria | 4370 |
| 708 | Ga0207702_10056601 | 3300026078 | Bacteria | 3330 |
| 709 | Ga0207702_10508734 | 3300026078 | Bacteria | 1175 |
| 710 | Ga0207702_10552873 | 3300026078 | Bacteria | 1126 |
| 711 | Ga0207641_10225327 | 3300026088 | Bacteria | 1740 |
| 712 | Ga0207641_10291486 | 3300026088 | Bacteria | 1538 |
| 713 | Ga0207641_10468640 | 3300026088 | Bacteria | 1219 |
| 714 | Ga0207648_10010726 | 3300026089 | Bacteria | 8662 |
| 715 | Ga0207648_10787138 | 3300026089 | Bacteria | 885 |
| 716 | Ga0207676_10027761 | 3300026095 | Bacteria | 4220 |
| 717 | Ga0207676_10042080 | 3300026095 | Bacteria | 3512 |
| 718 | Ga0207676_10104775 | 3300026095 | Bacteria | 2353 |
| 719 | Ga0207676_10171088 | 3300026095 | Bacteria | 1893 |
| 720 | Ga0207674_10085107 | 3300026116 | Bacteria | 3159 |
| 721 | Ga0207674_10092698 | 3300026116 | Bacteria | 3010 |
| 722 | Ga0207674_10097807 | 3300026116 | Bacteria | 2919 |
| 723 | Ga0207674_10097861 | 3300026116 | Bacteria | 2918 |
| 724 | Ga0207674_10342575 | 3300026116 | Bacteria | 1445 |
| 725 | Ga0207674_10382920 | 3300026116 | Bacteria | 1360 |
| 726 | Ga0207674_10830721 | 3300026116 | Bacteria | 891 |
| 727 | Ga0207675_100021508 | 3300026118 | Bacteria | 6008 |
| 728 | Ga0207675_100090463 | 3300026118 | Bacteria | 2877 |
| 729 | Ga0207675_100175893 | 3300026118 | Bacteria | 2048 |
| 730 | Ga0207675_100262645 | 3300026118 | Bacteria | 1674 |
| 731 | Ga0207675_100377193 | 3300026118 | Bacteria | 1394 |
| 732 | Ga0207675_100673288 | 3300026118 | Bacteria | 1042 |
| 733 | Ga0207683_10018433 | 3300026121 | Bacteria | 5956 |
| 734 | Ga0207683_10110225 | 3300026121 | Bacteria | 2464 |
| 735 | Ga0207683_10152146 | 3300026121 | Bacteria | 2088 |
| 736 | Ga0207683_10209651 | 3300026121 | Bacteria | 1773 |
| 737 | Ga0207683_10335122 | 3300026121 | Bacteria | 1387 |
| 738 | Ga0207683_10546620 | 3300026121 | Bacteria | 1071 |
| 739 | Ga0207683_10696565 | 3300026121 | Bacteria | 942 |
| 740 | Ga0207698_10027042 | 3300026142 | Bacteria | 4067 |
| 741 | Ga0207698_10059039 | 3300026142 | Bacteria | 2976 |
| 742 | Ga0207698_10114470 | 3300026142 | Bacteria | 2269 |
| 743 | Ga0207698_10307542 | 3300026142 | Bacteria | 1478 |
| 744 | Ga0207698_10607031 | 3300026142 | Bacteria | 1079 |
| 745 | Ga0209389_1001313 | 3300027296 | Bacteria | 17360 |
| 746 | Ga0209389_1001336 | 3300027296 | Bacteria | 17260 |
| 747 | Ga0209589_1000002 | 3300027357 | Bacteria | 708598 |
| 748 | Ga0209589_1004535 | 3300027357 | Bacteria | 23952 |
| 749 | Ga0209489_100002 | 3300027361 | Bacteria | 708609 |
| 750 | Ga0209489_100050 | 3300027361 | Bacteria | 154669 |
| 751 | Ga0209489_104795 | 3300027361 | Bacteria | 24473 |
| 752 | Ga0209700_100002 | 3300027363 | Bacteria | 708598 |
| 753 | Ga0209700_100016 | 3300027363 | Bacteria | 252567 |
| 754 | Ga0209588_1007888 | 3300027671 | Bacteria | 3148 |
| 755 | Ga0209813_10043201 | 3300027866 | Bacteria | 1380 |
| 756 | Ga0209813_10064452 | 3300027866 | Bacteria | 1177 |
| 757 | Ga0209813_10089483 | 3300027866 | Bacteria | 1031 |
| 758 | Ga0207428_10137746 | 3300027907 | Bacteria | 1866 |
| 759 | Ga0268266_10049793 | 3300028379 | Bacteria | 3593 |
| 760 | Ga0268266_10056532 | 3300028379 | Bacteria | 3375 |
| 761 | Ga0268266_10168690 | 3300028379 | Bacteria | 1985 |
| 762 | Ga0268266_10313394 | 3300028379 | Bacteria | 1466 |
| 763 | Ga0268266_10381673 | 3300028379 | Bacteria | 1329 |
| 764 | Ga0268266_10410116 | 3300028379 | Bacteria | 1282 |
| 765 | Ga0268266_10468838 | 3300028379 | Bacteria | 1199 |
| 766 | Ga0268266_10581825 | 3300028379 | Bacteria | 1074 |
| 767 | Ga0268266_10782305 | 3300028379 | Bacteria | 921 |
| 768 | Ga0268266_11145637 | 3300028379 | Bacteria | 752 |
| 769 | Ga0268265_10442205 | 3300028380 | Bacteria | 1212 |
| 770 | Ga0268265_10711658 | 3300028380 | Bacteria | 971 |
| 771 | Ga0268264_10000038 | 3300028381 | Bacteria | 383623 |
| 772 | Ga0268264_10105950 | 3300028381 | Bacteria | 2453 |
| 773 | Ga0268264_10270123 | 3300028381 | Bacteria | 1588 |
| 774 | Ga0268264_10849473 | 3300028381 | Bacteria | 914 |
| 775 | Ga0268264_10872998 | 3300028381 | Bacteria | 902 |
| 776 | Ga0268264_11301006 | 3300028381 | Bacteria | 737 |
| 777 | Ga0265337_1004994 | 3300028556 | Bacteria | 5386 |
| 778 | Ga0265326_10011046 | 3300028558 | Bacteria | 2671 |
| 779 | Ga0265319_1004750 | 3300028563 | Bacteria | 6655 |
| 780 | Ga0265334_10025808 | 3300028573 | Bacteria | 2376 |
| 781 | Ga0265318_10020324 | 3300028577 | Bacteria | 2681 |
| 782 | Ga0265323_10000744 | 3300028653 | Bacteria | 17485 |
| 783 | Ga0265322_10009604 | 3300028654 | Bacteria | 2806 |
| 784 | Ga0265336_10000228 | 3300028666 | Bacteria | 39886 |
| 785 | Ga0307517_10007898 | 3300028786 | Bacteria | 15387 |
| 786 | Ga0307517_10179540 | 3300028786 | Bacteria | 1370 |
| 787 | Ga0265338_10000116 | 3300028800 | Bacteria | 146839 |
| 788 | Ga0265324_10004530 | 3300029957 | Bacteria | 6237 |
| 789 | Ga0265328_10000055 | 3300031239 | Bacteria | 72155 |
| 790 | Ga0265328_10038546 | 3300031239 | Bacteria | 1764 |
| 791 | Ga0265325_10033422 | 3300031241 | Bacteria | 2742 |
| 792 | Ga0265339_10072795 | 3300031249 | Bacteria | 1828 |
| 793 | Ga0265331_10075671 | 3300031250 | Bacteria | 1569 |
| 794 | Ga0307513_10235391 | 3300031456 | Bacteria | 1641 |
| 795 | Ga0307513_10611121 | 3300031456 | Bacteria | 799 |
| 796 | Ga0307509_10207820 | 3300031507 | Bacteria | 1786 |
| 797 | Ga0307509_10271152 | 3300031507 | Bacteria | 1464 |
| 798 | Ga0307509_10601610 | 3300031507 | Bacteria | 772 |
| 799 | Ga0307408_100269517 | 3300031548 | Bacteria | 1413 |
| 800 | Ga0307408_100870530 | 3300031548 | Bacteria | 823 |
| 801 | Ga0265313_10171333 | 3300031595 | Bacteria | 917 |
| 802 | Ga0307508_10000008 | 3300031616 | Bacteria | 265023 |
| 803 | Ga0307508_10023981 | 3300031616 | Bacteria | 5536 |
| 804 | Ga0307508_10081178 | 3300031616 | Bacteria | 2824 |
| 805 | Ga0307508_10338481 | 3300031616 | Bacteria | 1096 |
| 806 | Ga0307508_10453554 | 3300031616 | Bacteria | 875 |
| 807 | Ga0265314_10030942 | 3300031711 | Bacteria | 3957 |
| 808 | Ga0265342_10023099 | 3300031712 | Bacteria | 3942 |
| 809 | Ga0307516_10005698 | 3300031730 | Bacteria | 14765 |
| 810 | Ga0307516_10012479 | 3300031730 | Bacteria | 9154 |
| 811 | Ga0307516_10451226 | 3300031730 | Bacteria | 942 |
| 812 | Ga0307413_10219223 | 3300031824 | Bacteria | 1388 |
| 813 | Ga0307410_10504798 | 3300031852 | Bacteria | 996 |
| 814 | Ga0307406_10383675 | 3300031901 | Bacteria | 1108 |
| 815 | Ga0307407_10097577 | 3300031903 | Bacteria | 1817 |
| 816 | Ga0307412_10299716 | 3300031911 | Bacteria | 1270 |
| 817 | Ga0307412_10434443 | 3300031911 | Bacteria | 1077 |
| 818 | Ga0307412_10542924 | 3300031911 | Bacteria | 975 |
| 819 | Ga0307416_100368616 | 3300032002 | Bacteria | 1461 |
| 820 | Ga0307416_100704182 | 3300032002 | Bacteria | 1099 |
| 821 | Ga0307416_101122751 | 3300032002 | Bacteria | 891 |
| 822 | Ga0307414_10943860 | 3300032004 | Bacteria | 792 |
| 823 | Ga0307415_100019725 | 3300032126 | Bacteria | 4099 |
| 824 | Ga0307415_100314809 | 3300032126 | Bacteria | 1302 |
| 825 | Ga0307507_10327767 | 3300033179 | Bacteria | 917 |
| 826 | Ga0307510_10016828 | 3300033180 | Bacteria | 8627 |
| 827 | Ga0307510_10052759 | 3300033180 | Bacteria | 4281 |
| 828 | Ga0307510_10098071 | 3300033180 | Bacteria | 2736 |
| 829 | Ga0307510_10240950 | 3300033180 | Bacteria | 1303 |
| 830 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 831 | Ga0373926_0144211 | 3300035083 | Bacteria | 905 |
| 832 | Ga0373928_0026296 | 3300035084 | Bacteria | 1260 |
| 833 | Ga0373934_0003099 | 3300035086 | Bacteria | 6068 |
| 834 | Ga0373934_0022147 | 3300035086 | Bacteria | 2450 |
| 835 | Ga0373934_0087419 | 3300035086 | Bacteria | 1255 |
| 836 | Ga0373944_0083577 | 3300035089 | Bacteria | 1058 |
| 837 | Ga0373923_0009432 | 3300035111 | Bacteria | 3521 |
| 838 | Ga0373923_0022975 | 3300035111 | Bacteria | 2449 |
| 839 | Ga0373936_0007656 | 3300035113 | Bacteria | 4057 |
| 840 | Ga0373936_0087446 | 3300035113 | Bacteria | 1303 |
| 841 | Ga0373945_0013918 | 3300035116 | Bacteria | 2691 |
| 842 | Ga0373945_0020708 | 3300035116 | Bacteria | 2254 |
| 843 | Ga0373953_0000196 | 3300035117 | Bacteria | 16203 |
| 844 | Ga0373953_0085182 | 3300035117 | Bacteria | 1318 |
| 845 | Ga0373953_0106647 | 3300035117 | Bacteria | 1182 |
| 846 | Ga0373954_0001139 | 3300035118 | Bacteria | 10675 |
| 847 | Ga0373954_0007143 | 3300035118 | Bacteria | 4876 |
| 848 | Ga0373954_0030823 | 3300035118 | Bacteria | 2474 |
| 849 | Ga0373956_0003545 | 3300035119 | Bacteria | 6290 |
| 850 | Ga0373956_0019483 | 3300035119 | Bacteria | 2877 |
| 851 | Ga0373956_0027490 | 3300035119 | Bacteria | 2470 |
| 852 | Ga0373956_0315694 | 3300035119 | Bacteria | 745 |
| 853 | Ga0373957_0088067 | 3300035120 | Bacteria | 1231 |
| 854 | Ga0373943_0006083 | 3300035170 | Bacteria | 5423 |
| 855 | Ga0373943_0079033 | 3300035170 | Bacteria | 1683 |
| 856 | Ga0373943_0158005 | 3300035170 | Bacteria | 1232 |
| 857 | Ga0373946_0027971 | 3300035171 | Bacteria | 2233 |
| 858 | Ga0373946_0041939 | 3300035171 | Bacteria | 1879 |
| 859 | Ga0373955_0000407 | 3300035172 | Bacteria | 18265 |
| 860 | Ga0373955_0135089 | 3300035172 | Bacteria | 1442 |
| 861 | Ga0373962_0052280 | 3300035242 | Bacteria | 1180 |
| 862 | Ga0373924_0000379 | 3300035410 | Bacteria | 13632 |
| 863 | Ga0373924_0019302 | 3300035410 | Bacteria | 2640 |
| 864 | Ga0373931_0011456 | 3300035691 | Bacteria | 4285 |
| 865 | Ga0373935_0000493 | 3300035692 | Bacteria | 20439 |
| 866 | Ga0373935_0116943 | 3300035692 | Bacteria | 1776 |
| 867 | Ga0373935_0126052 | 3300035692 | Bacteria | 1716 |
| 868 | Ga0373935_0364244 | 3300035692 | Bacteria | 1033 |
| 869 | Ga0373935_0701076 | 3300035692 | Bacteria | 744 |
| 870 | Ga0373927_0000331 | 3300035695 | Bacteria | 37139 |
| 871 | Ga0373927_0017298 | 3300035695 | Bacteria | 4746 |
| 872 | Ga0373927_0099987 | 3300035695 | Bacteria | 1886 |
| 873 | Ga0373927_0212010 | 3300035695 | Bacteria | 1272 |
| 874 | Ga0373933_0000272 | 3300035724 | Bacteria | 33654 |
| 875 | Ga0373933_0001601 | 3300035724 | Bacteria | 13262 |
| 876 | Ga0373933_0056075 | 3300035724 | Bacteria | 2364 |
| 877 | Ga0373933_0062081 | 3300035724 | Bacteria | 2256 |
| 878 | Ga0373947_0002830 | 3300035725 | Bacteria | 10355 |
| 879 | Ga0373947_0036532 | 3300035725 | Bacteria | 2913 |
| 880 | Ga0373947_0072974 | 3300035725 | Bacteria | 2108 |
| 881 | Ga0373947_0124719 | 3300035725 | Bacteria | 1639 |
| 882 | Ga0373937_0075562 | 3300036401 | Bacteria | 3110 |
| 883 | Ga0373937_0114039 | 3300036401 | Bacteria | 2515 |
| 884 | Ga0373937_0242409 | 3300036401 | Bacteria | 1698 |
| 885 | Ga0373925_0005476 | 3300037068 | Bacteria | 9451 |
| 886 | Ga0373925_0115175 | 3300037068 | Bacteria | 2081 |
| 887 | Ga0373925_0434489 | 3300037068 | Bacteria | 1074 |
| 888 | Ga0373925_0447373 | 3300037068 | Bacteria | 1058 |
| 889 | Ga0395899_0426396 | 3300037312 | Bacteria | 873 |
| 890 | Ga0395900_0001409 | 3300037418 | Bacteria | 28756 |
| 891 | Ga0395900_0080025 | 3300037418 | Bacteria | 3358 |
| 892 | Ga0395900_0646174 | 3300037418 | Bacteria | 995 |
| 893 | Ga0395898_0016001 | 3300037466 | Bacteria | 7683 |
| 894 | Ga0395898_0022213 | 3300037466 | Bacteria | 6430 |
| 895 | Ga0395898_0169178 | 3300037466 | Bacteria | 2089 |
| 896 | Ga0395898_0450917 | 3300037466 | Bacteria | 1225 |
| 897 | Ga0395898_0847546 | 3300037466 | Bacteria | 853 |
| 898 | Ga0395905_0015288 | 3300037471 | Bacteria | 7298 |
| 899 | Ga0395905_0022704 | 3300037471 | Bacteria | 5932 |
| 900 | Ga0395905_0209687 | 3300037471 | Bacteria | 1825 |
| 901 | Ga0436364_0714264 | 3300037853 | Bacteria | 1020 |
| 902 | Ga0436364_1290753 | 3300037853 | Bacteria | 1799 |
| 903 | Ga0436364_1508788 | 3300037853 | Bacteria | 3253 |
| 904 | Ga0395901_0118315 | 3300038443 | Bacteria | 2784 |
| 905 | Ga0395901_0185780 | 3300038443 | Bacteria | 2180 |
| 906 | Ga0395901_0318823 | 3300038443 | Bacteria | 1609 |
| 907 | Ga0395901_0632203 | 3300038443 | Bacteria | 1076 |
| 908 | Ga0436365_0399697 | 3300039437 | Bacteria | 12936 |
| 909 | Ga0436365_0399885 | 3300039437 | Bacteria | 5357 |
| 910 | Ga0436365_0718616 | 3300039437 | Bacteria | 3684 |
| 911 | Ga0436365_1142792 | 3300039437 | Bacteria | 1450 |
| 912 | Ga0436365_1622924 | 3300039437 | Bacteria | 3437 |
| 913 | Ga0436360_0221727 | 3300039438 | Bacteria | 2099 |
| 914 | Ga0436360_1241329 | 3300039438 | Bacteria | 1369 |
| 915 | Ga0436361_0214631 | 3300039447 | Bacteria | 935 |
| 916 | Ga0436361_0596678 | 3300039447 | Bacteria | 2424 |
| 917 | Ga0436361_0805829 | 3300039447 | Bacteria | 1794 |
| 918 | Ga0436361_1066979 | 3300039447 | Bacteria | 1761 |
| 919 | Ga0436361_1196720 | 3300039447 | Bacteria | 2051 |
| 920 | Ga0436363_0057188 | 3300039450 | Bacteria | 1029 |
| 921 | Ga0436363_0624071 | 3300039450 | Bacteria | 2252 |
| 922 | Ga0436363_0658047 | 3300039450 | Bacteria | 8838 |
| 923 | Ga0436363_1036919 | 3300039450 | Bacteria | 1158 |
| 924 | Ga0436362_0661692 | 3300039453 | Bacteria | 4324 |
| 925 | Ga0439465_0013288 | 3300041413 | Bacteria | 2570 |
| 926 | Ga0439465_0069947 | 3300041413 | Bacteria | 1175 |
| 927 | Ga0451787_242297 | 3300041441 | Bacteria | 956 |
| 928 | Ga0451789_0688189 | 3300041443 | Bacteria | 748 |
| 929 | Ga0451797_1213215 | 3300041453 | Bacteria | 713 |
| 930 | Ga0451795_1269232 | 3300041456 | Bacteria | 680 |
| 931 | Ga0451800_1245814 | 3300041459 | Bacteria | 1027 |
| 932 | Ga0451807_1676953 | 3300041486 | Bacteria | 900 |
| 933 | Ga0451833_1413762 | 3300041491 | Bacteria | 867 |
| 934 | Ga0451835_0009829 | 3300041492 | Bacteria | 847 |
| 935 | Ga0451841_0980059 | 3300041498 | Bacteria | 1173 |
| 936 | Ga0451851_0421058 | 3300041507 | Bacteria | 816 |
| 937 | Ga0451855_1803437 | 3300041511 | Bacteria | 842 |
| 938 | Ga0439455_0076042 | 3300042012 | Bacteria | 908 |
| 939 | Ga0439464_0160469 | 3300042439 | Bacteria | 706 |
| 940 | Ga0466969_0289749 | 3300044656 | Bacteria | 741 |
| 941 | Ga0466972_0002296 | 3300044658 | Bacteria | 9399 |
| 942 | Ga0466972_0002508 | 3300044658 | Bacteria | 9076 |
| 943 | Ga0466965_0040508 | 3300044683 | Bacteria | 2293 |
| 944 | Ga0466965_0188537 | 3300044683 | Bacteria | 1090 |
| 945 | Ga0466966_0001161 | 3300044684 | Bacteria | 16930 |
| 946 | Ga0466961_0000122 | 3300044693 | Bacteria | 52002 |
| 947 | Ga0466961_0109605 | 3300044693 | Bacteria | 1738 |
| 948 | Ga0466961_0117507 | 3300044693 | Bacteria | 1671 |
| 949 | Ga0466961_0132983 | 3300044693 | Bacteria | 1559 |
| 950 | Ga0466963_0077502 | 3300044694 | Bacteria | 2246 |
| 951 | Ga0466963_0141905 | 3300044694 | Bacteria | 1664 |
| 952 | Ga0466963_0283387 | 3300044694 | Bacteria | 1165 |
| 953 | Ga0466964_0100364 | 3300044706 | Bacteria | 1275 |
| 954 | Ga0466971_0328087 | 3300044719 | Bacteria | 738 |
| 955 | Ga0466968_0075537 | 3300044735 | Bacteria | 1473 |
| 956 | Ga0466968_0256153 | 3300044735 | Bacteria | 832 |
| 957 | Ga0466970_0118069 | 3300044765 | Bacteria | 1452 |
| 958 | Ga0466970_0254556 | 3300044765 | Bacteria | 984 |
| 959 | Ga0466957_0033326 | 3300044842 | Bacteria | 3090 |
| 960 | Ga0466957_0159521 | 3300044842 | Bacteria | 1464 |
| 961 | Ga0466957_0694343 | 3300044842 | Bacteria | 718 |
| 962 | Ga0466960_0164191 | 3300044901 | Bacteria | 1194 |
| 963 | Ga0466959_0031376 | 3300045049 | Bacteria | 3933 |
| 964 | Ga0466959_0420980 | 3300045049 | Bacteria | 907 |
| 965 | Ga0466967_0007117 | 3300045976 | Bacteria | 8028 |
| 966 | Ga0466967_0051636 | 3300045976 | Bacteria | 3604 |
| 967 | Ga0466967_0106705 | 3300045976 | Bacteria | 2568 |
| 968 | Ga0466967_0333879 | 3300045976 | Bacteria | 1464 |
| 969 | Ga0466967_0991496 | 3300045976 | Bacteria | 836 |
| 970 | Ga0495617_071502 | 3300046452 | Bacteria | 1141 |
| 971 | Ga0495617_096590 | 3300046452 | Bacteria | 962 |
| 972 | Ga0495627_079840 | 3300046453 | Bacteria | 949 |
| 973 | Ga0495592_0006060 | 3300046454 | Bacteria | 8992 |
| 974 | Ga0495592_0060220 | 3300046454 | Bacteria | 2793 |
| 975 | Ga0495592_0100066 | 3300046454 | Bacteria | 2067 |
| 976 | Ga0495592_0266270 | 3300046454 | Bacteria | 1126 |
| 977 | Ga0495603_0000643 | 3300046455 | Bacteria | 19657 |
| 978 | Ga0495603_0007318 | 3300046455 | Bacteria | 6637 |
| 979 | Ga0495603_0026372 | 3300046455 | Bacteria | 3511 |
| 980 | Ga0495603_0083545 | 3300046455 | Bacteria | 1870 |
| 981 | Ga0495603_0244015 | 3300046455 | Bacteria | 1034 |
| 982 | Ga0495603_0300588 | 3300046455 | Bacteria | 922 |
| 983 | Ga0495629_0000423 | 3300046459 | Bacteria | 35258 |
| 984 | Ga0495629_0023037 | 3300046459 | Bacteria | 4438 |
| 985 | Ga0495629_0065217 | 3300046459 | Bacteria | 2542 |
| 986 | Ga0495629_0170379 | 3300046459 | Bacteria | 1511 |
| 987 | Ga0495638_0013901 | 3300046460 | Bacteria | 5460 |
| 988 | Ga0495638_0062748 | 3300046460 | Bacteria | 2293 |
| 989 | Ga0495638_0375025 | 3300046460 | Bacteria | 745 |
| 990 | Ga0495641_0003178 | 3300046461 | Bacteria | 12492 |
| 991 | Ga0495641_0047305 | 3300046461 | Bacteria | 1975 |
| 992 | Ga0495641_0171543 | 3300046461 | Bacteria | 971 |
| 993 | Ga0495651_0018521 | 3300046462 | Bacteria | 5394 |
| 994 | Ga0495651_0063923 | 3300046462 | Bacteria | 2812 |
| 995 | Ga0495651_0097792 | 3300046462 | Bacteria | 2191 |
| 996 | Ga0495651_0102783 | 3300046462 | Bacteria | 2124 |
| 997 | Ga0495653_0018392 | 3300046463 | Bacteria | 5675 |
| 998 | Ga0495580_0001799 | 3300046472 | Bacteria | 18843 |
| 999 | Ga0495580_0002433 | 3300046472 | Bacteria | 16271 |
| 1000 | Ga0495580_0152666 | 3300046472 | Bacteria | 1600 |
| 1001 | Ga0495582_0000166 | 3300046473 | Bacteria | 35616 |
| 1002 | Ga0495582_0037791 | 3300046473 | Bacteria | 2656 |
| 1003 | Ga0495582_0142450 | 3300046473 | Bacteria | 1359 |
| 1004 | Ga0495582_0255736 | 3300046473 | Bacteria | 1005 |
| 1005 | Ga0495582_0577989 | 3300046473 | Bacteria | 650 |
| 1006 | Ga0495605_0067389 | 3300046474 | Bacteria | 1698 |
| 1007 | Ga0495605_0173215 | 3300046474 | Bacteria | 952 |
| 1008 | Ga0495639_0000306 | 3300046475 | Bacteria | 23854 |
| 1009 | Ga0495639_0015399 | 3300046475 | Bacteria | 3317 |
| 1010 | Ga0495639_0020088 | 3300046475 | Bacteria | 2918 |
| 1011 | Ga0495639_0124853 | 3300046475 | Bacteria | 1229 |
| 1012 | Ga0495639_0202963 | 3300046475 | Bacteria | 971 |
| 1013 | Ga0495662_0001733 | 3300046476 | Bacteria | 10893 |
| 1014 | Ga0495664_0008302 | 3300046477 | Bacteria | 5792 |
| 1015 | Ga0495664_0011786 | 3300046477 | Bacteria | 4936 |
| 1016 | Ga0495664_0028238 | 3300046477 | Bacteria | 3277 |
| 1017 | Ga0495664_0566331 | 3300046477 | Bacteria | 676 |
| 1018 | Ga0495584_0071051 | 3300046491 | Bacteria | 1749 |
| 1019 | Ga0495585_0011742 | 3300046492 | Bacteria | 5177 |
| 1020 | Ga0495594_0114992 | 3300046499 | Bacteria | 1518 |
| 1021 | Ga0495594_0178357 | 3300046499 | Bacteria | 1209 |
| 1022 | Ga0495594_0189179 | 3300046499 | Bacteria | 1172 |
| 1023 | Ga0495607_0371548 | 3300046501 | Bacteria | 656 |
| 1024 | Ga0495583_0066842 | 3300046506 | Bacteria | 1589 |
| 1025 | Ga0495606_0001165 | 3300046507 | Bacteria | 37175 |
| 1026 | Ga0495606_0057024 | 3300046507 | Bacteria | 2517 |
| 1027 | Ga0495606_0160737 | 3300046507 | Bacteria | 1311 |
| 1028 | Ga0495606_0370993 | 3300046507 | Bacteria | 753 |
| 1029 | Ga0495608_0014159 | 3300046511 | Bacteria | 5533 |
| 1030 | Ga0495608_0127357 | 3300046511 | Bacteria | 1631 |
| 1031 | Ga0495610_0101016 | 3300046512 | Bacteria | 1292 |
| 1032 | Ga0495618_0027782 | 3300046514 | Bacteria | 3523 |
| 1033 | Ga0495618_0141073 | 3300046514 | Bacteria | 1541 |
| 1034 | Ga0495618_0180921 | 3300046514 | Bacteria | 1340 |
| 1035 | Ga0495620_0074997 | 3300046515 | Bacteria | 1377 |
| 1036 | Ga0495628_0011146 | 3300046516 | Bacteria | 7611 |
| 1037 | Ga0495628_0033876 | 3300046516 | Bacteria | 4112 |
| 1038 | Ga0495628_0245871 | 3300046516 | Bacteria | 1337 |
| 1039 | Ga0495628_0424438 | 3300046516 | Bacteria | 969 |
| 1040 | Ga0495630_0019236 | 3300046517 | Bacteria | 5019 |
| 1041 | Ga0495630_0025234 | 3300046517 | Bacteria | 4394 |
| 1042 | Ga0495630_0041197 | 3300046517 | Bacteria | 3449 |
| 1043 | Ga0495630_0172807 | 3300046517 | Bacteria | 1647 |
| 1044 | Ga0495631_0192977 | 3300046518 | Bacteria | 872 |
| 1045 | Ga0495632_0045002 | 3300046519 | Bacteria | 2200 |
| 1046 | Ga0495637_0183975 | 3300046520 | Bacteria | 774 |
| 1047 | Ga0495637_0200816 | 3300046520 | Bacteria | 733 |
| 1048 | Ga0495643_0006526 | 3300046522 | Bacteria | 7675 |
| 1049 | Ga0495643_0077701 | 3300046522 | Bacteria | 1734 |
| 1050 | Ga0495643_0166971 | 3300046522 | Bacteria | 1079 |
| 1051 | Ga0495644_0030518 | 3300046523 | Bacteria | 2035 |
| 1052 | Ga0495648_0001607 | 3300046524 | Bacteria | 21994 |
| 1053 | Ga0495648_0120840 | 3300046524 | Bacteria | 1408 |
| 1054 | Ga0495663_0006353 | 3300046525 | Bacteria | 3265 |
| 1055 | Ga0495666_0221560 | 3300046526 | Bacteria | 866 |
| 1056 | Ga0495642_0136749 | 3300046528 | Bacteria | 1057 |
| 1057 | Ga0495642_0153253 | 3300046528 | Bacteria | 997 |
| 1058 | Ga0495652_0017206 | 3300046529 | Bacteria | 6454 |
| 1059 | Ga0495652_0029642 | 3300046529 | Bacteria | 4806 |
| 1060 | Ga0495652_0080914 | 3300046529 | Bacteria | 2681 |
| 1061 | Ga0495652_0184890 | 3300046529 | Bacteria | 1596 |
| 1062 | Ga0495652_0336032 | 3300046529 | Bacteria | 1087 |
| 1063 | Ga0495652_0498270 | 3300046529 | Bacteria | 845 |
| 1064 | Ga0495665_0000104 | 3300046531 | Bacteria | 39624 |
| 1065 | Ga0495665_0008245 | 3300046531 | Bacteria | 5648 |
| 1066 | Ga0495640_0003774 | 3300046533 | Bacteria | 12154 |
| 1067 | Ga0495640_0004857 | 3300046533 | Bacteria | 10694 |
| 1068 | Ga0495640_0046380 | 3300046533 | Bacteria | 3011 |
| 1069 | Ga0495640_0048913 | 3300046533 | Bacteria | 2918 |
| 1070 | Ga0495640_0206452 | 3300046533 | Bacteria | 1243 |
| 1071 | Ga0495586_0145771 | 3300046535 | Bacteria | 1330 |
| 1072 | Ga0495586_0182301 | 3300046535 | Bacteria | 1188 |
| 1073 | Ga0495586_0452994 | 3300046535 | Bacteria | 740 |
| 1074 | Ga0495587_0005400 | 3300046536 | Bacteria | 8347 |
| 1075 | Ga0495587_0021455 | 3300046536 | Bacteria | 3983 |
| 1076 | Ga0495587_0071501 | 3300046536 | Bacteria | 2018 |
| 1077 | Ga0495598_0054622 | 3300046537 | Bacteria | 1213 |
| 1078 | Ga0495609_0076111 | 3300046538 | Bacteria | 1471 |
| 1079 | Ga0495621_0056842 | 3300046539 | Bacteria | 1411 |
| 1080 | Ga0495597_0072882 | 3300046542 | Bacteria | 1477 |
| 1081 | Ga0495645_0012922 | 3300046543 | Bacteria | 5895 |
| 1082 | Ga0495645_0013919 | 3300046543 | Bacteria | 5702 |
| 1083 | Ga0495645_0050490 | 3300046543 | Bacteria | 3029 |
| 1084 | Ga0495645_0097937 | 3300046543 | Bacteria | 2088 |
| 1085 | Ga0495645_0196720 | 3300046543 | Bacteria | 1370 |
| 1086 | Ga0495645_0462691 | 3300046543 | Bacteria | 798 |
| 1087 | Ga0495622_0008182 | 3300046557 | Bacteria | 4845 |
| 1088 | Ga0495622_0011773 | 3300046557 | Bacteria | 4044 |
| 1089 | Ga0495622_0202431 | 3300046557 | Bacteria | 884 |
| 1090 | Ga0495633_0055762 | 3300046558 | Bacteria | 1857 |
| 1091 | Ga0495633_0065233 | 3300046558 | Bacteria | 1702 |
| 1092 | Ga0495667_0006655 | 3300046559 | Bacteria | 7843 |
