F495752

General Info

Members Datasets Scaffolds Average Seq Length
1805 776 1574 200

Family's Representative Sequence

Representative Sequence 3300006943|Ga0099822_1011366|Ga0099822_10113664
Length 212
Sequence MTLISEHNETDTRERILVVAERLFRQIGYQKTTVADIAKELRMSPANVYRFFDSKKSIHEGVARGLMGEVEVEAQRIARSEGPAAARLREMMTTINRMNTERYVGDSKLHEMVEIAMQEDWGVCVAHMELIARIIGEVIAQGAASGEFEVKDLQVASLCACTAMMRFFHPQMIAQCATKPGPTIDQMIDFVIAGLSPRVRANCAVSTDVFVS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2643221651 Afipia sp. Root123D2 Isolate Unclassified
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
32 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
33 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
34 2791355199
35 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
36 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
37 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
38 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
39 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
40 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
41 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
42 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
43 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
44 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
47 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
48 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
49 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
50 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
51 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
52 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
53 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
54 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
55 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
56 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
57 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
58 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
59 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
60 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
61 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
62 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
63 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
64 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
65 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
66 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
67 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
68 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
71 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
72 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
75 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
76 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
77 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
78 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
79 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
80 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
81 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
82 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
83 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
84 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
85 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
86 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
87 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
88 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
89 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
90 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
91 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
92 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
93 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
94 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
95 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
96 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
97 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
98 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
99 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
100 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
101 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
102 2904699407
103 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
104 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
105 2906610324
106 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
107 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
108 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
109 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
110 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
111 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
112 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
113 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
114 2922368715
115 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
116 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
117 2922425934
118 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
119 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
120 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
121 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
122 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
123 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
124 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
125 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
126 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
127 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
128 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
129 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
130 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
131 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
132 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
133 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
134 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
135 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
136 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
137 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
138 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
139 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
140 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
141 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
142 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
143 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
144 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
145 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
146 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
147 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
148 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
149 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
150 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
151 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
152 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
153 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
154 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
155 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
156 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
157 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
158 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
159 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
160 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
161 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
162 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
163 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
164 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
165 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
166 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
167 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
168 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
169 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
170 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
171 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
172 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
173 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
174 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
175 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
176 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
177 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
178 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
179 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
180 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
181 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
182 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
183 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
184 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
185 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
186 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
187 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
188 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
189 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
190 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
191 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
192 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
193 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
194 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
195 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
196 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
197 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
198 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
199 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
200 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
201 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
202 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
203 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
204 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
205 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
206 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
207 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
208 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
209 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
210 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
211 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
212 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
213 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
214 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
215 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
216 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
217 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
218 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
219 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
220 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
221 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
222 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
223 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
224 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
225 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
226 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
227 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
228 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
229 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
230 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
231 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
232 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
233 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
234 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
235 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
236 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
237 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
238 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
239 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
240 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
241 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
242 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
243 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
244 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
245 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
246 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
247 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
248 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
249 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
250 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
251 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
252 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
253 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
254 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
255 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
256 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
257 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
258 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
259 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
260 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
261 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
262 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
263 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
264 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
265 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
266 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
267 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
268 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
269 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
270 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
271 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
272 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
273 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
274 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
275 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
276 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
277 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
278 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
279 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
280 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
281 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
282 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
283 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
284 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
285 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