| 1093 | Ga0495667_0012970 | 3300046559 | Bacteria | 5650 |
| 1094 | Ga0495667_0019422 | 3300046559 | Bacteria | 4586 |
| 1095 | Ga0495667_0263017 | 3300046559 | Bacteria | 1097 |
| 1096 | Ga0495656_0018530 | 3300046615 | Bacteria | 2674 |
| 1097 | Ga0495656_0044808 | 3300046615 | Bacteria | 1864 |
| 1098 | Ga0495656_0046176 | 3300046615 | Bacteria | 1842 |
| 1099 | Ga0495668_0032483 | 3300046616 | Bacteria | 2937 |
| 1100 | Ga0495668_0266383 | 3300046616 | Bacteria | 938 |
| 1101 | Ga0495668_0475102 | 3300046616 | Bacteria | 688 |
| 1102 | Ga0495634_0001166 | 3300046642 | Bacteria | 24340 |
| 1103 | Ga0495634_0003095 | 3300046642 | Bacteria | 13527 |
| 1104 | Ga0495634_0020585 | 3300046642 | Bacteria | 4676 |
| 1105 | Ga0495634_0027792 | 3300046642 | Bacteria | 3933 |
| 1106 | Ga0495634_0160568 | 3300046642 | Bacteria | 1417 |
| 1107 | Ga0495634_0207835 | 3300046642 | Bacteria | 1213 |
| 1108 | Ga0495611_0018145 | 3300046648 | Bacteria | 3015 |
| 1109 | Ga0495611_0082437 | 3300046648 | Bacteria | 1480 |
| 1110 | Ga0495611_0117002 | 3300046648 | Bacteria | 1242 |
| 1111 | Ga0495611_0137730 | 3300046648 | Bacteria | 1140 |
| 1112 | Ga0495611_0173584 | 3300046648 | Bacteria | 1007 |
| 1113 | Ga0495625_0464380 | 3300046660 | Bacteria | 780 |
| 1114 | Ga0495635_0005385 | 3300046663 | Bacteria | 8902 |
| 1115 | Ga0495635_0020868 | 3300046663 | Bacteria | 4564 |
| 1116 | Ga0495661_0216994 | 3300046665 | Bacteria | 993 |
| 1117 | Ga0495588_0006415 | 3300046674 | Bacteria | 5295 |
| 1118 | Ga0495588_0023772 | 3300046674 | Bacteria | 3037 |
| 1119 | Ga0495588_0071367 | 3300046674 | Bacteria | 1806 |
| 1120 | Ga0495588_0278065 | 3300046674 | Bacteria | 882 |
| 1121 | Ga0495657_0006260 | 3300046675 | Bacteria | 9325 |
| 1122 | Ga0495657_0009904 | 3300046675 | Bacteria | 7190 |
| 1123 | Ga0495657_0073411 | 3300046675 | Bacteria | 2228 |
| 1124 | Ga0495599_0002627 | 3300046678 | Bacteria | 10471 |
| 1125 | Ga0495599_0023553 | 3300046678 | Bacteria | 3850 |
| 1126 | Ga0495599_0057760 | 3300046678 | Bacteria | 2428 |
| 1127 | Ga0495623_0008151 | 3300046679 | Bacteria | 6812 |
| 1128 | Ga0495623_0081378 | 3300046679 | Bacteria | 2002 |
| 1129 | Ga0495623_0109486 | 3300046679 | Bacteria | 1675 |
| 1130 | Ga0495623_0245280 | 3300046679 | Bacteria | 1010 |
| 1131 | Ga0495646_0007324 | 3300046680 | Bacteria | 7012 |
| 1132 | Ga0495646_0009165 | 3300046680 | Bacteria | 6281 |
| 1133 | Ga0495646_0012636 | 3300046680 | Bacteria | 5364 |
| 1134 | Ga0495646_0112490 | 3300046680 | Bacteria | 1549 |
| 1135 | Ga0495646_0201686 | 3300046680 | Bacteria | 1083 |
| 1136 | Ga0495646_0210213 | 3300046680 | Bacteria | 1056 |
| 1137 | Ga0495646_0320992 | 3300046680 | Bacteria | 816 |
| 1138 | Ga0495647_0000279 | 3300046681 | Bacteria | 14215 |
| 1139 | Ga0495647_0169176 | 3300046681 | Bacteria | 945 |
| 1140 | Ga0495658_0001753 | 3300046683 | Bacteria | 11214 |
| 1141 | Ga0495658_0027075 | 3300046683 | Bacteria | 3080 |
| 1142 | Ga0495658_0237902 | 3300046683 | Bacteria | 1143 |
| 1143 | Ga0495658_0373899 | 3300046683 | Bacteria | 907 |
| 1144 | Ga0495669_0028505 | 3300046684 | Bacteria | 2446 |
| 1145 | Ga0495669_0050303 | 3300046684 | Bacteria | 1868 |
| 1146 | Ga0495669_0155461 | 3300046684 | Bacteria | 1084 |
| 1147 | Ga0495669_0347624 | 3300046684 | Bacteria | 717 |
| 1148 | Ga0495613_0010689 | 3300046689 | Bacteria | 6808 |
| 1149 | Ga0495613_0024352 | 3300046689 | Bacteria | 4510 |
| 1150 | Ga0495613_0059911 | 3300046689 | Bacteria | 2789 |
| 1151 | Ga0495613_0068687 | 3300046689 | Bacteria | 2584 |
| 1152 | Ga0495624_0003536 | 3300046690 | Bacteria | 11576 |
| 1153 | Ga0495624_0128140 | 3300046690 | Bacteria | 1557 |
| 1154 | Ga0495670_0104656 | 3300046691 | Bacteria | 1460 |
| 1155 | Ga0495671_0364914 | 3300046692 | Bacteria | 692 |
| 1156 | Ga0495649_0058471 | 3300046694 | Bacteria | 2077 |
| 1157 | Ga0495649_0245039 | 3300046694 | Bacteria | 922 |
| 1158 | Ga0495589_0081267 | 3300046794 | Bacteria | 1577 |
| 1159 | Ga0495589_0172047 | 3300046794 | Bacteria | 1029 |
| 1160 | Ga0495589_0188277 | 3300046794 | Bacteria | 977 |
| 1161 | Ga0495589_0267994 | 3300046794 | Bacteria | 795 |
| 1162 | Ga0495600_0007519 | 3300046809 | Bacteria | 6669 |
| 1163 | Ga0495600_0011987 | 3300046809 | Bacteria | 5413 |
| 1164 | Ga0495600_0030566 | 3300046809 | Bacteria | 3488 |
| 1165 | Ga0495600_0104558 | 3300046809 | Bacteria | 1845 |
| 1166 | Ga0495600_0337440 | 3300046809 | Bacteria | 945 |
| 1167 | Ga0495600_0502733 | 3300046809 | Bacteria | 745 |
| 1168 | Ga0495581_0001274 | 3300047315 | Bacteria | 13870 |
| 1169 | Ga0495581_0069513 | 3300047315 | Bacteria | 2036 |
| 1170 | Ga0495581_0136915 | 3300047315 | Bacteria | 1428 |
| 1171 | Ga0495581_0355063 | 3300047315 | Bacteria | 856 |
| 1172 | Ga0495604_0015618 | 3300047317 | Bacteria | 6062 |
| 1173 | Ga0495604_0023252 | 3300047317 | Bacteria | 4944 |
| 1174 | Ga0495604_0047709 | 3300047317 | Bacteria | 3335 |
| 1175 | Ga0495604_0093657 | 3300047317 | Bacteria | 2222 |
| 1176 | Ga0495604_0100091 | 3300047317 | Bacteria | 2132 |
| 1177 | Ga0495604_0163680 | 3300047317 | Bacteria | 1570 |
| 1178 | Ga0495604_0333366 | 3300047317 | Bacteria | 1011 |
| 1179 | Ga0495674_0001108 | 3300047319 | Bacteria | 25886 |
| 1180 | Ga0495674_0007311 | 3300047319 | Bacteria | 10559 |
| 1181 | Ga0495674_0013620 | 3300047319 | Bacteria | 7639 |
| 1182 | Ga0495674_0018772 | 3300047319 | Bacteria | 6434 |
| 1183 | Ga0495674_0492951 | 3300047319 | Bacteria | 981 |
| 1184 | Ga0495672_0033034 | 3300047320 | Bacteria | 3210 |
| 1185 | Ga0495672_0058738 | 3300047320 | Bacteria | 2228 |
| 1186 | Ga0495672_0081722 | 3300047320 | Bacteria | 1798 |
| 1187 | Ga0495676_0120116 | 3300047321 | Bacteria | 1913 |
| 1188 | Ga0495676_0213893 | 3300047321 | Bacteria | 1332 |
| 1189 | Ga0495676_0222644 | 3300047321 | Bacteria | 1299 |
| 1190 | Ga0495676_0237537 | 3300047321 | Bacteria | 1249 |
| 1191 | Ga0495676_0414273 | 3300047321 | Bacteria | 892 |
| 1192 | Ga0495680_0023259 | 3300047322 | Bacteria | 5154 |
| 1193 | Ga0495680_0049923 | 3300047322 | Bacteria | 3274 |
| 1194 | Ga0495680_0059483 | 3300047322 | Bacteria | 2950 |
| 1195 | Ga0495683_0087307 | 3300047323 | Bacteria | 1515 |
| 1196 | Ga0495683_0268783 | 3300047323 | Bacteria | 742 |
| 1197 | Ga0495687_006361 | 3300047443 | Bacteria | 7260 |
| 1198 | Ga0495675_0009301 | 3300047444 | Bacteria | 6114 |
| 1199 | Ga0495675_0031499 | 3300047444 | Bacteria | 3385 |
| 1200 | Ga0495675_0239919 | 3300047444 | Bacteria | 1091 |
| 1201 | Ga0495677_0073571 | 3300047445 | Bacteria | 1275 |
| 1202 | Ga0495677_0177069 | 3300047445 | Bacteria | 826 |
| 1203 | Ga0495685_084712 | 3300047447 | Bacteria | 1054 |
| 1204 | Ga0495685_136405 | 3300047447 | Bacteria | 801 |
| 1205 | Ga0495673_0091133 | 3300047469 | Bacteria | 1245 |
| 1206 | Ga0495681_0041391 | 3300047470 | Bacteria | 2237 |
| 1207 | Ga0495684_0004305 | 3300047471 | Bacteria | 11116 |
| 1208 | Ga0495684_0004969 | 3300047471 | Bacteria | 10382 |
| 1209 | Ga0495684_0007463 | 3300047471 | Bacteria | 8467 |
| 1210 | Ga0495684_0068506 | 3300047471 | Bacteria | 2698 |
| 1211 | Ga0495684_0174848 | 3300047471 | Bacteria | 1594 |
| 1212 | Ga0495686_0056468 | 3300047472 | Bacteria | 2453 |
| 1213 | Ga0495686_0059621 | 3300047472 | Bacteria | 2375 |
| 1214 | Ga0495593_0005960 | 3300047673 | Bacteria | 7176 |
| 1215 | Ga0495593_0030461 | 3300047673 | Bacteria | 2952 |
| 1216 | Ga0495593_0225388 | 3300047673 | Bacteria | 940 |
| 1217 | Ga0495602_0020065 | 3300048088 | Bacteria | 6612 |
| 1218 | Ga0495602_0024322 | 3300048088 | Bacteria | 5878 |
| 1219 | Ga0495602_0071388 | 3300048088 | Bacteria | 2965 |
| 1220 | Ga0495602_0178469 | 3300048088 | Bacteria | 1641 |
| 1221 | Ga0495602_0348805 | 3300048088 | Bacteria | 1069 |
| 1222 | Ga0495615_0099012 | 3300048090 | Bacteria | 821 |
| 1223 | Ga0495626_0078552 | 3300048091 | Bacteria | 1470 |
| 1224 | Ga0496100_0026737 | 3300048903 | Bacteria | 3541 |
| 1225 | Ga0496100_0068392 | 3300048903 | Bacteria | 2362 |
| 1226 | Ga0496100_0154041 | 3300048903 | Bacteria | 1642 |
| 1227 | Ga0496100_0169796 | 3300048903 | Bacteria | 1570 |
| 1228 | Ga0496100_0236845 | 3300048903 | Bacteria | 1345 |
| 1229 | Ga0496100_0250592 | 3300048903 | Bacteria | 1310 |
| 1230 | Ga0496101_0014243 | 3300048904 | Bacteria | 5343 |
| 1231 | Ga0496101_0026481 | 3300048904 | Bacteria | 4032 |
| 1232 | Ga0496101_0218397 | 3300048904 | Bacteria | 1479 |
| 1233 | Ga0496101_0463384 | 3300048904 | Bacteria | 1000 |
| 1234 | Ga0496101_0532423 | 3300048904 | Bacteria | 929 |
| 1235 | Ga0496101_0548522 | 3300048904 | Bacteria | 914 |
| 1236 | Ga0496102_0171207 | 3300048905 | Bacteria | 2044 |
| 1237 | Ga0496102_0302013 | 3300048905 | Bacteria | 1509 |
| 1238 | Ga0496102_0303152 | 3300048905 | Bacteria | 1506 |
| 1239 | Ga0496102_0336242 | 3300048905 | Bacteria | 1422 |
| 1240 | Ga0496102_0374382 | 3300048905 | Bacteria | 1340 |
| 1241 | Ga0496102_0393982 | 3300048905 | Bacteria | 1302 |
| 1242 | Ga0496102_0510705 | 3300048905 | Bacteria | 1124 |
| 1243 | Ga0496102_0581536 | 3300048905 | Bacteria | 1043 |
| 1244 | Ga0496102_0658222 | 3300048905 | Bacteria | 970 |
| 1245 | Ga0496102_0676882 | 3300048905 | Bacteria | 955 |
| 1246 | Ga0496102_0712275 | 3300048905 | Bacteria | 927 |
| 1247 | Ga0496102_0731202 | 3300048905 | Bacteria | 912 |
| 1248 | Ga0496102_0739674 | 3300048905 | Bacteria | 906 |
| 1249 | Ga0496102_0866495 | 3300048905 | Bacteria | 825 |
| 1250 | Ga0496103_0007813 | 3300048906 | Bacteria | 6356 |
| 1251 | Ga0496103_0109410 | 3300048906 | Bacteria | 1754 |
| 1252 | Ga0496103_0168973 | 3300048906 | Bacteria | 1404 |
| 1253 | Ga0496103_0418269 | 3300048906 | Bacteria | 860 |
| 1254 | Ga0496103_0457087 | 3300048906 | Bacteria | 819 |
| 1255 | Ga0496104_0000069 | 3300048907 | Bacteria | 107511 |
| 1256 | Ga0496104_0000126 | 3300048907 | Bacteria | 70488 |
| 1257 | Ga0496104_0020423 | 3300048907 | Bacteria | 6071 |
| 1258 | Ga0496104_0024223 | 3300048907 | Bacteria | 5582 |
| 1259 | Ga0496104_0024665 | 3300048907 | Bacteria | 5533 |
| 1260 | Ga0496104_0069473 | 3300048907 | Bacteria | 3348 |
| 1261 | Ga0496104_0244626 | 3300048907 | Bacteria | 1706 |
| 1262 | Ga0496104_0270371 | 3300048907 | Bacteria | 1612 |
| 1263 | Ga0496104_0352006 | 3300048907 | Bacteria | 1385 |
| 1264 | Ga0496104_1017755 | 3300048907 | Bacteria | 732 |
| 1265 | Ga0496105_0002028 | 3300048908 | Bacteria | 14636 |
| 1266 | Ga0496105_0013439 | 3300048908 | Bacteria | 6499 |
| 1267 | Ga0496105_0014292 | 3300048908 | Bacteria | 6318 |
| 1268 | Ga0496105_0036501 | 3300048908 | Bacteria | 4049 |
| 1269 | Ga0496105_0126206 | 3300048908 | Bacteria | 2109 |
| 1270 | Ga0496105_0161008 | 3300048908 | Bacteria | 1842 |
| 1271 | Ga0496105_0238303 | 3300048908 | Bacteria | 1477 |
| 1272 | Ga0496105_0256403 | 3300048908 | Bacteria | 1416 |
| 1273 | Ga0496106_0004544 | 3300048909 | Bacteria | 10282 |
| 1274 | Ga0496106_0005271 | 3300048909 | Bacteria | 9578 |
| 1275 | Ga0496106_0017568 | 3300048909 | Bacteria | 5292 |
| 1276 | Ga0496106_0035159 | 3300048909 | Bacteria | 3746 |
| 1277 | Ga0496106_0060391 | 3300048909 | Bacteria | 2874 |
| 1278 | Ga0496106_0078728 | 3300048909 | Bacteria | 2530 |
| 1279 | Ga0496106_0099436 | 3300048909 | Bacteria | 2255 |
| 1280 | Ga0496107_0004055 | 3300048910 | Bacteria | 9861 |
| 1281 | Ga0496107_0011451 | 3300048910 | Bacteria | 6179 |
| 1282 | Ga0496107_0014869 | 3300048910 | Bacteria | 5450 |
| 1283 | Ga0496107_0065498 | 3300048910 | Bacteria | 2634 |
| 1284 | Ga0496107_0331444 | 3300048910 | Bacteria | 1132 |
| 1285 | Ga0496108_0000884 | 3300048911 | Bacteria | 23347 |
| 1286 | Ga0496108_0008268 | 3300048911 | Bacteria | 8439 |
| 1287 | Ga0496108_0013923 | 3300048911 | Bacteria | 6560 |
| 1288 | Ga0496108_0076007 | 3300048911 | Bacteria | 2838 |
| 1289 | Ga0496108_0154316 | 3300048911 | Bacteria | 1982 |
| 1290 | Ga0496108_0273262 | 3300048911 | Bacteria | 1471 |
| 1291 | Ga0496108_0315879 | 3300048911 | Bacteria | 1362 |
| 1292 | Ga0496108_0696693 | 3300048911 | Bacteria | 881 |
| 1293 | Ga0496109_0000166 | 3300048912 | Bacteria | 64848 |
| 1294 | Ga0496109_0005742 | 3300048912 | Bacteria | 10384 |
| 1295 | Ga0496109_0009117 | 3300048912 | Bacteria | 8449 |
| 1296 | Ga0496109_0210328 | 3300048912 | Bacteria | 1829 |
| 1297 | Ga0496109_1081603 | 3300048912 | Bacteria | 739 |
| 1298 | Ga0496109_1248153 | 3300048912 | Bacteria | 679 |
| 1299 | Ga0496110_0004672 | 3300048913 | Bacteria | 10648 |
| 1300 | Ga0496110_0014170 | 3300048913 | Bacteria | 6614 |
| 1301 | Ga0496110_0030062 | 3300048913 | Bacteria | 4681 |
| 1302 | Ga0496110_0051382 | 3300048913 | Bacteria | 3622 |
| 1303 | Ga0496110_0258575 | 3300048913 | Bacteria | 1585 |
| 1304 | Ga0496110_0379547 | 3300048913 | Bacteria | 1288 |
| 1305 | Ga0496110_0470706 | 3300048913 | Bacteria | 1145 |
| 1306 | Ga0496110_0806318 | 3300048913 | Bacteria | 843 |
| 1307 | Ga0496111_0004234 | 3300048914 | Bacteria | 9035 |
| 1308 | Ga0496111_0057082 | 3300048914 | Bacteria | 2826 |
| 1309 | Ga0496111_0169041 | 3300048914 | Bacteria | 1624 |
| 1310 | Ga0496111_0264936 | 3300048914 | Bacteria | 1275 |
| 1311 | Ga0496111_0470712 | 3300048914 | Bacteria | 926 |
| 1312 | Ga0496111_0576079 | 3300048914 | Bacteria | 825 |
| 1313 | Ga0496112_0000092 | 3300048915 | Bacteria | 58800 |
| 1314 | Ga0496112_0001913 | 3300048915 | Bacteria | 16432 |
| 1315 | Ga0496112_0009707 | 3300048915 | Bacteria | 8689 |
| 1316 | Ga0496112_0057575 | 3300048915 | Bacteria | 3826 |
| 1317 | Ga0496112_0144824 | 3300048915 | Bacteria | 2344 |
| 1318 | Ga0496112_0216321 | 3300048915 | Bacteria | 1872 |
| 1319 | Ga0496112_0313559 | 3300048915 | Bacteria | 1513 |
| 1320 | Ga0496112_0325415 | 3300048915 | Bacteria | 1481 |
| 1321 | Ga0496112_0363999 | 3300048915 | Bacteria | 1388 |
| 1322 | Ga0496112_0395479 | 3300048915 | Bacteria | 1322 |
| 1323 | Ga0496113_0026817 | 3300048916 | Bacteria | 4124 |
| 1324 | Ga0496113_0075256 | 3300048916 | Bacteria | 2576 |
| 1325 | Ga0496113_0110315 | 3300048916 | Bacteria | 2141 |
| 1326 | Ga0496113_0143961 | 3300048916 | Bacteria | 1877 |
| 1327 | Ga0496113_0197455 | 3300048916 | Bacteria | 1598 |
| 1328 | Ga0496113_0203178 | 3300048916 | Bacteria | 1575 |
| 1329 | Ga0496113_0467907 | 3300048916 | Bacteria | 1013 |
| 1330 | Ga0496113_0473984 | 3300048916 | Bacteria | 1006 |
| 1331 | Ga0496113_0523193 | 3300048916 | Bacteria | 952 |
| 1332 | Ga0496114_0032707 | 3300048917 | Bacteria | 4282 |
| 1333 | Ga0496114_0061856 | 3300048917 | Bacteria | 3132 |
| 1334 | Ga0496114_0065928 | 3300048917 | Bacteria | 3035 |
| 1335 | Ga0496114_0105449 | 3300048917 | Bacteria | 2411 |
| 1336 | Ga0496114_0166482 | 3300048917 | Bacteria | 1919 |
| 1337 | Ga0496114_0207630 | 3300048917 | Bacteria | 1717 |
| 1338 | Ga0496115_0001497 | 3300048918 | Bacteria | 16782 |
| 1339 | Ga0496115_0014260 | 3300048918 | Bacteria | 6017 |
| 1340 | Ga0496115_0145424 | 3300048918 | Bacteria | 1956 |
| 1341 | Ga0496115_0179211 | 3300048918 | Bacteria | 1752 |
| 1342 | Ga0496115_0267078 | 3300048918 | Bacteria | 1406 |
| 1343 | Ga0496115_0323333 | 3300048918 | Bacteria | 1261 |
| 1344 | Ga0496117_0182188 | 3300048920 | Bacteria | 1206 |
| 1345 | Ga0496118_0037797 | 3300048921 | Bacteria | 3879 |
| 1346 | Ga0496118_0180127 | 3300048921 | Bacteria | 1278 |
| 1347 | Ga0496118_0248905 | 3300048921 | Bacteria | 1011 |
| 1348 | Ga0496118_0269933 | 3300048921 | Bacteria | 954 |
| 1349 | Ga0496118_0412744 | 3300048921 | Bacteria | 697 |
| 1350 | Ga0496119_0004322 | 3300048922 | Bacteria | 14186 |
| 1351 | Ga0496119_0017486 | 3300048922 | Bacteria | 5390 |
| 1352 | Ga0496119_0036093 | 3300048922 | Bacteria | 3231 |
| 1353 | Ga0496120_0032833 | 3300048923 | Bacteria | 3125 |
| 1354 | Ga0496120_0076945 | 3300048923 | Bacteria | 1817 |
| 1355 | Ga0496121_0001158 | 3300048924 | Bacteria | 46235 |
| 1356 | Ga0496121_0021799 | 3300048924 | Bacteria | 6256 |
| 1357 | Ga0496121_0036524 | 3300048924 | Bacteria | 4377 |
| 1358 | Ga0496121_0046842 | 3300048924 | Bacteria | 3696 |
| 1359 | Ga0496121_0052743 | 3300048924 | Bacteria | 3412 |
| 1360 | Ga0496121_0064779 | 3300048924 | Bacteria | 2978 |
| 1361 | Ga0496121_0070499 | 3300048924 | Bacteria | 2815 |
| 1362 | Ga0496121_0076273 | 3300048924 | Bacteria | 2673 |
| 1363 | Ga0496121_0098311 | 3300048924 | Bacteria | 2265 |
| 1364 | Ga0496121_0109790 | 3300048924 | Bacteria | 2106 |
| 1365 | Ga0496121_0118735 | 3300048924 | Bacteria | 2001 |
| 1366 | Ga0496121_0128458 | 3300048924 | Bacteria | 1902 |
| 1367 | Ga0496121_0134288 | 3300048924 | Bacteria | 1846 |
| 1368 | Ga0496121_0200920 | 3300048924 | Bacteria | 1421 |
| 1369 | Ga0496122_0362827 | 3300048925 | Bacteria | 751 |
| 1370 | Ga0496123_0119933 | 3300048926 | Bacteria | 1482 |
| 1371 | Ga0496124_0058489 | 3300048927 | Bacteria | 3241 |
| 1372 | Ga0496124_0093164 | 3300048927 | Bacteria | 2452 |
| 1373 | Ga0496124_0162730 | 3300048927 | Bacteria | 1738 |
| 1374 | Ga0496124_0383865 | 3300048927 | Bacteria | 981 |
| 1375 | Ga0496124_0789310 | 3300048927 | Bacteria | 590 |
| 1376 | Ga0496125_0058918 | 3300048928 | Bacteria | 3098 |
| 1377 | Ga0496125_0101612 | 3300048928 | Bacteria | 2115 |
| 1378 | Ga0496126_0021248 | 3300048929 | Bacteria | 6343 |
| 1379 | Ga0496126_0027564 | 3300048929 | Bacteria | 5424 |
| 1380 | Ga0496126_0035540 | 3300048929 | Bacteria | 4669 |
| 1381 | Ga0496126_0058582 | 3300048929 | Bacteria | 3471 |
| 1382 | Ga0496126_0103744 | 3300048929 | Bacteria | 2484 |
| 1383 | Ga0496126_0154303 | 3300048929 | Bacteria | 1966 |
| 1384 | Ga0496126_0162968 | 3300048929 | Bacteria | 1904 |
| 1385 | Ga0496126_0231559 | 3300048929 | Bacteria | 1548 |
| 1386 | Ga0496126_0259698 | 3300048929 | Bacteria | 1445 |
| 1387 | Ga0496126_0338561 | 3300048929 | Bacteria | 1233 |
| 1388 | Ga0496126_0414179 | 3300048929 | Bacteria | 1091 |
| 1389 | Ga0496126_0519978 | 3300048929 | Bacteria | 948 |
| 1390 | Ga0496126_0540293 | 3300048929 | Bacteria | 926 |
| 1391 | Ga0496126_0545144 | 3300048929 | Bacteria | 921 |
| 1392 | Ga0496126_0964446 | 3300048929 | Bacteria | 642 |
| 1393 | Ga0495678_084196 | 3300049459 | Bacteria | 1135 |
| 1394 | Ga0495682_0064517 | 3300049460 | Bacteria | 1320 |
| 1395 | Ga0495682_0079238 | 3300049460 | Bacteria | 1182 |
| 1396 | Ga0495682_0193412 | 3300049460 | Bacteria | 722 |
| 1397 | Ga0501032_0580351 | 3300049569 | Bacteria | 714 |
| 1398 | Ga0501033_0150572 | 3300049570 | Bacteria | 1679 |
| 1399 | Ga0501034_0034045 | 3300049571 | Bacteria | 5166 |
| 1400 | Ga0501034_0891912 | 3300049571 | Bacteria | 778 |
| 1401 | Ga0501036_0237091 | 3300049572 | Bacteria | 1530 |
| 1402 | Ga0501037_0408957 | 3300049573 | Bacteria | 930 |
| 1403 | Ga0501038_0700286 | 3300049574 | Bacteria | 759 |
| 1404 | Ga0501040_0214192 | 3300049576 | Bacteria | 1370 |
| 1405 | Ga0501043_0756978 | 3300049579 | Bacteria | 706 |
| 1406 | Ga0501047_0015759 | 3300049581 | Bacteria | 7204 |
| 1407 | Ga0501047_0049372 | 3300049581 | Bacteria | 4063 |
| 1408 | Ga0501069_0323490 | 3300049585 | Bacteria | 906 |
| 1409 | Ga0501070_0006105 | 3300049586 | Bacteria | 10269 |
| 1410 | Ga0501070_0083794 | 3300049586 | Bacteria | 2640 |
| 1411 | Ga0501071_0171870 | 3300049587 | Bacteria | 1622 |
| 1412 | Ga0501074_0043902 | 3300049590 | Bacteria | 3236 |
| 1413 | Ga0501074_0392062 | 3300049590 | Bacteria | 985 |
| 1414 | Ga0501035_0026147 | 3300049822 | Bacteria | 5344 |
| 1415 | Ga0501035_0483430 | 3300049822 | Bacteria | 1021 |
| 1416 | Ga0501044_0105284 | 3300049823 | Bacteria | 2834 |
| 1417 | Ga0501044_0452447 | 3300049823 | Bacteria | 1190 |
| 1418 | Ga0501045_0734510 | 3300049824 | Bacteria | 728 |
| 1419 | nmdc:mga03683_209889_c1 | 3300050489 | Bacteria | 896 |
| 1420 | nmdc:mga03683_221296_c1 | 3300050489 | Bacteria | 873 |
| 1421 | nmdc:mga03683_31688_c2 | 3300050489 | Bacteria | 824 |
| 1422 | nmdc:mga03683_353013_c1 | 3300050489 | Bacteria | 696 |
| 1423 | nmdc:mga03683_71078_c1 | 3300050489 | Bacteria | 1488 |
| 1424 | nmdc:mga03n38_97972_c1 | 3300050490 | Bacteria | 1409 |
| 1425 | nmdc:mga00v17_197769_c1 | 3300050491 | Bacteria | 1299 |
| 1426 | nmdc:mga00v17_59104_c1 | 3300050491 | Bacteria | 2351 |
| 1427 | nmdc:mga00v17_631294_c1 | 3300050491 | Bacteria | 690 |
| 1428 | nmdc:mga0yw44_206148_c1 | 3300050492 | Bacteria | 1300 |
| 1429 | nmdc:mga0yw44_247782_c1 | 3300050492 | Bacteria | 1185 |
| 1430 | nmdc:mga0yw44_629110_c1 | 3300050492 | Bacteria | 729 |
| 1431 | nmdc:mga0yw44_653483_c1 | 3300050492 | Bacteria | 714 |
| 1432 | nmdc:mga0k408_133064_c1 | 3300050493 | Bacteria | 1477 |
| 1433 | nmdc:mga0k408_179750_c1 | 3300050493 | Bacteria | 1262 |
| 1434 | nmdc:mga0k408_18926_c1 | 3300050493 | Bacteria | 1527 |
| 1435 | nmdc:mga0k408_200604_c1 | 3300050493 | Bacteria | 1191 |
| 1436 | nmdc:mga0k408_404724_c1 | 3300050493 | Bacteria | 812 |
| 1437 | nmdc:mga0k408_505766_c1 | 3300050493 | Bacteria | 716 |
| 1438 | nmdc:mga0k408_73021_c1 | 3300050493 | Bacteria | 2004 |
| 1439 | nmdc:mga06z11_11035_c1 | 3300050494 | Bacteria | 3877 |
| 1440 | nmdc:mga06z11_61537_c1 | 3300050494 | Bacteria | 1958 |
| 1441 | nmdc:mga06z11_62894_c1 | 3300050494 | Bacteria | 1940 |
| 1442 | nmdc:mga04h51_51193_c1 | 3300050495 | Bacteria | 1387 |
| 1443 | nmdc:mga04h51_77007_c1 | 3300050495 | Bacteria | 1176 |
| 1444 | nmdc:mga04h51_78702_c1 | 3300050495 | Bacteria | 1166 |
| 1445 | nmdc:mga04h51_96333_c1 | 3300050495 | Bacteria | 1072 |
| 1446 | nmdc:mga07m45_105569_c1 | 3300050496 | Bacteria | 1620 |
| 1447 | nmdc:mga07m45_108751_c1 | 3300050496 | Bacteria | 1596 |
| 1448 | nmdc:mga07m45_113399_c1 | 3300050496 | Bacteria | 1563 |
| 1449 | nmdc:mga07m45_114194_c1 | 3300050496 | Bacteria | 1557 |
| 1450 | nmdc:mga07m45_25255_c1 | 3300050496 | Bacteria | 3257 |
| 1451 | nmdc:mga07m45_35516_c1 | 3300050496 | Bacteria | 2772 |
| 1452 | nmdc:mga07m45_8718_c1 | 3300050496 | Bacteria | 5224 |
| 1453 | nmdc:mga05p37_349995_c1 | 3300050507 | Bacteria | 1740 |
| 1454 | nmdc:mga0qj67_986413_c1 | 3300050509 | Bacteria | 661 |
| 1455 | nmdc:mga08y16_884119_c1 | 3300050511 | Bacteria | 881 |
| 1456 | nmdc:mga0n895_124354_c1 | 3300050512 | Bacteria | 2602 |
| 1457 | nmdc:mga0n895_14332_c1 | 3300050512 | Bacteria | 7196 |
| 1458 | nmdc:mga0n895_228752_c1 | 3300050512 | Bacteria | 1888 |
| 1459 | nmdc:mga0n895_29483_c1 | 3300050512 | Bacteria | 5235 |
| 1460 | nmdc:mga0n895_659535_c1 | 3300050512 | Bacteria | 1044 |
| 1461 | nmdc:mga0rr50_175839_c1 | 3300050513 | Bacteria | 1747 |
| 1462 | nmdc:mga0rr50_38374_c1 | 3300050513 | Bacteria | 3465 |
| 1463 | nmdc:mga0rr50_407471_c1 | 3300050513 | Bacteria | 1149 |
| 1464 | nmdc:mga08x19_85734_c1 | 3300050514 | Bacteria | 2073 |
| 1465 | nmdc:mga0a205_635069_c1 | 3300050515 | Bacteria | 919 |
| 1466 | nmdc:mga0sz30_124765_c1 | 3300050516 | Bacteria | 1133 |
| 1467 | nmdc:mga0sz30_12648_c1 | 3300050516 | Bacteria | 3287 |
| 1468 | nmdc:mga0sz30_49132_c1 | 3300050516 | Bacteria | 1215 |
| 1469 | nmdc:mga0sz30_52130_c1 | 3300050516 | Bacteria | 1737 |
| 1470 | Ga0495601_0069652 | 3300053077 | Bacteria | 2243 |
| 1471 | Ga0495601_0112890 | 3300053077 | Bacteria | 1761 |