286 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
287 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
288 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
289 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
290 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
291 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
292 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
293 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
294 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
295 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
296 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
297 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
298 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
299 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
300 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
301 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
302 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
303 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
304 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
305 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
306 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
307 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
308 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
309 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
310 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
311 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
312 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
313 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
314 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
315 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
316 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
317 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
318 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
319 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
320 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
321 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
322 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
323 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
324 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
325 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
326 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
327 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
328 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
329 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
330 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
331 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
332 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
333 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
334 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
335 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
336 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
337 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
338 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
339 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
340 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
341 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
342 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
343 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
344 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
345 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
346 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
347 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
351 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
353 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
354 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
355 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
356 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
357 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
358 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
359 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
423 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
424 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
425 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
426 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
428 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
429 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
433 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
434 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
435 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
436 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
437 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
438 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
439 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
440 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
441 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
442 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
443 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
444 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
445 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
446 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
447 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
448 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
449 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
450 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
451 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
452 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
453 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
454 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
455 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
456 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
457 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
458 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
459 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
460 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
461 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
462 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
463 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
464 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
465 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
466 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
467 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
468 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
469 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
470 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
471 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
472 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
473 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
474 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
475 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
476 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
477 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
478 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
479 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
480 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
481 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
482 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
483 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
484 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
485 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
486 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
487 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
488 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
489 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
490 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
491 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
492 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
493 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
494 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
495 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
496 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
497 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
498 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
499 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
500 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
501 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
502 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
503 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
504 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
505 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
506 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
507 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
508 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
509 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
510 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
511 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
512 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
513 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
514 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
515 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
516 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
517 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
518 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
519 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
520 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
521 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
522 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
523 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
524 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
525 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
526 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
527 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
528 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
529 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
530 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
531 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
532 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
533 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
534 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
535 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
536 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
537 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
538 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
539 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
540 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
541 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
542 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
543 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
544 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
545 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
546 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
547 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
548 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
549 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
550 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
551 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
552 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
553 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
554 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
555 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
556 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
557 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
558 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
559 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
560 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
561 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
562 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
563 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
564 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
565 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
566 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
567 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
568 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
569 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
570 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
571 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
572 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
573 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
574 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
575 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
576 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
577 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
578 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
579 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
580 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
581 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
582 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
583 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
584 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
585 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
586 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
587 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
588 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
589 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
590 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
591 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
592 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
593 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
594 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
595 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
596 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
597 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
598 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
599 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
600 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
601 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
602 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
603 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
604 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
605 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
606 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
607 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
608 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
609 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