| 1472 | Ga0495601_0212427 | 3300053077 | Bacteria | 1264 |
| 1473 | Ga0495601_0348248 | 3300053077 | Bacteria | 963 |
| 1474 | Ga0495612_0003490 | 3300053078 | Bacteria | 6515 |
| 1475 | Ga0495612_0007947 | 3300053078 | Bacteria | 4323 |
| 1476 | Ga0500610_0229951 | 3300053079 | Bacteria | 871 |
| 1477 | Ga0500635_0005867 | 3300053080 | Bacteria | 3253 |
| 1478 | Ga0500635_0021376 | 3300053080 | Bacteria | 1993 |
| 1479 | Ga0500635_0105523 | 3300053080 | Bacteria | 1041 |
| 1480 | Ga0500635_0264846 | 3300053080 | Bacteria | 675 |
| 1481 | Ga0495655_0129481 | 3300053083 | Bacteria | 776 |
| 1482 | Ga0495595_0000808 | 3300053084 | Bacteria | 11938 |
| 1483 | Ga0495595_0122241 | 3300053084 | Bacteria | 1268 |
| 1484 | Ga0495595_0347423 | 3300053084 | Bacteria | 748 |
| 1485 | Ga0495619_0032598 | 3300053085 | Bacteria | 3381 |
| 1486 | Ga0495619_0147365 | 3300053085 | Bacteria | 1623 |
| 1487 | Ga0495619_0209198 | 3300053085 | Bacteria | 1351 |
| 1488 | Ga0500578_0080223 | 3300053086 | Bacteria | 2076 |
| 1489 | Ga0500578_0222128 | 3300053086 | Bacteria | 1148 |
| 1490 | Ga0500643_000042 | 3300053087 | Bacteria | 158933 |
| 1491 | Ga0500643_069707 | 3300053087 | Bacteria | 977 |
| 1492 | Ga0500644_0111336 | 3300053088 | Bacteria | 1055 |
| 1493 | Ga0500646_0159789 | 3300053090 | Bacteria | 752 |
| 1494 | Ga0500647_0043524 | 3300053091 | Bacteria | 2155 |
| 1495 | Ga0500647_0059319 | 3300053091 | Bacteria | 1840 |
| 1496 | Ga0500583_0007131 | 3300053092 | Bacteria | 3905 |
| 1497 | Ga0500583_0059693 | 3300053092 | Bacteria | 1796 |
| 1498 | Ga0500651_0194250 | 3300053093 | Bacteria | 1200 |
| 1499 | Ga0500566_0000072 | 3300053094 | Bacteria | 48857 |
| 1500 | Ga0500566_0000264 | 3300053094 | Bacteria | 28047 |
| 1501 | Ga0500566_0002476 | 3300053094 | Bacteria | 10978 |
| 1502 | Ga0500566_0226593 | 3300053094 | Bacteria | 925 |
| 1503 | Ga0500640_034957 | 3300053095 | Bacteria | 2208 |
| 1504 | Ga0500640_127660 | 3300053095 | Bacteria | 1008 |
| 1505 | Ga0500641_0006798 | 3300053096 | Bacteria | 4068 |
| 1506 | Ga0500641_0090325 | 3300053096 | Bacteria | 1307 |
| 1507 | Ga0500650_0146739 | 3300053098 | Bacteria | 1092 |
| 1508 | Ga0500554_000273 | 3300053102 | Bacteria | 11165 |
| 1509 | Ga0500554_000792 | 3300053102 | Bacteria | 6252 |
| 1510 | Ga0500555_048190 | 3300053103 | Bacteria | 1171 |
| 1511 | Ga0500556_0115124 | 3300053104 | Bacteria | 1045 |
| 1512 | Ga0500557_000006 | 3300053105 | Bacteria | 141252 |
| 1513 | Ga0500569_060197 | 3300053109 | Bacteria | 1170 |
| 1514 | Ga0500572_000226 | 3300053111 | Bacteria | 19903 |
| 1515 | Ga0500572_000499 | 3300053111 | Bacteria | 13477 |
| 1516 | Ga0500591_043704 | 3300053115 | Bacteria | 2123 |
| 1517 | Ga0500595_000581 | 3300053119 | Bacteria | 21788 |
| 1518 | Ga0500595_003343 | 3300053119 | Bacteria | 7531 |
| 1519 | Ga0500595_015487 | 3300053119 | Bacteria | 2860 |
| 1520 | Ga0500595_072996 | 3300053119 | Bacteria | 1015 |
| 1521 | Ga0500595_097667 | 3300053119 | Bacteria | 844 |
| 1522 | Ga0500595_101390 | 3300053119 | Bacteria | 824 |
| 1523 | Ga0500607_049421 | 3300053121 | Bacteria | 2244 |
| 1524 | Ga0500608_092484 | 3300053122 | Bacteria | 1411 |
| 1525 | Ga0500614_003266 | 3300053123 | Bacteria | 3509 |
| 1526 | Ga0500642_0000068 | 3300053130 | Bacteria | 56277 |
| 1527 | Ga0500642_0077068 | 3300053130 | Bacteria | 1526 |
| 1528 | Ga0500658_0078768 | 3300053134 | Bacteria | 1405 |
| 1529 | Ga0500658_0087456 | 3300053134 | Bacteria | 1342 |
| 1530 | Ga0500559_0000155 | 3300053136 | Bacteria | 54058 |
| 1531 | Ga0500559_0001312 | 3300053136 | Bacteria | 14351 |
| 1532 | Ga0500559_0041811 | 3300053136 | Bacteria | 1998 |
| 1533 | Ga0500559_0101422 | 3300053136 | Bacteria | 1326 |
| 1534 | Ga0500564_042947 | 3300053138 | Bacteria | 2078 |
| 1535 | Ga0500568_0007584 | 3300053139 | Bacteria | 5309 |
| 1536 | Ga0500568_0171546 | 3300053139 | Bacteria | 798 |
| 1537 | Ga0500579_134954 | 3300053143 | Bacteria | 1138 |
| 1538 | Ga0500586_000095 | 3300053145 | Bacteria | 15393 |
| 1539 | Ga0500589_142501 | 3300053147 | Bacteria | 986 |
| 1540 | Ga0500590_025218 | 3300053148 | Bacteria | 3086 |
| 1541 | Ga0500590_034455 | 3300053148 | Bacteria | 2621 |
| 1542 | Ga0500590_243575 | 3300053148 | Bacteria | 721 |
| 1543 | Ga0500603_000346 | 3300053150 | Bacteria | 12097 |
| 1544 | Ga0500603_000767 | 3300053150 | Bacteria | 7724 |
| 1545 | Ga0500603_022200 | 3300053150 | Bacteria | 1569 |
| 1546 | Ga0500620_006327 | 3300053155 | Bacteria | 2831 |
| 1547 | Ga0500622_0026006 | 3300053156 | Bacteria | 3090 |
| 1548 | Ga0500627_0168806 | 3300053158 | Bacteria | 986 |
| 1549 | Ga0500630_000703 | 3300053159 | Bacteria | 15308 |
| 1550 | Ga0500633_0038617 | 3300053160 | Bacteria | 1592 |
| 1551 | Ga0500638_000737 | 3300053162 | Bacteria | 8836 |
| 1552 | Ga0500638_048030 | 3300053162 | Bacteria | 2065 |
| 1553 | Ga0500639_000029 | 3300053163 | Bacteria | 76014 |
| 1554 | Ga0500639_132881 | 3300053163 | Bacteria | 1176 |
| 1555 | Ga0500639_178363 | 3300053163 | Bacteria | 943 |
| 1556 | Ga0500639_194307 | 3300053163 | Bacteria | 880 |
| 1557 | Ga0500636_0007750 | 3300053177 | Bacteria | 6209 |
| 1558 | Ga0500636_0141455 | 3300053177 | Bacteria | 1331 |
| 1559 | Ga0500636_0159938 | 3300053177 | Bacteria | 1229 |
| 1560 | Ga0500637_0000163 | 3300053178 | Bacteria | 24481 |
| 1561 | Ga0500637_0094437 | 3300053178 | Bacteria | 1732 |
| 1562 | Ga0500649_085632 | 3300053722 | Bacteria | 1274 |
| 1563 | Ga0500576_065134 | 3300053725 | Bacteria | 1582 |
| 1564 | Ga0500576_163368 | 3300053725 | Bacteria | 813 |
| 1565 | Ga0500576_163874 | 3300053725 | Bacteria | 811 |
| 1566 | Ga0500625_011281 | 3300053729 | Bacteria | 4054 |
| 1567 | Ga0500645_020102 | 3300053730 | Bacteria | 2071 |
| 1568 | Ga0500645_068952 | 3300053730 | Bacteria | 1016 |
| 1569 | Ga0500609_002715 | 3300053731 | Bacteria | 2521 |
| 1570 | Ga0500609_006564 | 3300053731 | Bacteria | 1584 |
| 1571 | Ga0500601_020389 | 3300053737 | Bacteria | 764 |
| 1572 | Ga0500661_003807 | 3300055283 | Bacteria | 2833 |
| 1573 | Ga0587080_088941 | 3300059503 | Bacteria | 645 |
| 1574 | Ga0501082_0503461 | 3300060353 | Bacteria | 1059 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005458 | Ga0070681_10583189 | Ga0070681_105831892 | 160 |
| 2 | 3300005530 | Ga0070679_100055132 | Ga0070679_1000551322 | 160 |
| 3 | 3300025912 | Ga0207707_10052912 | Ga0207707_100529122 | 160 |
| 4 | 3300006358 | Ga0068871_100796548 | Ga0068871_1007965481 | 171 |
| 5 | 3300009176 | Ga0105242_10110621 | Ga0105242_101106215 | 171 |
| 6 | 3300025961 | Ga0207712_10110047 | Ga0207712_101100473 | 171 |
| 7 | 3300039447 | Ga0436361_1196720 | Ga0436361_1196720_501_1145 | 173 |
| 8 | 3300039450 | Ga0436363_0624071 | Ga0436363_0624071_1308_1952 | 173 |
| 9 | 3300050493 | nmdc:mga0k408_505766_c1 | nmdc:mga0k408_505766_c1_182_706 | 174 |
| 10 | 3300005327 | Ga0070658_10282156 | Ga0070658_102821562 | 177 |
| 11 | 3300005337 | Ga0070682_100188729 | Ga0070682_1001887292 | 177 |
| 12 | 3300005338 | Ga0068868_100180111 | Ga0068868_1001801112 | 177 |
| 13 | 3300005355 | Ga0070671_100115480 | Ga0070671_1001154802 | 177 |
| 14 | 3300005455 | Ga0070663_100149178 | Ga0070663_1001491782 | 177 |
| 15 | 3300005547 | Ga0070693_100028629 | Ga0070693_1000286291 | 177 |
| 16 | 3300005564 | Ga0070664_100202018 | Ga0070664_1002020182 | 177 |
| 17 | 3300005834 | Ga0068851_10437577 | Ga0068851_104375771 | 177 |
| 18 | 3300009177 | Ga0105248_11739186 | Ga0105248_117391861 | 177 |
| 19 | 3300009545 | Ga0105237_10396181 | Ga0105237_103961812 | 177 |
| 20 | 3300010375 | Ga0105239_10020532 | Ga0105239_100205322 | 177 |
| 21 | 3300011119 | Ga0105246_10003035 | Ga0105246_100030352 | 177 |
| 22 | 3300013308 | Ga0157375_11204890 | Ga0157375_112048901 | 177 |
| 23 | 3300014325 | Ga0163163_10019430 | Ga0163163_100194302 | 177 |
| 24 | 3300014969 | Ga0157376_10009146 | Ga0157376_100091467 | 177 |
| 25 | 3300025914 | Ga0207671_10431940 | Ga0207671_104319402 | 177 |
| 26 | 3300025931 | Ga0207644_10058382 | Ga0207644_100583823 | 177 |
| 27 | 3300025945 | Ga0207679_10252345 | Ga0207679_102523451 | 177 |
| 28 | 3300026067 | Ga0207678_10166968 | Ga0207678_101669682 | 177 |
| 29 | 3300026095 | Ga0207676_10027761 | Ga0207676_100277612 | 177 |
| 30 | 3300026121 | Ga0207683_10018433 | Ga0207683_100184336 | 177 |
| 31 | 3300026142 | Ga0207698_10307542 | Ga0207698_103075422 | 177 |
| 32 | 3300048904 | Ga0496101_0014243 | Ga0496101_0014243_1227_1826 | 177 |
| 33 | 3300048906 | Ga0496103_0007813 | Ga0496103_0007813_1769_2368 | 177 |
| 34 | 3300048907 | Ga0496104_0024665 | Ga0496104_0024665_269_868 | 177 |
| 35 | 3300048908 | Ga0496105_0013439 | Ga0496105_0013439_4536_5135 | 177 |
| 36 | 3300048909 | Ga0496106_0017568 | Ga0496106_0017568_417_1016 | 177 |
| 37 | 3300048910 | Ga0496107_0065498 | Ga0496107_0065498_1541_2140 | 177 |
| 38 | 3300048911 | Ga0496108_0008268 | Ga0496108_0008268_3447_4046 | 177 |
| 39 | 3300048912 | Ga0496109_0009117 | Ga0496109_0009117_4241_4840 | 177 |
| 40 | 3300048913 | Ga0496110_0014170 | Ga0496110_0014170_4478_5077 | 177 |
| 41 | 3300048914 | Ga0496111_0004234 | Ga0496111_0004234_4361_4960 | 177 |
| 42 | 3300048915 | Ga0496112_0216321 | Ga0496112_0216321_377_976 | 177 |
| 43 | 3300048916 | Ga0496113_0197455 | Ga0496113_0197455_987_1586 | 177 |
| 44 | 3300048917 | Ga0496114_0065928 | Ga0496114_0065928_2196_2795 | 177 |
| 45 | 3300048918 | Ga0496115_0001497 | Ga0496115_0001497_4393_4992 | 177 |
| 46 | 3300021377 | Ga0213874_10020432 | Ga0213874_100204322 | 179 |
| 47 | 3300046533 | Ga0495640_0046380 | Ga0495640_0046380_2462_3001 | 179 |
| 48 | 3300046680 | Ga0495646_0210213 | Ga0495646_0210213_11_550 | 179 |
| 49 | 3300046684 | Ga0495669_0050303 | Ga0495669_0050303_1178_1786 | 179 |
| 50 | 3300046533 | Ga0495640_0206452 | Ga0495640_0206452_677_1222 | 181 |
| 51 | 3300048929 | Ga0496126_0964446 | Ga0496126_0964446_65_616 | 181 |
| 52 | 3300048905 | Ga0496102_0171207 | Ga0496102_0171207_465_1031 | 182 |
| 53 | 3300046684 | Ga0495669_0347624 | Ga0495669_0347624_156_707 | 183 |
| 54 | 3300005435 | Ga0070714_100508149 | Ga0070714_1005081492 | 184 |
| 55 | 3300042439 | Ga0439464_0160469 | Ga0439464_0160469_128_682 | 184 |
| 56 | 3300046616 | Ga0495668_0475102 | Ga0495668_0475102_20_577 | 184 |
| 57 | 3300046683 | Ga0495658_0237902 | Ga0495658_0237902_562_1131 | 184 |
| 58 | 3300046684 | Ga0495669_0028505 | Ga0495669_0028505_1848_2417 | 184 |
| 59 | 3300046692 | Ga0495671_0364914 | Ga0495671_0364914_120_677 | 184 |
| 60 | 3300047445 | Ga0495677_0073571 | Ga0495677_0073571_25_582 | 184 |
| 61 | 3300048927 | Ga0496124_0789310 | Ga0496124_0789310_16_570 | 184 |
| 62 | 3300049572 | Ga0501036_0237091 | Ga0501036_0237091_165_719 | 184 |
| 63 | 3300050493 | nmdc:mga0k408_404724_c1 | nmdc:mga0k408_404724_c1_227_781 | 184 |
| 64 | 3300053079 | Ga0500610_0229951 | Ga0500610_0229951_286_840 | 184 |
| 65 | 3300053080 | Ga0500635_0264846 | Ga0500635_0264846_96_653 | 184 |
| 66 | 3300053090 | Ga0500646_0159789 | Ga0500646_0159789_26_583 | 184 |
| 67 | 3300053134 | Ga0500658_0078768 | Ga0500658_0078768_825_1382 | 184 |
| 68 | 3300005841 | Ga0068863_100988687 | Ga0068863_1009886872 | 192 |
| 69 | 3300006237 | Ga0097621_100023922 | Ga0097621_1000239227 | 192 |
| 70 | 3300013296 | Ga0157374_10007618 | Ga0157374_100076187 | 192 |
| 71 | 3300013306 | Ga0163162_10548363 | Ga0163162_105483632 | 192 |
| 72 | 3300014745 | Ga0157377_10166455 | Ga0157377_101664552 | 192 |
| 73 | 3300048918 | Ga0496115_0323333 | Ga0496115_0323333_287_901 | 192 |
| 74 | iso_pu_bacteria | 2728368998 | 2728754058 | 192 |
| 75 | 3300046809 | Ga0495600_0337440 | Ga0495600_0337440_248_835 | 195 |
| 76 | iso_pu_bacteria | 2507262055 | 2507507143 | 195 |
| 77 | iso_pu_bacteria | 2508501009 | 2508541193 | 195 |
| 78 | iso_pu_bacteria | 2508501042 | 2508693471 | 195 |
| 79 | iso_pu_bacteria | 2511231028 | 2511397690 | 195 |
| 80 | iso_pu_bacteria | 2513237092 | 2513629119 | 195 |
| 81 | iso_pu_bacteria | 2513237094 | 2513637240 | 195 |
| 82 | iso_pu_bacteria | 2513237095 | 2513651633 | 195 |
| 83 | iso_pu_bacteria | 2513237102 | 2513703050 | 195 |
| 84 | iso_pu_bacteria | 2513237104 | 2513717399 | 195 |
| 85 | iso_pu_bacteria | 2513237139 | 2513876795 | 195 |
| 86 | iso_pu_bacteria | 2515154112 | 2515628830 | 195 |
| 87 | iso_pu_bacteria | 2517093001 | 2517107386 | 195 |
| 88 | iso_pu_bacteria | 2524023205 | 2524439532 | 195 |
| 89 | iso_pu_bacteria | 2528768022 | 2528850996 | 195 |
| 90 | iso_pu_bacteria | 2617270735 | 2617348040 | 195 |
| 91 | iso_pu_bacteria | 2617270741 | 2617377728 | 195 |
| 92 | iso_pu_bacteria | 2744054633 | 2745081805 | 195 |
| 93 | iso_pu_bacteria | 2791355196 | 2793065995 | 195 |
| 94 | iso_pu_bacteria | 2802429603 | 2805918775 | 195 |
| 95 | iso_pu_bacteria | 2816332527 | 2818243226 | 195 |
| 96 | iso_pu_bacteria | 2824600985 | 2824605473 | 195 |
| 97 | iso_pu_bacteria | 2824609381 | 2824614811 | 195 |
| 98 | iso_pu_bacteria | 2824617872 | 2824622627 | 195 |
| 99 | iso_pu_bacteria | 2824626560 | 2824631790 | 195 |
| 100 | iso_pu_bacteria | 2824635225 | 2824638958 | 195 |
| 101 | iso_pu_bacteria | 2824644064 | 2824648105 | 195 |
| 102 | iso_pu_bacteria | 2824653114 | 2824658062 | 195 |
| 103 | iso_pu_bacteria | 2824661429 | 2824667904 | 195 |
| 104 | iso_pu_bacteria | 2824671348 | 2824673935 | 195 |
| 105 | iso_pu_bacteria | 2824679649 | 2824681684 | 195 |
| 106 | iso_pu_bacteria | 2824687955 | 2824690617 | 195 |
| 107 | iso_pu_bacteria | 2824696289 | 2824698138 | 195 |
| 108 | iso_pu_bacteria | 2824704595 | 2824707479 | 195 |
| 109 | iso_pu_bacteria | 2824714736 | 2824717942 | 195 |
| 110 | iso_pu_bacteria | 2824723954 | 2824727785 | 195 |
| 111 | iso_pu_bacteria | 2824732956 | 2824736672 | 195 |
| 112 | iso_pu_bacteria | 2824746037 | 2824746414 | 195 |
| 113 | iso_pu_bacteria | 2824753945 | 2824759260 | 195 |
| 114 | iso_pu_bacteria | 2824763712 | 2824769568 | 195 |
| 115 | iso_pu_bacteria | 2824773399 | 2824776151 | 195 |
| 116 | iso_pu_bacteria | 2838122688 | 2838126991 | 195 |
| 117 | iso_pu_bacteria | 2841941048 | 2841945529 | 195 |
| 118 | iso_pu_bacteria | 2841949485 | 2841954745 | 195 |
| 119 | iso_pu_bacteria | 2841957949 | 2841965839 | 195 |
| 120 | iso_pu_bacteria | 2841966195 | 2841972470 | 195 |
| 121 | iso_pu_bacteria | 2841974524 | 2841980554 | 195 |
| 122 | iso_pu_bacteria | 2841983080 | 2841988725 | 195 |
| 123 | iso_pu_bacteria | 2842038055 | 2842045014 | 195 |
| 124 | iso_pu_bacteria | 2842045827 | 2842052800 | 195 |
| 125 | iso_pu_bacteria | 2844315083 | 2844320544 | 195 |
| 126 | iso_pu_bacteria | 2847930680 | 2847938087 | 195 |
| 127 | iso_pu_bacteria | 2847939898 | 2847940003 | 195 |
| 128 | iso_pu_bacteria | 2849076700 | 2849077797 | 195 |
| 129 | iso_pu_bacteria | 2857509624 | 2857510974 | 195 |
| 130 | iso_pu_bacteria | 2874590934 | 2874596112 | 195 |
| 131 | iso_pu_bacteria | 2874612657 | 2874619022 | 195 |
| 132 | iso_pu_bacteria | 2874620515 | 2874625872 | 195 |
| 133 | iso_pu_bacteria | 2874628541 | 2874633156 | 195 |
| 134 | iso_pu_bacteria | 2874645413 | 2874650936 | 195 |
| 135 | iso_pu_bacteria | 2876761206 | 2876769121 | 195 |
| 136 | iso_pu_bacteria | 2876771140 | 2876776060 | 195 |
| 137 | iso_pu_bacteria | 2876818435 | 2876820668 | 195 |
| 138 | iso_pu_bacteria | 2879074833 | 2879080149 | 195 |
| 139 | iso_pu_bacteria | 2879083081 | 2879084366 | 195 |
| 140 | iso_pu_bacteria | 2879099564 | 2879101094 | 195 |
| 141 | iso_pu_bacteria | 2879127579 | 2879129922 | 195 |
| 142 | iso_pu_bacteria | 2879142872 | 2879147400 | 195 |
| 143 | iso_pu_bacteria | 2881364244 | 2881369391 | 195 |
| 144 | iso_pu_bacteria | 2881665667 | 2881672265 | 195 |
| 145 | iso_pu_bacteria | 2885366525 | 2885368481 | 195 |
| 146 | iso_pu_bacteria | 2885409591 | 2885410066 | 195 |
| 147 | iso_pu_bacteria | 2888378607 | 2888386037 | 195 |
| 148 | iso_pu_bacteria | 2888388044 | 2888392249 | 195 |
| 149 | iso_pu_bacteria | 2888419890 | 2888426153 | 195 |
| 150 | iso_pu_bacteria | 2903727486 | 2903732835 | 195 |
| 151 | iso_pu_bacteria | 2904666416 | 2904673768 | 195 |
| 152 | iso_pu_bacteria | 2904711408 | 2904717587 | 195 |
| 153 | iso_pu_bacteria | 2906602504 | 2906605634 | 195 |
| 154 | iso_pu_bacteria | 2906626472 | 2906628012 | 195 |
| 155 | iso_pu_bacteria | 2906643746 | 2906644067 | 195 |
| 156 | iso_pu_bacteria | 2908775508 | 2908782227 | 195 |
| 157 | iso_pu_bacteria | 2922368715 | 2922376365 | 195 |
| 158 | iso_pu_bacteria | 2922393267 | 2922399918 | 195 |
| 159 | iso_pu_bacteria | 2929615660 | 2929624021 | 195 |
| 160 | iso_pu_bacteria | 2929624759 | 2929633162 | 195 |
| 161 | iso_pu_bacteria | 2932784394 | 2932792668 | 195 |
| 162 | iso_pu_bacteria | 2932794094 | 2932797864 | 195 |
| 163 | iso_pu_bacteria | 2932801729 | 2932806399 | 195 |
| 164 | iso_pu_bacteria | 2932809354 | 2932815241 | 195 |
| 165 | iso_pu_bacteria | 2932818245 | 2932824480 | 195 |
| 166 | iso_pu_bacteria | 2932828146 | 2932832121 | 195 |
| 167 | iso_pu_bacteria | 2933577622 | 2933585922 | 195 |
| 168 | iso_pu_bacteria | 2935608549 | 2935610478 | 195 |
| 169 | iso_pu_bacteria | 2935616580 | 2935622059 | 195 |
| 170 | iso_pu_bacteria | 2935638405 | 2935643930 | 195 |
| 171 | iso_pu_bacteria | 2935648319 | 2935654320 | 195 |
| 172 | iso_pu_bacteria | 2935656913 | 2935663200 | 195 |
| 173 | iso_pu_bacteria | 2935665750 | 2935669154 | 195 |
| 174 | iso_pu_bacteria | 2935675223 | 2935683288 | 195 |
| 175 | iso_pu_bacteria | 2935684952 | 2935692229 | 195 |
| 176 | iso_pu_bacteria | 2935694250 | 2935700600 | 195 |
| 177 | iso_pu_bacteria | 2935703347 | 2935708770 | 195 |
| 178 | iso_pu_bacteria | 2935713505 | 2935720533 | 195 |
| 179 | iso_pu_bacteria | 2935722832 | 2935729814 | 195 |
| 180 | iso_pu_bacteria | 2935732158 | 2935739204 | 195 |
| 181 | iso_pu_bacteria | 2935741537 | 2935748255 | 195 |
| 182 | iso_pu_bacteria | 2935750917 | 2935758458 | 195 |
| 183 | iso_pu_bacteria | 2935760218 | 2935766115 | 195 |
| 184 | iso_pu_bacteria | 2935769743 | 2935770995 | 195 |
| 185 | iso_pu_bacteria | 2935777560 | 2935781162 | 195 |
| 186 | iso_pu_bacteria | 2935785616 | 2935786304 | 195 |
| 187 | iso_pu_bacteria | 2935793552 | 2935793899 | 195 |
| 188 | iso_pu_bacteria | 2935801545 | 2935805870 | 195 |
| 189 | iso_pu_bacteria | 2935810662 | 2935815571 | 195 |
| 190 | iso_pu_bacteria | 2935819856 | 2935823639 | 195 |
| 191 | iso_pu_bacteria | 2935827899 | 2935833182 | 195 |
| 192 | iso_pu_bacteria | 2935837841 | 2935843247 | 195 |
| 193 | iso_pu_bacteria | 2935847175 | 2935849165 | 195 |
| 194 | iso_pu_bacteria | 2935855204 | 2935860306 | 195 |
| 195 | iso_pu_bacteria | 2935864058 | 2935867704 | 195 |
| 196 | iso_pu_bacteria | 2935873716 | 2935878487 | 195 |
| 197 | iso_pu_bacteria | 2935883170 | 2935888406 | 195 |
| 198 | iso_pu_bacteria | 2935908558 | 2935912745 | 195 |
| 199 | iso_pu_bacteria | 2935916978 | 2935922936 | 195 |
| 200 | iso_pu_bacteria | 2935926038 | 2935930361 | 195 |
| 201 | iso_pu_bacteria | 2935934488 | 2935939261 | 195 |
| 202 | iso_pu_bacteria | 2935942939 | 2935946209 | 195 |
| 203 | iso_pu_bacteria | 2935951376 | 2935955546 | 195 |
| 204 | iso_pu_bacteria | 2935959822 | 2935966857 | 195 |
| 205 | iso_pu_bacteria | 2935967501 | 2935972083 | 195 |
| 206 | iso_pu_bacteria | 2935975950 | 2935976017 | 195 |
| 207 | iso_pu_bacteria | 2935984226 | 2935986492 | 195 |
| 208 | iso_pu_bacteria | 2935992306 | 2935998630 | 195 |
| 209 | iso_pu_bacteria | 2936002035 | 2936006936 | 195 |
| 210 | iso_pu_bacteria | 2936011229 | 2936017356 | 195 |
| 211 | iso_pu_bacteria | 2936019824 | 2936025858 | 195 |
| 212 | iso_pu_bacteria | 2936028420 | 2936034734 | 195 |
| 213 | iso_pu_bacteria | 2936037263 | 2936040809 | 195 |
| 214 | iso_pu_bacteria | 2936046547 | 2936052791 | 195 |
| 215 | iso_pu_bacteria | 2936055302 | 2936059986 | 195 |
| 216 | iso_pu_bacteria | 2940556831 | 2940564362 | 195 |
| 217 | iso_pu_bacteria | 2941531003 | 2941531742 | 195 |
| 218 | iso_pu_bacteria | 2941538514 | 2941544793 | 195 |
| 219 | iso_pu_bacteria | 3005483717 | 3005488395 | 195 |
| 220 | iso_pu_bacteria | 3005587118 | 3005594385 | 195 |
| 221 | iso_pu_bacteria | 3005594810 | 3005600937 | 195 |
| 222 | iso_pu_bacteria | 3005710791 | 3005716330 | 195 |
| 223 | iso_pu_bacteria | 3005718088 | 3005723721 | 195 |
| 224 | iso_pu_bacteria | 8016511872 | 8016520044 | 195 |
| 225 | iso_pu_bacteria | 8016522445 | 8016527964 | 195 |
| 226 | iso_pu_bacteria | 8016530956 | 8016533087 | 195 |
| 227 | iso_pu_bacteria | 8016539877 | 8016546321 | 195 |
| 228 | iso_pu_bacteria | 8016548790 | 8016555807 | 195 |
| 229 | iso_pu_bacteria | 8016566248 | 8016571400 | 195 |
| 230 | iso_pu_bacteria | 8016575299 | 8016575660 | 195 |
| 231 | iso_pu_bacteria | 8016583857 | 8016595052 | 195 |
| 232 | iso_pu_bacteria | 8016595262 | 8016601858 | 195 |
| 233 | iso_pu_bacteria | 8016603502 | 8016608391 | 195 |
| 234 | iso_pu_bacteria | 8016613128 | 8016616475 | 195 |
| 235 | iso_pu_bacteria | 8016622563 | 8016624663 | 195 |
| 236 | iso_pu_bacteria | 8016630954 | 8016638154 | 195 |
| 237 | iso_pu_bacteria | 8017057580 | 8017065509 | 195 |
| 238 | iso_pu_bacteria | 8019530166 | 8019532885 | 195 |
| 239 | iso_pu_bacteria | 8019538911 | 8019546966 | 195 |
| 240 | iso_pu_bacteria | 8019547302 | 8019551702 | 195 |
| 241 | iso_pu_bacteria | 8019576017 | 8019584913 | 195 |
| 242 | iso_pu_bacteria | 8019586578 | 8019592867 | 195 |
| 243 | iso_pu_bacteria | 8019597564 | 8019598591 | 195 |
| 244 | iso_pu_bacteria | 8019608314 | 8019609783 | 195 |
| 245 | iso_pu_bacteria | 8019619141 | 8019620368 | 195 |
| 246 | iso_pu_bacteria | 8019629233 | 8019632735 | 195 |
| 247 | iso_pu_bacteria | 8019638758 | 8019647195 | 195 |
| 248 | iso_pu_bacteria | 8019648815 | 8019655491 | 195 |
| 249 | iso_pu_bacteria | 8019659431 | 8019660600 | 195 |
| 250 | iso_pu_bacteria | 8019668869 | 8019670021 | 195 |
| 251 | iso_pu_bacteria | 8019678201 | 8019686081 | 195 |
| 252 | iso_pu_bacteria | 8055742211 | 8055744507 | 195 |
| 253 | iso_pu_bacteria | 8056967851 | 8056970450 | 195 |
| 254 | 3300007076 | Ga0075435_100260755 | Ga0075435_1002607552 | 196 |
| 255 | 3300025906 | Ga0207699_10596127 | Ga0207699_105961272 | 196 |
| 256 | 3300025922 | Ga0207646_10179696 | Ga0207646_101796963 | 196 |
| 257 | 3300044694 | Ga0466963_0077502 | Ga0466963_0077502_294_911 | 196 |
| 258 | 3300045976 | Ga0466967_0106705 | Ga0466967_0106705_1807_2424 | 196 |
| 259 | 3300050513 | nmdc:mga0rr50_38374_c1 | nmdc:mga0rr50_38374_c1_2431_3024 | 196 |
| 260 | iso_pu_bacteria | 2524023210 | 2524469204 | 196 |
| 261 | iso_pu_bacteria | 2903768456 | 2903770070 | 196 |
| 262 | iso_pu_bacteria | 8006926726 | 8006932597 | 196 |
| 263 | iso_pu_bacteria | 8056681323 | 8056682138 | 196 |
| 264 | 3300039447 | Ga0436361_0214631 | Ga0436361_0214631_36_656 | 197 |
| 265 | iso_pu_bacteria | 2508501128 | 2509147089 | 197 |
| 266 | iso_pu_bacteria | 2513237096 | 2513655818 | 197 |
| 267 | iso_pu_bacteria | 2513237098 | 2513672017 | 197 |
| 268 | iso_pu_bacteria | 2513237101 | 2513696478 | 197 |
| 269 | iso_pu_bacteria | 2513237137 | 2513856686 | 197 |