610 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
611 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
612 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
613 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
614 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
615 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
616 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
617 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
618 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
619 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
620 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
621 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
622 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
623 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
624 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
625 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
626 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
627 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
628 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
629 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
630 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
631 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
632 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
633 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
634 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
635 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
636 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
637 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
638 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
639 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
640 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
641 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
642 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
643 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
644 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
645 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
646 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
647 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
648 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
649 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
650 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
651 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
652 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
653 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
654 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
655 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
656 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
657 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
658 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
659 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
660 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
661 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
662 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
663 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
664 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
665 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
666 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
667 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
668 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
669 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
670 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
671 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
672 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
673 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
674 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
675 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
676 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
677 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
678 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
679 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
680 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
681 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
682 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
683 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
684 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
685 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
686 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
687 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
688 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
689 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
690 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
691 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
692 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
693 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
694 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
695 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
696 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
697 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
698 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
699 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
700 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
701 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
702 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
703 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
704 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
705 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
706 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
707 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
708 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
709 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
710 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
711 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
712 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
713 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
714 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
715 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
716 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
717 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
718 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
719 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
720 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
721 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
722 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
723 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
724 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
725 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
726 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
727 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
728 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
729 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
730 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
731 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
732 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
733 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
734 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
735 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
736 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
737 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
738 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
739 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
740 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
741 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
742 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
743 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
744 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
745 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
746 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
747 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
748 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
749 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
750 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
751 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
752 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
753 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
754 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
755 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
756 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
757 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
758 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
759 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
760 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
761 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
762 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
763 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
764 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
765 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
766 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
767 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
768 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
769 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
770 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
771 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
772 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
773 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
774 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
775 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
776 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.17
Metatranscriptomes 0.28
Isolates 12.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.08
Nodule 10.25
Rhizoplane 7.04
Rhizosphere 61.99
Stem 0
Stem Tuber 0
Unclassified 8.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014946 3300001979 Bacteria 2848
2 JGI24740J21852_10093049 3300001979 Bacteria 776
3 JGI24739J22299_10073834 3300001989 Bacteria 1057
4 JGI24737J22298_10020398 3300001990 Bacteria 2116
5 JGI24735J21928_10056643 3300002067 Bacteria 1128
6 JGI25406J46586_10000042 3300003203 Bacteria 56211
7 JGI25165J46597_1004815 3300003214 Bacteria 2760
8 JGI25153J46596_10008025 3300003215 Bacteria 5103
9 JGI25153J46596_10021145 3300003215 Bacteria 2433
10 JGI25153J46596_10087656 3300003215 Bacteria 760
11 JGI25160J50197_1002006 3300003354 Bacteria 9716
12 JGI25160J50197_1020040 3300003354 Bacteria 2031
13 JGI25404J52841_10006334 3300003659 Bacteria 2473
14 JGI25404J52841_10034536 3300003659 Bacteria 1077
15 JGI25404J52841_10041845 3300003659 Bacteria 969
16 Ga0055539_1001331 3300003752 Bacteria 4790
17 Ga0055525_1005132 3300003759 Bacteria 1115
18 Ga0055526_1032557 3300003771 Bacteria 1468
19 Ga0055526_1053039 3300003771 Bacteria 911
20 Ga0055524_1043256 3300003775 Bacteria 1110
21 Ga0055531_10008593 3300003794 Bacteria 5356
22 Ga0065165_1002451 3300005262 Bacteria 15679
23 Ga0065165_1002611 3300005262 Bacteria 14729
24 Ga0065165_1003698 3300005262 Bacteria 10374
25 Ga0065165_1032389 3300005262 Bacteria 1639
26 Ga0065707_10038970 3300005295 Bacteria 1022
27 Ga0070658_10135114 3300005327 Bacteria 2057
28 Ga0070658_10282156 3300005327 Bacteria 1414
29 Ga0070658_10395391 3300005327 Bacteria 1187
30 Ga0070676_10154307 3300005328 Bacteria 1472
31 Ga0070676_10246739 3300005328 Bacteria 1190
32 Ga0070683_100109347 3300005329 Bacteria 2607
33 Ga0070690_100085021 3300005330 Bacteria 2075
34 Ga0068869_100066490 3300005334 Bacteria 2656
35 Ga0068869_100068209 3300005334 Bacteria 2626
36 Ga0068869_100112284 3300005334 Bacteria 2074
37 Ga0070680_100088958 3300005336 Bacteria 2555
38 Ga0070680_100850116 3300005336 Bacteria 787
39 Ga0070682_100163478 3300005337 Bacteria 1540
40 Ga0070682_100188729 3300005337 Bacteria 1446
41 Ga0068868_100058744 3300005338 Bacteria 3040
42 Ga0068868_100180111 3300005338 Bacteria 1753
43 Ga0070660_100030069 3300005339 Bacteria 4072
44 Ga0070689_100701727 3300005340 Bacteria 884
45 Ga0070691_10192339 3300005341 Bacteria 1068
46 Ga0070661_100035244 3300005344 Bacteria 3633
47 Ga0070661_100149211 3300005344 Bacteria 1767
48 Ga0070668_100043305 3300005347 Bacteria 3452
49 Ga0070668_100370558 3300005347 Bacteria 1216
50 Ga0070668_100664503 3300005347 Bacteria 916
51 Ga0070668_100944900 3300005347 Bacteria 772
52 Ga0070675_100927245 3300005354 Bacteria 799
53 Ga0070671_100115480 3300005355 Bacteria 2257
54 Ga0070671_100283396 3300005355 Bacteria 1410
55 Ga0070671_100470937 3300005355 Bacteria 1079
56 Ga0070671_100664784 3300005355 Bacteria 902
57 Ga0070671_101282978 3300005355 Bacteria 646
58 Ga0070674_100064690 3300005356 Bacteria 2564
59 Ga0070674_100206666 3300005356 Bacteria 1519
60 Ga0070674_100688739 3300005356 Bacteria 872
61 Ga0070674_100798562 3300005356 Bacteria 815
62 Ga0070659_100501538 3300005366 Bacteria 1034
63 Ga0070659_100663637 3300005366 Bacteria 900
64 Ga0070659_100745771 3300005366 Bacteria 849
65 Ga0070667_100303983 3300005367 Bacteria 1437
66 Ga0070667_100549321 3300005367 Bacteria 1062
67 Ga0070709_10000380 3300005434 Bacteria 27434
68 Ga0070709_10004357 3300005434 Bacteria 7629
69 Ga0070709_10011774 3300005434 Bacteria 4884
70 Ga0070709_10017233 3300005434 Bacteria 4139
71 Ga0070709_10202467 3300005434 Bacteria 1407
72 Ga0070709_10394478 3300005434 Bacteria 1032
73 Ga0070709_10447408 3300005434 Bacteria 973
74 Ga0070709_10771121 3300005434 Bacteria 753
75 Ga0070714_100011779 3300005435 Bacteria 6949
76 Ga0070714_100043286 3300005435 Bacteria 3808
77 Ga0070714_100051414 3300005435 Bacteria 3512
78 Ga0070714_100106539 3300005435 Bacteria 2477
79 Ga0070714_100508149 3300005435 Bacteria 1150
80 Ga0070714_100572839 3300005435 Bacteria 1083
81 Ga0070714_101053565 3300005435 Bacteria 792
82 Ga0070713_100002836 3300005436 Bacteria 11341
83 Ga0070713_100004693 3300005436 Bacteria 9229
84 Ga0070713_100014512 3300005436 Bacteria 5855
85 Ga0070713_100028325 3300005436 Bacteria 4423
86 Ga0070713_100036343 3300005436 Bacteria 3974
87 Ga0070713_100200837 3300005436 Bacteria 1800
88 Ga0070713_100209153 3300005436 Bacteria 1765
89 Ga0070713_100305526 3300005436 Bacteria 1465
90 Ga0070710_10000933 3300005437 Bacteria 13902
91 Ga0070710_10001211 3300005437 Bacteria 12205
92 Ga0070710_10261085 3300005437 Bacteria 1117
93 Ga0070701_10250245 3300005438 Bacteria 1070
94 Ga0070711_100004399 3300005439 Bacteria 8310
95 Ga0070711_100007412 3300005439 Bacteria 6673
96 Ga0070711_100009990 3300005439 Bacteria 5856
97 Ga0070711_100222809 3300005439 Bacteria 1467
98 Ga0070711_100231149 3300005439 Bacteria 1442
99 Ga0070711_100455851 3300005439 Bacteria 1047