| 270 | iso_pu_bacteria | 2513237141 | 2513887520 | 197 |
| 271 | iso_pu_bacteria | 2513237145 | 2513917269 | 197 |
| 272 | iso_pu_bacteria | 2517572143 | 2517895447 | 197 |
| 273 | iso_pu_bacteria | 2524023228 | 2524539623 | 197 |
| 274 | iso_pu_bacteria | 2643221651 | 2644287320 | 197 |
| 275 | iso_pu_bacteria | 2667528175 | 2671122123 | 197 |
| 276 | iso_pu_bacteria | 2721755755 | 2723842984 | 197 |
| 277 | iso_pu_bacteria | 2728368998 | 2728754396 | 197 |
| 278 | iso_pu_bacteria | 2791355197 | 2793069426 | 197 |
| 279 | iso_pu_bacteria | 2791355199 | 2793082461 | 197 |
| 280 | iso_pu_bacteria | 2874604998 | 2874606361 | 197 |
| 281 | iso_pu_bacteria | 2876808645 | 2876809330 | 197 |
| 282 | iso_pu_bacteria | 2879110137 | 2879118134 | 197 |
| 283 | iso_pu_bacteria | 2885374607 | 2885382181 | 197 |
| 284 | iso_pu_bacteria | 2885383462 | 2885383694 | 197 |
| 285 | iso_pu_bacteria | 2889033259 | 2889033719 | 197 |
| 286 | iso_pu_bacteria | 2889033259 | 2889042250 | 197 |
| 287 | iso_pu_bacteria | 2903748898 | 2903751328 | 197 |
| 288 | iso_pu_bacteria | 2904690495 | 2904698792 | 197 |
| 289 | iso_pu_bacteria | 2904699407 | 2904710913 | 197 |
| 290 | iso_pu_bacteria | 2906610324 | 2906615932 | 197 |
| 291 | iso_pu_bacteria | 2906635258 | 2906639029 | 197 |
| 292 | iso_pu_bacteria | 2906660503 | 2906662077 | 197 |
| 293 | iso_pu_bacteria | 2908756301 | 2908758043 | 197 |
| 294 | iso_pu_bacteria | 2922361189 | 2922367080 | 197 |
| 295 | iso_pu_bacteria | 2922386360 | 2922390142 | 197 |
| 296 | iso_pu_bacteria | 2922425934 | 2922432095 | 197 |
| 297 | iso_pu_bacteria | 2935630451 | 2935631028 | 197 |
| 298 | iso_pu_bacteria | 2941507105 | 2941507680 | 197 |
| 299 | iso_pu_bacteria | 2941515067 | 2941516107 | 197 |
| 300 | iso_pu_bacteria | 2941523033 | 2941523185 | 197 |
| 301 | iso_pu_bacteria | 3005474847 | 3005476882 | 197 |
| 302 | iso_pu_bacteria | 8006964411 | 8006966618 | 197 |
| 303 | iso_pu_bacteria | 8006984368 | 8006989462 | 197 |
| 304 | iso_pu_bacteria | 8006994254 | 8006997929 | 197 |
| 305 | iso_pu_bacteria | 8019555841 | 8019564142 | 197 |
| 306 | iso_pu_bacteria | 8019565922 | 8019574218 | 197 |
| 307 | iso_pu_bacteria | 8056673599 | 8056674957 | 197 |
| 308 | iso_pu_bacteria | 8056689827 | 8056694586 | 197 |
| 309 | 3300005434 | Ga0070709_10447408 | Ga0070709_104474081 | 198 |
| 310 | 3300005435 | Ga0070714_100106539 | Ga0070714_1001065393 | 198 |
| 311 | 3300005436 | Ga0070713_100014512 | Ga0070713_1000145125 | 198 |
| 312 | 3300005439 | Ga0070711_100231149 | Ga0070711_1002311492 | 198 |
| 313 | 3300006871 | Ga0075434_100023687 | Ga0075434_1000236874 | 198 |
| 314 | 3300009545 | Ga0105237_10234989 | Ga0105237_102349892 | 198 |
| 315 | 3300009551 | Ga0105238_10600758 | Ga0105238_106007581 | 198 |
| 316 | 3300017792 | Ga0163161_10831299 | Ga0163161_108312991 | 198 |
| 317 | 3300025916 | Ga0207663_10459399 | Ga0207663_104593992 | 198 |
| 318 | 3300025928 | Ga0207700_10020194 | Ga0207700_100201942 | 198 |
| 319 | 3300025929 | Ga0207664_10137539 | Ga0207664_101375393 | 198 |
| 320 | 3300037853 | Ga0436364_0714264 | Ga0436364_0714264_251_853 | 198 |
| 321 | 3300047317 | Ga0495604_0100091 | Ga0495604_0100091_1125_1733 | 198 |
| 322 | 3300048907 | Ga0496104_0000069 | Ga0496104_0000069_936_1532 | 198 |
| 323 | 3300048907 | Ga0496104_0244626 | Ga0496104_0244626_229_825 | 198 |
| 324 | 3300048908 | Ga0496105_0002028 | Ga0496105_0002028_8275_8871 | 198 |
| 325 | 3300048908 | Ga0496105_0161008 | Ga0496105_0161008_646_1242 | 198 |
| 326 | 3300048917 | Ga0496114_0032707 | Ga0496114_0032707_147_743 | 198 |
| 327 | 3300048918 | Ga0496115_0014260 | Ga0496115_0014260_4376_4972 | 198 |
| 328 | 3300048922 | Ga0496119_0004322 | Ga0496119_0004322_9065_9661 | 198 |
| 329 | 3300050512 | nmdc:mga0n895_14332_c1 | nmdc:mga0n895_14332_c1_5383_5985 | 198 |
| 330 | 3300001979 | JGI24740J21852_10093049 | JGI24740J21852_100930491 | 199 |
| 331 | 3300001989 | JGI24739J22299_10073834 | JGI24739J22299_100738342 | 199 |
| 332 | 3300002067 | JGI24735J21928_10056643 | JGI24735J21928_100566432 | 199 |
| 333 | 3300003214 | JGI25165J46597_1004815 | JGI25165J46597_10048152 | 199 |
| 334 | 3300003215 | JGI25153J46596_10008025 | JGI25153J46596_100080252 | 199 |
| 335 | 3300003215 | JGI25153J46596_10021145 | JGI25153J46596_100211452 | 199 |
| 336 | 3300003354 | JGI25160J50197_1002006 | JGI25160J50197_10020062 | 199 |
| 337 | 3300003354 | JGI25160J50197_1020040 | JGI25160J50197_10200402 | 199 |
| 338 | 3300003759 | Ga0055525_1005132 | Ga0055525_10051322 | 199 |
| 339 | 3300003771 | Ga0055526_1032557 | Ga0055526_10325572 | 199 |
| 340 | 3300003771 | Ga0055526_1053039 | Ga0055526_10530392 | 199 |
| 341 | 3300003775 | Ga0055524_1043256 | Ga0055524_10432562 | 199 |
| 342 | 3300003794 | Ga0055531_10008593 | Ga0055531_100085932 | 199 |
| 343 | 3300005262 | Ga0065165_1002451 | Ga0065165_100245113 | 199 |
| 344 | 3300005262 | Ga0065165_1002611 | Ga0065165_100261114 | 199 |
| 345 | 3300005262 | Ga0065165_1003698 | Ga0065165_10036982 | 199 |
| 346 | 3300005262 | Ga0065165_1032389 | Ga0065165_10323892 | 199 |
| 347 | 3300005328 | Ga0070676_10246739 | Ga0070676_102467392 | 199 |
| 348 | 3300005330 | Ga0070690_100085021 | Ga0070690_1000850211 | 199 |
| 349 | 3300005336 | Ga0070680_100850116 | Ga0070680_1008501161 | 199 |
| 350 | 3300005341 | Ga0070691_10192339 | Ga0070691_101923391 | 199 |
| 351 | 3300005347 | Ga0070668_100043305 | Ga0070668_1000433052 | 199 |
| 352 | 3300005355 | Ga0070671_100664784 | Ga0070671_1006647841 | 199 |
| 353 | 3300005356 | Ga0070674_100206666 | Ga0070674_1002066662 | 199 |
| 354 | 3300005366 | Ga0070659_100663637 | Ga0070659_1006636371 | 199 |
| 355 | 3300005434 | Ga0070709_10017233 | Ga0070709_100172332 | 199 |
| 356 | 3300005436 | Ga0070713_100305526 | Ga0070713_1003055262 | 199 |
| 357 | 3300005437 | Ga0070710_10261085 | Ga0070710_102610852 | 199 |
| 358 | 3300005438 | Ga0070701_10250245 | Ga0070701_102502452 | 199 |
| 359 | 3300005455 | Ga0070663_100258536 | Ga0070663_1002585361 | 199 |
| 360 | 3300005455 | Ga0070663_100816585 | Ga0070663_1008165851 | 199 |
| 361 | 3300005455 | Ga0070663_100883963 | Ga0070663_1008839631 | 199 |
| 362 | 3300005458 | Ga0070681_10041826 | Ga0070681_100418264 | 199 |
| 363 | 3300005458 | Ga0070681_10117787 | Ga0070681_101177871 | 199 |
| 364 | 3300005466 | Ga0070685_10520085 | Ga0070685_105200851 | 199 |
| 365 | 3300005471 | Ga0070698_100256842 | Ga0070698_1002568422 | 199 |
| 366 | 3300005530 | Ga0070679_100581139 | Ga0070679_1005811391 | 199 |
| 367 | 3300005535 | Ga0070684_100043585 | Ga0070684_1000435852 | 199 |
| 368 | 3300005535 | Ga0070684_101032896 | Ga0070684_1010328961 | 199 |
| 369 | 3300005536 | Ga0070697_100034848 | Ga0070697_1000348482 | 199 |
| 370 | 3300005539 | Ga0068853_100991364 | Ga0068853_1009913641 | 199 |
| 371 | 3300005543 | Ga0070672_100029567 | Ga0070672_1000295672 | 199 |
| 372 | 3300005548 | Ga0070665_100430402 | Ga0070665_1004304022 | 199 |
| 373 | 3300005548 | Ga0070665_100769820 | Ga0070665_1007698202 | 199 |
| 374 | 3300005548 | Ga0070665_100922947 | Ga0070665_1009229471 | 199 |
| 375 | 3300005614 | Ga0068856_100514096 | Ga0068856_1005140962 | 199 |
| 376 | 3300005615 | Ga0070702_100016652 | Ga0070702_1000166522 | 199 |
| 377 | 3300005616 | Ga0068852_100005393 | Ga0068852_1000053934 | 199 |
| 378 | 3300005616 | Ga0068852_100828087 | Ga0068852_1008280872 | 199 |
| 379 | 3300005841 | Ga0068863_100246090 | Ga0068863_1002460902 | 199 |
| 380 | 3300006028 | Ga0070717_10610335 | Ga0070717_106103352 | 199 |
| 381 | 3300006038 | Ga0075365_10038304 | Ga0075365_100383043 | 199 |
| 382 | 3300006038 | Ga0075365_10343482 | Ga0075365_103434822 | 199 |
| 383 | 3300006038 | Ga0075365_10458362 | Ga0075365_104583621 | 199 |
| 384 | 3300006048 | Ga0075363_100144620 | Ga0075363_1001446202 | 199 |
| 385 | 3300006051 | Ga0075364_10102762 | Ga0075364_101027622 | 199 |
| 386 | 3300006051 | Ga0075364_10266151 | Ga0075364_102661512 | 199 |
| 387 | 3300006163 | Ga0070715_10287884 | Ga0070715_102878842 | 199 |
| 388 | 3300006163 | Ga0070715_10297031 | Ga0070715_102970311 | 199 |
| 389 | 3300006175 | Ga0070712_100037108 | Ga0070712_1000371082 | 199 |
| 390 | 3300006177 | Ga0075362_10275439 | Ga0075362_102754391 | 199 |
| 391 | 3300006186 | Ga0075369_10035188 | Ga0075369_100351882 | 199 |
| 392 | 3300006186 | Ga0075369_10274705 | Ga0075369_102747051 | 199 |
| 393 | 3300006195 | Ga0075366_10134751 | Ga0075366_101347512 | 199 |
| 394 | 3300006353 | Ga0075370_10033798 | Ga0075370_100337982 | 199 |
| 395 | 3300006353 | Ga0075370_10349343 | Ga0075370_103493432 | 199 |
| 396 | 3300006881 | Ga0068865_100571982 | Ga0068865_1005719821 | 199 |
| 397 | 3300006941 | Ga0099825_1015919 | Ga0099825_10159192 | 199 |
| 398 | 3300006942 | Ga0099824_1028363 | Ga0099824_10283631 | 199 |
| 399 | 3300006944 | Ga0099823_1063315 | Ga0099823_10633151 | 199 |
| 400 | 3300009093 | Ga0105240_10018407 | Ga0105240_100184075 | 199 |
| 401 | 3300009093 | Ga0105240_11129475 | Ga0105240_111294751 | 199 |
| 402 | 3300009098 | Ga0105245_10300323 | Ga0105245_103003232 | 199 |
| 403 | 3300009148 | Ga0105243_10126375 | Ga0105243_101263752 | 199 |
| 404 | 3300009174 | Ga0105241_10057681 | Ga0105241_100576812 | 199 |
| 405 | 3300009174 | Ga0105241_10178213 | Ga0105241_101782132 | 199 |
| 406 | 3300009174 | Ga0105241_10461296 | Ga0105241_104612962 | 199 |
| 407 | 3300009174 | Ga0105241_10750691 | Ga0105241_107506912 | 199 |
| 408 | 3300009176 | Ga0105242_10057151 | Ga0105242_100571514 | 199 |
| 409 | 3300009177 | Ga0105248_10108895 | Ga0105248_101088954 | 199 |
| 410 | 3300009177 | Ga0105248_10258573 | Ga0105248_102585732 | 199 |
| 411 | 3300009545 | Ga0105237_10016328 | Ga0105237_100163282 | 199 |
| 412 | 3300009545 | Ga0105237_10414071 | Ga0105237_104140712 | 199 |
| 413 | 3300009551 | Ga0105238_10170267 | Ga0105238_101702672 | 199 |
| 414 | 3300009553 | Ga0105249_10721690 | Ga0105249_107216902 | 199 |
| 415 | 3300010375 | Ga0105239_10117394 | Ga0105239_101173941 | 199 |
| 416 | 3300010375 | Ga0105239_10139090 | Ga0105239_101390903 | 199 |
| 417 | 3300010375 | Ga0105239_10201246 | Ga0105239_102012462 | 199 |
| 418 | 3300010375 | Ga0105239_10377607 | Ga0105239_103776072 | 199 |
| 419 | 3300010375 | Ga0105239_11222313 | Ga0105239_112223131 | 199 |
| 420 | 3300011119 | Ga0105246_10400002 | Ga0105246_104000022 | 199 |
| 421 | 3300011119 | Ga0105246_10549288 | Ga0105246_105492882 | 199 |
| 422 | 3300013104 | Ga0157370_11017251 | Ga0157370_110172511 | 199 |
| 423 | 3300013105 | Ga0157369_10426866 | Ga0157369_104268662 | 199 |
| 424 | 3300013296 | Ga0157374_10395252 | Ga0157374_103952522 | 199 |
| 425 | 3300013297 | Ga0157378_10275117 | Ga0157378_102751172 | 199 |
| 426 | 3300013306 | Ga0163162_10364985 | Ga0163162_103649852 | 199 |
| 427 | 3300013306 | Ga0163162_11517043 | Ga0163162_115170431 | 199 |
| 428 | 3300014497 | Ga0182008_10145084 | Ga0182008_101450842 | 199 |
| 429 | 3300014968 | Ga0157379_10240892 | Ga0157379_102408922 | 199 |
| 430 | 3300015261 | Ga0182006_1118523 | Ga0182006_11185232 | 199 |
| 431 | 3300017792 | Ga0163161_10326252 | Ga0163161_103262521 | 199 |
| 432 | 3300017792 | Ga0163161_10362385 | Ga0163161_103623851 | 199 |
| 433 | 3300020070 | Ga0206356_10310093 | Ga0206356_103100932 | 199 |
| 434 | 3300020082 | Ga0206353_11784540 | Ga0206353_117845402 | 199 |
| 435 | 3300021320 | Ga0214544_1000136 | Ga0214544_10001363 | 199 |
| 436 | 3300021321 | Ga0214542_1000127 | Ga0214542_10001273 | 199 |
| 437 | 3300021324 | Ga0214545_1000063 | Ga0214545_100006395 | 199 |
| 438 | 3300021327 | Ga0214543_1014866 | Ga0214543_10148663 | 199 |
| 439 | 3300022467 | Ga0224712_10083188 | Ga0224712_100831882 | 199 |
| 440 | 3300025230 | Ga0209563_109501 | Ga0209563_1095012 | 199 |
| 441 | 3300025253 | Ga0209677_108643 | Ga0209677_1086433 | 199 |
| 442 | 3300025254 | Ga0209148_1000879 | Ga0209148_100087920 | 199 |
| 443 | 3300025261 | Ga0209233_1002427 | Ga0209233_10024273 | 199 |
| 444 | 3300025261 | Ga0209233_1014216 | Ga0209233_10142162 | 199 |
| 445 | 3300025261 | Ga0209233_1016287 | Ga0209233_10162871 | 199 |
| 446 | 3300025272 | Ga0209455_1001366 | Ga0209455_10013667 | 199 |
| 447 | 3300025273 | Ga0209673_1019322 | Ga0209673_10193222 | 199 |
| 448 | 3300025284 | Ga0209130_1046517 | Ga0209130_10465171 | 199 |
| 449 | 3300025295 | Ga0209564_1000602 | Ga0209564_100060218 | 199 |
| 450 | 3300025295 | Ga0209564_1006952 | Ga0209564_10069524 | 199 |
| 451 | 3300025295 | Ga0209564_1026798 | Ga0209564_10267982 | 199 |
| 452 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011900 | 199 |
| 453 | 3300025297 | Ga0209758_1000455 | Ga0209758_10004552 | 199 |
| 454 | 3300025297 | Ga0209758_1007373 | Ga0209758_10073731 | 199 |
| 455 | 3300025297 | Ga0209758_1011599 | Ga0209758_10115992 | 199 |
| 456 | 3300025297 | Ga0209758_1035461 | Ga0209758_10354612 | 199 |
| 457 | 3300025299 | Ga0209256_1002822 | Ga0209256_10028223 | 199 |
| 458 | 3300025299 | Ga0209256_1035913 | Ga0209256_10359132 | 199 |
| 459 | 3300025302 | Ga0207426_1000505 | Ga0207426_100050517 | 199 |
| 460 | 3300025302 | Ga0207426_1000551 | Ga0207426_100055116 | 199 |
| 461 | 3300025302 | Ga0207426_1001912 | Ga0207426_10019123 | 199 |
| 462 | 3300025302 | Ga0207426_1112932 | Ga0207426_11129321 | 199 |
| 463 | 3300025303 | Ga0209051_1094255 | Ga0209051_10942552 | 199 |
| 464 | 3300025304 | Ga0209257_1003002 | Ga0209257_10030022 | 199 |
| 465 | 3300025304 | Ga0209257_1019280 | Ga0209257_10192802 | 199 |
| 466 | 3300025304 | Ga0209257_1069568 | Ga0209257_10695682 | 199 |
| 467 | 3300025903 | Ga0207680_10140852 | Ga0207680_101408521 | 199 |
| 468 | 3300025904 | Ga0207647_10003320 | Ga0207647_100033202 | 199 |
| 469 | 3300025906 | Ga0207699_10052724 | Ga0207699_100527243 | 199 |
| 470 | 3300025906 | Ga0207699_10238831 | Ga0207699_102388312 | 199 |
| 471 | 3300025909 | Ga0207705_10039590 | Ga0207705_100395903 | 199 |
| 472 | 3300025910 | Ga0207684_10337259 | Ga0207684_103372592 | 199 |
| 473 | 3300025911 | Ga0207654_10042854 | Ga0207654_100428541 | 199 |
| 474 | 3300025911 | Ga0207654_10110845 | Ga0207654_101108452 | 199 |
| 475 | 3300025911 | Ga0207654_10325079 | Ga0207654_103250792 | 199 |
| 476 | 3300025912 | Ga0207707_10592111 | Ga0207707_105921111 | 199 |
| 477 | 3300025913 | Ga0207695_10000157 | Ga0207695_1000015795 | 199 |
| 478 | 3300025914 | Ga0207671_10009946 | Ga0207671_100099465 | 199 |
| 479 | 3300025915 | Ga0207693_10015868 | Ga0207693_100158682 | 199 |
| 480 | 3300025916 | Ga0207663_10062505 | Ga0207663_100625052 | 199 |
| 481 | 3300025917 | Ga0207660_10604613 | Ga0207660_106046132 | 199 |
| 482 | 3300025918 | Ga0207662_10202162 | Ga0207662_102021622 | 199 |
| 483 | 3300025919 | Ga0207657_10136834 | Ga0207657_101368342 | 199 |
| 484 | 3300025919 | Ga0207657_10612208 | Ga0207657_106122081 | 199 |
| 485 | 3300025920 | Ga0207649_10148623 | Ga0207649_101486232 | 199 |
| 486 | 3300025921 | Ga0207652_10912363 | Ga0207652_109123631 | 199 |
| 487 | 3300025924 | Ga0207694_10025055 | Ga0207694_100250553 | 199 |
| 488 | 3300025924 | Ga0207694_10518528 | Ga0207694_105185282 | 199 |
| 489 | 3300025927 | Ga0207687_10060872 | Ga0207687_100608723 | 199 |
| 490 | 3300025928 | Ga0207700_10172234 | Ga0207700_101722342 | 199 |
| 491 | 3300025932 | Ga0207690_10359279 | Ga0207690_103592792 | 199 |
| 492 | 3300025935 | Ga0207709_10030496 | Ga0207709_100304962 | 199 |
| 493 | 3300025935 | Ga0207709_10171538 | Ga0207709_101715382 | 199 |
| 494 | 3300025938 | Ga0207704_10423169 | Ga0207704_104231692 | 199 |
| 495 | 3300025939 | Ga0207665_10408302 | Ga0207665_104083022 | 199 |
| 496 | 3300025940 | Ga0207691_10013516 | Ga0207691_100135168 | 199 |
| 497 | 3300025941 | Ga0207711_10084823 | Ga0207711_100848233 | 199 |
| 498 | 3300025944 | Ga0207661_10026657 | Ga0207661_100266572 | 199 |
| 499 | 3300025945 | Ga0207679_10407203 | Ga0207679_104072032 | 199 |
| 500 | 3300025949 | Ga0207667_10708850 | Ga0207667_107088501 | 199 |
| 501 | 3300025961 | Ga0207712_10592788 | Ga0207712_105927881 | 199 |
| 502 | 3300025972 | Ga0207668_10110094 | Ga0207668_101100942 | 199 |
| 503 | 3300026041 | Ga0207639_10041161 | Ga0207639_100411613 | 199 |
| 504 | 3300026067 | Ga0207678_10198446 | Ga0207678_101984462 | 199 |
| 505 | 3300026078 | Ga0207702_10552873 | Ga0207702_105528731 | 199 |
| 506 | 3300026089 | Ga0207648_10010726 | Ga0207648_100107268 | 199 |
| 507 | 3300026089 | Ga0207648_10787138 | Ga0207648_107871381 | 199 |
| 508 | 3300026116 | Ga0207674_10092698 | Ga0207674_100926982 | 199 |
| 509 | 3300026116 | Ga0207674_10342575 | Ga0207674_103425752 | 199 |
| 510 | 3300026121 | Ga0207683_10110225 | Ga0207683_101102252 | 199 |
| 511 | 3300026142 | Ga0207698_10059039 | Ga0207698_100590392 | 199 |
| 512 | 3300027296 | Ga0209389_1001313 | Ga0209389_100131316 | 199 |
| 513 | 3300027296 | Ga0209389_1001336 | Ga0209389_100133616 | 199 |
| 514 | 3300027357 | Ga0209589_1004535 | Ga0209589_10045353 | 199 |
| 515 | 3300027361 | Ga0209489_100050 | Ga0209489_100050145 | 199 |
| 516 | 3300027361 | Ga0209489_104795 | Ga0209489_10479519 | 199 |
| 517 | 3300027363 | Ga0209700_100016 | Ga0209700_100016253 | 199 |
| 518 | 3300027866 | Ga0209813_10043201 | Ga0209813_100432012 | 199 |
| 519 | 3300028379 | Ga0268266_10581825 | Ga0268266_105818252 | 199 |
| 520 | 3300031239 | Ga0265328_10000055 | Ga0265328_1000005567 | 199 |
| 521 | 3300031239 | Ga0265328_10038546 | Ga0265328_100385462 | 199 |
| 522 | 3300031548 | Ga0307408_100870530 | Ga0307408_1008705301 | 199 |
| 523 | 3300031595 | Ga0265313_10171333 | Ga0265313_101713331 | 199 |
| 524 | 3300033180 | Ga0307510_10052759 | Ga0307510_100527593 | 199 |
| 525 | 3300033180 | Ga0307510_10240950 | Ga0307510_102409501 | 199 |
| 526 | 3300037312 | Ga0395899_0426396 | Ga0395899_0426396_76_675 | 199 |
| 527 | 3300037418 | Ga0395900_0001409 | Ga0395900_0001409_7858_8457 | 199 |
| 528 | 3300037466 | Ga0395898_0016001 | Ga0395898_0016001_4734_5333 | 199 |
| 529 | 3300037466 | Ga0395898_0450917 | Ga0395898_0450917_499_1098 | 199 |
| 530 | 3300037466 | Ga0395898_0847546 | Ga0395898_0847546_203_802 | 199 |
| 531 | 3300037471 | Ga0395905_0022704 | Ga0395905_0022704_3290_3889 | 199 |
| 532 | 3300037471 | Ga0395905_0209687 | Ga0395905_0209687_702_1301 | 199 |
| 533 | 3300037853 | Ga0436364_1290753 | Ga0436364_1290753_1065_1667 | 199 |
| 534 | 3300038443 | Ga0395901_0118315 | Ga0395901_0118315_268_867 | 199 |
| 535 | 3300039437 | Ga0436365_0718616 | Ga0436365_0718616_3054_3653 | 199 |
| 536 | 3300039450 | Ga0436363_0057188 | Ga0436363_0057188_376_975 | 199 |
| 537 | 3300041456 | Ga0451795_1269232 | Ga0451795_1269232_36_635 | 199 |
| 538 | 3300041459 | Ga0451800_1245814 | Ga0451800_1245814_171_770 | 199 |
| 539 | 3300041491 | Ga0451833_1413762 | Ga0451833_1413762_113_712 | 199 |
| 540 | 3300041492 | Ga0451835_0009829 | Ga0451835_0009829_151_750 | 199 |
| 541 | 3300041498 | Ga0451841_0980059 | Ga0451841_0980059_55_654 | 199 |
| 542 | 3300041507 | Ga0451851_0421058 | Ga0451851_0421058_67_666 | 199 |
| 543 | 3300041511 | Ga0451855_1803437 | Ga0451855_1803437_101_700 | 199 |
| 544 | 3300042012 | Ga0439455_0076042 | Ga0439455_0076042_105_704 | 199 |
| 545 | 3300044658 | Ga0466972_0002296 | Ga0466972_0002296_6439_7038 | 199 |
| 546 | 3300044658 | Ga0466972_0002508 | Ga0466972_0002508_6632_7231 | 199 |
| 547 | 3300044683 | Ga0466965_0040508 | Ga0466965_0040508_1136_1735 | 199 |
| 548 | 3300044683 | Ga0466965_0188537 | Ga0466965_0188537_349_948 | 199 |
| 549 | 3300044684 | Ga0466966_0001161 | Ga0466966_0001161_14767_15366 | 199 |
| 550 | 3300044693 | Ga0466961_0000122 | Ga0466961_0000122_22899_23498 | 199 |
| 551 | 3300044693 | Ga0466961_0109605 | Ga0466961_0109605_264_863 | 199 |
| 552 | 3300044693 | Ga0466961_0117507 | Ga0466961_0117507_907_1527 | 199 |
| 553 | 3300044693 | Ga0466961_0132983 | Ga0466961_0132983_205_804 | 199 |
| 554 | 3300044694 | Ga0466963_0141905 | Ga0466963_0141905_332_931 | 199 |
| 555 | 3300044706 | Ga0466964_0100364 | Ga0466964_0100364_212_811 | 199 |
| 556 | 3300044719 | Ga0466971_0328087 | Ga0466971_0328087_19_618 | 199 |
| 557 | 3300044735 | Ga0466968_0075537 | Ga0466968_0075537_429_1028 | 199 |
| 558 | 3300044735 | Ga0466968_0256153 | Ga0466968_0256153_11_610 | 199 |
| 559 | 3300044765 | Ga0466970_0254556 | Ga0466970_0254556_75_674 | 199 |
| 560 | 3300044842 | Ga0466957_0033326 | Ga0466957_0033326_1001_1600 | 199 |
| 561 | 3300044901 | Ga0466960_0164191 | Ga0466960_0164191_214_813 | 199 |
| 562 | 3300045049 | Ga0466959_0031376 | Ga0466959_0031376_846_1445 | 199 |
| 563 | 3300045976 | Ga0466967_0007117 | Ga0466967_0007117_5939_6538 | 199 |
| 564 | 3300045976 | Ga0466967_0051636 | Ga0466967_0051636_2891_3490 | 199 |
| 565 | 3300046452 | Ga0495617_096590 | Ga0495617_096590_35_634 | 199 |
| 566 | 3300046454 | Ga0495592_0100066 | Ga0495592_0100066_230_829 | 199 |
| 567 | 3300046460 | Ga0495638_0013901 | Ga0495638_0013901_4019_4618 | 199 |
| 568 | 3300046462 | Ga0495651_0102783 | Ga0495651_0102783_780_1379 | 199 |
| 569 | 3300046473 | Ga0495582_0255736 | Ga0495582_0255736_85_684 | 199 |
| 570 | 3300046477 | Ga0495664_0028238 | Ga0495664_0028238_1678_2277 | 199 |
| 571 | 3300046506 | Ga0495583_0066842 | Ga0495583_0066842_590_1189 | 199 |
| 572 | 3300046507 | Ga0495606_0001165 | Ga0495606_0001165_27486_28085 | 199 |
| 573 | 3300046507 | Ga0495606_0057024 | Ga0495606_0057024_677_1276 | 199 |
| 574 | 3300046511 | Ga0495608_0127357 | Ga0495608_0127357_978_1577 | 199 |
| 575 | 3300046512 | Ga0495610_0101016 | Ga0495610_0101016_142_741 | 199 |
| 576 | 3300046514 | Ga0495618_0180921 | Ga0495618_0180921_423_1022 | 199 |
| 577 | 3300046515 | Ga0495620_0074997 | Ga0495620_0074997_286_885 | 199 |
| 578 | 3300046517 | Ga0495630_0172807 | Ga0495630_0172807_373_972 | 199 |
| 579 | 3300046522 | Ga0495643_0006526 | Ga0495643_0006526_2136_2735 | 199 |
| 580 | 3300046522 | Ga0495643_0077701 | Ga0495643_0077701_873_1472 | 199 |
| 581 | 3300046524 | Ga0495648_0001607 | Ga0495648_0001607_301_900 | 199 |
| 582 | 3300046524 | Ga0495648_0120840 | Ga0495648_0120840_623_1222 | 199 |
| 583 | 3300046529 | Ga0495652_0080914 | Ga0495652_0080914_148_747 | 199 |
| 584 | 3300046535 | Ga0495586_0452994 | Ga0495586_0452994_47_646 | 199 |
| 585 | 3300046536 | Ga0495587_0071501 | Ga0495587_0071501_370_969 | 199 |
| 586 | 3300046538 | Ga0495609_0076111 | Ga0495609_0076111_433_1032 | 199 |
| 587 | 3300046542 | Ga0495597_0072882 | Ga0495597_0072882_567_1166 | 199 |
| 588 | 3300046543 | Ga0495645_0097937 | Ga0495645_0097937_400_999 | 199 |
| 589 | 3300046557 | Ga0495622_0202431 | Ga0495622_0202431_162_761 | 199 |
| 590 | 3300046616 | Ga0495668_0266383 | Ga0495668_0266383_149_748 | 199 |
| 591 | 3300046642 | Ga0495634_0160568 | Ga0495634_0160568_709_1308 | 199 |
| 592 | 3300046642 | Ga0495634_0207835 | Ga0495634_0207835_71_670 | 199 |
| 593 | 3300046665 | Ga0495661_0216994 | Ga0495661_0216994_170_769 | 199 |
| 594 | 3300046674 | Ga0495588_0071367 | Ga0495588_0071367_560_1159 | 199 |
| 595 | 3300046675 | Ga0495657_0073411 | Ga0495657_0073411_565_1164 | 199 |
| 596 | 3300046678 | Ga0495599_0057760 | Ga0495599_0057760_1161_1760 | 199 |
| 597 | 3300046679 | Ga0495623_0109486 | Ga0495623_0109486_417_1016 | 199 |
| 598 | 3300046680 | Ga0495646_0112490 | Ga0495646_0112490_737_1336 | 199 |
| 599 | 3300046680 | Ga0495646_0201686 | Ga0495646_0201686_314_913 | 199 |
| 600 | 3300046684 | Ga0495669_0155461 | Ga0495669_0155461_400_999 | 199 |
| 601 | 3300046689 | Ga0495613_0068687 | Ga0495613_0068687_1930_2529 | 199 |
| 602 | 3300046694 | Ga0495649_0058471 | Ga0495649_0058471_1330_1929 | 199 |
| 603 | 3300046794 | Ga0495589_0081267 | Ga0495589_0081267_587_1186 | 199 |
| 604 | 3300046809 | Ga0495600_0011987 | Ga0495600_0011987_2569_3168 | 199 |
| 605 | 3300046809 | Ga0495600_0502733 | Ga0495600_0502733_38_637 | 199 |
| 606 | 3300047315 | Ga0495581_0136915 | Ga0495581_0136915_728_1327 | 199 |
| 607 | 3300047317 | Ga0495604_0093657 | Ga0495604_0093657_1507_2106 | 199 |
| 608 | 3300047317 | Ga0495604_0333366 | Ga0495604_0333366_399_998 | 199 |
| 609 | 3300047319 | Ga0495674_0018772 | Ga0495674_0018772_4349_4948 | 199 |
| 610 | 3300047320 | Ga0495672_0033034 | Ga0495672_0033034_1380_1979 | 199 |
| 611 | 3300047322 | Ga0495680_0059483 | Ga0495680_0059483_71_670 | 199 |
| 612 | 3300047323 | Ga0495683_0268783 | Ga0495683_0268783_28_627 | 199 |
| 613 | 3300047443 | Ga0495687_006361 | Ga0495687_006361_4253_4852 | 199 |
| 614 | 3300047444 | Ga0495675_0239919 | Ga0495675_0239919_145_744 | 199 |
| 615 | 3300047471 | Ga0495684_0174848 | Ga0495684_0174848_77_676 | 199 |
| 616 | 3300047673 | Ga0495593_0225388 | Ga0495593_0225388_108_707 | 199 |
| 617 | 3300048088 | Ga0495602_0024322 | Ga0495602_0024322_1888_2487 | 199 |
| 618 | 3300048091 | Ga0495626_0078552 | Ga0495626_0078552_468_1067 | 199 |
| 619 | 3300048904 | Ga0496101_0463384 | Ga0496101_0463384_80_679 | 199 |
| 620 | 3300048904 | Ga0496101_0548522 | Ga0496101_0548522_64_663 | 199 |
| 621 | 3300048905 | Ga0496102_0510705 | Ga0496102_0510705_443_1042 | 199 |
| 622 | 3300048905 | Ga0496102_0658222 | Ga0496102_0658222_290_889 | 199 |
| 623 | 3300048905 | Ga0496102_0676882 | Ga0496102_0676882_346_945 | 199 |
| 624 | 3300048905 | Ga0496102_0712275 | Ga0496102_0712275_129_728 | 199 |
| 625 | 3300048906 | Ga0496103_0109410 | Ga0496103_0109410_1033_1632 | 199 |
| 626 | 3300048907 | Ga0496104_0024223 | Ga0496104_0024223_3217_3816 | 199 |
| 627 | 3300048907 | Ga0496104_1017755 | Ga0496104_1017755_82_681 | 199 |
| 628 | 3300048908 | Ga0496105_0036501 | Ga0496105_0036501_2833_3432 | 199 |
| 629 | 3300048909 | Ga0496106_0060391 | Ga0496106_0060391_405_1004 | 199 |
| 630 | 3300048913 | Ga0496110_0470706 | Ga0496110_0470706_461_1060 | 199 |
| 631 | 3300048914 | Ga0496111_0470712 | Ga0496111_0470712_314_913 | 199 |
| 632 | 3300048915 | Ga0496112_0144824 | Ga0496112_0144824_483_1082 | 199 |
| 633 | 3300048915 | Ga0496112_0325415 | Ga0496112_0325415_750_1349 | 199 |
| 634 | 3300048916 | Ga0496113_0110315 | Ga0496113_0110315_336_935 | 199 |
| 635 | 3300048916 | Ga0496113_0523193 | Ga0496113_0523193_117_716 | 199 |
| 636 | 3300048917 | Ga0496114_0166482 | Ga0496114_0166482_189_788 | 199 |
| 637 | 3300048921 | Ga0496118_0248905 | Ga0496118_0248905_90_689 | 199 |
| 638 | 3300048922 | Ga0496119_0017486 | Ga0496119_0017486_3965_4564 | 199 |
| 639 | 3300048923 | Ga0496120_0032833 | Ga0496120_0032833_129_728 | 199 |
| 640 | 3300048923 | Ga0496120_0076945 | Ga0496120_0076945_529_1128 | 199 |
| 641 | 3300048924 | Ga0496121_0021799 | Ga0496121_0021799_5412_6011 | 199 |
| 642 | 3300048924 | Ga0496121_0046842 | Ga0496121_0046842_3046_3648 | 199 |
| 643 | 3300048924 | Ga0496121_0200920 | Ga0496121_0200920_26_625 | 199 |
| 644 | 3300048925 | Ga0496122_0362827 | Ga0496122_0362827_134_733 | 199 |
| 645 | 3300048926 | Ga0496123_0119933 | Ga0496123_0119933_229_831 | 199 |
| 646 | 3300048929 | Ga0496126_0103744 | Ga0496126_0103744_88_687 | 199 |
| 647 | 3300048929 | Ga0496126_0162968 | Ga0496126_0162968_47_646 | 199 |
| 648 | 3300048929 | Ga0496126_0259698 | Ga0496126_0259698_265_864 | 199 |
| 649 | 3300049460 | Ga0495682_0064517 | Ga0495682_0064517_578_1177 | 199 |
| 650 | 3300049460 | Ga0495682_0079238 | Ga0495682_0079238_21_620 | 199 |
| 651 | 3300050489 | nmdc:mga03683_221296_c1 | nmdc:mga03683_221296_c1_103_702 | 199 |
| 652 | 3300050489 | nmdc:mga03683_31688_c2 | nmdc:mga03683_31688_c2_64_663 | 199 |
| 653 | 3300050491 | nmdc:mga00v17_197769_c1 | nmdc:mga00v17_197769_c1_424_1023 | 199 |
| 654 | 3300050492 | nmdc:mga0yw44_206148_c1 | nmdc:mga0yw44_206148_c1_164_763 | 199 |
| 655 | 3300050492 | nmdc:mga0yw44_653483_c1 | nmdc:mga0yw44_653483_c1_51_653 | 199 |
| 656 | 3300050493 | nmdc:mga0k408_179750_c1 | nmdc:mga0k408_179750_c1_156_755 | 199 |
| 657 | 3300050493 | nmdc:mga0k408_73021_c1 | nmdc:mga0k408_73021_c1_425_1024 | 199 |
| 658 | 3300050495 | nmdc:mga04h51_51193_c1 | nmdc:mga04h51_51193_c1_478_1077 | 199 |
| 659 | 3300050496 | nmdc:mga07m45_113399_c1 | nmdc:mga07m45_113399_c1_233_832 | 199 |
| 660 | 3300050496 | nmdc:mga07m45_114194_c1 | nmdc:mga07m45_114194_c1_561_1160 | 199 |
| 661 | 3300050496 | nmdc:mga07m45_25255_c1 | nmdc:mga07m45_25255_c1_1004_1603 | 199 |
| 662 | 3300050512 | nmdc:mga0n895_659535_c1 | nmdc:mga0n895_659535_c1_390_989 | 199 |
| 663 | 3300050516 | nmdc:mga0sz30_124765_c1 | nmdc:mga0sz30_124765_c1_478_1077 | 199 |
| 664 | 3300050516 | nmdc:mga0sz30_12648_c1 | nmdc:mga0sz30_12648_c1_485_1084 | 199 |
| 665 | 3300053080 | Ga0500635_0105523 | Ga0500635_0105523_152_751 | 199 |
| 666 | 3300053085 | Ga0495619_0209198 | Ga0495619_0209198_193_792 | 199 |
| 667 | 3300053086 | Ga0500578_0080223 | Ga0500578_0080223_1382_1981 | 199 |
| 668 | 3300053086 | Ga0500578_0222128 | Ga0500578_0222128_307_906 | 199 |
| 669 | 3300053087 | Ga0500643_000042 | Ga0500643_000042_135365_135964 | 199 |
| 670 | 3300053091 | Ga0500647_0043524 | Ga0500647_0043524_1538_2137 | 199 |
| 671 | 3300053092 | Ga0500583_0059693 | Ga0500583_0059693_1078_1677 | 199 |
| 672 | 3300053093 | Ga0500651_0194250 | Ga0500651_0194250_104_703 | 199 |
| 673 | 3300053094 | Ga0500566_0000264 | Ga0500566_0000264_9290_9889 | 199 |
| 674 | 3300053095 | Ga0500640_127660 | Ga0500640_127660_116_715 | 199 |
| 675 | 3300053096 | Ga0500641_0090325 | Ga0500641_0090325_623_1222 | 199 |
| 676 | 3300053103 | Ga0500555_048190 | Ga0500555_048190_80_679 | 199 |
| 677 | 3300053104 | Ga0500556_0115124 | Ga0500556_0115124_132_731 | 199 |
| 678 | 3300053105 | Ga0500557_000006 | Ga0500557_000006_20650_21249 | 199 |
| 679 | 3300053109 | Ga0500569_060197 | Ga0500569_060197_100_699 | 199 |
| 680 | 3300053119 | Ga0500595_101390 | Ga0500595_101390_28_627 | 199 |
| 681 | 3300053121 | Ga0500607_049421 | Ga0500607_049421_555_1154 | 199 |
| 682 | 3300053122 | Ga0500608_092484 | Ga0500608_092484_79_678 | 199 |
| 683 | 3300053130 | Ga0500642_0000068 | Ga0500642_0000068_8297_8896 | 199 |
| 684 | 3300053130 | Ga0500642_0077068 | Ga0500642_0077068_281_880 | 199 |
| 685 | 3300053134 | Ga0500658_0087456 | Ga0500658_0087456_653_1252 | 199 |
| 686 | 3300053136 | Ga0500559_0041811 | Ga0500559_0041811_884_1483 | 199 |
| 687 | 3300053136 | Ga0500559_0101422 | Ga0500559_0101422_103_702 | 199 |
| 688 | 3300053138 | Ga0500564_042947 | Ga0500564_042947_1133_1732 | 199 |
| 689 | 3300053139 | Ga0500568_0007584 | Ga0500568_0007584_4669_5268 | 199 |
| 690 | 3300053143 | Ga0500579_134954 | Ga0500579_134954_236_835 | 199 |
| 691 | 3300053145 | Ga0500586_000095 | Ga0500586_000095_8890_9489 | 199 |
| 692 | 3300053148 | Ga0500590_025218 | Ga0500590_025218_1091_1690 | 199 |
| 693 | 3300053155 | Ga0500620_006327 | Ga0500620_006327_711_1310 | 199 |
| 694 | 3300053156 | Ga0500622_0026006 | Ga0500622_0026006_1683_2282 | 199 |
| 695 | 3300053158 | Ga0500627_0168806 | Ga0500627_0168806_84_683 | 199 |
| 696 | 3300053160 | Ga0500633_0038617 | Ga0500633_0038617_149_748 | 199 |
| 697 | 3300053162 | Ga0500638_048030 | Ga0500638_048030_733_1332 | 199 |
| 698 | 3300053163 | Ga0500639_194307 | Ga0500639_194307_217_816 | 199 |
| 699 | 3300053177 | Ga0500636_0007750 | Ga0500636_0007750_3594_4193 | 199 |
| 700 | 3300053722 | Ga0500649_085632 | Ga0500649_085632_504_1103 | 199 |
| 701 | 3300053725 | Ga0500576_163874 | Ga0500576_163874_101_700 | 199 |
| 702 | 3300053729 | Ga0500625_011281 | Ga0500625_011281_2507_3106 | 199 |
| 703 | 3300053730 | Ga0500645_068952 | Ga0500645_068952_365_964 | 199 |
| 704 | 3300053731 | Ga0500609_006564 | Ga0500609_006564_91_690 | 199 |
| 705 | 3300005327 | Ga0070658_10395391 | Ga0070658_103953911 | 200 |
| 706 | 3300005354 | Ga0070675_100927245 | Ga0070675_1009272451 | 200 |
| 707 | 3300005356 | Ga0070674_100798562 | Ga0070674_1007985621 | 200 |
| 708 | 3300005366 | Ga0070659_100501538 | Ga0070659_1005015382 | 200 |
| 709 | 3300005367 | Ga0070667_100549321 | Ga0070667_1005493211 | 200 |
| 710 | 3300005440 | Ga0070705_100206883 | Ga0070705_1002068832 | 200 |
| 711 | 3300005445 | Ga0070708_100522450 | Ga0070708_1005224501 | 200 |
| 712 | 3300005455 | Ga0070663_100225602 | Ga0070663_1002256021 | 200 |
| 713 | 3300005456 | Ga0070678_100282665 | Ga0070678_1002826652 | 200 |
| 714 | 3300005468 | Ga0070707_100121925 | Ga0070707_1001219253 | 200 |
| 715 | 3300005614 | Ga0068856_100000217 | Ga0068856_10000021719 | 200 |
| 716 | 3300005718 | Ga0068866_10057212 | Ga0068866_100572122 | 200 |
| 717 | 3300005840 | Ga0068870_10497570 | Ga0068870_104975702 | 200 |
| 718 | 3300005842 | Ga0068858_100441351 | Ga0068858_1004413512 | 200 |
| 719 | 3300005983 | Ga0081540_1012457 | Ga0081540_10124575 | 200 |
| 720 | 3300006038 | Ga0075365_10137806 | Ga0075365_101378063 | 200 |
| 721 | 3300006048 | Ga0075363_100073623 | Ga0075363_1000736232 | 200 |
| 722 | 3300006048 | Ga0075363_100180615 | Ga0075363_1001806151 | 200 |
| 723 | 3300006178 | Ga0075367_10030061 | Ga0075367_100300612 | 200 |
| 724 | 3300006844 | Ga0075428_100652061 | Ga0075428_1006520612 | 200 |
| 725 | 3300006871 | Ga0075434_100093534 | Ga0075434_1000935344 | 200 |
| 726 | 3300006881 | Ga0068865_100004347 | Ga0068865_1000043479 | 200 |
| 727 | 3300007788 | Ga0099795_10150480 | Ga0099795_101504802 | 200 |
| 728 | 3300009094 | Ga0111539_10997827 | Ga0111539_109978271 | 200 |
| 729 | 3300009098 | Ga0105245_10282136 | Ga0105245_102821362 | 200 |
| 730 | 3300009148 | Ga0105243_11399399 | Ga0105243_113993991 | 200 |
| 731 | 3300010159 | Ga0099796_10226005 | Ga0099796_102260052 | 200 |
| 732 | 3300013308 | Ga0157375_11359337 | Ga0157375_113593371 | 200 |
| 733 | 3300014326 | Ga0157380_10054606 | Ga0157380_100546061 | 200 |
| 734 | 3300014969 | Ga0157376_10460283 | Ga0157376_104602832 | 200 |
| 735 | 3300025315 | Ga0207697_10090967 | Ga0207697_100909672 | 200 |
| 736 | 3300025901 | Ga0207688_10066881 | Ga0207688_100668812 | 200 |
| 737 | 3300025901 | Ga0207688_10544015 | Ga0207688_105440151 | 200 |
| 738 | 3300025908 | Ga0207643_10314459 | Ga0207643_103144592 | 200 |
| 739 | 3300025913 | Ga0207695_10321131 | Ga0207695_103211311 | 200 |
| 740 | 3300025915 | Ga0207693_10387227 | Ga0207693_103872271 | 200 |
| 741 | 3300025922 | Ga0207646_10034318 | Ga0207646_100343182 | 200 |
| 742 | 3300025923 | Ga0207681_10082915 | Ga0207681_100829152 | 200 |
| 743 | 3300025937 | Ga0207669_11020477 | Ga0207669_110204771 | 200 |
| 744 | 3300025940 | Ga0207691_10577453 | Ga0207691_105774532 | 200 |
| 745 | 3300025949 | Ga0207667_10332090 | Ga0207667_103320901 | 200 |
| 746 | 3300025960 | Ga0207651_10140997 | Ga0207651_101409972 | 200 |
| 747 | 3300025981 | Ga0207640_10050789 | Ga0207640_100507891 | 200 |
| 748 | 3300026035 | Ga0207703_10782073 | Ga0207703_107820732 | 200 |
| 749 | 3300026067 | Ga0207678_10094920 | Ga0207678_100949202 | 200 |
| 750 | 3300026078 | Ga0207702_10004131 | Ga0207702_100041312 | 200 |
| 751 | 3300027907 | Ga0207428_10137746 | Ga0207428_101377462 | 200 |
| 752 | 3300031616 | Ga0307508_10081178 | Ga0307508_100811782 | 200 |
| 753 | 3300031711 | Ga0265314_10030942 | Ga0265314_100309425 | 200 |
| 754 | 3300031730 | Ga0307516_10012479 | Ga0307516_100124796 | 200 |
| 755 | 3300035086 | Ga0373934_0022147 | Ga0373934_0022147_629_1231 | 200 |
| 756 | 3300035117 | Ga0373953_0085182 | Ga0373953_0085182_241_843 | 200 |
| 757 | 3300035118 | Ga0373954_0007143 | Ga0373954_0007143_1392_1994 | 200 |
| 758 | 3300035119 | Ga0373956_0019483 | Ga0373956_0019483_311_913 | 200 |
| 759 | 3300035692 | Ga0373935_0364244 | Ga0373935_0364244_49_651 | 200 |
| 760 | 3300035724 | Ga0373933_0056075 | Ga0373933_0056075_1573_2175 | 200 |
| 761 | 3300036401 | Ga0373937_0242409 | Ga0373937_0242409_504_1106 | 200 |
| 762 | 3300046455 | Ga0495603_0083545 | Ga0495603_0083545_56_658 | 200 |
| 763 | 3300046462 | Ga0495651_0018521 | Ga0495651_0018521_1808_2410 | 200 |
| 764 | 3300046475 | Ga0495639_0020088 | Ga0495639_0020088_2127_2729 | 200 |
| 765 | 3300046507 | Ga0495606_0160737 | Ga0495606_0160737_244_846 | 200 |
| 766 | 3300046514 | Ga0495618_0027782 | Ga0495618_0027782_58_660 | 200 |
| 767 | 3300046518 | Ga0495631_0192977 | Ga0495631_0192977_220_825 | 200 |
| 768 | 3300046522 | Ga0495643_0166971 | Ga0495643_0166971_296_898 | 200 |
| 769 | 3300046529 | Ga0495652_0029642 | Ga0495652_0029642_435_1037 | 200 |
| 770 | 3300046533 | Ga0495640_0048913 | Ga0495640_0048913_2155_2757 | 200 |
| 771 | 3300046535 | Ga0495586_0145771 | Ga0495586_0145771_509_1111 | 200 |
| 772 | 3300046535 | Ga0495586_0182301 | Ga0495586_0182301_240_845 | 200 |
| 773 | 3300046536 | Ga0495587_0005400 | Ga0495587_0005400_4204_4806 | 200 |
| 774 | 3300046543 | Ga0495645_0013919 | Ga0495645_0013919_444_1046 | 200 |
| 775 | 3300046559 | Ga0495667_0006655 | Ga0495667_0006655_5822_6424 | 200 |
| 776 | 3300046616 | Ga0495668_0032483 | Ga0495668_0032483_1757_2359 | 200 |
| 777 | 3300046642 | Ga0495634_0020585 | Ga0495634_0020585_3272_3874 | 200 |
| 778 | 3300046675 | Ga0495657_0009904 | Ga0495657_0009904_1223_1825 | 200 |
| 779 | 3300046679 | Ga0495623_0008151 | Ga0495623_0008151_4838_5440 | 200 |
| 780 | 3300046680 | Ga0495646_0012636 | Ga0495646_0012636_4526_5128 | 200 |
| 781 | 3300046809 | Ga0495600_0007519 | Ga0495600_0007519_2814_3416 | 200 |
| 782 | 3300046809 | Ga0495600_0104558 | Ga0495600_0104558_15_629 | 200 |
| 783 | 3300047317 | Ga0495604_0015618 | Ga0495604_0015618_5041_5643 | 200 |
| 784 | 3300047319 | Ga0495674_0007311 | Ga0495674_0007311_4606_5208 | 200 |
| 785 | 3300047319 | Ga0495674_0492951 | Ga0495674_0492951_12_626 | 200 |
| 786 | 3300047320 | Ga0495672_0058738 | Ga0495672_0058738_1456_2058 | 200 |
| 787 | 3300047444 | Ga0495675_0009301 | Ga0495675_0009301_2259_2861 | 200 |
| 788 | 3300047447 | Ga0495685_136405 | Ga0495685_136405_99_701 | 200 |
| 789 | 3300047471 | Ga0495684_0007463 | Ga0495684_0007463_4140_4742 | 200 |
| 790 | 3300048088 | Ga0495602_0020065 | Ga0495602_0020065_1680_2282 | 200 |
| 791 | 3300048905 | Ga0496102_0303152 | Ga0496102_0303152_712_1326 | 200 |
| 792 | 3300048905 | Ga0496102_0581536 | Ga0496102_0581536_213_815 | 200 |
| 793 | 3300048911 | Ga0496108_0273262 | Ga0496108_0273262_490_1104 | 200 |
| 794 | 3300048914 | Ga0496111_0576079 | Ga0496111_0576079_112_714 | 200 |
| 795 | 3300048915 | Ga0496112_0000092 | Ga0496112_0000092_32169_32771 | 200 |
| 796 | 3300048916 | Ga0496113_0473984 | Ga0496113_0473984_212_814 | 200 |
| 797 | 3300048917 | Ga0496114_0105449 | Ga0496114_0105449_974_1588 | 200 |
| 798 | 3300048922 | Ga0496119_0036093 | Ga0496119_0036093_296_898 | 200 |
| 799 | 3300048929 | Ga0496126_0035540 | Ga0496126_0035540_788_1396 | 200 |
| 800 | 3300050494 | nmdc:mga06z11_61537_c1 | nmdc:mga06z11_61537_c1_961_1563 | 200 |
| 801 | 3300050511 | nmdc:mga08y16_884119_c1 | nmdc:mga08y16_884119_c1_132_734 | 200 |
| 802 | 3300050512 | nmdc:mga0n895_29483_c1 | nmdc:mga0n895_29483_c1_130_732 | 200 |
| 803 | 3300053077 | Ga0495601_0069652 | Ga0495601_0069652_706_1308 | 200 |
| 804 | 3300053078 | Ga0495612_0003490 | Ga0495612_0003490_1525_2127 | 200 |
| 805 | 3300053084 | Ga0495595_0122241 | Ga0495595_0122241_504_1106 | 200 |
| 806 | 3300053085 | Ga0495619_0147365 | Ga0495619_0147365_823_1437 | 200 |
| 807 | 3300053139 | Ga0500568_0171546 | Ga0500568_0171546_126_728 | 200 |
| 808 | 3300053163 | Ga0500639_178363 | Ga0500639_178363_101_703 | 200 |
| 809 | iso_pu_bacteria | 8002060224 | 8002062311 | 200 |
| 810 | 3300001979 | JGI24740J21852_10014946 | JGI24740J21852_100149462 | 201 |
| 811 | 3300001990 | JGI24737J22298_10020398 | JGI24737J22298_100203982 | 201 |
| 812 | 3300003203 | JGI25406J46586_10000042 | JGI25406J46586_1000004246 | 201 |
| 813 | 3300003215 | JGI25153J46596_10087656 | JGI25153J46596_100876561 | 201 |
| 814 | 3300003659 | JGI25404J52841_10006334 | JGI25404J52841_100063342 | 201 |
| 815 | 3300003659 | JGI25404J52841_10034536 | JGI25404J52841_100345362 | 201 |
| 816 | 3300003659 | JGI25404J52841_10041845 | JGI25404J52841_100418451 | 201 |
| 817 | 3300003752 | Ga0055539_1001331 | Ga0055539_10013316 | 201 |
| 818 | 3300005295 | Ga0065707_10038970 | Ga0065707_100389701 | 201 |
| 819 | 3300005327 | Ga0070658_10135114 | Ga0070658_101351142 | 201 |
| 820 | 3300005328 | Ga0070676_10154307 | Ga0070676_101543072 | 201 |
| 821 | 3300005329 | Ga0070683_100109347 | Ga0070683_1001093471 | 201 |
| 822 | 3300005334 | Ga0068869_100066490 | Ga0068869_1000664902 | 201 |
| 823 | 3300005334 | Ga0068869_100068209 | Ga0068869_1000682093 | 201 |
| 824 | 3300005334 | Ga0068869_100112284 | Ga0068869_1001122842 | 201 |
| 825 | 3300005336 | Ga0070680_100088958 | Ga0070680_1000889582 | 201 |
| 826 | 3300005337 | Ga0070682_100163478 | Ga0070682_1001634782 | 201 |
| 827 | 3300005338 | Ga0068868_100058744 | Ga0068868_1000587442 | 201 |
| 828 | 3300005339 | Ga0070660_100030069 | Ga0070660_1000300691 | 201 |
| 829 | 3300005340 | Ga0070689_100701727 | Ga0070689_1007017271 | 201 |
| 830 | 3300005344 | Ga0070661_100035244 | Ga0070661_1000352441 | 201 |
| 831 | 3300005344 | Ga0070661_100149211 | Ga0070661_1001492112 | 201 |
| 832 | 3300005347 | Ga0070668_100370558 | Ga0070668_1003705582 | 201 |
| 833 | 3300005347 | Ga0070668_100664503 | Ga0070668_1006645031 | 201 |
| 834 | 3300005347 | Ga0070668_100944900 | Ga0070668_1009449001 | 201 |
| 835 | 3300005355 | Ga0070671_100283396 | Ga0070671_1002833962 | 201 |
| 836 | 3300005355 | Ga0070671_100470937 | Ga0070671_1004709371 | 201 |
| 837 | 3300005355 | Ga0070671_101282978 | Ga0070671_1012829781 | 201 |
| 838 | 3300005356 | Ga0070674_100064690 | Ga0070674_1000646902 | 201 |
| 839 | 3300005356 | Ga0070674_100688739 | Ga0070674_1006887391 | 201 |
| 840 | 3300005366 | Ga0070659_100745771 | Ga0070659_1007457711 | 201 |
| 841 | 3300005367 | Ga0070667_100303983 | Ga0070667_1003039832 | 201 |
| 842 | 3300005434 | Ga0070709_10000380 | Ga0070709_100003802 | 201 |
| 843 | 3300005434 | Ga0070709_10004357 | Ga0070709_100043575 | 201 |
| 844 | 3300005434 | Ga0070709_10011774 | Ga0070709_100117743 | 201 |
| 845 | 3300005434 | Ga0070709_10202467 | Ga0070709_102024672 | 201 |
| 846 | 3300005434 | Ga0070709_10394478 | Ga0070709_103944782 | 201 |
| 847 | 3300005434 | Ga0070709_10771121 | Ga0070709_107711211 | 201 |
| 848 | 3300005435 | Ga0070714_100011779 | Ga0070714_1000117794 | 201 |
| 849 | 3300005435 | Ga0070714_100043286 | Ga0070714_1000432862 | 201 |
| 850 | 3300005435 | Ga0070714_100051414 | Ga0070714_1000514142 | 201 |
| 851 | 3300005435 | Ga0070714_100572839 | Ga0070714_1005728392 | 201 |
| 852 | 3300005435 | Ga0070714_101053565 | Ga0070714_1010535651 | 201 |
| 853 | 3300005436 | Ga0070713_100002836 | Ga0070713_1000028363 | 201 |
| 854 | 3300005436 | Ga0070713_100004693 | Ga0070713_1000046932 | 201 |
| 855 | 3300005436 | Ga0070713_100028325 | Ga0070713_1000283253 | 201 |
| 856 | 3300005436 | Ga0070713_100036343 | Ga0070713_1000363434 | 201 |
| 857 | 3300005436 | Ga0070713_100200837 | Ga0070713_1002008372 | 201 |
| 858 | 3300005436 | Ga0070713_100209153 | Ga0070713_1002091532 | 201 |
| 859 | 3300005437 | Ga0070710_10000933 | Ga0070710_100009332 | 201 |
| 860 | 3300005437 | Ga0070710_10001211 | Ga0070710_100012112 | 201 |
| 861 | 3300005439 | Ga0070711_100004399 | Ga0070711_1000043995 | 201 |
| 862 | 3300005439 | Ga0070711_100007412 | Ga0070711_1000074123 | 201 |
| 863 | 3300005439 | Ga0070711_100009990 | Ga0070711_1000099905 | 201 |
| 864 | 3300005439 | Ga0070711_100222809 | Ga0070711_1002228092 | 201 |
| 865 | 3300005439 | Ga0070711_100455851 | Ga0070711_1004558512 | 201 |
| 866 | 3300005439 | Ga0070711_100540110 | Ga0070711_1005401101 | 201 |
| 867 | 3300005441 | Ga0070700_100071377 | Ga0070700_1000713772 | 201 |
| 868 | 3300005444 | Ga0070694_100257396 | Ga0070694_1002573961 | 201 |
| 869 | 3300005455 | Ga0070663_100089893 | Ga0070663_1000898932 | 201 |
| 870 | 3300005455 | Ga0070663_100123601 | Ga0070663_1001236012 | 201 |
| 871 | 3300005455 | Ga0070663_100341193 | Ga0070663_1003411932 | 201 |
| 872 | 3300005455 | Ga0070663_100372050 | Ga0070663_1003720501 | 201 |
| 873 | 3300005456 | Ga0070678_100181322 | Ga0070678_1001813223 | 201 |
| 874 | 3300005456 | Ga0070678_100303358 | Ga0070678_1003033581 | 201 |
| 875 | 3300005457 | Ga0070662_100057253 | Ga0070662_1000572532 | 201 |
| 876 | 3300005457 | Ga0070662_100097475 | Ga0070662_1000974752 | 201 |
| 877 | 3300005458 | Ga0070681_10188605 | Ga0070681_101886052 | 201 |
| 878 | 3300005458 | Ga0070681_10435840 | Ga0070681_104358402 | 201 |
| 879 | 3300005467 | Ga0070706_100131890 | Ga0070706_1001318902 | 201 |
| 880 | 3300005468 | Ga0070707_100674806 | Ga0070707_1006748062 | 201 |
| 881 | 3300005471 | Ga0070698_100896333 | Ga0070698_1008963332 | 201 |
| 882 | 3300005518 | Ga0070699_100068026 | Ga0070699_1000680262 | 201 |
| 883 | 3300005530 | Ga0070679_100020904 | Ga0070679_1000209046 | 201 |
| 884 | 3300005530 | Ga0070679_100223109 | Ga0070679_1002231092 | 201 |
| 885 | 3300005530 | Ga0070679_100466946 | Ga0070679_1004669462 | 201 |
| 886 | 3300005535 | Ga0070684_100030973 | Ga0070684_1000309733 | 201 |
| 887 | 3300005536 | Ga0070697_101055700 | Ga0070697_1010557001 | 201 |
| 888 | 3300005539 | Ga0068853_100025492 | Ga0068853_1000254922 | 201 |
| 889 | 3300005539 | Ga0068853_100043569 | Ga0068853_1000435692 | 201 |
| 890 | 3300005539 | Ga0068853_100081244 | Ga0068853_1000812444 | 201 |
| 891 | 3300005539 | Ga0068853_100308800 | Ga0068853_1003088002 | 201 |
| 892 | 3300005539 | Ga0068853_100866771 | Ga0068853_1008667712 | 201 |
| 893 | 3300005543 | Ga0070672_100875699 | Ga0070672_1008756992 | 201 |
| 894 | 3300005545 | Ga0070695_100181288 | Ga0070695_1001812882 | 201 |
| 895 | 3300005546 | Ga0070696_100217077 | Ga0070696_1002170772 | 201 |
| 896 | 3300005547 | Ga0070693_100042510 | Ga0070693_1000425103 | 201 |
| 897 | 3300005547 | Ga0070693_100099385 | Ga0070693_1000993852 | 201 |
| 898 | 3300005548 | Ga0070665_100030244 | Ga0070665_1000302442 | 201 |
| 899 | 3300005548 | Ga0070665_100038083 | Ga0070665_1000380834 | 201 |
| 900 | 3300005548 | Ga0070665_100144019 | Ga0070665_1001440192 | 201 |
| 901 | 3300005548 | Ga0070665_100250045 | Ga0070665_1002500452 | 201 |
| 902 | 3300005548 | Ga0070665_100326616 | Ga0070665_1003266162 | 201 |
| 903 | 3300005548 | Ga0070665_100393302 | Ga0070665_1003933022 | 201 |
| 904 | 3300005548 | Ga0070665_100844626 | Ga0070665_1008446262 | 201 |