100 Ga0070711_100540110 3300005439 Bacteria 966
101 Ga0070705_100206883 3300005440 Bacteria 1350
102 Ga0070700_100071377 3300005441 Bacteria 2217
103 Ga0070694_100257396 3300005444 Bacteria 1322
104 Ga0070708_100522450 3300005445 Bacteria 1120
105 Ga0070663_100089893 3300005455 Bacteria 2273
106 Ga0070663_100123601 3300005455 Bacteria 1957
107 Ga0070663_100149178 3300005455 Bacteria 1792
108 Ga0070663_100225602 3300005455 Bacteria 1473
109 Ga0070663_100258536 3300005455 Bacteria 1380
110 Ga0070663_100341193 3300005455 Bacteria 1210
111 Ga0070663_100372050 3300005455 Bacteria 1162
112 Ga0070663_100816585 3300005455 Bacteria 800
113 Ga0070663_100883963 3300005455 Bacteria 771
114 Ga0070678_100181322 3300005456 Bacteria 1724
115 Ga0070678_100282665 3300005456 Bacteria 1404
116 Ga0070678_100303358 3300005456 Bacteria 1358
117 Ga0070662_100057253 3300005457 Bacteria 2832
118 Ga0070662_100097475 3300005457 Bacteria 2219
119 Ga0070681_10041826 3300005458 Bacteria 4593
120 Ga0070681_10117787 3300005458 Bacteria 2592
121 Ga0070681_10188605 3300005458 Bacteria 1982
122 Ga0070681_10435840 3300005458 Bacteria 1222
123 Ga0070681_10583189 3300005458 Bacteria 1032
124 Ga0070685_10520085 3300005466 Bacteria 845
125 Ga0070706_100131890 3300005467 Bacteria 2332
126 Ga0070707_100121925 3300005468 Bacteria 2531
127 Ga0070707_100674806 3300005468 Bacteria 996
128 Ga0070698_100256842 3300005471 Bacteria 1680
129 Ga0070698_100896333 3300005471 Bacteria 832
130 Ga0070699_100068026 3300005518 Bacteria 3093
131 Ga0070679_100020904 3300005530 Bacteria 6385
132 Ga0070679_100055132 3300005530 Bacteria 3959
133 Ga0070679_100223109 3300005530 Bacteria 1845
134 Ga0070679_100466946 3300005530 Bacteria 1206
135 Ga0070679_100581139 3300005530 Bacteria 1064
136 Ga0070684_100030973 3300005535 Bacteria 4550
137 Ga0070684_100043585 3300005535 Bacteria 3875
138 Ga0070684_101032896 3300005535 Bacteria 772
139 Ga0070697_100034848 3300005536 Bacteria 4060
140 Ga0070697_101055700 3300005536 Bacteria 723
141 Ga0068853_100025492 3300005539 Bacteria 4962
142 Ga0068853_100043569 3300005539 Bacteria 3839
143 Ga0068853_100081244 3300005539 Bacteria 2837
144 Ga0068853_100308800 3300005539 Bacteria 1463
145 Ga0068853_100866771 3300005539 Bacteria 866
146 Ga0068853_100991364 3300005539 Bacteria 809
147 Ga0070672_100029567 3300005543 Bacteria 4110
148 Ga0070672_100875699 3300005543 Bacteria 793
149 Ga0070695_100181288 3300005545 Bacteria 1492
150 Ga0070696_100217077 3300005546 Bacteria 1433
151 Ga0070693_100028629 3300005547 Bacteria 3031
152 Ga0070693_100042510 3300005547 Bacteria 2561
153 Ga0070693_100099385 3300005547 Bacteria 1770
154 Ga0070665_100030244 3300005548 Bacteria 5450
155 Ga0070665_100038083 3300005548 Bacteria 4834
156 Ga0070665_100144019 3300005548 Bacteria 2386
157 Ga0070665_100250045 3300005548 Bacteria 1773
158 Ga0070665_100326616 3300005548 Bacteria 1538
159 Ga0070665_100393302 3300005548 Bacteria 1394
160 Ga0070665_100430402 3300005548 Bacteria 1328
161 Ga0070665_100769820 3300005548 Bacteria 975
162 Ga0070665_100844626 3300005548 Bacteria 929
163 Ga0070665_100922947 3300005548 Bacteria 886
164 Ga0070704_100808971 3300005549 Bacteria 838
165 Ga0068855_100027933 3300005563 Bacteria 6749
166 Ga0068855_100049446 3300005563 Bacteria 4959
167 Ga0068855_100068968 3300005563 Bacteria 4115
168 Ga0068855_100186192 3300005563 Bacteria 2344
169 Ga0068855_100398121 3300005563 Bacteria 1509
170 Ga0070664_100202018 3300005564 Bacteria 1774
171 Ga0070664_100288344 3300005564 Bacteria 1481
172 Ga0068857_100010524 3300005577 Bacteria 8041
173 Ga0068857_100084190 3300005577 Bacteria 2842
174 Ga0068857_100095363 3300005577 Bacteria 2665
175 Ga0068857_100134916 3300005577 Bacteria 2228
176 Ga0068857_100173848 3300005577 Bacteria 1959
177 Ga0068854_100144658 3300005578 Bacteria 1828
178 Ga0068854_100184670 3300005578 Bacteria 1631
179 Ga0068854_100324336 3300005578 Bacteria 1253
180 Ga0068856_100000217 3300005614 Bacteria 61831
181 Ga0068856_100003953 3300005614 Bacteria 14841
182 Ga0068856_100033390 3300005614 Bacteria 5038
183 Ga0068856_100514096 3300005614 Bacteria 1219
184 Ga0068856_100607455 3300005614 Bacteria 1115
185 Ga0070702_100016652 3300005615 Bacteria 3775
186 Ga0068852_100005393 3300005616 Bacteria 9145
187 Ga0068852_100032679 3300005616 Bacteria 4311
188 Ga0068852_100118243 3300005616 Bacteria 2422
189 Ga0068852_100828087 3300005616 Bacteria 940
190 Ga0068852_100875035 3300005616 Bacteria 915
191 Ga0068859_100026003 3300005617 Bacteria 5872
192 Ga0068859_100068312 3300005617 Bacteria 3588
193 Ga0068859_100272587 3300005617 Bacteria 1784
194 Ga0068859_100325615 3300005617 Bacteria 1630
195 Ga0068864_100118727 3300005618 Bacteria 2362
196 Ga0068864_100771107 3300005618 Bacteria 943
197 Ga0068866_10057212 3300005718 Bacteria 2008
198 Ga0068861_100079783 3300005719 Bacteria 2559
199 Ga0068861_100139587 3300005719 Bacteria 1977
200 Ga0068861_100320045 3300005719 Bacteria 1350
201 Ga0068861_100668591 3300005719 Bacteria 961
202 Ga0068861_100880465 3300005719 Bacteria 846
203 Ga0068851_10089407 3300005834 Bacteria 1620
204 Ga0068851_10437577 3300005834 Bacteria 775
205 Ga0068870_10173473 3300005840 Bacteria 1288
206 Ga0068870_10497570 3300005840 Bacteria 812
207 Ga0068863_100246090 3300005841 Bacteria 1726
208 Ga0068863_100278770 3300005841 Bacteria 1619
209 Ga0068863_100293003 3300005841 Bacteria 1577
210 Ga0068863_100988687 3300005841 Bacteria 844
211 Ga0068863_101017083 3300005841 Bacteria 832
212 Ga0068858_100057906 3300005842 Bacteria 3581
213 Ga0068858_100078178 3300005842 Bacteria 3074
214 Ga0068858_100126924 3300005842 Bacteria 2389
215 Ga0068858_100264428 3300005842 Bacteria 1636
216 Ga0068858_100441351 3300005842 Bacteria 1253
217 Ga0068858_100590804 3300005842 Bacteria 1077
218 Ga0068860_100000280 3300005843 Bacteria 72849
219 Ga0068860_100298239 3300005843 Bacteria 1578
220 Ga0068860_100789512 3300005843 Bacteria 963
221 Ga0068862_100138012 3300005844 Bacteria 2162
222 Ga0068862_100454852 3300005844 Bacteria 1208
223 Ga0081455_10360995 3300005937 Bacteria 1021
224 Ga0081538_10030517 3300005981 Bacteria 3658
225 Ga0081540_1000914 3300005983 Bacteria 26584
226 Ga0081540_1002541 3300005983 Bacteria 14800
227 Ga0081540_1004331 3300005983 Bacteria 10872
228 Ga0081540_1006771 3300005983 Bacteria 8286
229 Ga0081540_1011082 3300005983 Bacteria 6053
230 Ga0081540_1012457 3300005983 Bacteria 5596
231 Ga0081540_1032224 3300005983 Bacteria 2866
232 Ga0081540_1035306 3300005983 Bacteria 2683
233 Ga0081540_1064864 3300005983 Bacteria 1721
234 Ga0081540_1107981 3300005983 Bacteria 1184
235 Ga0081539_10000099 3300005985 Bacteria 201018
236 Ga0081539_10001660 3300005985 Bacteria 36067
237 Ga0081539_10050340 3300005985 Bacteria 2358
238 Ga0070717_10000851 3300006028 Bacteria 20235
239 Ga0070717_10007189 3300006028 Bacteria 8252
240 Ga0070717_10109964 3300006028 Bacteria 2350
241 Ga0070717_10218673 3300006028 Bacteria 1674
242 Ga0070717_10604749 3300006028 Bacteria 995
243 Ga0070717_10610335 3300006028 Bacteria 990
244 Ga0075365_10036550 3300006038 Bacteria 3182
245 Ga0075365_10038304 3300006038 Bacteria 3115
246 Ga0075365_10095420 3300006038 Bacteria 2031
247 Ga0075365_10137806 3300006038 Bacteria 1692
248 Ga0075365_10343482 3300006038 Bacteria 1052
249 Ga0075365_10458362 3300006038 Bacteria 900
250 Ga0075368_10018984 3300006042 Bacteria 2591
251 Ga0075363_100073623 3300006048 Bacteria 1859
252 Ga0075363_100087120 3300006048 Bacteria 1715
253 Ga0075363_100090134 3300006048 Bacteria 1687
254 Ga0075363_100144620 3300006048 Bacteria 1340
255 Ga0075363_100180615 3300006048 Bacteria 1200
256 Ga0075364_10017356 3300006051 Bacteria 4495
257 Ga0075364_10083514 3300006051 Bacteria 2114
258 Ga0075364_10102762 3300006051 Bacteria 1903
259 Ga0075364_10266151 3300006051 Bacteria 1165
260 Ga0070715_10003420 3300006163 Bacteria 5045
261 Ga0070715_10287884 3300006163 Bacteria 874
262 Ga0070715_10297031 3300006163 Bacteria 863
263 Ga0070716_100006081 3300006173 Bacteria 5885
264 Ga0070716_100022965 3300006173 Bacteria 3302
265 Ga0070716_100189762 3300006173 Bacteria 1357
266 Ga0070716_100347908 3300006173 Bacteria 1048
267 Ga0070712_100037108 3300006175 Bacteria 3319
268 Ga0070712_100077589 3300006175 Bacteria 2394
269 Ga0070712_100956264 3300006175 Bacteria 740
270 Ga0075362_10275439 3300006177 Bacteria 831
271 Ga0075367_10030061 3300006178 Bacteria 3111
272 Ga0075367_10040767 3300006178 Bacteria 2712
273 Ga0075367_10151055 3300006178 Bacteria 1441
274 Ga0075367_10172004 3300006178 Bacteria 1349
275 Ga0075369_10018979 3300006186 Bacteria 2804
276 Ga0075369_10021022 3300006186 Bacteria 2677
277 Ga0075369_10035188 3300006186 Bacteria 2128
278 Ga0075369_10274705 3300006186 Bacteria 784
279 Ga0075366_10069831 3300006195 Bacteria 2091
280 Ga0075366_10081157 3300006195 Bacteria 1937
281 Ga0075366_10134751 3300006195 Bacteria 1491
282 Ga0075366_10135136 3300006195 Bacteria 1489
283 Ga0075366_10169494 3300006195 Bacteria 1325
284 Ga0075366_10181274 3300006195 Bacteria 1279
285 Ga0075366_10278812 3300006195 Bacteria 1021
286 Ga0097621_100023922 3300006237 Bacteria 4762
287 Ga0097621_100999238 3300006237 Bacteria 782
288 Ga0075370_10033798 3300006353 Bacteria 2864
289 Ga0075370_10077347 3300006353 Bacteria 1909
290 Ga0075370_10255625 3300006353 Bacteria 1038
291 Ga0075370_10349343 3300006353 Bacteria 883
292 Ga0075370_10381482 3300006353 Bacteria 844
293 Ga0068871_100121740 3300006358 Bacteria 2204
294 Ga0068871_100245021 3300006358 Bacteria 1559
295 Ga0068871_100621906 3300006358 Bacteria 984
296 Ga0068871_100796548 3300006358 Bacteria 871
297 Ga0075428_100652061 3300006844 Bacteria 1123
298 Ga0075431_100665681 3300006847 Bacteria 1021
299 Ga0075434_100023687 3300006871 Bacteria 5988
300 Ga0075434_100093534 3300006871 Bacteria 3010
301 Ga0075434_100130919 3300006871 Bacteria 2527
302 Ga0075434_100249421 3300006871 Bacteria 1794
303 Ga0068865_100004347 3300006881 Bacteria 8548
304 Ga0068865_100150935 3300006881 Bacteria 1763
305 Ga0068865_100404314 3300006881 Bacteria 1119
306 Ga0068865_100571982 3300006881 Bacteria 952
307 Ga0075436_100102897 3300006914 Bacteria 1990
308 Ga0097620_100026006 3300006931 Bacteria 5872
309 Ga0097620_100068312 3300006931 Bacteria 3588
310 Ga0097620_100272574 3300006931 Bacteria 1784
311 Ga0097620_100325598 3300006931 Bacteria 1630
312 Ga0099825_1015919 3300006941 Bacteria 6609
313 Ga0099824_1028363 3300006942 Bacteria 2554
314 Ga0099824_1030197 3300006942 Bacteria 2203
315 Ga0099822_1011366 3300006943 Bacteria 10857
316 Ga0099823_1063315 3300006944 Bacteria 1851
317 Ga0075435_100260755 3300007076 Bacteria 1477
318 Ga0075435_100649584 3300007076 Bacteria 916
319 Ga0099794_10053926 3300007265 Bacteria 1940
320 Ga0099794_10134058 3300007265 Bacteria 1252
321 Ga0099794_10213087 3300007265 Bacteria 991
322 Ga0099795_10011772 3300007788 Bacteria 2629
323 Ga0099795_10018762 3300007788 Bacteria 2228
324 Ga0099795_10150480 3300007788 Bacteria 953
325 Ga0105244_10130491 3300009036 Bacteria 1213
326 Ga0105250_10038359 3300009092 Bacteria 1921
327 Ga0105250_10186600 3300009092 Bacteria 871
328 Ga0105240_10005613 3300009093 Bacteria 18626
329 Ga0105240_10018407 3300009093 Bacteria 9379
330 Ga0105240_10093752 3300009093 Bacteria 3664
331 Ga0105240_10183196 3300009093 Bacteria 2470
332 Ga0105240_10261289 3300009093 Bacteria 1997
333 Ga0105240_11129475 3300009093 Bacteria 833
334 Ga0111539_10405041 3300009094 Bacteria 1589
335 Ga0111539_10997827 3300009094 Bacteria 973
336 Ga0105245_10143282 3300009098 Bacteria 2253
337 Ga0105245_10241082 3300009098 Bacteria 1752
338 Ga0105245_10282136 3300009098 Bacteria 1624
339 Ga0105245_10300323 3300009098 Bacteria 1575
340 Ga0105245_10718052 3300009098 Bacteria 1033
341 Ga0105245_10728216 3300009098 Bacteria 1026
342 Ga0105247_10040165 3300009101 Bacteria 2859
343 Ga0105247_10181498 3300009101 Bacteria 1405
344 Ga0105247_10203963 3300009101 Bacteria 1330
345 Ga0114129_10203191 3300009147 Bacteria 2682
346 Ga0105243_10126375 3300009148 Bacteria 2164
347 Ga0105243_10334231 3300009148 Bacteria 1385
348 Ga0105243_10386232 3300009148 Bacteria 1296
349 Ga0105243_11399399 3300009148 Bacteria 720
350 Ga0105241_10009918 3300009174 Bacteria 7000
351 Ga0105241_10057681 3300009174 Bacteria 2980
352 Ga0105241_10148190 3300009174 Bacteria 1917
353 Ga0105241_10178213 3300009174 Bacteria 1761
354 Ga0105241_10461296 3300009174 Bacteria 1126
355 Ga0105241_10750691 3300009174 Bacteria 895
356 Ga0105242_10057151 3300009176 Bacteria 3194
357 Ga0105242_10110621 3300009176 Bacteria 2341
358 Ga0105242_10273389 3300009176 Bacteria 1531
359 Ga0105248_10108895 3300009177 Bacteria 3124
360 Ga0105248_10194704 3300009177 Bacteria 2284
361 Ga0105248_10258573 3300009177 Bacteria 1960
362 Ga0105248_10549999 3300009177 Bacteria 1302
363 Ga0105248_10664245 3300009177 Bacteria 1176
364 Ga0105248_10726179 3300009177 Bacteria 1121
365 Ga0105248_10753057 3300009177 Bacteria 1099
366 Ga0105248_11071797 3300009177 Bacteria 911
367 Ga0105248_11739186 3300009177 Bacteria 707
368 Ga0105237_10016328 3300009545 Bacteria 7718
369 Ga0105237_10049985 3300009545 Bacteria 4202
370 Ga0105237_10081699 3300009545 Bacteria 3222
371 Ga0105237_10234989 3300009545 Bacteria 1834
372 Ga0105237_10235500 3300009545 Bacteria 1832
373 Ga0105237_10262921 3300009545 Bacteria 1728
374 Ga0105237_10396181 3300009545 Bacteria 1385
375 Ga0105237_10414071 3300009545 Bacteria 1353
376 Ga0105237_11133239 3300009545 Bacteria 789
377 Ga0105238_10000577 3300009551 Bacteria 38524
378 Ga0105238_10021436 3300009551 Bacteria 6581
379 Ga0105238_10114871 3300009551 Bacteria 2671
380 Ga0105238_10170267 3300009551 Bacteria 2154
381 Ga0105238_10439031 3300009551 Bacteria 1301
382 Ga0105238_10600758 3300009551 Bacteria 1108
383 Ga0105249_10472924 3300009553 Bacteria 1295
384 Ga0105249_10721690 3300009553 Bacteria 1058
385 Ga0099796_10037817 3300010159 Bacteria 1616
386 Ga0099796_10071598 3300010159 Bacteria 1253
387 Ga0099796_10125134 3300010159 Bacteria 992
388 Ga0099796_10148153 3300010159 Bacteria 922
389 Ga0099796_10226005 3300010159 Bacteria 769
390 Ga0105239_10020532 3300010375 Bacteria 7286
391 Ga0105239_10117394 3300010375 Bacteria 2953
392 Ga0105239_10123302 3300010375 Bacteria 2879
393 Ga0105239_10125916 3300010375 Bacteria 2847
394 Ga0105239_10139090 3300010375 Bacteria 2705
395 Ga0105239_10160857 3300010375 Bacteria 2508
396 Ga0105239_10164521 3300010375 Bacteria 2480
397 Ga0105239_10201246 3300010375 Bacteria 2231
398 Ga0105239_10377607 3300010375 Bacteria 1602
399 Ga0105239_10493715 3300010375 Bacteria 1391
400 Ga0105239_10661704 3300010375 Bacteria 1193
401 Ga0105239_10729951 3300010375 Bacteria 1133
402 Ga0105239_11222313 3300010375 Bacteria 866
403 Ga0105246_10003035 3300011119 Bacteria 10189
404 Ga0105246_10035006 3300011119 Bacteria 3352
405 Ga0105246_10094802 3300011119 Bacteria 2159
406 Ga0105246_10112304 3300011119 Bacteria 2004
407 Ga0105246_10339635 3300011119 Bacteria 1227
408 Ga0105246_10400002 3300011119 Bacteria 1140
409 Ga0105246_10549288 3300011119 Bacteria 990
410 Ga0157337_1013156 3300012483 Bacteria 677
411 Ga0157373_10495387 3300013100 Bacteria 882
412 Ga0157370_10063235 3300013104 Bacteria 3507
413 Ga0157370_10072033 3300013104 Bacteria 3260
414 Ga0157370_10097521 3300013104 Bacteria 2757
415 Ga0157370_11017251 3300013104 Bacteria 750
416 Ga0157369_10010776 3300013105 Bacteria 10408
417 Ga0157369_10083426 3300013105 Bacteria 3418
418 Ga0157369_10426866 3300013105 Bacteria 1374
419 Ga0157369_10865464 3300013105 Bacteria 927
420 Ga0157374_10007618 3300013296 Bacteria 9240
421 Ga0157374_10213862 3300013296 Bacteria 1891
422 Ga0157374_10379073 3300013296 Bacteria 1409
423 Ga0157374_10395252 3300013296 Bacteria 1378
424 Ga0157374_10481947 3300013296 Bacteria 1244
425 Ga0157374_10737787 3300013296 Bacteria 999
426 Ga0157378_10028135 3300013297 Bacteria 4957
427 Ga0157378_10174818 3300013297 Bacteria 2016
428 Ga0157378_10235317 3300013297 Bacteria 1747
429 Ga0157378_10275117 3300013297 Bacteria 1621
430 Ga0157378_10371609 3300013297 Bacteria 1402
431 Ga0157378_10829708 3300013297 Bacteria 952
432 Ga0163162_10038265 3300013306 Bacteria 4787
433 Ga0163162_10077090 3300013306 Bacteria 3397
434 Ga0163162_10187116 3300013306 Bacteria 2198
435 Ga0163162_10313269 3300013306 Bacteria 1702
436 Ga0163162_10364985 3300013306 Bacteria 1577
437 Ga0163162_10548363 3300013306 Bacteria 1284
438 Ga0163162_11180599 3300013306 Bacteria 868
439 Ga0163162_11517043 3300013306 Bacteria 764
440 Ga0157372_10144125 3300013307 Bacteria 2747
441 Ga0157372_10700413 3300013307 Bacteria 1179
442 Ga0157375_10730746 3300013308 Bacteria 1142
443 Ga0157375_11204890 3300013308 Bacteria 888
444 Ga0157375_11269099 3300013308 Bacteria 865
445 Ga0157375_11359337 3300013308 Bacteria 836
446 Ga0163163_10019430 3300014325 Bacteria 6382
447 Ga0163163_10127341 3300014325 Bacteria 2585
448 Ga0157380_10054606 3300014326 Bacteria 3171
449 Ga0157380_10080105 3300014326 Bacteria 2669
450 Ga0157380_10766140 3300014326 Bacteria 978
451 Ga0182008_10145084 3300014497 Bacteria 1189
452 Ga0157377_10166455 3300014745 Bacteria 1375
453 Ga0157377_10330358 3300014745 Bacteria 1016
454 Ga0157379_10049039 3300014968 Bacteria 3770
455 Ga0157379_10059103 3300014968 Bacteria 3428
456 Ga0157379_10240892 3300014968 Bacteria 1641
457 Ga0157379_11496434 3300014968 Bacteria 657
458 Ga0157376_10009146 3300014969 Bacteria 7185
459 Ga0157376_10091881 3300014969 Bacteria 2630
460 Ga0157376_10460283 3300014969 Bacteria 1243
461 Ga0157376_10672891 3300014969 Bacteria 1038
462 Ga0157376_10680553 3300014969 Bacteria 1032
463 Ga0182006_1118523 3300015261 Bacteria 922
464 Ga0163161_10016201 3300017792 Bacteria 5202
465 Ga0163161_10326252 3300017792 Bacteria 1215
466 Ga0163161_10362385 3300017792 Bacteria 1155
467 Ga0163161_10410958 3300017792 Bacteria 1087
468 Ga0163161_10831299 3300017792 Bacteria 778
469 Ga0206356_10310093 3300020070 Bacteria 1186
470 Ga0206354_10849355 3300020081 Bacteria 867
471 Ga0206353_11784540 3300020082 Bacteria 1729
472 Ga0214544_1000136 3300021320 Bacteria 107814
473 Ga0214542_1000127 3300021321 Bacteria 107829
474 Ga0214545_1000063 3300021324 Bacteria 107829
475 Ga0214543_1014866 3300021327 Bacteria 8916
476 Ga0213872_10061429 3300021361 Bacteria 1699
477 Ga0213872_10201526 3300021361 Bacteria 853
478 Ga0213874_10010634 3300021377 Bacteria 2309
479 Ga0213874_10020432 3300021377 Bacteria 1815
480 Ga0213876_10003500 3300021384 Bacteria 8967
481 Ga0213876_10069173 3300021384 Bacteria 1865
482 Ga0213876_10272938 3300021384 Bacteria 899
483 Ga0213876_10345555 3300021384 Bacteria 791
484 Ga0213875_10019412 3300021388 Bacteria 3270
485 Ga0213871_10012173 3300021441 Bacteria 1991
486 Ga0224712_10083188 3300022467 Bacteria 1326
487 Ga0209563_109501 3300025230 Bacteria 1465
488 Ga0209677_102922 3300025253 Bacteria 5978
489 Ga0209677_108643 3300025253 Bacteria 1940
490 Ga0209148_1000879 3300025254 Bacteria 20675
491 Ga0209148_1020491 3300025254 Bacteria 1086
492 Ga0209233_1000753 3300025261 Bacteria 14662
493 Ga0209233_1002427 3300025261 Bacteria 6882
494 Ga0209233_1014216 3300025261 Bacteria 2250
495 Ga0209233_1016287 3300025261 Bacteria 2050
496 Ga0209455_1001366 3300025272 Bacteria 11167
497 Ga0209455_1004258 3300025272 Bacteria 4756
498 Ga0209455_1018520 3300025272 Bacteria 1428
499 Ga0209673_1019322 3300025273 Bacteria 2450
500 Ga0209130_1046517 3300025284 Bacteria 810
501 Ga0209564_1000602 3300025295 Bacteria 56176
502 Ga0209564_1006952 3300025295 Bacteria 5943
503 Ga0209564_1026798 3300025295 Bacteria 1892
504 Ga0209758_1000011 3300025297 Bacteria 1049685
505 Ga0209758_1000455 3300025297 Bacteria 68279
506 Ga0209758_1007373 3300025297 Bacteria 7519
507 Ga0209758_1010431 3300025297 Bacteria 5561
508 Ga0209758_1011599 3300025297 Bacteria 5076
509 Ga0209758_1035461 3300025297 Bacteria 1966
510 Ga0209758_1045155 3300025297 Bacteria 1602
511 Ga0209256_1002822 3300025299 Bacteria 13270
512 Ga0209256_1035913 3300025299 Bacteria 1304
513 Ga0207426_1000505 3300025302 Bacteria 57583
514 Ga0207426_1000551 3300025302 Bacteria 51985
515 Ga0207426_1001912 3300025302 Bacteria 15063
516 Ga0207426_1112932 3300025302 Bacteria 682
517 Ga0209051_1094255 3300025303 Bacteria 823
518 Ga0209257_1003002 3300025304 Bacteria 15298
519 Ga0209257_1019280 3300025304 Bacteria 2577
520 Ga0209257_1069568 3300025304 Bacteria 932
521 Ga0207697_10090967 3300025315 Bacteria 1293
522 Ga0207697_10114127 3300025315 Bacteria 1158
523 Ga0207656_10072619 3300025321 Bacteria 1532
524 Ga0207692_10000726 3300025898 Bacteria 11627
525 Ga0207692_10028535 3300025898 Bacteria 2641
526 Ga0207692_10199355 3300025898 Bacteria 1176
527 Ga0207710_10030771 3300025900 Bacteria 2343
528 Ga0207710_10075752 3300025900 Bacteria 1551
529 Ga0207710_10175022 3300025900 Bacteria 1051
530 Ga0207688_10066881 3300025901 Bacteria 2033
531 Ga0207688_10237010 3300025901 Bacteria 1103
532 Ga0207688_10544015 3300025901 Bacteria 729
533 Ga0207680_10077450 3300025903 Bacteria 2080
534 Ga0207680_10140852 3300025903 Bacteria 1599
535 Ga0207647_10003320 3300025904 Bacteria 12087
536 Ga0207647_10015241 3300025904 Bacteria 5278
537 Ga0207647_10211861 3300025904 Bacteria 1119
538 Ga0207647_10285561 3300025904 Bacteria 941
539 Ga0207685_10013389 3300025905 Bacteria 2536
540 Ga0207685_10077657 3300025905 Bacteria 1365
541 Ga0207699_10008623 3300025906 Bacteria 5041
542 Ga0207699_10012451 3300025906 Bacteria 4328
543 Ga0207699_10052098 3300025906 Bacteria 2421
544 Ga0207699_10052507 3300025906 Bacteria 2413
545 Ga0207699_10052724 3300025906 Bacteria 2409
546 Ga0207699_10128526 3300025906 Bacteria 1649
547 Ga0207699_10238831 3300025906 Bacteria 1247
548 Ga0207699_10391886 3300025906 Bacteria 988
549 Ga0207699_10596127 3300025906 Bacteria 804
550 Ga0207645_10066938 3300025907 Bacteria 2296
551 Ga0207643_10155034 3300025908 Bacteria 1375
552 Ga0207643_10314459 3300025908 Bacteria 977
553 Ga0207705_10039590 3300025909 Bacteria 3379
554 Ga0207705_10302883 3300025909 Bacteria 1226
555 Ga0207684_10337259 3300025910 Bacteria 1298
556 Ga0207654_10000358 3300025911 Bacteria 26923
557 Ga0207654_10042854 3300025911 Bacteria 2563
558 Ga0207654_10059283 3300025911 Bacteria 2232
559 Ga0207654_10102165 3300025911 Bacteria 1768
560 Ga0207654_10110845 3300025911 Bacteria 1707
561 Ga0207654_10325079 3300025911 Bacteria 1052
562 Ga0207707_10000183 3300025912 Bacteria 65793
563 Ga0207707_10052912 3300025912 Bacteria 3534
564 Ga0207707_10071470 3300025912 Bacteria 3024
565 Ga0207707_10183103 3300025912 Bacteria 1828
566 Ga0207707_10592111 3300025912 Bacteria 939
567 Ga0207695_10000157 3300025913 Bacteria 204140
568 Ga0207695_10002150 3300025913 Bacteria 29851
569 Ga0207695_10321131 3300025913 Bacteria 1438
570 Ga0207695_10508089 3300025913 Bacteria 1087
571 Ga0207671_10009946 3300025914 Bacteria 7903
572 Ga0207671_10014366 3300025914 Bacteria 6263
573 Ga0207671_10179830 3300025914 Bacteria 1646
574 Ga0207671_10208073 3300025914 Bacteria 1530
575 Ga0207671_10370424 3300025914 Bacteria 1137
576 Ga0207671_10431940 3300025914 Bacteria 1048
577 Ga0207693_10000269 3300025915 Bacteria 47979
578 Ga0207693_10015868 3300025915 Bacteria 6032
579 Ga0207693_10032441 3300025915 Bacteria 4123
580 Ga0207693_10136401 3300025915 Bacteria 1929
581 Ga0207693_10387227 3300025915 Bacteria 1093
582 Ga0207663_10000096 3300025916 Bacteria 41229
583 Ga0207663_10002855 3300025916 Bacteria 8348
584 Ga0207663_10028303 3300025916 Bacteria 3279
585 Ga0207663_10037012 3300025916 Bacteria 2939
586 Ga0207663_10043990 3300025916 Bacteria 2738
587 Ga0207663_10062505 3300025916 Bacteria 2367
588 Ga0207663_10459399 3300025916 Bacteria 983
589 Ga0207660_10604613 3300025917 Bacteria 893
590 Ga0207662_10202162 3300025918 Bacteria 1286
591 Ga0207662_10490002 3300025918 Bacteria 845
592 Ga0207657_10006462 3300025919 Bacteria 12146
593 Ga0207657_10136834 3300025919 Bacteria 2004
594 Ga0207657_10458734 3300025919 Bacteria 1000
595 Ga0207657_10612208 3300025919 Bacteria 849
596 Ga0207649_10026710 3300025920 Bacteria 3380
597 Ga0207649_10090245 3300025920 Bacteria 2005
598 Ga0207649_10148623 3300025920 Bacteria 1611
599 Ga0207652_10153229 3300025921 Bacteria 2064
600 Ga0207652_10189329 3300025921 Bacteria 1851
601 Ga0207652_10228921 3300025921 Bacteria 1675
602 Ga0207652_10402680 3300025921 Bacteria 1235
603 Ga0207652_10912363 3300025921 Bacteria 776
604 Ga0207646_10034318 3300025922 Bacteria 4585
605 Ga0207646_10179696 3300025922 Bacteria 1911
606 Ga0207681_10060393 3300025923 Bacteria 2602
607 Ga0207681_10082915 3300025923 Bacteria 2268
608 Ga0207694_10000491 3300025924 Bacteria 35820
609 Ga0207694_10025055 3300025924 Bacteria 4533
610 Ga0207694_10109801 3300025924 Bacteria 2194
611 Ga0207694_10248776 3300025924 Bacteria 1454
612 Ga0207694_10422724 3300025924 Bacteria 1110
613 Ga0207694_10518528 3300025924 Bacteria 999
614 Ga0207694_10577760 3300025924 Bacteria 944
615 Ga0207650_10442919 3300025925 Bacteria 1080
616 Ga0207650_10518086 3300025925 Bacteria 998
617 Ga0207687_10060872 3300025927 Bacteria 2664
618 Ga0207687_10101422 3300025927 Bacteria 2119
619 Ga0207700_10004115 3300025928 Bacteria 8533
620 Ga0207700_10020194 3300025928 Bacteria 4518
621 Ga0207700_10026105 3300025928 Bacteria 4069
622 Ga0207700_10052150 3300025928 Bacteria 3057
623 Ga0207700_10053842 3300025928 Bacteria 3017
624 Ga0207700_10172234 3300025928 Bacteria 1806
625 Ga0207700_10189647 3300025928 Bacteria 1727
626 Ga0207700_10223738 3300025928 Bacteria 1597
627 Ga0207664_10027009 3300025929 Bacteria 4347
628 Ga0207664_10047125 3300025929 Bacteria 3385
629 Ga0207664_10051997 3300025929 Bacteria 3238
630 Ga0207664_10055299 3300025929 Bacteria 3149
631 Ga0207664_10137539 3300025929 Bacteria 2063
632 Ga0207664_10247549 3300025929 Bacteria 1554
633 Ga0207664_10569118 3300025929 Bacteria 1017
634 Ga0207644_10058382 3300025931 Bacteria 2789
635 Ga0207644_10081518 3300025931 Bacteria 2391
636 Ga0207690_10359279 3300025932 Bacteria 1153
637 Ga0207690_10719975 3300025932 Bacteria 821
638 Ga0207706_10029379 3300025933 Bacteria 4907
639 Ga0207706_10078177 3300025933 Bacteria 2910
640 Ga0207706_10154987 3300025933 Bacteria 2015
641 Ga0207706_10281857 3300025933 Bacteria 1449
642 Ga0207706_11145142 3300025933 Bacteria 648
643 Ga0207709_10030496 3300025935 Bacteria 3137
644 Ga0207709_10171538 3300025935 Bacteria 1523
645 Ga0207669_11020477 3300025937 Bacteria 696
646 Ga0207704_10266735 3300025938 Bacteria 1294
647 Ga0207704_10423169 3300025938 Bacteria 1056
648 Ga0207665_10000104 3300025939 Bacteria 55188
649 Ga0207665_10408302 3300025939 Bacteria 1035
650 Ga0207691_10013516 3300025940 Bacteria 7808
651 Ga0207691_10178168 3300025940 Bacteria 1858
652 Ga0207691_10290112 3300025940 Bacteria 1407
653 Ga0207691_10577453 3300025940 Bacteria 952
654 Ga0207711_10084823 3300025941 Bacteria 2774
655 Ga0207711_10584149 3300025941 Bacteria 1042
656 Ga0207689_10012148 3300025942 Bacteria 7371
657 Ga0207689_10098371 3300025942 Bacteria 2403
658 Ga0207661_10026657 3300025944 Bacteria 4406
659 Ga0207679_10252345 3300025945 Bacteria 1500
660 Ga0207679_10407203 3300025945 Bacteria 1198
661 Ga0207667_10026442 3300025949 Bacteria 6340
662 Ga0207667_10035571 3300025949 Bacteria 5342
663 Ga0207667_10045712 3300025949 Bacteria 4636
664 Ga0207667_10227765 3300025949 Bacteria 1909
665 Ga0207667_10332090 3300025949 Bacteria 1552
666 Ga0207667_10708850 3300025949 Bacteria 1008
667 Ga0207651_10140997 3300025960 Bacteria 1862
668 Ga0207712_10110047 3300025961 Bacteria 2065
669 Ga0207712_10592788 3300025961 Bacteria 958
670 Ga0207712_10707759 3300025961 Bacteria 879
671 Ga0207668_10037232 3300025972 Bacteria 3254
672 Ga0207668_10047986 3300025972 Bacteria 2927
673 Ga0207668_10110094 3300025972 Bacteria 2064
674 Ga0207668_10498579 3300025972 Bacteria 1047
675 Ga0207640_10010167 3300025981 Bacteria 5289
676 Ga0207640_10050789 3300025981 Bacteria 2693
677 Ga0207640_10094168 3300025981 Bacteria 2083
678 Ga0207640_10229379 3300025981 Bacteria 1427
679 Ga0207640_10381057 3300025981 Bacteria 1143
680 Ga0207640_10540992 3300025981 Bacteria 977
681 Ga0207658_10189965 3300025986 Bacteria 1706
682 Ga0207677_10046125 3300026023 Bacteria 2916
683 Ga0207677_10321373 3300026023 Bacteria 1286
684 Ga0207677_10456695 3300026023 Bacteria 1096
685 Ga0207677_10606578 3300026023 Bacteria 961
686 Ga0207703_10220030 3300026035 Bacteria 1697
687 Ga0207703_10448590 3300026035 Bacteria 1205
688 Ga0207703_10782073 3300026035 Bacteria 910
689 Ga0207703_10855369 3300026035 Bacteria 870
690 Ga0207703_10959786 3300026035 Bacteria 820
691 Ga0207639_10003195 3300026041 Bacteria 11016
692 Ga0207639_10041161 3300026041 Bacteria 3455
693 Ga0207639_10127953 3300026041 Bacteria 2098
694 Ga0207639_10424083 3300026041 Bacteria 1203
695 Ga0207639_11268578 3300026041 Bacteria 691
696 Ga0207678_10014065 3300026067 Bacteria 7037
697 Ga0207678_10030744 3300026067 Bacteria 4688
698 Ga0207678_10094920 3300026067 Bacteria 2549
699 Ga0207678_10128929 3300026067 Bacteria 2157
700 Ga0207678_10166968 3300026067 Bacteria 1879
701 Ga0207678_10198446 3300026067 Bacteria 1715
702 Ga0207678_10218996 3300026067 Bacteria 1629
703 Ga0207678_10313947 3300026067 Bacteria 1348
704 Ga0207708_10075619 3300026075 Bacteria 2583
705 Ga0207702_10000003 3300026078 Bacteria 434196
706 Ga0207702_10004131 3300026078 Bacteria 13017
707 Ga0207702_10032268 3300026078 Bacteria 4370
708 Ga0207702_10056601 3300026078 Bacteria 3330
709 Ga0207702_10508734 3300026078 Bacteria 1175