| 905 | 3300005549 | Ga0070704_100808971 | Ga0070704_1008089712 | 201 |
| 906 | 3300005563 | Ga0068855_100027933 | Ga0068855_1000279332 | 201 |
| 907 | 3300005563 | Ga0068855_100049446 | Ga0068855_1000494462 | 201 |
| 908 | 3300005563 | Ga0068855_100068968 | Ga0068855_1000689682 | 201 |
| 909 | 3300005563 | Ga0068855_100186192 | Ga0068855_1001861923 | 201 |
| 910 | 3300005563 | Ga0068855_100398121 | Ga0068855_1003981212 | 201 |
| 911 | 3300005564 | Ga0070664_100288344 | Ga0070664_1002883441 | 201 |
| 912 | 3300005577 | Ga0068857_100010524 | Ga0068857_1000105243 | 201 |
| 913 | 3300005577 | Ga0068857_100084190 | Ga0068857_1000841903 | 201 |
| 914 | 3300005577 | Ga0068857_100095363 | Ga0068857_1000953632 | 201 |
| 915 | 3300005577 | Ga0068857_100134916 | Ga0068857_1001349162 | 201 |
| 916 | 3300005577 | Ga0068857_100173848 | Ga0068857_1001738482 | 201 |
| 917 | 3300005578 | Ga0068854_100144658 | Ga0068854_1001446582 | 201 |
| 918 | 3300005578 | Ga0068854_100184670 | Ga0068854_1001846702 | 201 |
| 919 | 3300005578 | Ga0068854_100324336 | Ga0068854_1003243362 | 201 |
| 920 | 3300005614 | Ga0068856_100003953 | Ga0068856_1000039532 | 201 |
| 921 | 3300005614 | Ga0068856_100033390 | Ga0068856_1000333904 | 201 |
| 922 | 3300005614 | Ga0068856_100607455 | Ga0068856_1006074552 | 201 |
| 923 | 3300005616 | Ga0068852_100032679 | Ga0068852_1000326792 | 201 |
| 924 | 3300005616 | Ga0068852_100118243 | Ga0068852_1001182432 | 201 |
| 925 | 3300005616 | Ga0068852_100875035 | Ga0068852_1008750352 | 201 |
| 926 | 3300005617 | Ga0068859_100026003 | Ga0068859_1000260032 | 201 |
| 927 | 3300005617 | Ga0068859_100068312 | Ga0068859_1000683122 | 201 |
| 928 | 3300005617 | Ga0068859_100272587 | Ga0068859_1002725872 | 201 |
| 929 | 3300005617 | Ga0068859_100325615 | Ga0068859_1003256152 | 201 |
| 930 | 3300005618 | Ga0068864_100118727 | Ga0068864_1001187272 | 201 |
| 931 | 3300005618 | Ga0068864_100771107 | Ga0068864_1007711072 | 201 |
| 932 | 3300005719 | Ga0068861_100079783 | Ga0068861_1000797831 | 201 |
| 933 | 3300005719 | Ga0068861_100139587 | Ga0068861_1001395874 | 201 |
| 934 | 3300005719 | Ga0068861_100320045 | Ga0068861_1003200452 | 201 |
| 935 | 3300005719 | Ga0068861_100668591 | Ga0068861_1006685912 | 201 |
| 936 | 3300005719 | Ga0068861_100880465 | Ga0068861_1008804651 | 201 |
| 937 | 3300005834 | Ga0068851_10089407 | Ga0068851_100894072 | 201 |
| 938 | 3300005840 | Ga0068870_10173473 | Ga0068870_101734732 | 201 |
| 939 | 3300005841 | Ga0068863_100278770 | Ga0068863_1002787702 | 201 |
| 940 | 3300005841 | Ga0068863_100293003 | Ga0068863_1002930032 | 201 |
| 941 | 3300005841 | Ga0068863_101017083 | Ga0068863_1010170832 | 201 |
| 942 | 3300005842 | Ga0068858_100057906 | Ga0068858_1000579062 | 201 |
| 943 | 3300005842 | Ga0068858_100078178 | Ga0068858_1000781783 | 201 |
| 944 | 3300005842 | Ga0068858_100126924 | Ga0068858_1001269242 | 201 |
| 945 | 3300005842 | Ga0068858_100264428 | Ga0068858_1002644282 | 201 |
| 946 | 3300005842 | Ga0068858_100590804 | Ga0068858_1005908041 | 201 |
| 947 | 3300005843 | Ga0068860_100000280 | Ga0068860_10000028029 | 201 |
| 948 | 3300005843 | Ga0068860_100298239 | Ga0068860_1002982392 | 201 |
| 949 | 3300005843 | Ga0068860_100789512 | Ga0068860_1007895121 | 201 |
| 950 | 3300005844 | Ga0068862_100138012 | Ga0068862_1001380122 | 201 |
| 951 | 3300005844 | Ga0068862_100454852 | Ga0068862_1004548522 | 201 |
| 952 | 3300005937 | Ga0081455_10360995 | Ga0081455_103609952 | 201 |
| 953 | 3300005981 | Ga0081538_10030517 | Ga0081538_100305174 | 201 |
| 954 | 3300005983 | Ga0081540_1000914 | Ga0081540_10009146 | 201 |
| 955 | 3300005983 | Ga0081540_1002541 | Ga0081540_10025418 | 201 |
| 956 | 3300005983 | Ga0081540_1004331 | Ga0081540_10043312 | 201 |
| 957 | 3300005983 | Ga0081540_1006771 | Ga0081540_10067712 | 201 |
| 958 | 3300005983 | Ga0081540_1011082 | Ga0081540_10110823 | 201 |
| 959 | 3300005983 | Ga0081540_1032224 | Ga0081540_10322243 | 201 |
| 960 | 3300005983 | Ga0081540_1035306 | Ga0081540_10353062 | 201 |
| 961 | 3300005983 | Ga0081540_1064864 | Ga0081540_10648642 | 201 |
| 962 | 3300005983 | Ga0081540_1107981 | Ga0081540_11079812 | 201 |
| 963 | 3300005985 | Ga0081539_10000099 | Ga0081539_10000099183 | 201 |
| 964 | 3300005985 | Ga0081539_10001660 | Ga0081539_1000166021 | 201 |
| 965 | 3300005985 | Ga0081539_10050340 | Ga0081539_100503402 | 201 |
| 966 | 3300006028 | Ga0070717_10000851 | Ga0070717_1000085115 | 201 |
| 967 | 3300006028 | Ga0070717_10007189 | Ga0070717_100071894 | 201 |
| 968 | 3300006028 | Ga0070717_10109964 | Ga0070717_101099642 | 201 |
| 969 | 3300006028 | Ga0070717_10218673 | Ga0070717_102186731 | 201 |
| 970 | 3300006028 | Ga0070717_10604749 | Ga0070717_106047492 | 201 |
| 971 | 3300006038 | Ga0075365_10036550 | Ga0075365_100365504 | 201 |
| 972 | 3300006038 | Ga0075365_10095420 | Ga0075365_100954202 | 201 |
| 973 | 3300006042 | Ga0075368_10018984 | Ga0075368_100189842 | 201 |
| 974 | 3300006048 | Ga0075363_100087120 | Ga0075363_1000871202 | 201 |
| 975 | 3300006048 | Ga0075363_100090134 | Ga0075363_1000901342 | 201 |
| 976 | 3300006051 | Ga0075364_10017356 | Ga0075364_100173562 | 201 |
| 977 | 3300006051 | Ga0075364_10083514 | Ga0075364_100835142 | 201 |
| 978 | 3300006163 | Ga0070715_10003420 | Ga0070715_100034203 | 201 |
| 979 | 3300006173 | Ga0070716_100006081 | Ga0070716_1000060813 | 201 |
| 980 | 3300006173 | Ga0070716_100022965 | Ga0070716_1000229654 | 201 |
| 981 | 3300006173 | Ga0070716_100189762 | Ga0070716_1001897622 | 201 |
| 982 | 3300006173 | Ga0070716_100347908 | Ga0070716_1003479081 | 201 |
| 983 | 3300006175 | Ga0070712_100077589 | Ga0070712_1000775892 | 201 |
| 984 | 3300006175 | Ga0070712_100956264 | Ga0070712_1009562641 | 201 |
| 985 | 3300006178 | Ga0075367_10040767 | Ga0075367_100407672 | 201 |
| 986 | 3300006178 | Ga0075367_10151055 | Ga0075367_101510552 | 201 |
| 987 | 3300006178 | Ga0075367_10172004 | Ga0075367_101720042 | 201 |
| 988 | 3300006186 | Ga0075369_10018979 | Ga0075369_100189793 | 201 |
| 989 | 3300006186 | Ga0075369_10021022 | Ga0075369_100210223 | 201 |
| 990 | 3300006195 | Ga0075366_10069831 | Ga0075366_100698312 | 201 |
| 991 | 3300006195 | Ga0075366_10081157 | Ga0075366_100811572 | 201 |
| 992 | 3300006195 | Ga0075366_10135136 | Ga0075366_101351361 | 201 |
| 993 | 3300006195 | Ga0075366_10169494 | Ga0075366_101694942 | 201 |
| 994 | 3300006195 | Ga0075366_10181274 | Ga0075366_101812742 | 201 |
| 995 | 3300006195 | Ga0075366_10278812 | Ga0075366_102788121 | 201 |
| 996 | 3300006237 | Ga0097621_100999238 | Ga0097621_1009992381 | 201 |
| 997 | 3300006353 | Ga0075370_10077347 | Ga0075370_100773472 | 201 |
| 998 | 3300006353 | Ga0075370_10255625 | Ga0075370_102556251 | 201 |
| 999 | 3300006353 | Ga0075370_10381482 | Ga0075370_103814821 | 201 |
| 1000 | 3300006358 | Ga0068871_100121740 | Ga0068871_1001217402 | 201 |
| 1001 | 3300006358 | Ga0068871_100245021 | Ga0068871_1002450212 | 201 |
| 1002 | 3300006358 | Ga0068871_100621906 | Ga0068871_1006219062 | 201 |
| 1003 | 3300006847 | Ga0075431_100665681 | Ga0075431_1006656811 | 201 |
| 1004 | 3300006871 | Ga0075434_100130919 | Ga0075434_1001309192 | 201 |
| 1005 | 3300006871 | Ga0075434_100249421 | Ga0075434_1002494212 | 201 |
| 1006 | 3300006881 | Ga0068865_100150935 | Ga0068865_1001509353 | 201 |
| 1007 | 3300006881 | Ga0068865_100404314 | Ga0068865_1004043142 | 201 |
| 1008 | 3300006914 | Ga0075436_100102897 | Ga0075436_1001028973 | 201 |
| 1009 | 3300006931 | Ga0097620_100026006 | Ga0097620_1000260062 | 201 |
| 1010 | 3300006931 | Ga0097620_100068312 | Ga0097620_1000683124 | 201 |
| 1011 | 3300006931 | Ga0097620_100272574 | Ga0097620_1002725742 | 201 |
| 1012 | 3300006931 | Ga0097620_100325598 | Ga0097620_1003255982 | 201 |
| 1013 | 3300006942 | Ga0099824_1030197 | Ga0099824_10301971 | 201 |
| 1014 | 3300006943 | Ga0099822_1011366 | Ga0099822_10113664 | 201 |
| 1015 | 3300007076 | Ga0075435_100649584 | Ga0075435_1006495842 | 201 |
| 1016 | 3300007265 | Ga0099794_10053926 | Ga0099794_100539262 | 201 |
| 1017 | 3300007265 | Ga0099794_10134058 | Ga0099794_101340582 | 201 |
| 1018 | 3300007265 | Ga0099794_10213087 | Ga0099794_102130871 | 201 |
| 1019 | 3300007788 | Ga0099795_10011772 | Ga0099795_100117724 | 201 |
| 1020 | 3300007788 | Ga0099795_10018762 | Ga0099795_100187622 | 201 |
| 1021 | 3300009036 | Ga0105244_10130491 | Ga0105244_101304912 | 201 |
| 1022 | 3300009092 | Ga0105250_10038359 | Ga0105250_100383592 | 201 |
| 1023 | 3300009092 | Ga0105250_10186600 | Ga0105250_101866001 | 201 |
| 1024 | 3300009093 | Ga0105240_10005613 | Ga0105240_1000561310 | 201 |
| 1025 | 3300009093 | Ga0105240_10093752 | Ga0105240_100937522 | 201 |
| 1026 | 3300009093 | Ga0105240_10183196 | Ga0105240_101831962 | 201 |
| 1027 | 3300009093 | Ga0105240_10261289 | Ga0105240_102612892 | 201 |
| 1028 | 3300009094 | Ga0111539_10405041 | Ga0111539_104050412 | 201 |
| 1029 | 3300009098 | Ga0105245_10143282 | Ga0105245_101432823 | 201 |
| 1030 | 3300009098 | Ga0105245_10241082 | Ga0105245_102410822 | 201 |
| 1031 | 3300009098 | Ga0105245_10718052 | Ga0105245_107180522 | 201 |
| 1032 | 3300009098 | Ga0105245_10728216 | Ga0105245_107282162 | 201 |
| 1033 | 3300009101 | Ga0105247_10040165 | Ga0105247_100401651 | 201 |
| 1034 | 3300009101 | Ga0105247_10181498 | Ga0105247_101814981 | 201 |
| 1035 | 3300009101 | Ga0105247_10203963 | Ga0105247_102039631 | 201 |
| 1036 | 3300009147 | Ga0114129_10203191 | Ga0114129_102031912 | 201 |
| 1037 | 3300009148 | Ga0105243_10334231 | Ga0105243_103342312 | 201 |
| 1038 | 3300009148 | Ga0105243_10386232 | Ga0105243_103862322 | 201 |
| 1039 | 3300009174 | Ga0105241_10009918 | Ga0105241_100099184 | 201 |
| 1040 | 3300009174 | Ga0105241_10148190 | Ga0105241_101481902 | 201 |
| 1041 | 3300009176 | Ga0105242_10273389 | Ga0105242_102733892 | 201 |
| 1042 | 3300009177 | Ga0105248_10194704 | Ga0105248_101947043 | 201 |
| 1043 | 3300009177 | Ga0105248_10549999 | Ga0105248_105499991 | 201 |
| 1044 | 3300009177 | Ga0105248_10664245 | Ga0105248_106642452 | 201 |
| 1045 | 3300009177 | Ga0105248_10726179 | Ga0105248_107261791 | 201 |
| 1046 | 3300009177 | Ga0105248_10753057 | Ga0105248_107530572 | 201 |
| 1047 | 3300009177 | Ga0105248_11071797 | Ga0105248_110717972 | 201 |
| 1048 | 3300009545 | Ga0105237_10049985 | Ga0105237_100499852 | 201 |
| 1049 | 3300009545 | Ga0105237_10081699 | Ga0105237_100816992 | 201 |
| 1050 | 3300009545 | Ga0105237_10235500 | Ga0105237_102355002 | 201 |
| 1051 | 3300009545 | Ga0105237_10262921 | Ga0105237_102629212 | 201 |
| 1052 | 3300009545 | Ga0105237_11133239 | Ga0105237_111332391 | 201 |
| 1053 | 3300009551 | Ga0105238_10000577 | Ga0105238_1000057738 | 201 |
| 1054 | 3300009551 | Ga0105238_10021436 | Ga0105238_100214362 | 201 |
| 1055 | 3300009551 | Ga0105238_10114871 | Ga0105238_101148711 | 201 |
| 1056 | 3300009551 | Ga0105238_10439031 | Ga0105238_104390312 | 201 |
| 1057 | 3300009553 | Ga0105249_10472924 | Ga0105249_104729242 | 201 |
| 1058 | 3300010159 | Ga0099796_10037817 | Ga0099796_100378172 | 201 |
| 1059 | 3300010159 | Ga0099796_10071598 | Ga0099796_100715982 | 201 |
| 1060 | 3300010159 | Ga0099796_10125134 | Ga0099796_101251342 | 201 |
| 1061 | 3300010159 | Ga0099796_10148153 | Ga0099796_101481532 | 201 |
| 1062 | 3300010375 | Ga0105239_10123302 | Ga0105239_101233022 | 201 |
| 1063 | 3300010375 | Ga0105239_10125916 | Ga0105239_101259162 | 201 |
| 1064 | 3300010375 | Ga0105239_10160857 | Ga0105239_101608572 | 201 |
| 1065 | 3300010375 | Ga0105239_10164521 | Ga0105239_101645212 | 201 |
| 1066 | 3300010375 | Ga0105239_10493715 | Ga0105239_104937152 | 201 |
| 1067 | 3300010375 | Ga0105239_10661704 | Ga0105239_106617042 | 201 |
| 1068 | 3300010375 | Ga0105239_10729951 | Ga0105239_107299512 | 201 |
| 1069 | 3300011119 | Ga0105246_10035006 | Ga0105246_100350062 | 201 |
| 1070 | 3300011119 | Ga0105246_10094802 | Ga0105246_100948022 | 201 |
| 1071 | 3300011119 | Ga0105246_10112304 | Ga0105246_101123042 | 201 |
| 1072 | 3300011119 | Ga0105246_10339635 | Ga0105246_103396352 | 201 |
| 1073 | 3300012483 | Ga0157337_1013156 | Ga0157337_10131561 | 201 |
| 1074 | 3300013100 | Ga0157373_10495387 | Ga0157373_104953872 | 201 |
| 1075 | 3300013104 | Ga0157370_10063235 | Ga0157370_100632352 | 201 |
| 1076 | 3300013104 | Ga0157370_10072033 | Ga0157370_100720332 | 201 |
| 1077 | 3300013104 | Ga0157370_10097521 | Ga0157370_100975213 | 201 |
| 1078 | 3300013105 | Ga0157369_10010776 | Ga0157369_100107769 | 201 |
| 1079 | 3300013105 | Ga0157369_10083426 | Ga0157369_100834262 | 201 |
| 1080 | 3300013105 | Ga0157369_10865464 | Ga0157369_108654641 | 201 |
| 1081 | 3300013296 | Ga0157374_10213862 | Ga0157374_102138622 | 201 |
| 1082 | 3300013296 | Ga0157374_10379073 | Ga0157374_103790732 | 201 |
| 1083 | 3300013296 | Ga0157374_10481947 | Ga0157374_104819472 | 201 |
| 1084 | 3300013296 | Ga0157374_10737787 | Ga0157374_107377872 | 201 |
| 1085 | 3300013297 | Ga0157378_10028135 | Ga0157378_100281352 | 201 |
| 1086 | 3300013297 | Ga0157378_10174818 | Ga0157378_101748183 | 201 |
| 1087 | 3300013297 | Ga0157378_10235317 | Ga0157378_102353172 | 201 |
| 1088 | 3300013297 | Ga0157378_10371609 | Ga0157378_103716092 | 201 |
| 1089 | 3300013297 | Ga0157378_10829708 | Ga0157378_108297082 | 201 |
| 1090 | 3300013306 | Ga0163162_10038265 | Ga0163162_100382653 | 201 |
| 1091 | 3300013306 | Ga0163162_10077090 | Ga0163162_100770904 | 201 |
| 1092 | 3300013306 | Ga0163162_10187116 | Ga0163162_101871162 | 201 |
| 1093 | 3300013306 | Ga0163162_10313269 | Ga0163162_103132692 | 201 |
| 1094 | 3300013306 | Ga0163162_11180599 | Ga0163162_111805991 | 201 |
| 1095 | 3300013307 | Ga0157372_10144125 | Ga0157372_101441253 | 201 |
| 1096 | 3300013307 | Ga0157372_10700413 | Ga0157372_107004132 | 201 |
| 1097 | 3300013308 | Ga0157375_10730746 | Ga0157375_107307462 | 201 |
| 1098 | 3300013308 | Ga0157375_11269099 | Ga0157375_112690991 | 201 |
| 1099 | 3300014325 | Ga0163163_10127341 | Ga0163163_101273413 | 201 |
| 1100 | 3300014326 | Ga0157380_10080105 | Ga0157380_100801052 | 201 |
| 1101 | 3300014326 | Ga0157380_10766140 | Ga0157380_107661402 | 201 |
| 1102 | 3300014745 | Ga0157377_10330358 | Ga0157377_103303582 | 201 |
| 1103 | 3300014968 | Ga0157379_10049039 | Ga0157379_100490393 | 201 |
| 1104 | 3300014968 | Ga0157379_10059103 | Ga0157379_100591033 | 201 |
| 1105 | 3300014968 | Ga0157379_11496434 | Ga0157379_114964341 | 201 |
| 1106 | 3300014969 | Ga0157376_10091881 | Ga0157376_100918812 | 201 |
| 1107 | 3300014969 | Ga0157376_10672891 | Ga0157376_106728912 | 201 |
| 1108 | 3300014969 | Ga0157376_10680553 | Ga0157376_106805532 | 201 |
| 1109 | 3300017792 | Ga0163161_10016201 | Ga0163161_100162011 | 201 |
| 1110 | 3300017792 | Ga0163161_10410958 | Ga0163161_104109581 | 201 |
| 1111 | 3300020081 | Ga0206354_10849355 | Ga0206354_108493551 | 201 |
| 1112 | 3300021361 | Ga0213872_10061429 | Ga0213872_100614292 | 201 |
| 1113 | 3300021361 | Ga0213872_10201526 | Ga0213872_102015261 | 201 |
| 1114 | 3300021377 | Ga0213874_10010634 | Ga0213874_100106343 | 201 |
| 1115 | 3300021384 | Ga0213876_10003500 | Ga0213876_100035006 | 201 |
| 1116 | 3300021384 | Ga0213876_10069173 | Ga0213876_100691731 | 201 |
| 1117 | 3300021384 | Ga0213876_10272938 | Ga0213876_102729382 | 201 |
| 1118 | 3300021384 | Ga0213876_10345555 | Ga0213876_103455551 | 201 |
| 1119 | 3300021388 | Ga0213875_10019412 | Ga0213875_100194122 | 201 |
| 1120 | 3300021441 | Ga0213871_10012173 | Ga0213871_100121732 | 201 |
| 1121 | 3300025253 | Ga0209677_102922 | Ga0209677_1029227 | 201 |
| 1122 | 3300025254 | Ga0209148_1020491 | Ga0209148_10204911 | 201 |
| 1123 | 3300025261 | Ga0209233_1000753 | Ga0209233_100075311 | 201 |
| 1124 | 3300025272 | Ga0209455_1004258 | Ga0209455_10042583 | 201 |
| 1125 | 3300025272 | Ga0209455_1018520 | Ga0209455_10185202 | 201 |
| 1126 | 3300025297 | Ga0209758_1010431 | Ga0209758_10104313 | 201 |
| 1127 | 3300025297 | Ga0209758_1045155 | Ga0209758_10451552 | 201 |
| 1128 | 3300025315 | Ga0207697_10114127 | Ga0207697_101141271 | 201 |
| 1129 | 3300025321 | Ga0207656_10072619 | Ga0207656_100726192 | 201 |
| 1130 | 3300025898 | Ga0207692_10000726 | Ga0207692_100007267 | 201 |
| 1131 | 3300025898 | Ga0207692_10028535 | Ga0207692_100285352 | 201 |
| 1132 | 3300025898 | Ga0207692_10199355 | Ga0207692_101993551 | 201 |
| 1133 | 3300025900 | Ga0207710_10030771 | Ga0207710_100307712 | 201 |
| 1134 | 3300025900 | Ga0207710_10075752 | Ga0207710_100757522 | 201 |
| 1135 | 3300025900 | Ga0207710_10175022 | Ga0207710_101750222 | 201 |
| 1136 | 3300025901 | Ga0207688_10237010 | Ga0207688_102370102 | 201 |
| 1137 | 3300025903 | Ga0207680_10077450 | Ga0207680_100774503 | 201 |
| 1138 | 3300025904 | Ga0207647_10015241 | Ga0207647_100152414 | 201 |
| 1139 | 3300025904 | Ga0207647_10211861 | Ga0207647_102118612 | 201 |
| 1140 | 3300025904 | Ga0207647_10285561 | Ga0207647_102855612 | 201 |
| 1141 | 3300025905 | Ga0207685_10013389 | Ga0207685_100133892 | 201 |
| 1142 | 3300025905 | Ga0207685_10077657 | Ga0207685_100776572 | 201 |
| 1143 | 3300025906 | Ga0207699_10008623 | Ga0207699_100086233 | 201 |
| 1144 | 3300025906 | Ga0207699_10012451 | Ga0207699_100124513 | 201 |
| 1145 | 3300025906 | Ga0207699_10052098 | Ga0207699_100520981 | 201 |
| 1146 | 3300025906 | Ga0207699_10052507 | Ga0207699_100525072 | 201 |
| 1147 | 3300025906 | Ga0207699_10128526 | Ga0207699_101285262 | 201 |
| 1148 | 3300025906 | Ga0207699_10391886 | Ga0207699_103918862 | 201 |
| 1149 | 3300025907 | Ga0207645_10066938 | Ga0207645_100669382 | 201 |
| 1150 | 3300025908 | Ga0207643_10155034 | Ga0207643_101550342 | 201 |
| 1151 | 3300025909 | Ga0207705_10302883 | Ga0207705_103028832 | 201 |
| 1152 | 3300025911 | Ga0207654_10000358 | Ga0207654_100003584 | 201 |
| 1153 | 3300025911 | Ga0207654_10059283 | Ga0207654_100592832 | 201 |
| 1154 | 3300025911 | Ga0207654_10102165 | Ga0207654_101021653 | 201 |
| 1155 | 3300025912 | Ga0207707_10000183 | Ga0207707_1000018342 | 201 |
| 1156 | 3300025912 | Ga0207707_10071470 | Ga0207707_100714702 | 201 |
| 1157 | 3300025912 | Ga0207707_10183103 | Ga0207707_101831032 | 201 |
| 1158 | 3300025913 | Ga0207695_10002150 | Ga0207695_1000215018 | 201 |
| 1159 | 3300025913 | Ga0207695_10508089 | Ga0207695_105080892 | 201 |
| 1160 | 3300025914 | Ga0207671_10014366 | Ga0207671_100143663 | 201 |
| 1161 | 3300025914 | Ga0207671_10179830 | Ga0207671_101798301 | 201 |
| 1162 | 3300025914 | Ga0207671_10208073 | Ga0207671_102080731 | 201 |
| 1163 | 3300025914 | Ga0207671_10370424 | Ga0207671_103704242 | 201 |
| 1164 | 3300025915 | Ga0207693_10000269 | Ga0207693_1000026918 | 201 |
| 1165 | 3300025915 | Ga0207693_10032441 | Ga0207693_100324411 | 201 |
| 1166 | 3300025915 | Ga0207693_10136401 | Ga0207693_101364012 | 201 |
| 1167 | 3300025916 | Ga0207663_10000096 | Ga0207663_1000009620 | 201 |
| 1168 | 3300025916 | Ga0207663_10002855 | Ga0207663_100028552 | 201 |
| 1169 | 3300025916 | Ga0207663_10028303 | Ga0207663_100283032 | 201 |
| 1170 | 3300025916 | Ga0207663_10037012 | Ga0207663_100370122 | 201 |
| 1171 | 3300025916 | Ga0207663_10043990 | Ga0207663_100439902 | 201 |
| 1172 | 3300025918 | Ga0207662_10490002 | Ga0207662_104900022 | 201 |
| 1173 | 3300025919 | Ga0207657_10006462 | Ga0207657_100064629 | 201 |
| 1174 | 3300025919 | Ga0207657_10458734 | Ga0207657_104587341 | 201 |
| 1175 | 3300025920 | Ga0207649_10026710 | Ga0207649_100267101 | 201 |
| 1176 | 3300025920 | Ga0207649_10090245 | Ga0207649_100902452 | 201 |
| 1177 | 3300025921 | Ga0207652_10153229 | Ga0207652_101532293 | 201 |
| 1178 | 3300025921 | Ga0207652_10189329 | Ga0207652_101893291 | 201 |
| 1179 | 3300025921 | Ga0207652_10228921 | Ga0207652_102289212 | 201 |
| 1180 | 3300025921 | Ga0207652_10402680 | Ga0207652_104026802 | 201 |
| 1181 | 3300025923 | Ga0207681_10060393 | Ga0207681_100603932 | 201 |
| 1182 | 3300025924 | Ga0207694_10000491 | Ga0207694_1000049115 | 201 |
| 1183 | 3300025924 | Ga0207694_10109801 | Ga0207694_101098012 | 201 |
| 1184 | 3300025924 | Ga0207694_10248776 | Ga0207694_102487761 | 201 |
| 1185 | 3300025924 | Ga0207694_10422724 | Ga0207694_104227242 | 201 |
| 1186 | 3300025924 | Ga0207694_10577760 | Ga0207694_105777601 | 201 |
| 1187 | 3300025925 | Ga0207650_10442919 | Ga0207650_104429192 | 201 |
| 1188 | 3300025925 | Ga0207650_10518086 | Ga0207650_105180862 | 201 |
| 1189 | 3300025927 | Ga0207687_10101422 | Ga0207687_101014222 | 201 |
| 1190 | 3300025928 | Ga0207700_10004115 | Ga0207700_100041154 | 201 |
| 1191 | 3300025928 | Ga0207700_10026105 | Ga0207700_100261052 | 201 |
| 1192 | 3300025928 | Ga0207700_10052150 | Ga0207700_100521503 | 201 |
| 1193 | 3300025928 | Ga0207700_10053842 | Ga0207700_100538422 | 201 |
| 1194 | 3300025928 | Ga0207700_10189647 | Ga0207700_101896472 | 201 |
| 1195 | 3300025928 | Ga0207700_10223738 | Ga0207700_102237382 | 201 |
| 1196 | 3300025929 | Ga0207664_10027009 | Ga0207664_100270092 | 201 |
| 1197 | 3300025929 | Ga0207664_10047125 | Ga0207664_100471252 | 201 |
| 1198 | 3300025929 | Ga0207664_10051997 | Ga0207664_100519973 | 201 |
| 1199 | 3300025929 | Ga0207664_10055299 | Ga0207664_100552992 | 201 |
| 1200 | 3300025929 | Ga0207664_10247549 | Ga0207664_102475492 | 201 |
| 1201 | 3300025929 | Ga0207664_10569118 | Ga0207664_105691181 | 201 |
| 1202 | 3300025931 | Ga0207644_10081518 | Ga0207644_100815182 | 201 |
| 1203 | 3300025932 | Ga0207690_10719975 | Ga0207690_107199751 | 201 |
| 1204 | 3300025933 | Ga0207706_10029379 | Ga0207706_100293796 | 201 |
| 1205 | 3300025933 | Ga0207706_10078177 | Ga0207706_100781772 | 201 |
| 1206 | 3300025933 | Ga0207706_10154987 | Ga0207706_101549872 | 201 |
| 1207 | 3300025933 | Ga0207706_10281857 | Ga0207706_102818572 | 201 |
| 1208 | 3300025933 | Ga0207706_11145142 | Ga0207706_111451421 | 201 |
| 1209 | 3300025938 | Ga0207704_10266735 | Ga0207704_102667352 | 201 |
| 1210 | 3300025939 | Ga0207665_10000104 | Ga0207665_1000010422 | 201 |
| 1211 | 3300025940 | Ga0207691_10178168 | Ga0207691_101781682 | 201 |
| 1212 | 3300025940 | Ga0207691_10290112 | Ga0207691_102901122 | 201 |
| 1213 | 3300025941 | Ga0207711_10584149 | Ga0207711_105841492 | 201 |
| 1214 | 3300025942 | Ga0207689_10012148 | Ga0207689_100121486 | 201 |
| 1215 | 3300025942 | Ga0207689_10098371 | Ga0207689_100983713 | 201 |
| 1216 | 3300025949 | Ga0207667_10026442 | Ga0207667_100264422 | 201 |
| 1217 | 3300025949 | Ga0207667_10035571 | Ga0207667_100355713 | 201 |
| 1218 | 3300025949 | Ga0207667_10045712 | Ga0207667_100457122 | 201 |
| 1219 | 3300025949 | Ga0207667_10227765 | Ga0207667_102277652 | 201 |
| 1220 | 3300025961 | Ga0207712_10707759 | Ga0207712_107077591 | 201 |
| 1221 | 3300025972 | Ga0207668_10037232 | Ga0207668_100372324 | 201 |
| 1222 | 3300025972 | Ga0207668_10047986 | Ga0207668_100479862 | 201 |
| 1223 | 3300025972 | Ga0207668_10498579 | Ga0207668_104985792 | 201 |
| 1224 | 3300025981 | Ga0207640_10010167 | Ga0207640_100101673 | 201 |
| 1225 | 3300025981 | Ga0207640_10094168 | Ga0207640_100941682 | 201 |
| 1226 | 3300025981 | Ga0207640_10229379 | Ga0207640_102293792 | 201 |
| 1227 | 3300025981 | Ga0207640_10381057 | Ga0207640_103810572 | 201 |
| 1228 | 3300025981 | Ga0207640_10540992 | Ga0207640_105409921 | 201 |
| 1229 | 3300025986 | Ga0207658_10189965 | Ga0207658_101899652 | 201 |
| 1230 | 3300026023 | Ga0207677_10046125 | Ga0207677_100461253 | 201 |
| 1231 | 3300026023 | Ga0207677_10321373 | Ga0207677_103213732 | 201 |
| 1232 | 3300026023 | Ga0207677_10456695 | Ga0207677_104566951 | 201 |
| 1233 | 3300026023 | Ga0207677_10606578 | Ga0207677_106065781 | 201 |
| 1234 | 3300026035 | Ga0207703_10220030 | Ga0207703_102200302 | 201 |
| 1235 | 3300026035 | Ga0207703_10448590 | Ga0207703_104485902 | 201 |
| 1236 | 3300026035 | Ga0207703_10855369 | Ga0207703_108553692 | 201 |
| 1237 | 3300026035 | Ga0207703_10959786 | Ga0207703_109597862 | 201 |
| 1238 | 3300026041 | Ga0207639_10003195 | Ga0207639_100031953 | 201 |
| 1239 | 3300026041 | Ga0207639_10127953 | Ga0207639_101279532 | 201 |
| 1240 | 3300026041 | Ga0207639_10424083 | Ga0207639_104240831 | 201 |
| 1241 | 3300026041 | Ga0207639_11268578 | Ga0207639_112685781 | 201 |
| 1242 | 3300026067 | Ga0207678_10014065 | Ga0207678_100140657 | 201 |
| 1243 | 3300026067 | Ga0207678_10030744 | Ga0207678_100307442 | 201 |
| 1244 | 3300026067 | Ga0207678_10128929 | Ga0207678_101289292 | 201 |
| 1245 | 3300026067 | Ga0207678_10218996 | Ga0207678_102189962 | 201 |
| 1246 | 3300026067 | Ga0207678_10313947 | Ga0207678_103139472 | 201 |
| 1247 | 3300026075 | Ga0207708_10075619 | Ga0207708_100756192 | 201 |
| 1248 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003294 | 201 |
| 1249 | 3300026078 | Ga0207702_10032268 | Ga0207702_100322682 | 201 |
| 1250 | 3300026078 | Ga0207702_10056601 | Ga0207702_100566012 | 201 |
| 1251 | 3300026078 | Ga0207702_10508734 | Ga0207702_105087341 | 201 |
| 1252 | 3300026088 | Ga0207641_10225327 | Ga0207641_102253272 | 201 |
| 1253 | 3300026088 | Ga0207641_10291486 | Ga0207641_102914862 | 201 |
| 1254 | 3300026088 | Ga0207641_10468640 | Ga0207641_104686402 | 201 |
| 1255 | 3300026095 | Ga0207676_10042080 | Ga0207676_100420803 | 201 |
| 1256 | 3300026095 | Ga0207676_10104775 | Ga0207676_101047752 | 201 |
| 1257 | 3300026095 | Ga0207676_10171088 | Ga0207676_101710882 | 201 |
| 1258 | 3300026116 | Ga0207674_10085107 | Ga0207674_100851072 | 201 |
| 1259 | 3300026116 | Ga0207674_10097807 | Ga0207674_100978072 | 201 |
| 1260 | 3300026116 | Ga0207674_10097861 | Ga0207674_100978612 | 201 |
| 1261 | 3300026116 | Ga0207674_10382920 | Ga0207674_103829202 | 201 |
| 1262 | 3300026116 | Ga0207674_10830721 | Ga0207674_108307211 | 201 |
| 1263 | 3300026118 | Ga0207675_100021508 | Ga0207675_1000215082 | 201 |
| 1264 | 3300026118 | Ga0207675_100090463 | Ga0207675_1000904632 | 201 |
| 1265 | 3300026118 | Ga0207675_100175893 | Ga0207675_1001758932 | 201 |
| 1266 | 3300026118 | Ga0207675_100262645 | Ga0207675_1002626452 | 201 |
| 1267 | 3300026118 | Ga0207675_100377193 | Ga0207675_1003771932 | 201 |
| 1268 | 3300026118 | Ga0207675_100673288 | Ga0207675_1006732881 | 201 |
| 1269 | 3300026121 | Ga0207683_10152146 | Ga0207683_101521461 | 201 |
| 1270 | 3300026121 | Ga0207683_10209651 | Ga0207683_102096512 | 201 |
| 1271 | 3300026121 | Ga0207683_10335122 | Ga0207683_103351222 | 201 |
| 1272 | 3300026121 | Ga0207683_10546620 | Ga0207683_105466201 | 201 |
| 1273 | 3300026121 | Ga0207683_10696565 | Ga0207683_106965652 | 201 |
| 1274 | 3300026142 | Ga0207698_10027042 | Ga0207698_100270422 | 201 |
| 1275 | 3300026142 | Ga0207698_10114470 | Ga0207698_101144702 | 201 |
| 1276 | 3300026142 | Ga0207698_10607031 | Ga0207698_106070312 | 201 |
| 1277 | 3300027357 | Ga0209589_1000002 | Ga0209589_100000248 | 201 |
| 1278 | 3300027361 | Ga0209489_100002 | Ga0209489_10000248 | 201 |
| 1279 | 3300027363 | Ga0209700_100002 | Ga0209700_10000248 | 201 |
| 1280 | 3300027671 | Ga0209588_1007888 | Ga0209588_10078882 | 201 |
| 1281 | 3300027866 | Ga0209813_10064452 | Ga0209813_100644521 | 201 |
| 1282 | 3300027866 | Ga0209813_10089483 | Ga0209813_100894831 | 201 |
| 1283 | 3300028379 | Ga0268266_10049793 | Ga0268266_100497932 | 201 |
| 1284 | 3300028379 | Ga0268266_10056532 | Ga0268266_100565322 | 201 |
| 1285 | 3300028379 | Ga0268266_10168690 | Ga0268266_101686902 | 201 |
| 1286 | 3300028379 | Ga0268266_10313394 | Ga0268266_103133942 | 201 |
| 1287 | 3300028379 | Ga0268266_10381673 | Ga0268266_103816733 | 201 |
| 1288 | 3300028379 | Ga0268266_10410116 | Ga0268266_104101162 | 201 |
| 1289 | 3300028379 | Ga0268266_10468838 | Ga0268266_104688381 | 201 |
| 1290 | 3300028379 | Ga0268266_10782305 | Ga0268266_107823051 | 201 |
| 1291 | 3300028379 | Ga0268266_11145637 | Ga0268266_111456371 | 201 |
| 1292 | 3300028380 | Ga0268265_10442205 | Ga0268265_104422052 | 201 |
| 1293 | 3300028380 | Ga0268265_10711658 | Ga0268265_107116582 | 201 |
| 1294 | 3300028381 | Ga0268264_10000038 | Ga0268264_10000038258 | 201 |
| 1295 | 3300028381 | Ga0268264_10105950 | Ga0268264_101059502 | 201 |
| 1296 | 3300028381 | Ga0268264_10270123 | Ga0268264_102701231 | 201 |
| 1297 | 3300028381 | Ga0268264_10849473 | Ga0268264_108494732 | 201 |
| 1298 | 3300028381 | Ga0268264_10872998 | Ga0268264_108729982 | 201 |
| 1299 | 3300028381 | Ga0268264_11301006 | Ga0268264_113010062 | 201 |
| 1300 | 3300028556 | Ga0265337_1004994 | Ga0265337_10049943 | 201 |
| 1301 | 3300028558 | Ga0265326_10011046 | Ga0265326_100110462 | 201 |
| 1302 | 3300028563 | Ga0265319_1004750 | Ga0265319_10047503 | 201 |
| 1303 | 3300028573 | Ga0265334_10025808 | Ga0265334_100258082 | 201 |
| 1304 | 3300028577 | Ga0265318_10020324 | Ga0265318_100203244 | 201 |
| 1305 | 3300028653 | Ga0265323_10000744 | Ga0265323_100007443 | 201 |
| 1306 | 3300028654 | Ga0265322_10009604 | Ga0265322_100096042 | 201 |
| 1307 | 3300028666 | Ga0265336_10000228 | Ga0265336_100002283 | 201 |
| 1308 | 3300028786 | Ga0307517_10007898 | Ga0307517_100078988 | 201 |
| 1309 | 3300028786 | Ga0307517_10179540 | Ga0307517_101795402 | 201 |
| 1310 | 3300028800 | Ga0265338_10000116 | Ga0265338_1000011633 | 201 |
| 1311 | 3300029957 | Ga0265324_10004530 | Ga0265324_100045304 | 201 |
| 1312 | 3300031241 | Ga0265325_10033422 | Ga0265325_100334222 | 201 |
| 1313 | 3300031249 | Ga0265339_10072795 | Ga0265339_100727952 | 201 |
| 1314 | 3300031250 | Ga0265331_10075671 | Ga0265331_100756711 | 201 |
| 1315 | 3300031456 | Ga0307513_10235391 | Ga0307513_102353912 | 201 |
| 1316 | 3300031456 | Ga0307513_10611121 | Ga0307513_106111211 | 201 |
| 1317 | 3300031507 | Ga0307509_10207820 | Ga0307509_102078202 | 201 |
| 1318 | 3300031507 | Ga0307509_10271152 | Ga0307509_102711522 | 201 |
| 1319 | 3300031507 | Ga0307509_10601610 | Ga0307509_106016102 | 201 |
| 1320 | 3300031548 | Ga0307408_100269517 | Ga0307408_1002695172 | 201 |
| 1321 | 3300031616 | Ga0307508_10000008 | Ga0307508_1000000851 | 201 |
| 1322 | 3300031616 | Ga0307508_10023981 | Ga0307508_100239812 | 201 |
| 1323 | 3300031616 | Ga0307508_10338481 | Ga0307508_103384812 | 201 |
| 1324 | 3300031616 | Ga0307508_10453554 | Ga0307508_104535541 | 201 |
| 1325 | 3300031712 | Ga0265342_10023099 | Ga0265342_100230992 | 201 |
| 1326 | 3300031730 | Ga0307516_10005698 | Ga0307516_100056986 | 201 |
| 1327 | 3300031730 | Ga0307516_10451226 | Ga0307516_104512261 | 201 |
| 1328 | 3300031824 | Ga0307413_10219223 | Ga0307413_102192232 | 201 |
| 1329 | 3300031852 | Ga0307410_10504798 | Ga0307410_105047982 | 201 |
| 1330 | 3300031901 | Ga0307406_10383675 | Ga0307406_103836752 | 201 |
| 1331 | 3300031903 | Ga0307407_10097577 | Ga0307407_100975772 | 201 |
| 1332 | 3300031911 | Ga0307412_10299716 | Ga0307412_102997162 | 201 |
| 1333 | 3300031911 | Ga0307412_10434443 | Ga0307412_104344432 | 201 |
| 1334 | 3300031911 | Ga0307412_10542924 | Ga0307412_105429241 | 201 |
| 1335 | 3300032002 | Ga0307416_100368616 | Ga0307416_1003686162 | 201 |
| 1336 | 3300032002 | Ga0307416_100704182 | Ga0307416_1007041822 | 201 |
| 1337 | 3300032002 | Ga0307416_101122751 | Ga0307416_1011227511 | 201 |
| 1338 | 3300032004 | Ga0307414_10943860 | Ga0307414_109438601 | 201 |
| 1339 | 3300032126 | Ga0307415_100019725 | Ga0307415_1000197252 | 201 |
| 1340 | 3300032126 | Ga0307415_100314809 | Ga0307415_1003148092 | 201 |
| 1341 | 3300033179 | Ga0307507_10327767 | Ga0307507_103277672 | 201 |
| 1342 | 3300033180 | Ga0307510_10016828 | Ga0307510_100168287 | 201 |
| 1343 | 3300033180 | Ga0307510_10098071 | Ga0307510_100980712 | 201 |
| 1344 | 3300033442 | Ga0315911_1000004 | Ga0315911_1000004316 | 201 |
| 1345 | 3300035083 | Ga0373926_0144211 | Ga0373926_0144211_86_694 | 201 |
| 1346 | 3300035084 | Ga0373928_0026296 | Ga0373928_0026296_311_916 | 201 |
| 1347 | 3300035086 | Ga0373934_0003099 | Ga0373934_0003099_3796_4410 | 201 |
| 1348 | 3300035086 | Ga0373934_0087419 | Ga0373934_0087419_138_743 | 201 |
| 1349 | 3300035089 | Ga0373944_0083577 | Ga0373944_0083577_404_1018 | 201 |
| 1350 | 3300035111 | Ga0373923_0009432 | Ga0373923_0009432_670_1284 | 201 |
| 1351 | 3300035111 | Ga0373923_0022975 | Ga0373923_0022975_53_658 | 201 |
| 1352 | 3300035113 | Ga0373936_0007656 | Ga0373936_0007656_2737_3342 | 201 |
| 1353 | 3300035113 | Ga0373936_0087446 | Ga0373936_0087446_519_1124 | 201 |
| 1354 | 3300035116 | Ga0373945_0013918 | Ga0373945_0013918_167_772 | 201 |
| 1355 | 3300035116 | Ga0373945_0020708 | Ga0373945_0020708_90_704 | 201 |
| 1356 | 3300035117 | Ga0373953_0000196 | Ga0373953_0000196_3146_3760 | 201 |
| 1357 | 3300035117 | Ga0373953_0106647 | Ga0373953_0106647_557_1162 | 201 |
| 1358 | 3300035118 | Ga0373954_0001139 | Ga0373954_0001139_9090_9704 | 201 |
| 1359 | 3300035118 | Ga0373954_0030823 | Ga0373954_0030823_1330_1944 | 201 |
| 1360 | 3300035119 | Ga0373956_0003545 | Ga0373956_0003545_3850_4464 | 201 |
| 1361 | 3300035119 | Ga0373956_0027490 | Ga0373956_0027490_209_814 | 201 |
| 1362 | 3300035119 | Ga0373956_0315694 | Ga0373956_0315694_30_638 | 201 |
| 1363 | 3300035120 | Ga0373957_0088067 | Ga0373957_0088067_124_729 | 201 |
| 1364 | 3300035170 | Ga0373943_0006083 | Ga0373943_0006083_4300_4914 | 201 |
| 1365 | 3300035170 | Ga0373943_0079033 | Ga0373943_0079033_590_1195 | 201 |
| 1366 | 3300035170 | Ga0373943_0158005 | Ga0373943_0158005_299_907 | 201 |
| 1367 | 3300035171 | Ga0373946_0027971 | Ga0373946_0027971_1290_1904 | 201 |
| 1368 | 3300035171 | Ga0373946_0041939 | Ga0373946_0041939_250_870 | 201 |
| 1369 | 3300035172 | Ga0373955_0000407 | Ga0373955_0000407_1857_2471 | 201 |
| 1370 | 3300035172 | Ga0373955_0135089 | Ga0373955_0135089_346_951 | 201 |
| 1371 | 3300035242 | Ga0373962_0052280 | Ga0373962_0052280_459_1079 | 201 |
| 1372 | 3300035410 | Ga0373924_0000379 | Ga0373924_0000379_12307_12921 | 201 |
| 1373 | 3300035410 | Ga0373924_0019302 | Ga0373924_0019302_905_1510 | 201 |
| 1374 | 3300035691 | Ga0373931_0011456 | Ga0373931_0011456_310_930 | 201 |
| 1375 | 3300035692 | Ga0373935_0000493 | Ga0373935_0000493_17038_17652 | 201 |
| 1376 | 3300035692 | Ga0373935_0116943 | Ga0373935_0116943_522_1127 | 201 |
| 1377 | 3300035692 | Ga0373935_0126052 | Ga0373935_0126052_432_1040 | 201 |
| 1378 | 3300035692 | Ga0373935_0701076 | Ga0373935_0701076_98_706 | 201 |
| 1379 | 3300035695 | Ga0373927_0000331 | Ga0373927_0000331_7264_7878 | 201 |
| 1380 | 3300035695 | Ga0373927_0017298 | Ga0373927_0017298_2188_2793 | 201 |
| 1381 | 3300035695 | Ga0373927_0099987 | Ga0373927_0099987_560_1180 | 201 |
| 1382 | 3300035695 | Ga0373927_0212010 | Ga0373927_0212010_544_1158 | 201 |
| 1383 | 3300035724 | Ga0373933_0000272 | Ga0373933_0000272_17072_17677 | 201 |
| 1384 | 3300035724 | Ga0373933_0001601 | Ga0373933_0001601_10887_11501 | 201 |
| 1385 | 3300035724 | Ga0373933_0062081 | Ga0373933_0062081_1039_1653 | 201 |
| 1386 | 3300035725 | Ga0373947_0002830 | Ga0373947_0002830_9284_9898 | 201 |
| 1387 | 3300035725 | Ga0373947_0036532 | Ga0373947_0036532_1221_1841 | 201 |
| 1388 | 3300035725 | Ga0373947_0072974 | Ga0373947_0072974_1109_1714 | 201 |
| 1389 | 3300035725 | Ga0373947_0124719 | Ga0373947_0124719_617_1231 | 201 |
| 1390 | 3300036401 | Ga0373937_0075562 | Ga0373937_0075562_961_1575 | 201 |
| 1391 | 3300036401 | Ga0373937_0114039 | Ga0373937_0114039_1644_2258 | 201 |
| 1392 | 3300037068 | Ga0373925_0005476 | Ga0373925_0005476_6418_7032 | 201 |
| 1393 | 3300037068 | Ga0373925_0115175 | Ga0373925_0115175_1117_1725 | 201 |
| 1394 | 3300037068 | Ga0373925_0434489 | Ga0373925_0434489_187_807 | 201 |
| 1395 | 3300037068 | Ga0373925_0447373 | Ga0373925_0447373_368_988 | 201 |
| 1396 | 3300037418 | Ga0395900_0080025 | Ga0395900_0080025_1752_2360 | 201 |
| 1397 | 3300037418 | Ga0395900_0646174 | Ga0395900_0646174_307_915 | 201 |
| 1398 | 3300037466 | Ga0395898_0022213 | Ga0395898_0022213_182_790 | 201 |
| 1399 | 3300037466 | Ga0395898_0169178 | Ga0395898_0169178_965_1573 | 201 |
| 1400 | 3300037471 | Ga0395905_0015288 | Ga0395905_0015288_1816_2424 | 201 |
| 1401 | 3300037853 | Ga0436364_1508788 | Ga0436364_1508788_318_926 | 201 |
| 1402 | 3300038443 | Ga0395901_0185780 | Ga0395901_0185780_362_970 | 201 |
| 1403 | 3300038443 | Ga0395901_0318823 | Ga0395901_0318823_321_941 | 201 |
| 1404 | 3300038443 | Ga0395901_0632203 | Ga0395901_0632203_191_799 | 201 |
| 1405 | 3300039437 | Ga0436365_0399697 | Ga0436365_0399697_12307_12921 | 201 |
| 1406 | 3300039437 | Ga0436365_0399885 | Ga0436365_0399885_3315_3929 | 201 |
| 1407 | 3300039437 | Ga0436365_1142792 | Ga0436365_1142792_745_1353 | 201 |
| 1408 | 3300039437 | Ga0436365_1622924 | Ga0436365_1622924_152_760 | 201 |
| 1409 | 3300039438 | Ga0436360_0221727 | Ga0436360_0221727_136_744 | 201 |
| 1410 | 3300039438 | Ga0436360_1241329 | Ga0436360_1241329_40_648 | 201 |
| 1411 | 3300039447 | Ga0436361_0596678 | Ga0436361_0596678_943_1551 | 201 |
| 1412 | 3300039447 | Ga0436361_0805829 | Ga0436361_0805829_601_1209 | 201 |
| 1413 | 3300039447 | Ga0436361_1066979 | Ga0436361_1066979_817_1425 | 201 |
| 1414 | 3300039450 | Ga0436363_0658047 | Ga0436363_0658047_4505_5113 | 201 |
| 1415 | 3300039450 | Ga0436363_1036919 | Ga0436363_1036919_211_825 | 201 |
| 1416 | 3300039453 | Ga0436362_0661692 | Ga0436362_0661692_1885_2499 | 201 |
| 1417 | 3300041413 | Ga0439465_0013288 | Ga0439465_0013288_1738_2343 | 201 |
| 1418 | 3300041413 | Ga0439465_0069947 | Ga0439465_0069947_244_852 | 201 |
| 1419 | 3300041441 | Ga0451787_242297 | Ga0451787_242297_216_836 | 201 |
| 1420 | 3300041443 | Ga0451789_0688189 | Ga0451789_0688189_102_707 | 201 |
| 1421 | 3300041453 | Ga0451797_1213215 | Ga0451797_1213215_57_662 | 201 |
| 1422 | 3300041486 | Ga0451807_1676953 | Ga0451807_1676953_37_657 | 201 |
| 1423 | 3300044656 | Ga0466969_0289749 | Ga0466969_0289749_94_702 | 201 |
| 1424 | 3300044694 | Ga0466963_0283387 | Ga0466963_0283387_493_1101 | 201 |
| 1425 | 3300044765 | Ga0466970_0118069 | Ga0466970_0118069_517_1125 | 201 |
| 1426 | 3300044842 | Ga0466957_0159521 | Ga0466957_0159521_261_869 | 201 |
| 1427 | 3300044842 | Ga0466957_0694343 | Ga0466957_0694343_71_679 | 201 |
| 1428 | 3300045049 | Ga0466959_0420980 | Ga0466959_0420980_231_839 | 201 |
| 1429 | 3300045976 | Ga0466967_0333879 | Ga0466967_0333879_387_995 | 201 |
| 1430 | 3300045976 | Ga0466967_0991496 | Ga0466967_0991496_122_730 | 201 |
| 1431 | 3300046452 | Ga0495617_071502 | Ga0495617_071502_507_1115 | 201 |
| 1432 | 3300046453 | Ga0495627_079840 | Ga0495627_079840_220_828 | 201 |
| 1433 | 3300046454 | Ga0495592_0006060 | Ga0495592_0006060_3780_4394 | 201 |
| 1434 | 3300046454 | Ga0495592_0060220 | Ga0495592_0060220_287_901 | 201 |
| 1435 | 3300046454 | Ga0495592_0266270 | Ga0495592_0266270_464_1069 | 201 |
| 1436 | 3300046455 | Ga0495603_0000643 | Ga0495603_0000643_11898_12512 | 201 |
| 1437 | 3300046455 | Ga0495603_0007318 | Ga0495603_0007318_5092_5712 | 201 |
| 1438 | 3300046455 | Ga0495603_0026372 | Ga0495603_0026372_918_1526 | 201 |
| 1439 | 3300046455 | Ga0495603_0244015 | Ga0495603_0244015_129_737 | 201 |
| 1440 | 3300046455 | Ga0495603_0300588 | Ga0495603_0300588_52_657 | 201 |
| 1441 | 3300046459 | Ga0495629_0000423 | Ga0495629_0000423_20550_21164 | 201 |
| 1442 | 3300046459 | Ga0495629_0023037 | Ga0495629_0023037_590_1195 | 201 |
| 1443 | 3300046459 | Ga0495629_0065217 | Ga0495629_0065217_1760_2374 | 201 |
| 1444 | 3300046459 | Ga0495629_0170379 | Ga0495629_0170379_69_674 | 201 |
| 1445 | 3300046460 | Ga0495638_0062748 | Ga0495638_0062748_41_646 | 201 |
| 1446 | 3300046460 | Ga0495638_0375025 | Ga0495638_0375025_19_636 | 201 |
| 1447 | 3300046461 | Ga0495641_0003178 | Ga0495641_0003178_4398_5012 | 201 |
| 1448 | 3300046461 | Ga0495641_0047305 | Ga0495641_0047305_584_1189 | 201 |
| 1449 | 3300046461 | Ga0495641_0171543 | Ga0495641_0171543_61_681 | 201 |
| 1450 | 3300046462 | Ga0495651_0063923 | Ga0495651_0063923_663_1277 | 201 |
| 1451 | 3300046462 | Ga0495651_0097792 | Ga0495651_0097792_1440_2048 | 201 |
| 1452 | 3300046463 | Ga0495653_0018392 | Ga0495653_0018392_1689_2303 | 201 |
| 1453 | 3300046472 | Ga0495580_0001799 | Ga0495580_0001799_4242_4847 | 201 |
| 1454 | 3300046472 | Ga0495580_0002433 | Ga0495580_0002433_11136_11750 | 201 |
| 1455 | 3300046472 | Ga0495580_0152666 | Ga0495580_0152666_824_1432 | 201 |
| 1456 | 3300046473 | Ga0495582_0000166 | Ga0495582_0000166_33800_34414 | 201 |
| 1457 | 3300046473 | Ga0495582_0037791 | Ga0495582_0037791_1500_2120 | 201 |
| 1458 | 3300046473 | Ga0495582_0142450 | Ga0495582_0142450_299_904 | 201 |
| 1459 | 3300046473 | Ga0495582_0577989 | Ga0495582_0577989_32_640 | 201 |
| 1460 | 3300046474 | Ga0495605_0067389 | Ga0495605_0067389_453_1058 | 201 |
| 1461 | 3300046474 | Ga0495605_0173215 | Ga0495605_0173215_151_759 | 201 |
| 1462 | 3300046475 | Ga0495639_0000306 | Ga0495639_0000306_11926_12540 | 201 |
| 1463 | 3300046475 | Ga0495639_0015399 | Ga0495639_0015399_2477_3085 | 201 |
| 1464 | 3300046475 | Ga0495639_0124853 | Ga0495639_0124853_103_708 | 201 |
| 1465 | 3300046475 | Ga0495639_0202963 | Ga0495639_0202963_271_885 | 201 |
| 1466 | 3300046476 | Ga0495662_0001733 | Ga0495662_0001733_1737_2351 | 201 |
| 1467 | 3300046477 | Ga0495664_0008302 | Ga0495664_0008302_1447_2061 | 201 |
| 1468 | 3300046477 | Ga0495664_0011786 | Ga0495664_0011786_2159_2764 | 201 |
| 1469 | 3300046477 | Ga0495664_0566331 | Ga0495664_0566331_30_653 | 201 |
| 1470 | 3300046491 | Ga0495584_0071051 | Ga0495584_0071051_62_670 | 201 |
| 1471 | 3300046492 | Ga0495585_0011742 | Ga0495585_0011742_456_1064 | 201 |
| 1472 | 3300046499 | Ga0495594_0114992 | Ga0495594_0114992_831_1436 | 201 |
| 1473 | 3300046499 | Ga0495594_0178357 | Ga0495594_0178357_311_931 | 201 |
| 1474 | 3300046499 | Ga0495594_0189179 | Ga0495594_0189179_216_830 | 201 |
| 1475 | 3300046501 | Ga0495607_0371548 | Ga0495607_0371548_16_624 | 201 |
| 1476 | 3300046507 | Ga0495606_0370993 | Ga0495606_0370993_58_663 | 201 |
| 1477 | 3300046511 | Ga0495608_0014159 | Ga0495608_0014159_2264_2878 | 201 |
| 1478 | 3300046514 | Ga0495618_0141073 | Ga0495618_0141073_564_1169 | 201 |
| 1479 | 3300046516 | Ga0495628_0011146 | Ga0495628_0011146_5719_6324 | 201 |
| 1480 | 3300046516 | Ga0495628_0033876 | Ga0495628_0033876_2424_3038 | 201 |
| 1481 | 3300046516 | Ga0495628_0245871 | Ga0495628_0245871_536_1141 | 201 |
| 1482 | 3300046516 | Ga0495628_0424438 | Ga0495628_0424438_65_688 | 201 |
| 1483 | 3300046517 | Ga0495630_0019236 | Ga0495630_0019236_3165_3770 | 201 |
| 1484 | 3300046517 | Ga0495630_0025234 | Ga0495630_0025234_3324_3938 | 201 |
| 1485 | 3300046517 | Ga0495630_0041197 | Ga0495630_0041197_782_1402 | 201 |
| 1486 | 3300046519 | Ga0495632_0045002 | Ga0495632_0045002_391_996 | 201 |
| 1487 | 3300046520 | Ga0495637_0183975 | Ga0495637_0183975_27_635 | 201 |
| 1488 | 3300046520 | Ga0495637_0200816 | Ga0495637_0200816_26_631 | 201 |
| 1489 | 3300046523 | Ga0495644_0030518 | Ga0495644_0030518_207_815 | 201 |
| 1490 | 3300046525 | Ga0495663_0006353 | Ga0495663_0006353_440_1060 | 201 |
| 1491 | 3300046526 | Ga0495666_0221560 | Ga0495666_0221560_48_653 | 201 |
| 1492 | 3300046528 | Ga0495642_0136749 | Ga0495642_0136749_179_799 | 201 |
| 1493 | 3300046528 | Ga0495642_0153253 | Ga0495642_0153253_120_725 | 201 |
| 1494 | 3300046529 | Ga0495652_0017206 | Ga0495652_0017206_844_1458 | 201 |
| 1495 | 3300046529 | Ga0495652_0184890 | Ga0495652_0184890_538_1143 | 201 |
| 1496 | 3300046529 | Ga0495652_0336032 | Ga0495652_0336032_25_630 | 201 |
| 1497 | 3300046529 | Ga0495652_0498270 | Ga0495652_0498270_41_655 | 201 |
| 1498 | 3300046531 | Ga0495665_0000104 | Ga0495665_0000104_9292_9906 | 201 |
| 1499 | 3300046531 | Ga0495665_0008245 | Ga0495665_0008245_4389_4994 | 201 |
| 1500 | 3300046533 | Ga0495640_0003774 | Ga0495640_0003774_7063_7677 | 201 |
| 1501 | 3300046533 | Ga0495640_0004857 | Ga0495640_0004857_9387_10001 | 201 |
| 1502 | 3300046536 | Ga0495587_0021455 | Ga0495587_0021455_1706_2320 | 201 |
| 1503 | 3300046537 | Ga0495598_0054622 | Ga0495598_0054622_177_785 | 201 |
| 1504 | 3300046539 | Ga0495621_0056842 | Ga0495621_0056842_346_954 | 201 |
| 1505 | 3300046543 | Ga0495645_0012922 | Ga0495645_0012922_4787_5392 | 201 |
| 1506 | 3300046543 | Ga0495645_0050490 | Ga0495645_0050490_2234_2848 | 201 |
| 1507 | 3300046543 | Ga0495645_0196720 | Ga0495645_0196720_523_1128 | 201 |
| 1508 | 3300046543 | Ga0495645_0462691 | Ga0495645_0462691_160_777 | 201 |
| 1509 | 3300046557 | Ga0495622_0008182 | Ga0495622_0008182_1017_1625 | 201 |
| 1510 | 3300046557 | Ga0495622_0011773 | Ga0495622_0011773_3260_3874 | 201 |
| 1511 | 3300046558 | Ga0495633_0055762 | Ga0495633_0055762_680_1288 | 201 |
| 1512 | 3300046558 | Ga0495633_0065233 | Ga0495633_0065233_761_1381 | 201 |
| 1513 | 3300046559 | Ga0495667_0012970 | Ga0495667_0012970_1664_2278 | 201 |
| 1514 | 3300046559 | Ga0495667_0019422 | Ga0495667_0019422_1045_1650 | 201 |
| 1515 | 3300046559 | Ga0495667_0263017 | Ga0495667_0263017_211_825 | 201 |
| 1516 | 3300046615 | Ga0495656_0018530 | Ga0495656_0018530_1262_1867 | 201 |
| 1517 | 3300046615 | Ga0495656_0044808 | Ga0495656_0044808_639_1247 | 201 |
| 1518 | 3300046615 | Ga0495656_0046176 | Ga0495656_0046176_926_1531 | 201 |
| 1519 | 3300046642 | Ga0495634_0001166 | Ga0495634_0001166_22142_22756 | 201 |
| 1520 | 3300046642 | Ga0495634_0003095 | Ga0495634_0003095_12254_12868 | 201 |
| 1521 | 3300046642 | Ga0495634_0027792 | Ga0495634_0027792_1533_2138 | 201 |
| 1522 | 3300046648 | Ga0495611_0018145 | Ga0495611_0018145_732_1340 | 201 |
| 1523 | 3300046648 | Ga0495611_0082437 | Ga0495611_0082437_357_965 | 201 |
| 1524 | 3300046648 | Ga0495611_0117002 | Ga0495611_0117002_531_1136 | 201 |
| 1525 | 3300046648 | Ga0495611_0137730 | Ga0495611_0137730_226_846 | 201 |
| 1526 | 3300046648 | Ga0495611_0173584 | Ga0495611_0173584_363_971 | 201 |
| 1527 | 3300046660 | Ga0495625_0464380 | Ga0495625_0464380_98_706 | 201 |
| 1528 | 3300046663 | Ga0495635_0005385 | Ga0495635_0005385_5865_6479 | 201 |
| 1529 | 3300046663 | Ga0495635_0020868 | Ga0495635_0020868_2915_3520 | 201 |
| 1530 | 3300046674 | Ga0495588_0006415 | Ga0495588_0006415_4481_5095 | 201 |
| 1531 | 3300046674 | Ga0495588_0023772 | Ga0495588_0023772_1171_1779 | 201 |
| 1532 | 3300046674 | Ga0495588_0278065 | Ga0495588_0278065_52_660 | 201 |
| 1533 | 3300046675 | Ga0495657_0006260 | Ga0495657_0006260_5737_6351 | 201 |
| 1534 | 3300046678 | Ga0495599_0002627 | Ga0495599_0002627_8995_9609 | 201 |