710 Ga0207702_10552873 3300026078 Bacteria 1126
711 Ga0207641_10225327 3300026088 Bacteria 1740
712 Ga0207641_10291486 3300026088 Bacteria 1538
713 Ga0207641_10468640 3300026088 Bacteria 1219
714 Ga0207648_10010726 3300026089 Bacteria 8662
715 Ga0207648_10787138 3300026089 Bacteria 885
716 Ga0207676_10027761 3300026095 Bacteria 4220
717 Ga0207676_10042080 3300026095 Bacteria 3512
718 Ga0207676_10104775 3300026095 Bacteria 2353
719 Ga0207676_10171088 3300026095 Bacteria 1893
720 Ga0207674_10085107 3300026116 Bacteria 3159
721 Ga0207674_10092698 3300026116 Bacteria 3010
722 Ga0207674_10097807 3300026116 Bacteria 2919
723 Ga0207674_10097861 3300026116 Bacteria 2918
724 Ga0207674_10342575 3300026116 Bacteria 1445
725 Ga0207674_10382920 3300026116 Bacteria 1360
726 Ga0207674_10830721 3300026116 Bacteria 891
727 Ga0207675_100021508 3300026118 Bacteria 6008
728 Ga0207675_100090463 3300026118 Bacteria 2877
729 Ga0207675_100175893 3300026118 Bacteria 2048
730 Ga0207675_100262645 3300026118 Bacteria 1674
731 Ga0207675_100377193 3300026118 Bacteria 1394
732 Ga0207675_100673288 3300026118 Bacteria 1042
733 Ga0207683_10018433 3300026121 Bacteria 5956
734 Ga0207683_10110225 3300026121 Bacteria 2464
735 Ga0207683_10152146 3300026121 Bacteria 2088
736 Ga0207683_10209651 3300026121 Bacteria 1773
737 Ga0207683_10335122 3300026121 Bacteria 1387
738 Ga0207683_10546620 3300026121 Bacteria 1071
739 Ga0207683_10696565 3300026121 Bacteria 942
740 Ga0207698_10027042 3300026142 Bacteria 4067
741 Ga0207698_10059039 3300026142 Bacteria 2976
742 Ga0207698_10114470 3300026142 Bacteria 2269
743 Ga0207698_10307542 3300026142 Bacteria 1478
744 Ga0207698_10607031 3300026142 Bacteria 1079
745 Ga0209389_1001313 3300027296 Bacteria 17360
746 Ga0209389_1001336 3300027296 Bacteria 17260
747 Ga0209589_1000002 3300027357 Bacteria 708598
748 Ga0209589_1004535 3300027357 Bacteria 23952
749 Ga0209489_100002 3300027361 Bacteria 708609
750 Ga0209489_100050 3300027361 Bacteria 154669
751 Ga0209489_104795 3300027361 Bacteria 24473
752 Ga0209700_100002 3300027363 Bacteria 708598
753 Ga0209700_100016 3300027363 Bacteria 252567
754 Ga0209588_1007888 3300027671 Bacteria 3148
755 Ga0209813_10043201 3300027866 Bacteria 1380
756 Ga0209813_10064452 3300027866 Bacteria 1177
757 Ga0209813_10089483 3300027866 Bacteria 1031
758 Ga0207428_10137746 3300027907 Bacteria 1866
759 Ga0268266_10049793 3300028379 Bacteria 3593
760 Ga0268266_10056532 3300028379 Bacteria 3375
761 Ga0268266_10168690 3300028379 Bacteria 1985
762 Ga0268266_10313394 3300028379 Bacteria 1466
763 Ga0268266_10381673 3300028379 Bacteria 1329
764 Ga0268266_10410116 3300028379 Bacteria 1282
765 Ga0268266_10468838 3300028379 Bacteria 1199
766 Ga0268266_10581825 3300028379 Bacteria 1074
767 Ga0268266_10782305 3300028379 Bacteria 921
768 Ga0268266_11145637 3300028379 Bacteria 752
769 Ga0268265_10442205 3300028380 Bacteria 1212
770 Ga0268265_10711658 3300028380 Bacteria 971
771 Ga0268264_10000038 3300028381 Bacteria 383623
772 Ga0268264_10105950 3300028381 Bacteria 2453
773 Ga0268264_10270123 3300028381 Bacteria 1588
774 Ga0268264_10849473 3300028381 Bacteria 914
775 Ga0268264_10872998 3300028381 Bacteria 902
776 Ga0268264_11301006 3300028381 Bacteria 737
777 Ga0265337_1004994 3300028556 Bacteria 5386
778 Ga0265326_10011046 3300028558 Bacteria 2671
779 Ga0265319_1004750 3300028563 Bacteria 6655
780 Ga0265334_10025808 3300028573 Bacteria 2376
781 Ga0265318_10020324 3300028577 Bacteria 2681
782 Ga0265323_10000744 3300028653 Bacteria 17485
783 Ga0265322_10009604 3300028654 Bacteria 2806
784 Ga0265336_10000228 3300028666 Bacteria 39886
785 Ga0307517_10007898 3300028786 Bacteria 15387
786 Ga0307517_10179540 3300028786 Bacteria 1370
787 Ga0265338_10000116 3300028800 Bacteria 146839
788 Ga0265324_10004530 3300029957 Bacteria 6237
789 Ga0265328_10000055 3300031239 Bacteria 72155
790 Ga0265328_10038546 3300031239 Bacteria 1764
791 Ga0265325_10033422 3300031241 Bacteria 2742
792 Ga0265339_10072795 3300031249 Bacteria 1828
793 Ga0265331_10075671 3300031250 Bacteria 1569
794 Ga0307513_10235391 3300031456 Bacteria 1641
795 Ga0307513_10611121 3300031456 Bacteria 799
796 Ga0307509_10207820 3300031507 Bacteria 1786
797 Ga0307509_10271152 3300031507 Bacteria 1464
798 Ga0307509_10601610 3300031507 Bacteria 772
799 Ga0307408_100269517 3300031548 Bacteria 1413
800 Ga0307408_100870530 3300031548 Bacteria 823
801 Ga0265313_10171333 3300031595 Bacteria 917
802 Ga0307508_10000008 3300031616 Bacteria 265023
803 Ga0307508_10023981 3300031616 Bacteria 5536
804 Ga0307508_10081178 3300031616 Bacteria 2824
805 Ga0307508_10338481 3300031616 Bacteria 1096
806 Ga0307508_10453554 3300031616 Bacteria 875
807 Ga0265314_10030942 3300031711 Bacteria 3957
808 Ga0265342_10023099 3300031712 Bacteria 3942
809 Ga0307516_10005698 3300031730 Bacteria 14765
810 Ga0307516_10012479 3300031730 Bacteria 9154
811 Ga0307516_10451226 3300031730 Bacteria 942
812 Ga0307413_10219223 3300031824 Bacteria 1388
813 Ga0307410_10504798 3300031852 Bacteria 996
814 Ga0307406_10383675 3300031901 Bacteria 1108
815 Ga0307407_10097577 3300031903 Bacteria 1817
816 Ga0307412_10299716 3300031911 Bacteria 1270
817 Ga0307412_10434443 3300031911 Bacteria 1077
818 Ga0307412_10542924 3300031911 Bacteria 975
819 Ga0307416_100368616 3300032002 Bacteria 1461
820 Ga0307416_100704182 3300032002 Bacteria 1099
821 Ga0307416_101122751 3300032002 Bacteria 891
822 Ga0307414_10943860 3300032004 Bacteria 792
823 Ga0307415_100019725 3300032126 Bacteria 4099
824 Ga0307415_100314809 3300032126 Bacteria 1302
825 Ga0307507_10327767 3300033179 Bacteria 917
826 Ga0307510_10016828 3300033180 Bacteria 8627
827 Ga0307510_10052759 3300033180 Bacteria 4281
828 Ga0307510_10098071 3300033180 Bacteria 2736
829 Ga0307510_10240950 3300033180 Bacteria 1303
830 Ga0315911_1000004 3300033442 Bacteria 472637
831 Ga0373926_0144211 3300035083 Bacteria 905
832 Ga0373928_0026296 3300035084 Bacteria 1260
833 Ga0373934_0003099 3300035086 Bacteria 6068
834 Ga0373934_0022147 3300035086 Bacteria 2450
835 Ga0373934_0087419 3300035086 Bacteria 1255
836 Ga0373944_0083577 3300035089 Bacteria 1058
837 Ga0373923_0009432 3300035111 Bacteria 3521
838 Ga0373923_0022975 3300035111 Bacteria 2449
839 Ga0373936_0007656 3300035113 Bacteria 4057
840 Ga0373936_0087446 3300035113 Bacteria 1303
841 Ga0373945_0013918 3300035116 Bacteria 2691
842 Ga0373945_0020708 3300035116 Bacteria 2254
843 Ga0373953_0000196 3300035117 Bacteria 16203
844 Ga0373953_0085182 3300035117 Bacteria 1318
845 Ga0373953_0106647 3300035117 Bacteria 1182
846 Ga0373954_0001139 3300035118 Bacteria 10675
847 Ga0373954_0007143 3300035118 Bacteria 4876
848 Ga0373954_0030823 3300035118 Bacteria 2474
849 Ga0373956_0003545 3300035119 Bacteria 6290
850 Ga0373956_0019483 3300035119 Bacteria 2877
851 Ga0373956_0027490 3300035119 Bacteria 2470
852 Ga0373956_0315694 3300035119 Bacteria 745
853 Ga0373957_0088067 3300035120 Bacteria 1231
854 Ga0373943_0006083 3300035170 Bacteria 5423
855 Ga0373943_0079033 3300035170 Bacteria 1683
856 Ga0373943_0158005 3300035170 Bacteria 1232
857 Ga0373946_0027971 3300035171 Bacteria 2233
858 Ga0373946_0041939 3300035171 Bacteria 1879
859 Ga0373955_0000407 3300035172 Bacteria 18265
860 Ga0373955_0135089 3300035172 Bacteria 1442
861 Ga0373962_0052280 3300035242 Bacteria 1180
862 Ga0373924_0000379 3300035410 Bacteria 13632
863 Ga0373924_0019302 3300035410 Bacteria 2640
864 Ga0373931_0011456 3300035691 Bacteria 4285
865 Ga0373935_0000493 3300035692 Bacteria 20439
866 Ga0373935_0116943 3300035692 Bacteria 1776
867 Ga0373935_0126052 3300035692 Bacteria 1716
868 Ga0373935_0364244 3300035692 Bacteria 1033
869 Ga0373935_0701076 3300035692 Bacteria 744
870 Ga0373927_0000331 3300035695 Bacteria 37139
871 Ga0373927_0017298 3300035695 Bacteria 4746
872 Ga0373927_0099987 3300035695 Bacteria 1886
873 Ga0373927_0212010 3300035695 Bacteria 1272
874 Ga0373933_0000272 3300035724 Bacteria 33654
875 Ga0373933_0001601 3300035724 Bacteria 13262
876 Ga0373933_0056075 3300035724 Bacteria 2364
877 Ga0373933_0062081 3300035724 Bacteria 2256
878 Ga0373947_0002830 3300035725 Bacteria 10355
879 Ga0373947_0036532 3300035725 Bacteria 2913
880 Ga0373947_0072974 3300035725 Bacteria 2108
881 Ga0373947_0124719 3300035725 Bacteria 1639
882 Ga0373937_0075562 3300036401 Bacteria 3110
883 Ga0373937_0114039 3300036401 Bacteria 2515
884 Ga0373937_0242409 3300036401 Bacteria 1698
885 Ga0373925_0005476 3300037068 Bacteria 9451
886 Ga0373925_0115175 3300037068 Bacteria 2081
887 Ga0373925_0434489 3300037068 Bacteria 1074
888 Ga0373925_0447373 3300037068 Bacteria 1058
889 Ga0395899_0426396 3300037312 Bacteria 873
890 Ga0395900_0001409 3300037418 Bacteria 28756
891 Ga0395900_0080025 3300037418 Bacteria 3358
892 Ga0395900_0646174 3300037418 Bacteria 995
893 Ga0395898_0016001 3300037466 Bacteria 7683
894 Ga0395898_0022213 3300037466 Bacteria 6430
895 Ga0395898_0169178 3300037466 Bacteria 2089
896 Ga0395898_0450917 3300037466 Bacteria 1225
897 Ga0395898_0847546 3300037466 Bacteria 853
898 Ga0395905_0015288 3300037471 Bacteria 7298
899 Ga0395905_0022704 3300037471 Bacteria 5932
900 Ga0395905_0209687 3300037471 Bacteria 1825
901 Ga0436364_0714264 3300037853 Bacteria 1020
902 Ga0436364_1290753 3300037853 Bacteria 1799
903 Ga0436364_1508788 3300037853 Bacteria 3253
904 Ga0395901_0118315 3300038443 Bacteria 2784
905 Ga0395901_0185780 3300038443 Bacteria 2180
906 Ga0395901_0318823 3300038443 Bacteria 1609
907 Ga0395901_0632203 3300038443 Bacteria 1076
908 Ga0436365_0399697 3300039437 Bacteria 12936
909 Ga0436365_0399885 3300039437 Bacteria 5357
910 Ga0436365_0718616 3300039437 Bacteria 3684
911 Ga0436365_1142792 3300039437 Bacteria 1450
912 Ga0436365_1622924 3300039437 Bacteria 3437
913 Ga0436360_0221727 3300039438 Bacteria 2099
914 Ga0436360_1241329 3300039438 Bacteria 1369
915 Ga0436361_0214631 3300039447 Bacteria 935
916 Ga0436361_0596678 3300039447 Bacteria 2424
917 Ga0436361_0805829 3300039447 Bacteria 1794
918 Ga0436361_1066979 3300039447 Bacteria 1761
919 Ga0436361_1196720 3300039447 Bacteria 2051
920 Ga0436363_0057188 3300039450 Bacteria 1029
921 Ga0436363_0624071 3300039450 Bacteria 2252
922 Ga0436363_0658047 3300039450 Bacteria 8838
923 Ga0436363_1036919 3300039450 Bacteria 1158
924 Ga0436362_0661692 3300039453 Bacteria 4324
925 Ga0439465_0013288 3300041413 Bacteria 2570
926 Ga0439465_0069947 3300041413 Bacteria 1175
927 Ga0451787_242297 3300041441 Bacteria 956
928 Ga0451789_0688189 3300041443 Bacteria 748
929 Ga0451797_1213215 3300041453 Bacteria 713
930 Ga0451795_1269232 3300041456 Bacteria 680
931 Ga0451800_1245814 3300041459 Bacteria 1027
932 Ga0451807_1676953 3300041486 Bacteria 900
933 Ga0451833_1413762 3300041491 Bacteria 867
934 Ga0451835_0009829 3300041492 Bacteria 847
935 Ga0451841_0980059 3300041498 Bacteria 1173
936 Ga0451851_0421058 3300041507 Bacteria 816
937 Ga0451855_1803437 3300041511 Bacteria 842
938 Ga0439455_0076042 3300042012 Bacteria 908
939 Ga0439464_0160469 3300042439 Bacteria 706
940 Ga0466969_0289749 3300044656 Bacteria 741
941 Ga0466972_0002296 3300044658 Bacteria 9399
942 Ga0466972_0002508 3300044658 Bacteria 9076
943 Ga0466965_0040508 3300044683 Bacteria 2293
944 Ga0466965_0188537 3300044683 Bacteria 1090
945 Ga0466966_0001161 3300044684 Bacteria 16930
946 Ga0466961_0000122 3300044693 Bacteria 52002
947 Ga0466961_0109605 3300044693 Bacteria 1738
948 Ga0466961_0117507 3300044693 Bacteria 1671
949 Ga0466961_0132983 3300044693 Bacteria 1559
950 Ga0466963_0077502 3300044694 Bacteria 2246
951 Ga0466963_0141905 3300044694 Bacteria 1664
952 Ga0466963_0283387 3300044694 Bacteria 1165
953 Ga0466964_0100364 3300044706 Bacteria 1275
954 Ga0466971_0328087 3300044719 Bacteria 738
955 Ga0466968_0075537 3300044735 Bacteria 1473
956 Ga0466968_0256153 3300044735 Bacteria 832
957 Ga0466970_0118069 3300044765 Bacteria 1452
958 Ga0466970_0254556 3300044765 Bacteria 984
959 Ga0466957_0033326 3300044842 Bacteria 3090
960 Ga0466957_0159521 3300044842 Bacteria 1464
961 Ga0466957_0694343 3300044842 Bacteria 718
962 Ga0466960_0164191 3300044901 Bacteria 1194
963 Ga0466959_0031376 3300045049 Bacteria 3933
964 Ga0466959_0420980 3300045049 Bacteria 907
965 Ga0466967_0007117 3300045976 Bacteria 8028
966 Ga0466967_0051636 3300045976 Bacteria 3604
967 Ga0466967_0106705 3300045976 Bacteria 2568
968 Ga0466967_0333879 3300045976 Bacteria 1464
969 Ga0466967_0991496 3300045976 Bacteria 836
970 Ga0495617_071502 3300046452 Bacteria 1141
971 Ga0495617_096590 3300046452 Bacteria 962
972 Ga0495627_079840 3300046453 Bacteria 949
973 Ga0495592_0006060 3300046454 Bacteria 8992
974 Ga0495592_0060220 3300046454 Bacteria 2793
975 Ga0495592_0100066 3300046454 Bacteria 2067
976 Ga0495592_0266270 3300046454 Bacteria 1126
977 Ga0495603_0000643 3300046455 Bacteria 19657
978 Ga0495603_0007318 3300046455 Bacteria 6637
979 Ga0495603_0026372 3300046455 Bacteria 3511
980 Ga0495603_0083545 3300046455 Bacteria 1870
981 Ga0495603_0244015 3300046455 Bacteria 1034
982 Ga0495603_0300588 3300046455 Bacteria 922
983 Ga0495629_0000423 3300046459 Bacteria 35258
984 Ga0495629_0023037 3300046459 Bacteria 4438
985 Ga0495629_0065217 3300046459 Bacteria 2542
986 Ga0495629_0170379 3300046459 Bacteria 1511
987 Ga0495638_0013901 3300046460 Bacteria 5460
988 Ga0495638_0062748 3300046460 Bacteria 2293
989 Ga0495638_0375025 3300046460 Bacteria 745
990 Ga0495641_0003178 3300046461 Bacteria 12492
991 Ga0495641_0047305 3300046461 Bacteria 1975
992 Ga0495641_0171543 3300046461 Bacteria 971
993 Ga0495651_0018521 3300046462 Bacteria 5394
994 Ga0495651_0063923 3300046462 Bacteria 2812
995 Ga0495651_0097792 3300046462 Bacteria 2191
996 Ga0495651_0102783 3300046462 Bacteria 2124
997 Ga0495653_0018392 3300046463 Bacteria 5675
998 Ga0495580_0001799 3300046472 Bacteria 18843
999 Ga0495580_0002433 3300046472 Bacteria 16271
1000 Ga0495580_0152666 3300046472 Bacteria 1600
1001 Ga0495582_0000166 3300046473 Bacteria 35616
1002 Ga0495582_0037791 3300046473 Bacteria 2656
1003 Ga0495582_0142450 3300046473 Bacteria 1359
1004 Ga0495582_0255736 3300046473 Bacteria 1005
1005 Ga0495582_0577989 3300046473 Bacteria 650
1006 Ga0495605_0067389 3300046474 Bacteria 1698
1007 Ga0495605_0173215 3300046474 Bacteria 952
1008 Ga0495639_0000306 3300046475 Bacteria 23854
1009 Ga0495639_0015399 3300046475 Bacteria 3317
1010 Ga0495639_0020088 3300046475 Bacteria 2918
1011 Ga0495639_0124853 3300046475 Bacteria 1229
1012 Ga0495639_0202963 3300046475 Bacteria 971
1013 Ga0495662_0001733 3300046476 Bacteria 10893
1014 Ga0495664_0008302 3300046477 Bacteria 5792
1015 Ga0495664_0011786 3300046477 Bacteria 4936
1016 Ga0495664_0028238 3300046477 Bacteria 3277
1017 Ga0495664_0566331 3300046477 Bacteria 676
1018 Ga0495584_0071051 3300046491 Bacteria 1749
1019 Ga0495585_0011742 3300046492 Bacteria 5177
1020 Ga0495594_0114992 3300046499 Bacteria 1518
1021 Ga0495594_0178357 3300046499 Bacteria 1209
1022 Ga0495594_0189179 3300046499 Bacteria 1172
1023 Ga0495607_0371548 3300046501 Bacteria 656
1024 Ga0495583_0066842 3300046506 Bacteria 1589
1025 Ga0495606_0001165 3300046507 Bacteria 37175
1026 Ga0495606_0057024 3300046507 Bacteria 2517
1027 Ga0495606_0160737 3300046507 Bacteria 1311
1028 Ga0495606_0370993 3300046507 Bacteria 753
1029 Ga0495608_0014159 3300046511 Bacteria 5533
1030 Ga0495608_0127357 3300046511 Bacteria 1631
1031 Ga0495610_0101016 3300046512 Bacteria 1292
1032 Ga0495618_0027782 3300046514 Bacteria 3523
1033 Ga0495618_0141073 3300046514 Bacteria 1541
1034 Ga0495618_0180921 3300046514 Bacteria 1340
1035 Ga0495620_0074997 3300046515 Bacteria 1377
1036 Ga0495628_0011146 3300046516 Bacteria 7611
1037 Ga0495628_0033876 3300046516 Bacteria 4112
1038 Ga0495628_0245871 3300046516 Bacteria 1337
1039 Ga0495628_0424438 3300046516 Bacteria 969
1040 Ga0495630_0019236 3300046517 Bacteria 5019
1041 Ga0495630_0025234 3300046517 Bacteria 4394
1042 Ga0495630_0041197 3300046517 Bacteria 3449
1043 Ga0495630_0172807 3300046517 Bacteria 1647
1044 Ga0495631_0192977 3300046518 Bacteria 872
1045 Ga0495632_0045002 3300046519 Bacteria 2200
1046 Ga0495637_0183975 3300046520 Bacteria 774
1047 Ga0495637_0200816 3300046520 Bacteria 733
1048 Ga0495643_0006526 3300046522 Bacteria 7675
1049 Ga0495643_0077701 3300046522 Bacteria 1734
1050 Ga0495643_0166971 3300046522 Bacteria 1079
1051 Ga0495644_0030518 3300046523 Bacteria 2035
1052 Ga0495648_0001607 3300046524 Bacteria 21994
1053 Ga0495648_0120840 3300046524 Bacteria 1408
1054 Ga0495663_0006353 3300046525 Bacteria 3265
1055 Ga0495666_0221560 3300046526 Bacteria 866
1056 Ga0495642_0136749 3300046528 Bacteria 1057
1057 Ga0495642_0153253 3300046528 Bacteria 997
1058 Ga0495652_0017206 3300046529 Bacteria 6454
1059 Ga0495652_0029642 3300046529 Bacteria 4806
1060 Ga0495652_0080914 3300046529 Bacteria 2681
1061 Ga0495652_0184890 3300046529 Bacteria 1596
1062 Ga0495652_0336032 3300046529 Bacteria 1087
1063 Ga0495652_0498270 3300046529 Bacteria 845
1064 Ga0495665_0000104 3300046531 Bacteria 39624
1065 Ga0495665_0008245 3300046531 Bacteria 5648
1066 Ga0495640_0003774 3300046533 Bacteria 12154
1067 Ga0495640_0004857 3300046533 Bacteria 10694
1068 Ga0495640_0046380 3300046533 Bacteria 3011
1069 Ga0495640_0048913 3300046533 Bacteria 2918
1070 Ga0495640_0206452 3300046533 Bacteria 1243
1071 Ga0495586_0145771 3300046535 Bacteria 1330
1072 Ga0495586_0182301 3300046535 Bacteria 1188
1073 Ga0495586_0452994 3300046535 Bacteria 740
1074 Ga0495587_0005400 3300046536 Bacteria 8347
1075 Ga0495587_0021455 3300046536 Bacteria 3983
1076 Ga0495587_0071501 3300046536 Bacteria 2018
1077 Ga0495598_0054622 3300046537 Bacteria 1213
1078 Ga0495609_0076111 3300046538 Bacteria 1471
1079 Ga0495621_0056842 3300046539 Bacteria 1411
1080 Ga0495597_0072882 3300046542 Bacteria 1477
1081 Ga0495645_0012922 3300046543 Bacteria 5895
1082 Ga0495645_0013919 3300046543 Bacteria 5702
1083 Ga0495645_0050490 3300046543 Bacteria 3029
1084 Ga0495645_0097937 3300046543 Bacteria 2088
1085 Ga0495645_0196720 3300046543 Bacteria 1370
1086 Ga0495645_0462691 3300046543 Bacteria 798
1087 Ga0495622_0008182 3300046557 Bacteria 4845
1088 Ga0495622_0011773 3300046557 Bacteria 4044
1089 Ga0495622_0202431 3300046557 Bacteria 884
1090 Ga0495633_0055762 3300046558 Bacteria 1857
1091 Ga0495633_0065233 3300046558 Bacteria 1702
1092 Ga0495667_0006655 3300046559 Bacteria 7843
1093 Ga0495667_0012970 3300046559 Bacteria 5650
1094 Ga0495667_0019422 3300046559 Bacteria 4586
1095 Ga0495667_0263017 3300046559 Bacteria 1097
1096 Ga0495656_0018530 3300046615 Bacteria 2674
1097 Ga0495656_0044808 3300046615 Bacteria 1864
1098 Ga0495656_0046176 3300046615 Bacteria 1842
1099 Ga0495668_0032483 3300046616 Bacteria 2937
1100 Ga0495668_0266383 3300046616 Bacteria 938
1101 Ga0495668_0475102 3300046616 Bacteria 688
1102 Ga0495634_0001166 3300046642 Bacteria 24340
1103 Ga0495634_0003095 3300046642 Bacteria 13527
1104 Ga0495634_0020585 3300046642 Bacteria 4676
1105 Ga0495634_0027792 3300046642 Bacteria 3933
1106 Ga0495634_0160568 3300046642 Bacteria 1417
1107 Ga0495634_0207835 3300046642 Bacteria 1213
1108 Ga0495611_0018145 3300046648 Bacteria 3015
1109 Ga0495611_0082437 3300046648 Bacteria 1480
1110 Ga0495611_0117002 3300046648 Bacteria 1242
1111 Ga0495611_0137730 3300046648 Bacteria 1140
1112 Ga0495611_0173584 3300046648 Bacteria 1007
1113 Ga0495625_0464380 3300046660 Bacteria 780
1114 Ga0495635_0005385 3300046663 Bacteria 8902
1115 Ga0495635_0020868 3300046663 Bacteria 4564
1116 Ga0495661_0216994 3300046665 Bacteria 993
1117 Ga0495588_0006415 3300046674 Bacteria 5295
1118 Ga0495588_0023772 3300046674 Bacteria 3037
1119 Ga0495588_0071367 3300046674 Bacteria 1806
1120 Ga0495588_0278065 3300046674 Bacteria 882
1121 Ga0495657_0006260 3300046675 Bacteria 9325
1122 Ga0495657_0009904 3300046675 Bacteria 7190
1123 Ga0495657_0073411 3300046675 Bacteria 2228
1124 Ga0495599_0002627 3300046678 Bacteria 10471
1125 Ga0495599_0023553 3300046678 Bacteria 3850
1126 Ga0495599_0057760 3300046678 Bacteria 2428
1127 Ga0495623_0008151 3300046679 Bacteria 6812
1128 Ga0495623_0081378 3300046679 Bacteria 2002
1129 Ga0495623_0109486 3300046679 Bacteria 1675
1130 Ga0495623_0245280 3300046679 Bacteria 1010
1131 Ga0495646_0007324 3300046680 Bacteria 7012
1132 Ga0495646_0009165 3300046680 Bacteria 6281
1133 Ga0495646_0012636 3300046680 Bacteria 5364
1134 Ga0495646_0112490 3300046680 Bacteria 1549
1135 Ga0495646_0201686 3300046680 Bacteria 1083
1136 Ga0495646_0210213 3300046680 Bacteria 1056
1137 Ga0495646_0320992 3300046680 Bacteria 816
1138 Ga0495647_0000279 3300046681 Bacteria 14215
1139 Ga0495647_0169176 3300046681 Bacteria 945
1140 Ga0495658_0001753 3300046683 Bacteria 11214
1141 Ga0495658_0027075 3300046683 Bacteria 3080
1142 Ga0495658_0237902 3300046683 Bacteria 1143
1143 Ga0495658_0373899 3300046683 Bacteria 907
1144 Ga0495669_0028505 3300046684 Bacteria 2446
1145 Ga0495669_0050303 3300046684 Bacteria 1868
1146 Ga0495669_0155461 3300046684 Bacteria 1084
1147 Ga0495669_0347624 3300046684 Bacteria 717
1148 Ga0495613_0010689 3300046689 Bacteria 6808
1149 Ga0495613_0024352 3300046689 Bacteria 4510
1150 Ga0495613_0059911 3300046689 Bacteria 2789
1151 Ga0495613_0068687 3300046689 Bacteria 2584
1152 Ga0495624_0003536 3300046690 Bacteria 11576
1153 Ga0495624_0128140 3300046690 Bacteria 1557
1154 Ga0495670_0104656 3300046691 Bacteria 1460
1155 Ga0495671_0364914 3300046692 Bacteria 692
1156 Ga0495649_0058471 3300046694 Bacteria 2077
1157 Ga0495649_0245039 3300046694 Bacteria 922
1158 Ga0495589_0081267 3300046794 Bacteria 1577
1159 Ga0495589_0172047 3300046794 Bacteria 1029
1160 Ga0495589_0188277 3300046794 Bacteria 977
1161 Ga0495589_0267994 3300046794 Bacteria 795
1162 Ga0495600_0007519 3300046809 Bacteria 6669
1163 Ga0495600_0011987 3300046809 Bacteria 5413
1164 Ga0495600_0030566 3300046809 Bacteria 3488
1165 Ga0495600_0104558 3300046809 Bacteria 1845
1166 Ga0495600_0337440 3300046809 Bacteria 945
1167 Ga0495600_0502733 3300046809 Bacteria 745
1168 Ga0495581_0001274 3300047315 Bacteria 13870
1169 Ga0495581_0069513 3300047315 Bacteria 2036
1170 Ga0495581_0136915 3300047315 Bacteria 1428
1171 Ga0495581_0355063 3300047315 Bacteria 856
1172 Ga0495604_0015618 3300047317 Bacteria 6062
1173 Ga0495604_0023252 3300047317 Bacteria 4944
1174 Ga0495604_0047709 3300047317 Bacteria 3335
1175 Ga0495604_0093657 3300047317 Bacteria 2222
1176 Ga0495604_0100091 3300047317 Bacteria 2132
1177 Ga0495604_0163680 3300047317 Bacteria 1570
1178 Ga0495604_0333366 3300047317 Bacteria 1011
1179 Ga0495674_0001108 3300047319 Bacteria 25886
1180 Ga0495674_0007311 3300047319 Bacteria 10559
1181 Ga0495674_0013620 3300047319 Bacteria 7639
1182 Ga0495674_0018772 3300047319 Bacteria 6434
1183 Ga0495674_0492951 3300047319 Bacteria 981
1184 Ga0495672_0033034 3300047320 Bacteria 3210
1185 Ga0495672_0058738 3300047320 Bacteria 2228
1186 Ga0495672_0081722 3300047320 Bacteria 1798
1187 Ga0495676_0120116 3300047321 Bacteria 1913
1188 Ga0495676_0213893 3300047321 Bacteria 1332
1189 Ga0495676_0222644 3300047321 Bacteria 1299
1190 Ga0495676_0237537 3300047321 Bacteria 1249
1191 Ga0495676_0414273 3300047321 Bacteria 892
1192 Ga0495680_0023259 3300047322 Bacteria 5154
1193 Ga0495680_0049923 3300047322 Bacteria 3274
1194 Ga0495680_0059483 3300047322 Bacteria 2950
1195 Ga0495683_0087307 3300047323 Bacteria 1515
1196 Ga0495683_0268783 3300047323 Bacteria 742
1197 Ga0495687_006361 3300047443 Bacteria 7260
1198 Ga0495675_0009301 3300047444 Bacteria 6114
1199 Ga0495675_0031499 3300047444 Bacteria 3385
1200 Ga0495675_0239919 3300047444 Bacteria 1091
1201 Ga0495677_0073571 3300047445 Bacteria 1275
1202 Ga0495677_0177069 3300047445 Bacteria 826
1203 Ga0495685_084712 3300047447 Bacteria 1054
1204 Ga0495685_136405 3300047447 Bacteria 801
1205 Ga0495673_0091133 3300047469 Bacteria 1245
1206 Ga0495681_0041391 3300047470 Bacteria 2237
1207 Ga0495684_0004305 3300047471 Bacteria 11116
1208 Ga0495684_0004969 3300047471 Bacteria 10382
1209 Ga0495684_0007463 3300047471 Bacteria 8467
1210 Ga0495684_0068506 3300047471 Bacteria 2698
1211 Ga0495684_0174848 3300047471 Bacteria 1594
1212 Ga0495686_0056468 3300047472 Bacteria 2453
1213 Ga0495686_0059621 3300047472 Bacteria 2375
1214 Ga0495593_0005960 3300047673 Bacteria 7176
1215 Ga0495593_0030461 3300047673 Bacteria 2952
1216 Ga0495593_0225388 3300047673 Bacteria 940
1217 Ga0495602_0020065 3300048088 Bacteria 6612
1218 Ga0495602_0024322 3300048088 Bacteria 5878
1219 Ga0495602_0071388 3300048088 Bacteria 2965
1220 Ga0495602_0178469 3300048088 Bacteria 1641
1221 Ga0495602_0348805 3300048088 Bacteria 1069
1222 Ga0495615_0099012 3300048090 Bacteria 821
1223 Ga0495626_0078552 3300048091 Bacteria 1470
1224 Ga0496100_0026737 3300048903 Bacteria 3541
1225 Ga0496100_0068392 3300048903 Bacteria 2362
1226 Ga0496100_0154041 3300048903 Bacteria 1642
1227 Ga0496100_0169796 3300048903 Bacteria 1570
1228 Ga0496100_0236845 3300048903 Bacteria 1345
1229 Ga0496100_0250592 3300048903 Bacteria 1310
1230 Ga0496101_0014243 3300048904 Bacteria 5343
1231 Ga0496101_0026481 3300048904 Bacteria 4032
1232 Ga0496101_0218397 3300048904 Bacteria 1479
1233 Ga0496101_0463384 3300048904 Bacteria 1000
1234 Ga0496101_0532423 3300048904 Bacteria 929
1235 Ga0496101_0548522 3300048904 Bacteria 914
1236 Ga0496102_0171207 3300048905 Bacteria 2044
1237 Ga0496102_0302013 3300048905 Bacteria 1509
1238 Ga0496102_0303152 3300048905 Bacteria 1506
1239 Ga0496102_0336242 3300048905 Bacteria 1422
1240 Ga0496102_0374382 3300048905 Bacteria 1340
1241 Ga0496102_0393982 3300048905 Bacteria 1302
1242 Ga0496102_0510705 3300048905 Bacteria 1124
1243 Ga0496102_0581536 3300048905 Bacteria 1043
1244 Ga0496102_0658222 3300048905 Bacteria 970
1245 Ga0496102_0676882 3300048905 Bacteria 955
1246 Ga0496102_0712275 3300048905 Bacteria 927
1247 Ga0496102_0731202 3300048905 Bacteria 912
1248 Ga0496102_0739674 3300048905 Bacteria 906
1249 Ga0496102_0866495 3300048905 Bacteria 825
1250 Ga0496103_0007813 3300048906 Bacteria 6356
1251 Ga0496103_0109410 3300048906 Bacteria 1754
1252 Ga0496103_0168973 3300048906 Bacteria 1404
1253 Ga0496103_0418269 3300048906 Bacteria 860
1254 Ga0496103_0457087 3300048906 Bacteria 819
1255 Ga0496104_0000069 3300048907 Bacteria 107511
1256 Ga0496104_0000126 3300048907 Bacteria 70488
1257 Ga0496104_0020423 3300048907 Bacteria 6071
1258 Ga0496104_0024223 3300048907 Bacteria 5582
1259 Ga0496104_0024665 3300048907 Bacteria 5533
1260 Ga0496104_0069473 3300048907 Bacteria 3348
1261 Ga0496104_0244626 3300048907 Bacteria 1706
1262 Ga0496104_0270371 3300048907 Bacteria 1612
1263 Ga0496104_0352006 3300048907 Bacteria 1385
1264 Ga0496104_1017755 3300048907 Bacteria 732
1265 Ga0496105_0002028 3300048908 Bacteria 14636
1266 Ga0496105_0013439 3300048908 Bacteria 6499
1267 Ga0496105_0014292 3300048908 Bacteria 6318
1268 Ga0496105_0036501 3300048908 Bacteria 4049
1269 Ga0496105_0126206 3300048908 Bacteria 2109
1270 Ga0496105_0161008 3300048908 Bacteria 1842
1271 Ga0496105_0238303 3300048908 Bacteria 1477
1272 Ga0496105_0256403 3300048908 Bacteria 1416
1273 Ga0496106_0004544 3300048909 Bacteria 10282
1274 Ga0496106_0005271 3300048909 Bacteria 9578
1275 Ga0496106_0017568 3300048909 Bacteria 5292
1276 Ga0496106_0035159 3300048909 Bacteria 3746
1277 Ga0496106_0060391 3300048909 Bacteria 2874
1278 Ga0496106_0078728 3300048909 Bacteria 2530
1279 Ga0496106_0099436 3300048909 Bacteria 2255
1280 Ga0496107_0004055 3300048910 Bacteria 9861
1281 Ga0496107_0011451 3300048910 Bacteria 6179
1282 Ga0496107_0014869 3300048910 Bacteria 5450
1283 Ga0496107_0065498 3300048910 Bacteria 2634
1284 Ga0496107_0331444 3300048910 Bacteria 1132
1285 Ga0496108_0000884 3300048911 Bacteria 23347
1286 Ga0496108_0008268 3300048911 Bacteria 8439
1287 Ga0496108_0013923 3300048911 Bacteria 6560
1288 Ga0496108_0076007 3300048911 Bacteria 2838
1289 Ga0496108_0154316 3300048911 Bacteria 1982
1290 Ga0496108_0273262 3300048911 Bacteria 1471
1291 Ga0496108_0315879 3300048911 Bacteria 1362
1292 Ga0496108_0696693 3300048911 Bacteria 881
1293 Ga0496109_0000166 3300048912 Bacteria 64848
1294 Ga0496109_0005742 3300048912 Bacteria 10384
1295 Ga0496109_0009117 3300048912 Bacteria 8449
1296 Ga0496109_0210328 3300048912 Bacteria 1829
1297 Ga0496109_1081603 3300048912 Bacteria 739
1298 Ga0496109_1248153 3300048912 Bacteria 679
1299 Ga0496110_0004672 3300048913 Bacteria 10648
1300 Ga0496110_0014170 3300048913 Bacteria 6614
1301 Ga0496110_0030062 3300048913 Bacteria 4681
1302 Ga0496110_0051382 3300048913 Bacteria 3622
1303 Ga0496110_0258575 3300048913 Bacteria 1585
1304 Ga0496110_0379547 3300048913 Bacteria 1288
1305 Ga0496110_0470706 3300048913 Bacteria 1145
1306 Ga0496110_0806318 3300048913 Bacteria 843
1307 Ga0496111_0004234 3300048914 Bacteria 9035
1308 Ga0496111_0057082 3300048914 Bacteria 2826
1309 Ga0496111_0169041 3300048914 Bacteria 1624
1310 Ga0496111_0264936 3300048914 Bacteria 1275
1311 Ga0496111_0470712 3300048914 Bacteria 926
1312 Ga0496111_0576079 3300048914 Bacteria 825
1313 Ga0496112_0000092 3300048915 Bacteria 58800
1314 Ga0496112_0001913 3300048915 Bacteria 16432
1315 Ga0496112_0009707 3300048915 Bacteria 8689
1316 Ga0496112_0057575 3300048915 Bacteria 3826
1317 Ga0496112_0144824 3300048915 Bacteria 2344
1318 Ga0496112_0216321 3300048915 Bacteria 1872
1319 Ga0496112_0313559 3300048915 Bacteria 1513
1320 Ga0496112_0325415 3300048915 Bacteria 1481
1321 Ga0496112_0363999 3300048915 Bacteria 1388
1322 Ga0496112_0395479 3300048915 Bacteria 1322
1323 Ga0496113_0026817 3300048916 Bacteria 4124
1324 Ga0496113_0075256 3300048916 Bacteria 2576
1325 Ga0496113_0110315 3300048916 Bacteria 2141
1326 Ga0496113_0143961 3300048916 Bacteria 1877
1327 Ga0496113_0197455 3300048916 Bacteria 1598
1328 Ga0496113_0203178 3300048916 Bacteria 1575
1329 Ga0496113_0467907 3300048916 Bacteria 1013
1330 Ga0496113_0473984 3300048916 Bacteria 1006
1331 Ga0496113_0523193 3300048916 Bacteria 952
1332 Ga0496114_0032707 3300048917 Bacteria 4282
1333 Ga0496114_0061856 3300048917 Bacteria 3132
1334 Ga0496114_0065928 3300048917 Bacteria 3035
1335 Ga0496114_0105449 3300048917 Bacteria 2411
1336 Ga0496114_0166482 3300048917 Bacteria 1919
1337 Ga0496114_0207630 3300048917 Bacteria 1717
1338 Ga0496115_0001497 3300048918 Bacteria 16782
1339 Ga0496115_0014260 3300048918 Bacteria 6017
1340 Ga0496115_0145424 3300048918 Bacteria 1956
1341 Ga0496115_0179211 3300048918 Bacteria 1752
1342 Ga0496115_0267078 3300048918 Bacteria 1406
1343 Ga0496115_0323333 3300048918 Bacteria 1261
1344 Ga0496117_0182188 3300048920 Bacteria 1206
1345 Ga0496118_0037797 3300048921 Bacteria 3879
1346 Ga0496118_0180127 3300048921 Bacteria 1278
1347 Ga0496118_0248905 3300048921 Bacteria 1011
1348 Ga0496118_0269933 3300048921 Bacteria 954
1349 Ga0496118_0412744 3300048921 Bacteria 697
1350 Ga0496119_0004322 3300048922 Bacteria 14186
1351 Ga0496119_0017486 3300048922 Bacteria 5390
1352 Ga0496119_0036093 3300048922 Bacteria 3231
1353 Ga0496120_0032833 3300048923 Bacteria 3125
1354 Ga0496120_0076945 3300048923 Bacteria 1817
1355 Ga0496121_0001158 3300048924 Bacteria 46235
1356 Ga0496121_0021799 3300048924 Bacteria 6256
1357 Ga0496121_0036524 3300048924 Bacteria 4377
1358 Ga0496121_0046842 3300048924 Bacteria 3696
1359 Ga0496121_0052743 3300048924 Bacteria 3412
1360 Ga0496121_0064779 3300048924 Bacteria 2978
1361 Ga0496121_0070499 3300048924 Bacteria 2815
1362 Ga0496121_0076273 3300048924 Bacteria 2673
1363 Ga0496121_0098311 3300048924 Bacteria 2265
1364 Ga0496121_0109790 3300048924 Bacteria 2106
1365 Ga0496121_0118735 3300048924 Bacteria 2001
1366 Ga0496121_0128458 3300048924 Bacteria 1902
1367 Ga0496121_0134288 3300048924 Bacteria 1846
1368 Ga0496121_0200920 3300048924 Bacteria 1421
1369 Ga0496122_0362827 3300048925 Bacteria 751
1370 Ga0496123_0119933 3300048926 Bacteria 1482
1371 Ga0496124_0058489 3300048927 Bacteria 3241
1372 Ga0496124_0093164 3300048927 Bacteria 2452
1373 Ga0496124_0162730 3300048927 Bacteria 1738
1374 Ga0496124_0383865 3300048927 Bacteria 981
1375 Ga0496124_0789310 3300048927 Bacteria 590
1376 Ga0496125_0058918 3300048928 Bacteria 3098
1377 Ga0496125_0101612 3300048928 Bacteria 2115
1378 Ga0496126_0021248 3300048929 Bacteria 6343
1379 Ga0496126_0027564 3300048929 Bacteria 5424
1380 Ga0496126_0035540 3300048929 Bacteria 4669
1381 Ga0496126_0058582 3300048929 Bacteria 3471
1382 Ga0496126_0103744 3300048929 Bacteria 2484
1383 Ga0496126_0154303 3300048929 Bacteria 1966
1384 Ga0496126_0162968 3300048929 Bacteria 1904
1385 Ga0496126_0231559 3300048929 Bacteria 1548
1386 Ga0496126_0259698 3300048929 Bacteria 1445
1387 Ga0496126_0338561 3300048929 Bacteria 1233
1388 Ga0496126_0414179 3300048929 Bacteria 1091
1389 Ga0496126_0519978 3300048929 Bacteria 948
1390 Ga0496126_0540293 3300048929 Bacteria 926
1391 Ga0496126_0545144 3300048929 Bacteria 921
1392 Ga0496126_0964446 3300048929 Bacteria 642
1393 Ga0495678_084196 3300049459 Bacteria 1135
1394 Ga0495682_0064517 3300049460 Bacteria 1320
1395 Ga0495682_0079238 3300049460 Bacteria 1182
1396 Ga0495682_0193412 3300049460 Bacteria 722
1397 Ga0501032_0580351 3300049569 Bacteria 714
1398 Ga0501033_0150572 3300049570 Bacteria 1679
1399 Ga0501034_0034045 3300049571 Bacteria 5166
1400 Ga0501034_0891912 3300049571 Bacteria 778
1401 Ga0501036_0237091 3300049572 Bacteria 1530
1402 Ga0501037_0408957 3300049573 Bacteria 930
1403 Ga0501038_0700286 3300049574 Bacteria 759
1404 Ga0501040_0214192 3300049576 Bacteria 1370
1405 Ga0501043_0756978 3300049579 Bacteria 706
1406 Ga0501047_0015759 3300049581 Bacteria 7204
1407 Ga0501047_0049372 3300049581 Bacteria 4063
1408 Ga0501069_0323490 3300049585 Bacteria 906
1409 Ga0501070_0006105 3300049586 Bacteria 10269
1410 Ga0501070_0083794 3300049586 Bacteria 2640
1411 Ga0501071_0171870 3300049587 Bacteria 1622
1412 Ga0501074_0043902 3300049590 Bacteria 3236
1413 Ga0501074_0392062 3300049590 Bacteria 985
1414 Ga0501035_0026147 3300049822 Bacteria 5344
1415 Ga0501035_0483430 3300049822 Bacteria 1021
1416 Ga0501044_0105284 3300049823 Bacteria 2834
1417 Ga0501044_0452447 3300049823 Bacteria 1190
1418 Ga0501045_0734510 3300049824 Bacteria 728
1419 nmdc:mga03683_209889_c1 3300050489 Bacteria 896
1420 nmdc:mga03683_221296_c1 3300050489 Bacteria 873
1421 nmdc:mga03683_31688_c2 3300050489 Bacteria 824
1422 nmdc:mga03683_353013_c1 3300050489 Bacteria 696
1423 nmdc:mga03683_71078_c1 3300050489 Bacteria 1488
1424 nmdc:mga03n38_97972_c1 3300050490 Bacteria 1409
1425 nmdc:mga00v17_197769_c1 3300050491 Bacteria 1299
1426 nmdc:mga00v17_59104_c1 3300050491 Bacteria 2351
1427 nmdc:mga00v17_631294_c1 3300050491 Bacteria 690
1428 nmdc:mga0yw44_206148_c1 3300050492 Bacteria 1300
1429 nmdc:mga0yw44_247782_c1 3300050492 Bacteria 1185
1430 nmdc:mga0yw44_629110_c1 3300050492 Bacteria 729
1431 nmdc:mga0yw44_653483_c1 3300050492 Bacteria 714
1432 nmdc:mga0k408_133064_c1 3300050493 Bacteria 1477
1433 nmdc:mga0k408_179750_c1 3300050493 Bacteria 1262
1434 nmdc:mga0k408_18926_c1 3300050493 Bacteria 1527
1435 nmdc:mga0k408_200604_c1 3300050493 Bacteria 1191
1436 nmdc:mga0k408_404724_c1 3300050493 Bacteria 812
1437 nmdc:mga0k408_505766_c1 3300050493 Bacteria 716
1438 nmdc:mga0k408_73021_c1 3300050493 Bacteria 2004
1439 nmdc:mga06z11_11035_c1 3300050494 Bacteria 3877
1440 nmdc:mga06z11_61537_c1 3300050494 Bacteria 1958
1441 nmdc:mga06z11_62894_c1 3300050494 Bacteria 1940
1442 nmdc:mga04h51_51193_c1 3300050495 Bacteria 1387
1443 nmdc:mga04h51_77007_c1 3300050495 Bacteria 1176
1444 nmdc:mga04h51_78702_c1 3300050495 Bacteria 1166
1445 nmdc:mga04h51_96333_c1 3300050495 Bacteria 1072
1446 nmdc:mga07m45_105569_c1 3300050496 Bacteria 1620
1447 nmdc:mga07m45_108751_c1 3300050496 Bacteria 1596
1448 nmdc:mga07m45_113399_c1 3300050496 Bacteria 1563
1449 nmdc:mga07m45_114194_c1 3300050496 Bacteria 1557
1450 nmdc:mga07m45_25255_c1 3300050496 Bacteria 3257
1451 nmdc:mga07m45_35516_c1 3300050496 Bacteria 2772
1452 nmdc:mga07m45_8718_c1 3300050496 Bacteria 5224
1453 nmdc:mga05p37_349995_c1 3300050507 Bacteria 1740
1454 nmdc:mga0qj67_986413_c1 3300050509 Bacteria 661
1455 nmdc:mga08y16_884119_c1 3300050511 Bacteria 881
1456 nmdc:mga0n895_124354_c1 3300050512 Bacteria 2602
1457 nmdc:mga0n895_14332_c1 3300050512 Bacteria 7196
1458 nmdc:mga0n895_228752_c1 3300050512 Bacteria 1888
1459 nmdc:mga0n895_29483_c1 3300050512 Bacteria 5235
1460 nmdc:mga0n895_659535_c1 3300050512 Bacteria 1044
1461 nmdc:mga0rr50_175839_c1 3300050513 Bacteria 1747
1462 nmdc:mga0rr50_38374_c1 3300050513 Bacteria 3465
1463 nmdc:mga0rr50_407471_c1 3300050513 Bacteria 1149
1464 nmdc:mga08x19_85734_c1 3300050514 Bacteria 2073
1465 nmdc:mga0a205_635069_c1 3300050515 Bacteria 919
1466 nmdc:mga0sz30_124765_c1 3300050516 Bacteria 1133
1467 nmdc:mga0sz30_12648_c1 3300050516 Bacteria 3287
1468 nmdc:mga0sz30_49132_c1 3300050516 Bacteria 1215
1469 nmdc:mga0sz30_52130_c1 3300050516 Bacteria 1737
1470 Ga0495601_0069652 3300053077 Bacteria 2243
1471 Ga0495601_0112890 3300053077 Bacteria 1761
1472 Ga0495601_0212427 3300053077 Bacteria 1264
1473 Ga0495601_0348248 3300053077 Bacteria 963
1474 Ga0495612_0003490 3300053078 Bacteria 6515
1475 Ga0495612_0007947 3300053078 Bacteria 4323
1476 Ga0500610_0229951 3300053079 Bacteria 871
1477 Ga0500635_0005867 3300053080 Bacteria 3253
1478 Ga0500635_0021376 3300053080 Bacteria 1993
1479 Ga0500635_0105523 3300053080 Bacteria 1041
1480 Ga0500635_0264846 3300053080 Bacteria 675
1481 Ga0495655_0129481 3300053083 Bacteria 776
1482 Ga0495595_0000808 3300053084 Bacteria 11938
1483 Ga0495595_0122241 3300053084 Bacteria 1268
1484 Ga0495595_0347423 3300053084 Bacteria 748
1485 Ga0495619_0032598 3300053085 Bacteria 3381
1486 Ga0495619_0147365 3300053085 Bacteria 1623
1487 Ga0495619_0209198 3300053085 Bacteria 1351
1488 Ga0500578_0080223 3300053086 Bacteria 2076
1489 Ga0500578_0222128 3300053086 Bacteria 1148
1490 Ga0500643_000042 3300053087 Bacteria 158933
1491 Ga0500643_069707 3300053087 Bacteria 977
1492 Ga0500644_0111336 3300053088 Bacteria 1055
1493 Ga0500646_0159789 3300053090 Bacteria 752
1494 Ga0500647_0043524 3300053091 Bacteria 2155
1495 Ga0500647_0059319 3300053091 Bacteria 1840
1496 Ga0500583_0007131 3300053092 Bacteria 3905
1497 Ga0500583_0059693 3300053092 Bacteria 1796
1498 Ga0500651_0194250 3300053093 Bacteria 1200
1499 Ga0500566_0000072 3300053094 Bacteria 48857
1500 Ga0500566_0000264 3300053094 Bacteria 28047
1501 Ga0500566_0002476 3300053094 Bacteria 10978
1502 Ga0500566_0226593 3300053094 Bacteria 925
1503 Ga0500640_034957 3300053095 Bacteria 2208
1504 Ga0500640_127660 3300053095 Bacteria 1008
1505 Ga0500641_0006798 3300053096 Bacteria 4068
1506 Ga0500641_0090325 3300053096 Bacteria 1307
1507 Ga0500650_0146739 3300053098 Bacteria 1092
1508 Ga0500554_000273 3300053102 Bacteria 11165
1509 Ga0500554_000792 3300053102 Bacteria 6252
1510 Ga0500555_048190 3300053103 Bacteria 1171
1511 Ga0500556_0115124 3300053104 Bacteria 1045
1512 Ga0500557_000006 3300053105 Bacteria 141252
1513 Ga0500569_060197 3300053109 Bacteria 1170
1514 Ga0500572_000226 3300053111 Bacteria 19903
1515 Ga0500572_000499 3300053111 Bacteria 13477
1516 Ga0500591_043704 3300053115 Bacteria 2123
1517 Ga0500595_000581 3300053119 Bacteria 21788
1518 Ga0500595_003343 3300053119 Bacteria 7531
1519 Ga0500595_015487 3300053119 Bacteria 2860
1520 Ga0500595_072996 3300053119 Bacteria 1015
1521 Ga0500595_097667 3300053119 Bacteria 844
1522 Ga0500595_101390 3300053119 Bacteria 824
1523 Ga0500607_049421 3300053121 Bacteria 2244
1524 Ga0500608_092484 3300053122 Bacteria 1411
1525 Ga0500614_003266 3300053123 Bacteria 3509
1526 Ga0500642_0000068 3300053130 Bacteria 56277
1527 Ga0500642_0077068 3300053130 Bacteria 1526
1528 Ga0500658_0078768 3300053134 Bacteria 1405
1529 Ga0500658_0087456 3300053134 Bacteria 1342
1530 Ga0500559_0000155 3300053136 Bacteria 54058
1531 Ga0500559_0001312 3300053136 Bacteria 14351
1532 Ga0500559_0041811 3300053136 Bacteria 1998
1533 Ga0500559_0101422 3300053136 Bacteria 1326
1534 Ga0500564_042947 3300053138 Bacteria 2078
1535 Ga0500568_0007584 3300053139 Bacteria 5309
1536 Ga0500568_0171546 3300053139 Bacteria 798
1537 Ga0500579_134954 3300053143 Bacteria 1138
1538 Ga0500586_000095 3300053145 Bacteria 15393
1539 Ga0500589_142501 3300053147 Bacteria 986
1540 Ga0500590_025218 3300053148 Bacteria 3086
1541 Ga0500590_034455 3300053148 Bacteria 2621
1542 Ga0500590_243575 3300053148 Bacteria 721
1543 Ga0500603_000346 3300053150 Bacteria 12097
1544 Ga0500603_000767 3300053150 Bacteria 7724
1545 Ga0500603_022200 3300053150 Bacteria 1569
1546 Ga0500620_006327 3300053155 Bacteria 2831
1547 Ga0500622_0026006 3300053156 Bacteria 3090
1548 Ga0500627_0168806 3300053158 Bacteria 986
1549 Ga0500630_000703 3300053159 Bacteria 15308
1550 Ga0500633_0038617 3300053160 Bacteria 1592
1551 Ga0500638_000737 3300053162 Bacteria 8836
1552 Ga0500638_048030 3300053162 Bacteria 2065
1553 Ga0500639_000029 3300053163 Bacteria 76014
1554 Ga0500639_132881 3300053163 Bacteria 1176
1555 Ga0500639_178363 3300053163 Bacteria 943
1556 Ga0500639_194307 3300053163 Bacteria 880
1557 Ga0500636_0007750 3300053177 Bacteria 6209
1558 Ga0500636_0141455 3300053177 Bacteria 1331
1559 Ga0500636_0159938 3300053177 Bacteria 1229
1560 Ga0500637_0000163 3300053178 Bacteria 24481
1561 Ga0500637_0094437 3300053178 Bacteria 1732
1562 Ga0500649_085632 3300053722 Bacteria 1274
1563 Ga0500576_065134 3300053725 Bacteria 1582
1564 Ga0500576_163368 3300053725 Bacteria 813
1565 Ga0500576_163874 3300053725 Bacteria 811
1566 Ga0500625_011281 3300053729 Bacteria 4054
1567 Ga0500645_020102 3300053730 Bacteria 2071
1568 Ga0500645_068952 3300053730 Bacteria 1016
1569 Ga0500609_002715 3300053731 Bacteria 2521
1570 Ga0500609_006564 3300053731 Bacteria 1584
1571 Ga0500601_020389 3300053737 Bacteria 764
1572 Ga0500661_003807 3300055283 Bacteria 2833
1573 Ga0587080_088941 3300059503 Bacteria 645
1574 Ga0501082_0503461 3300060353 Bacteria 1059

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10583189 Ga0070681_105831892 160
2 3300005530 Ga0070679_100055132 Ga0070679_1000551322 160
3 3300025912 Ga0207707_10052912 Ga0207707_100529122 160
4 3300006358 Ga0068871_100796548 Ga0068871_1007965481 171
5 3300009176 Ga0105242_10110621 Ga0105242_101106215 171
6 3300025961 Ga0207712_10110047 Ga0207712_101100473 171
7 3300039447 Ga0436361_1196720 Ga0436361_1196720_501_1145 173
8 3300039450 Ga0436363_0624071 Ga0436363_0624071_1308_1952 173
9 3300050493 nmdc:mga0k408_505766_c1 nmdc:mga0k408_505766_c1_182_706 174
10 3300005327 Ga0070658_10282156 Ga0070658_102821562 177
11 3300005337 Ga0070682_100188729 Ga0070682_1001887292 177
12 3300005338 Ga0068868_100180111 Ga0068868_1001801112 177
13 3300005355 Ga0070671_100115480 Ga0070671_1001154802 177
14 3300005455 Ga0070663_100149178 Ga0070663_1001491782 177
15 3300005547 Ga0070693_100028629 Ga0070693_1000286291 177
16 3300005564 Ga0070664_100202018 Ga0070664_1002020182 177
17 3300005834 Ga0068851_10437577 Ga0068851_104375771 177
18 3300009177 Ga0105248_11739186 Ga0105248_117391861 177
19 3300009545 Ga0105237_10396181 Ga0105237_103961812 177
20 3300010375 Ga0105239_10020532 Ga0105239_100205322 177
21 3300011119 Ga0105246_10003035 Ga0105246_100030352 177
22 3300013308 Ga0157375_11204890 Ga0157375_112048901 177
23 3300014325 Ga0163163_10019430 Ga0163163_100194302 177
24 3300014969 Ga0157376_10009146 Ga0157376_100091467 177
25 3300025914 Ga0207671_10431940 Ga0207671_104319402 177
26 3300025931 Ga0207644_10058382 Ga0207644_100583823 177
27 3300025945 Ga0207679_10252345 Ga0207679_102523451 177
28 3300026067 Ga0207678_10166968 Ga0207678_101669682 177
29 3300026095 Ga0207676_10027761 Ga0207676_100277612 177
30 3300026121 Ga0207683_10018433 Ga0207683_100184336 177
31 3300026142 Ga0207698_10307542 Ga0207698_103075422 177
32 3300048904 Ga0496101_0014243 Ga0496101_0014243_1227_1826 177
33 3300048906 Ga0496103_0007813 Ga0496103_0007813_1769_2368 177
34 3300048907 Ga0496104_0024665 Ga0496104_0024665_269_868 177
35 3300048908 Ga0496105_0013439 Ga0496105_0013439_4536_5135 177
36 3300048909 Ga0496106_0017568 Ga0496106_0017568_417_1016 177
37 3300048910 Ga0496107_0065498 Ga0496107_0065498_1541_2140 177
38 3300048911 Ga0496108_0008268 Ga0496108_0008268_3447_4046 177
39 3300048912 Ga0496109_0009117 Ga0496109_0009117_4241_4840 177
40 3300048913 Ga0496110_0014170 Ga0496110_0014170_4478_5077 177
41 3300048914 Ga0496111_0004234 Ga0496111_0004234_4361_4960 177
42 3300048915 Ga0496112_0216321 Ga0496112