| 1535 | 3300046678 | Ga0495599_0023553 | Ga0495599_0023553_2523_3128 | 201 |
| 1536 | 3300046679 | Ga0495623_0081378 | Ga0495623_0081378_41_655 | 201 |
| 1537 | 3300046679 | Ga0495623_0245280 | Ga0495623_0245280_269_874 | 201 |
| 1538 | 3300046680 | Ga0495646_0007324 | Ga0495646_0007324_695_1309 | 201 |
| 1539 | 3300046680 | Ga0495646_0009165 | Ga0495646_0009165_3854_4468 | 201 |
| 1540 | 3300046680 | Ga0495646_0320992 | Ga0495646_0320992_88_693 | 201 |
| 1541 | 3300046681 | Ga0495647_0000279 | Ga0495647_0000279_5431_6045 | 201 |
| 1542 | 3300046681 | Ga0495647_0169176 | Ga0495647_0169176_255_863 | 201 |
| 1543 | 3300046683 | Ga0495658_0001753 | Ga0495658_0001753_6050_6664 | 201 |
| 1544 | 3300046683 | Ga0495658_0027075 | Ga0495658_0027075_1953_2558 | 201 |
| 1545 | 3300046683 | Ga0495658_0373899 | Ga0495658_0373899_174_788 | 201 |
| 1546 | 3300046689 | Ga0495613_0010689 | Ga0495613_0010689_3795_4409 | 201 |
| 1547 | 3300046689 | Ga0495613_0024352 | Ga0495613_0024352_2314_2928 | 201 |
| 1548 | 3300046689 | Ga0495613_0059911 | Ga0495613_0059911_346_951 | 201 |
| 1549 | 3300046690 | Ga0495624_0003536 | Ga0495624_0003536_5277_5891 | 201 |
| 1550 | 3300046690 | Ga0495624_0128140 | Ga0495624_0128140_621_1241 | 201 |
| 1551 | 3300046691 | Ga0495670_0104656 | Ga0495670_0104656_458_1066 | 201 |
| 1552 | 3300046694 | Ga0495649_0245039 | Ga0495649_0245039_114_734 | 201 |
| 1553 | 3300046794 | Ga0495589_0172047 | Ga0495589_0172047_167_772 | 201 |
| 1554 | 3300046794 | Ga0495589_0188277 | Ga0495589_0188277_101_721 | 201 |
| 1555 | 3300046794 | Ga0495589_0267994 | Ga0495589_0267994_96_704 | 201 |
| 1556 | 3300046809 | Ga0495600_0030566 | Ga0495600_0030566_2706_3320 | 201 |
| 1557 | 3300047315 | Ga0495581_0001274 | Ga0495581_0001274_11926_12540 | 201 |
| 1558 | 3300047315 | Ga0495581_0069513 | Ga0495581_0069513_476_1090 | 201 |
| 1559 | 3300047315 | Ga0495581_0355063 | Ga0495581_0355063_121_741 | 201 |
| 1560 | 3300047317 | Ga0495604_0023252 | Ga0495604_0023252_663_1277 | 201 |
| 1561 | 3300047317 | Ga0495604_0047709 | Ga0495604_0047709_42_656 | 201 |
| 1562 | 3300047317 | Ga0495604_0163680 | Ga0495604_0163680_353_958 | 201 |
| 1563 | 3300047319 | Ga0495674_0001108 | Ga0495674_0001108_9296_9910 | 201 |
| 1564 | 3300047319 | Ga0495674_0013620 | Ga0495674_0013620_3805_4410 | 201 |
| 1565 | 3300047320 | Ga0495672_0081722 | Ga0495672_0081722_41_685 | 201 |
| 1566 | 3300047321 | Ga0495676_0120116 | Ga0495676_0120116_643_1263 | 201 |
| 1567 | 3300047321 | Ga0495676_0213893 | Ga0495676_0213893_191_796 | 201 |
| 1568 | 3300047321 | Ga0495676_0222644 | Ga0495676_0222644_37_645 | 201 |
| 1569 | 3300047321 | Ga0495676_0237537 | Ga0495676_0237537_394_1002 | 201 |
| 1570 | 3300047321 | Ga0495676_0414273 | Ga0495676_0414273_147_761 | 201 |
| 1571 | 3300047322 | Ga0495680_0023259 | Ga0495680_0023259_873_1487 | 201 |
| 1572 | 3300047322 | Ga0495680_0049923 | Ga0495680_0049923_1331_1945 | 201 |
| 1573 | 3300047323 | Ga0495683_0087307 | Ga0495683_0087307_632_1240 | 201 |
| 1574 | 3300047444 | Ga0495675_0031499 | Ga0495675_0031499_2731_3345 | 201 |
| 1575 | 3300047445 | Ga0495677_0177069 | Ga0495677_0177069_96_701 | 201 |
| 1576 | 3300047447 | Ga0495685_084712 | Ga0495685_084712_136_741 | 201 |
| 1577 | 3300047469 | Ga0495673_0091133 | Ga0495673_0091133_16_621 | 201 |
| 1578 | 3300047470 | Ga0495681_0041391 | Ga0495681_0041391_308_916 | 201 |
| 1579 | 3300047471 | Ga0495684_0004305 | Ga0495684_0004305_9136_9741 | 201 |
| 1580 | 3300047471 | Ga0495684_0004969 | Ga0495684_0004969_7505_8119 | 201 |
| 1581 | 3300047471 | Ga0495684_0068506 | Ga0495684_0068506_2073_2687 | 201 |
| 1582 | 3300047472 | Ga0495686_0056468 | Ga0495686_0056468_1773_2378 | 201 |
| 1583 | 3300047472 | Ga0495686_0059621 | Ga0495686_0059621_463_1074 | 201 |
| 1584 | 3300047673 | Ga0495593_0005960 | Ga0495593_0005960_2127_2732 | 201 |
| 1585 | 3300047673 | Ga0495593_0030461 | Ga0495593_0030461_1136_1750 | 201 |
| 1586 | 3300048088 | Ga0495602_0071388 | Ga0495602_0071388_1689_2303 | 201 |
| 1587 | 3300048088 | Ga0495602_0178469 | Ga0495602_0178469_694_1317 | 201 |
| 1588 | 3300048088 | Ga0495602_0348805 | Ga0495602_0348805_122_736 | 201 |
| 1589 | 3300048090 | Ga0495615_0099012 | Ga0495615_0099012_13_618 | 201 |
| 1590 | 3300048903 | Ga0496100_0026737 | Ga0496100_0026737_1363_1986 | 201 |
| 1591 | 3300048903 | Ga0496100_0068392 | Ga0496100_0068392_26_634 | 201 |
| 1592 | 3300048903 | Ga0496100_0154041 | Ga0496100_0154041_412_1032 | 201 |
| 1593 | 3300048903 | Ga0496100_0169796 | Ga0496100_0169796_855_1460 | 201 |
| 1594 | 3300048903 | Ga0496100_0236845 | Ga0496100_0236845_23_631 | 201 |
| 1595 | 3300048903 | Ga0496100_0250592 | Ga0496100_0250592_393_998 | 201 |
| 1596 | 3300048904 | Ga0496101_0026481 | Ga0496101_0026481_746_1366 | 201 |
| 1597 | 3300048904 | Ga0496101_0218397 | Ga0496101_0218397_266_871 | 201 |
| 1598 | 3300048904 | Ga0496101_0532423 | Ga0496101_0532423_98_706 | 201 |
| 1599 | 3300048905 | Ga0496102_0302013 | Ga0496102_0302013_291_896 | 201 |
| 1600 | 3300048905 | Ga0496102_0336242 | Ga0496102_0336242_557_1186 | 201 |
| 1601 | 3300048905 | Ga0496102_0374382 | Ga0496102_0374382_403_1008 | 201 |
| 1602 | 3300048905 | Ga0496102_0393982 | Ga0496102_0393982_554_1174 | 201 |
| 1603 | 3300048905 | Ga0496102_0731202 | Ga0496102_0731202_192_797 | 201 |
| 1604 | 3300048905 | Ga0496102_0739674 | Ga0496102_0739674_180_800 | 201 |
| 1605 | 3300048905 | Ga0496102_0866495 | Ga0496102_0866495_37_666 | 201 |
| 1606 | 3300048906 | Ga0496103_0168973 | Ga0496103_0168973_378_998 | 201 |
| 1607 | 3300048906 | Ga0496103_0418269 | Ga0496103_0418269_30_650 | 201 |
| 1608 | 3300048906 | Ga0496103_0457087 | Ga0496103_0457087_151_759 | 201 |
| 1609 | 3300048907 | Ga0496104_0000126 | Ga0496104_0000126_4629_5237 | 201 |
| 1610 | 3300048907 | Ga0496104_0020423 | Ga0496104_0020423_4425_5030 | 201 |
| 1611 | 3300048907 | Ga0496104_0069473 | Ga0496104_0069473_199_819 | 201 |
| 1612 | 3300048907 | Ga0496104_0270371 | Ga0496104_0270371_904_1509 | 201 |
| 1613 | 3300048907 | Ga0496104_0352006 | Ga0496104_0352006_165_785 | 201 |
| 1614 | 3300048908 | Ga0496105_0014292 | Ga0496105_0014292_11_619 | 201 |
| 1615 | 3300048908 | Ga0496105_0126206 | Ga0496105_0126206_611_1231 | 201 |
| 1616 | 3300048908 | Ga0496105_0238303 | Ga0496105_0238303_551_1171 | 201 |
| 1617 | 3300048908 | Ga0496105_0256403 | Ga0496105_0256403_441_1049 | 201 |
| 1618 | 3300048909 | Ga0496106_0004544 | Ga0496106_0004544_2392_3015 | 201 |
| 1619 | 3300048909 | Ga0496106_0005271 | Ga0496106_0005271_201_821 | 201 |
| 1620 | 3300048909 | Ga0496106_0035159 | Ga0496106_0035159_529_1134 | 201 |
| 1621 | 3300048909 | Ga0496106_0078728 | Ga0496106_0078728_590_1210 | 201 |
| 1622 | 3300048909 | Ga0496106_0099436 | Ga0496106_0099436_95_703 | 201 |
| 1623 | 3300048910 | Ga0496107_0004055 | Ga0496107_0004055_4641_5264 | 201 |
| 1624 | 3300048910 | Ga0496107_0011451 | Ga0496107_0011451_214_834 | 201 |
| 1625 | 3300048910 | Ga0496107_0014869 | Ga0496107_0014869_3112_3732 | 201 |
| 1626 | 3300048910 | Ga0496107_0331444 | Ga0496107_0331444_83_688 | 201 |
| 1627 | 3300048911 | Ga0496108_0000884 | Ga0496108_0000884_2657_3280 | 201 |
| 1628 | 3300048911 | Ga0496108_0013923 | Ga0496108_0013923_5611_6231 | 201 |
| 1629 | 3300048911 | Ga0496108_0076007 | Ga0496108_0076007_1948_2553 | 201 |
| 1630 | 3300048911 | Ga0496108_0154316 | Ga0496108_0154316_1069_1674 | 201 |
| 1631 | 3300048911 | Ga0496108_0315879 | Ga0496108_0315879_579_1187 | 201 |
| 1632 | 3300048911 | Ga0496108_0696693 | Ga0496108_0696693_247_852 | 201 |
| 1633 | 3300048912 | Ga0496109_0000166 | Ga0496109_0000166_58396_59019 | 201 |
| 1634 | 3300048912 | Ga0496109_0005742 | Ga0496109_0005742_9517_10137 | 201 |
| 1635 | 3300048912 | Ga0496109_0210328 | Ga0496109_0210328_803_1411 | 201 |
| 1636 | 3300048912 | Ga0496109_1081603 | Ga0496109_1081603_62_667 | 201 |
| 1637 | 3300048912 | Ga0496109_1248153 | Ga0496109_1248153_56_661 | 201 |
| 1638 | 3300048913 | Ga0496110_0004672 | Ga0496110_0004672_2216_2821 | 201 |
| 1639 | 3300048913 | Ga0496110_0030062 | Ga0496110_0030062_3870_4493 | 201 |
| 1640 | 3300048913 | Ga0496110_0051382 | Ga0496110_0051382_1863_2483 | 201 |
| 1641 | 3300048913 | Ga0496110_0258575 | Ga0496110_0258575_675_1283 | 201 |
| 1642 | 3300048913 | Ga0496110_0379547 | Ga0496110_0379547_437_1042 | 201 |
| 1643 | 3300048913 | Ga0496110_0806318 | Ga0496110_0806318_186_791 | 201 |
| 1644 | 3300048914 | Ga0496111_0057082 | Ga0496111_0057082_2117_2722 | 201 |
| 1645 | 3300048914 | Ga0496111_0169041 | Ga0496111_0169041_180_803 | 201 |
| 1646 | 3300048914 | Ga0496111_0264936 | Ga0496111_0264936_58_678 | 201 |
| 1647 | 3300048915 | Ga0496112_0001913 | Ga0496112_0001913_5769_6392 | 201 |
| 1648 | 3300048915 | Ga0496112_0009707 | Ga0496112_0009707_46_651 | 201 |
| 1649 | 3300048915 | Ga0496112_0057575 | Ga0496112_0057575_1475_2095 | 201 |
| 1650 | 3300048915 | Ga0496112_0313559 | Ga0496112_0313559_209_829 | 201 |
| 1651 | 3300048915 | Ga0496112_0363999 | Ga0496112_0363999_169_774 | 201 |
| 1652 | 3300048915 | Ga0496112_0395479 | Ga0496112_0395479_482_1090 | 201 |
| 1653 | 3300048916 | Ga0496113_0026817 | Ga0496113_0026817_1511_2134 | 201 |
| 1654 | 3300048916 | Ga0496113_0075256 | Ga0496113_0075256_1192_1812 | 201 |
| 1655 | 3300048916 | Ga0496113_0143961 | Ga0496113_0143961_493_1098 | 201 |
| 1656 | 3300048916 | Ga0496113_0203178 | Ga0496113_0203178_785_1558 | 201 |
| 1657 | 3300048916 | Ga0496113_0467907 | Ga0496113_0467907_152_772 | 201 |
| 1658 | 3300048917 | Ga0496114_0061856 | Ga0496114_0061856_2276_2896 | 201 |
| 1659 | 3300048917 | Ga0496114_0207630 | Ga0496114_0207630_86_694 | 201 |
| 1660 | 3300048918 | Ga0496115_0145424 | Ga0496115_0145424_417_1037 | 201 |
| 1661 | 3300048918 | Ga0496115_0179211 | Ga0496115_0179211_321_935 | 201 |
| 1662 | 3300048918 | Ga0496115_0267078 | Ga0496115_0267078_632_1237 | 201 |
| 1663 | 3300048920 | Ga0496117_0182188 | Ga0496117_0182188_508_1113 | 201 |
| 1664 | 3300048921 | Ga0496118_0037797 | Ga0496118_0037797_1951_2559 | 201 |
| 1665 | 3300048921 | Ga0496118_0180127 | Ga0496118_0180127_662_1267 | 201 |
| 1666 | 3300048921 | Ga0496118_0269933 | Ga0496118_0269933_266_889 | 201 |
| 1667 | 3300048921 | Ga0496118_0412744 | Ga0496118_0412744_49_660 | 201 |
| 1668 | 3300048924 | Ga0496121_0001158 | Ga0496121_0001158_9573_10181 | 201 |
| 1669 | 3300048924 | Ga0496121_0036524 | Ga0496121_0036524_727_1335 | 201 |
| 1670 | 3300048924 | Ga0496121_0052743 | Ga0496121_0052743_380_1024 | 201 |
| 1671 | 3300048924 | Ga0496121_0064779 | Ga0496121_0064779_1040_1645 | 201 |
| 1672 | 3300048924 | Ga0496121_0070499 | Ga0496121_0070499_808_1413 | 201 |
| 1673 | 3300048924 | Ga0496121_0076273 | Ga0496121_0076273_1916_2524 | 201 |
| 1674 | 3300048924 | Ga0496121_0098311 | Ga0496121_0098311_831_1436 | 201 |
| 1675 | 3300048924 | Ga0496121_0109790 | Ga0496121_0109790_852_1460 | 201 |
| 1676 | 3300048924 | Ga0496121_0118735 | Ga0496121_0118735_1201_1809 | 201 |
| 1677 | 3300048924 | Ga0496121_0128458 | Ga0496121_0128458_261_866 | 201 |
| 1678 | 3300048924 | Ga0496121_0134288 | Ga0496121_0134288_267_911 | 201 |
| 1679 | 3300048927 | Ga0496124_0058489 | Ga0496124_0058489_2198_2809 | 201 |
| 1680 | 3300048927 | Ga0496124_0093164 | Ga0496124_0093164_1697_2305 | 201 |
| 1681 | 3300048927 | Ga0496124_0162730 | Ga0496124_0162730_572_1177 | 201 |
| 1682 | 3300048927 | Ga0496124_0383865 | Ga0496124_0383865_271_879 | 201 |
| 1683 | 3300048928 | Ga0496125_0058918 | Ga0496125_0058918_849_1460 | 201 |
| 1684 | 3300048928 | Ga0496125_0101612 | Ga0496125_0101612_794_1402 | 201 |
| 1685 | 3300048929 | Ga0496126_0021248 | Ga0496126_0021248_1875_2480 | 201 |
| 1686 | 3300048929 | Ga0496126_0027564 | Ga0496126_0027564_4549_5160 | 201 |
| 1687 | 3300048929 | Ga0496126_0058582 | Ga0496126_0058582_1712_2317 | 201 |
| 1688 | 3300048929 | Ga0496126_0154303 | Ga0496126_0154303_792_1397 | 201 |
| 1689 | 3300048929 | Ga0496126_0231559 | Ga0496126_0231559_293_913 | 201 |
| 1690 | 3300048929 | Ga0496126_0338561 | Ga0496126_0338561_146_760 | 201 |
| 1691 | 3300048929 | Ga0496126_0414179 | Ga0496126_0414179_201_806 | 201 |
| 1692 | 3300048929 | Ga0496126_0519978 | Ga0496126_0519978_314_922 | 201 |
| 1693 | 3300048929 | Ga0496126_0540293 | Ga0496126_0540293_226_849 | 201 |
| 1694 | 3300048929 | Ga0496126_0545144 | Ga0496126_0545144_251_859 | 201 |
| 1695 | 3300049459 | Ga0495678_084196 | Ga0495678_084196_441_1046 | 201 |
| 1696 | 3300049460 | Ga0495682_0193412 | Ga0495682_0193412_24_629 | 201 |
| 1697 | 3300049569 | Ga0501032_0580351 | Ga0501032_0580351_73_678 | 201 |
| 1698 | 3300049570 | Ga0501033_0150572 | Ga0501033_0150572_35_679 | 201 |
| 1699 | 3300049571 | Ga0501034_0034045 | Ga0501034_0034045_3713_4357 | 201 |
| 1700 | 3300049571 | Ga0501034_0891912 | Ga0501034_0891912_32_679 | 201 |
| 1701 | 3300049573 | Ga0501037_0408957 | Ga0501037_0408957_129_734 | 201 |
| 1702 | 3300049574 | Ga0501038_0700286 | Ga0501038_0700286_77_682 | 201 |
| 1703 | 3300049576 | Ga0501040_0214192 | Ga0501040_0214192_735_1340 | 201 |
| 1704 | 3300049579 | Ga0501043_0756978 | Ga0501043_0756978_21_665 | 201 |
| 1705 | 3300049581 | Ga0501047_0015759 | Ga0501047_0015759_2365_2979 | 201 |
| 1706 | 3300049581 | Ga0501047_0049372 | Ga0501047_0049372_1561_2205 | 201 |
| 1707 | 3300049585 | Ga0501069_0323490 | Ga0501069_0323490_201_806 | 201 |
| 1708 | 3300049586 | Ga0501070_0006105 | Ga0501070_0006105_894_1508 | 201 |
| 1709 | 3300049586 | Ga0501070_0083794 | Ga0501070_0083794_290_934 | 201 |
| 1710 | 3300049587 | Ga0501071_0171870 | Ga0501071_0171870_109_714 | 201 |
| 1711 | 3300049590 | Ga0501074_0043902 | Ga0501074_0043902_1627_2241 | 201 |
| 1712 | 3300049590 | Ga0501074_0392062 | Ga0501074_0392062_80_685 | 201 |
| 1713 | 3300049822 | Ga0501035_0026147 | Ga0501035_0026147_4542_5186 | 201 |
| 1714 | 3300049822 | Ga0501035_0483430 | Ga0501035_0483430_167_772 | 201 |
| 1715 | 3300049823 | Ga0501044_0105284 | Ga0501044_0105284_81_725 | 201 |
| 1716 | 3300049823 | Ga0501044_0452447 | Ga0501044_0452447_77_691 | 201 |
| 1717 | 3300049824 | Ga0501045_0734510 | Ga0501045_0734510_36_641 | 201 |
| 1718 | 3300050489 | nmdc:mga03683_209889_c1 | nmdc:mga03683_209889_c1_78_683 | 201 |
| 1719 | 3300050489 | nmdc:mga03683_353013_c1 | nmdc:mga03683_353013_c1_61_669 | 201 |
| 1720 | 3300050489 | nmdc:mga03683_71078_c1 | nmdc:mga03683_71078_c1_464_1069 | 201 |
| 1721 | 3300050490 | nmdc:mga03n38_97972_c1 | nmdc:mga03n38_97972_c1_85_690 | 201 |
| 1722 | 3300050491 | nmdc:mga00v17_59104_c1 | nmdc:mga00v17_59104_c1_935_1540 | 201 |
| 1723 | 3300050491 | nmdc:mga00v17_631294_c1 | nmdc:mga00v17_631294_c1_65_670 | 201 |
| 1724 | 3300050492 | nmdc:mga0yw44_247782_c1 | nmdc:mga0yw44_247782_c1_502_1128 | 201 |
| 1725 | 3300050492 | nmdc:mga0yw44_629110_c1 | nmdc:mga0yw44_629110_c1_26_652 | 201 |
| 1726 | 3300050493 | nmdc:mga0k408_133064_c1 | nmdc:mga0k408_133064_c1_549_1154 | 201 |
| 1727 | 3300050493 | nmdc:mga0k408_18926_c1 | nmdc:mga0k408_18926_c1_38_646 | 201 |
| 1728 | 3300050493 | nmdc:mga0k408_200604_c1 | nmdc:mga0k408_200604_c1_278_883 | 201 |
| 1729 | 3300050494 | nmdc:mga06z11_11035_c1 | nmdc:mga06z11_11035_c1_136_741 | 201 |
| 1730 | 3300050494 | nmdc:mga06z11_62894_c1 | nmdc:mga06z11_62894_c1_187_795 | 201 |
| 1731 | 3300050495 | nmdc:mga04h51_77007_c1 | nmdc:mga04h51_77007_c1_364_969 | 201 |
| 1732 | 3300050495 | nmdc:mga04h51_78702_c1 | nmdc:mga04h51_78702_c1_209_817 | 201 |
| 1733 | 3300050495 | nmdc:mga04h51_96333_c1 | nmdc:mga04h51_96333_c1_73_678 | 201 |
| 1734 | 3300050496 | nmdc:mga07m45_105569_c1 | nmdc:mga07m45_105569_c1_646_1254 | 201 |
| 1735 | 3300050496 | nmdc:mga07m45_108751_c1 | nmdc:mga07m45_108751_c1_258_863 | 201 |
| 1736 | 3300050496 | nmdc:mga07m45_35516_c1 | nmdc:mga07m45_35516_c1_524_1129 | 201 |
| 1737 | 3300050496 | nmdc:mga07m45_8718_c1 | nmdc:mga07m45_8718_c1_2687_3292 | 201 |
| 1738 | 3300050507 | nmdc:mga05p37_349995_c1 | nmdc:mga05p37_349995_c1_909_1514 | 201 |
| 1739 | 3300050509 | nmdc:mga0qj67_986413_c1 | nmdc:mga0qj67_986413_c1_32_640 | 201 |
| 1740 | 3300050512 | nmdc:mga0n895_124354_c1 | nmdc:mga0n895_124354_c1_626_1231 | 201 |
| 1741 | 3300050512 | nmdc:mga0n895_228752_c1 | nmdc:mga0n895_228752_c1_964_1569 | 201 |
| 1742 | 3300050513 | nmdc:mga0rr50_175839_c1 | nmdc:mga0rr50_175839_c1_387_992 | 201 |
| 1743 | 3300050513 | nmdc:mga0rr50_407471_c1 | nmdc:mga0rr50_407471_c1_447_1052 | 201 |
| 1744 | 3300050514 | nmdc:mga08x19_85734_c1 | nmdc:mga08x19_85734_c1_235_843 | 201 |
| 1745 | 3300050515 | nmdc:mga0a205_635069_c1 | nmdc:mga0a205_635069_c1_203_808 | 201 |
| 1746 | 3300050516 | nmdc:mga0sz30_49132_c1 | nmdc:mga0sz30_49132_c1_209_814 | 201 |
| 1747 | 3300050516 | nmdc:mga0sz30_52130_c1 | nmdc:mga0sz30_52130_c1_725_1330 | 201 |
| 1748 | 3300053077 | Ga0495601_0112890 | Ga0495601_0112890_884_1489 | 201 |
| 1749 | 3300053077 | Ga0495601_0212427 | Ga0495601_0212427_41_646 | 201 |
| 1750 | 3300053077 | Ga0495601_0348248 | Ga0495601_0348248_182_796 | 201 |
| 1751 | 3300053078 | Ga0495612_0007947 | Ga0495612_0007947_554_1159 | 201 |
| 1752 | 3300053080 | Ga0500635_0005867 | Ga0500635_0005867_2123_2728 | 201 |
| 1753 | 3300053080 | Ga0500635_0021376 | Ga0500635_0021376_281_889 | 201 |
| 1754 | 3300053083 | Ga0495655_0129481 | Ga0495655_0129481_47_664 | 201 |
| 1755 | 3300053084 | Ga0495595_0000808 | Ga0495595_0000808_2301_2915 | 201 |
| 1756 | 3300053084 | Ga0495595_0347423 | Ga0495595_0347423_102_722 | 201 |
| 1757 | 3300053085 | Ga0495619_0032598 | Ga0495619_0032598_1062_1676 | 201 |
| 1758 | 3300053087 | Ga0500643_069707 | Ga0500643_069707_246_854 | 201 |
| 1759 | 3300053088 | Ga0500644_0111336 | Ga0500644_0111336_419_1024 | 201 |
| 1760 | 3300053091 | Ga0500647_0059319 | Ga0500647_0059319_586_1191 | 201 |
| 1761 | 3300053092 | Ga0500583_0007131 | Ga0500583_0007131_1448_2056 | 201 |
| 1762 | 3300053094 | Ga0500566_0000072 | Ga0500566_0000072_10677_11282 | 201 |
| 1763 | 3300053094 | Ga0500566_0002476 | Ga0500566_0002476_1736_2353 | 201 |
| 1764 | 3300053094 | Ga0500566_0226593 | Ga0500566_0226593_234_842 | 201 |
| 1765 | 3300053095 | Ga0500640_034957 | Ga0500640_034957_52_657 | 201 |
| 1766 | 3300053096 | Ga0500641_0006798 | Ga0500641_0006798_3228_3833 | 201 |
| 1767 | 3300053098 | Ga0500650_0146739 | Ga0500650_0146739_64_672 | 201 |
| 1768 | 3300053102 | Ga0500554_000273 | Ga0500554_000273_6161_6769 | 201 |
| 1769 | 3300053102 | Ga0500554_000792 | Ga0500554_000792_1933_2550 | 201 |
| 1770 | 3300053111 | Ga0500572_000226 | Ga0500572_000226_15910_16533 | 201 |
| 1771 | 3300053111 | Ga0500572_000499 | Ga0500572_000499_12046_12651 | 201 |
| 1772 | 3300053115 | Ga0500591_043704 | Ga0500591_043704_1076_1681 | 201 |
| 1773 | 3300053119 | Ga0500595_000581 | Ga0500595_000581_7962_8579 | 201 |
| 1774 | 3300053119 | Ga0500595_003343 | Ga0500595_003343_2192_2797 | 201 |
| 1775 | 3300053119 | Ga0500595_015487 | Ga0500595_015487_378_986 | 201 |
| 1776 | 3300053119 | Ga0500595_072996 | Ga0500595_072996_389_994 | 201 |
| 1777 | 3300053119 | Ga0500595_097667 | Ga0500595_097667_155_763 | 201 |
| 1778 | 3300053123 | Ga0500614_003266 | Ga0500614_003266_181_786 | 201 |
| 1779 | 3300053136 | Ga0500559_0000155 | Ga0500559_0000155_53162_53785 | 201 |
| 1780 | 3300053136 | Ga0500559_0001312 | Ga0500559_0001312_2580_3185 | 201 |
| 1781 | 3300053147 | Ga0500589_142501 | Ga0500589_142501_292_897 | 201 |
| 1782 | 3300053148 | Ga0500590_034455 | Ga0500590_034455_69_674 | 201 |
| 1783 | 3300053148 | Ga0500590_243575 | Ga0500590_243575_23_628 | 201 |
| 1784 | 3300053150 | Ga0500603_000346 | Ga0500603_000346_2553_3161 | 201 |
| 1785 | 3300053150 | Ga0500603_000767 | Ga0500603_000767_6506_7111 | 201 |
| 1786 | 3300053150 | Ga0500603_022200 | Ga0500603_022200_128_736 | 201 |
| 1787 | 3300053159 | Ga0500630_000703 | Ga0500630_000703_815_1420 | 201 |
| 1788 | 3300053162 | Ga0500638_000737 | Ga0500638_000737_124_741 | 201 |
| 1789 | 3300053163 | Ga0500639_000029 | Ga0500639_000029_70853_71458 | 201 |
| 1790 | 3300053163 | Ga0500639_132881 | Ga0500639_132881_276_899 | 201 |
| 1791 | 3300053177 | Ga0500636_0141455 | Ga0500636_0141455_657_1265 | 201 |
| 1792 | 3300053177 | Ga0500636_0159938 | Ga0500636_0159938_83_700 | 201 |
| 1793 | 3300053178 | Ga0500637_0000163 | Ga0500637_0000163_3058_3666 | 201 |
| 1794 | 3300053178 | Ga0500637_0094437 | Ga0500637_0094437_107_715 | 201 |
| 1795 | 3300053725 | Ga0500576_065134 | Ga0500576_065134_144_767 | 201 |
| 1796 | 3300053725 | Ga0500576_163368 | Ga0500576_163368_172_777 | 201 |
| 1797 | 3300053730 | Ga0500645_020102 | Ga0500645_020102_1383_1991 | 201 |
| 1798 | 3300053731 | Ga0500609_002715 | Ga0500609_002715_156_764 | 201 |
| 1799 | 3300053737 | Ga0500601_020389 | Ga0500601_020389_31_636 | 201 |
| 1800 | 3300055283 | Ga0500661_003807 | Ga0500661_003807_1928_2545 | 201 |
| 1801 | 3300059503 | Ga0587080_088941 | Ga0587080_088941_17_625 | 201 |
| 1802 | 3300060353 | Ga0501082_0503461 | Ga0501082_0503461_415_1020 | 201 |
| 1803 | iso_pu_bacteria | 2908739725 | 2908740947 | 201 |
| 1804 | iso_pu_bacteria | 8006933436 | 8006934535 | 201 |
| 1805 | iso_pu_bacteria | 8006973647 | 8006974505 | 201 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3crj-assembly1.cif.gz_B | crystal structure of a tetr transcription regulator from haloarcula marismortui atcc 43049 | 0.7862 | 10 | 197 |
| 2ras-assembly1.cif.gz_A | crystal structure of a putative tetr/acrr family transcriptional regulator (saro_0558) from novosphingobium aromaticivorans dsm at 1.80 a resolution | 0.781 | 7 | 200 |
| 3crj-assembly1.cif.gz_B | crystal structure of a tetr transcription regulator from haloarcula marismortui atcc 43049 | 0.7789 | 10 | 197 |
| 6el2-assembly1.cif.gz_B | safadr_lauroyl_coa complex | 0.7752 | 14 | 197 |
| 3dcf-assembly1.cif.gz_B | crystal structure of transcriptional regulator of the tetr/acrr family (yp_290855.1) from thermobifida fusca yx-er1 at 2.50 a resolution | 0.7687 | 11 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4w97A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9764 | 12 | 52 | 1.10.10.60 |
| 5ojxA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9755 | 14 | 62 | 1.10.10.60 |
| 3dcfB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9748 | 11 | 52 | 1.10.10.60 |
| 2raeA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9701 | 12 | 52 | 1.10.10.60 |
| 2eh3A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9668 | 12 | 58 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5A7WJM6-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.981 | 1 | 198 |
GO:0000976
GO:0003700 |
| AF-A0A657LRB5-F1-model_v4 | TetR family transcriptional regulator | 0.9804 | 5 | 195 |
GO:0000976
GO:0003700 |
| AF-A0A1I4DDH6-F1-model_v4 | DNA-binding transcriptional regulator, AcrR family | 0.9755 | 12 | 199 |
GO:0000976
GO:0003700 |
| AF-A0A327KRD9-F1-model_v4 | TetR family transcriptional regulator | 0.9727 | 6 | 195 |
GO:0000976
GO:0003700 |
| AF-A0A5A7WJM6-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9713 | 1 | 198 |
GO:0000976
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar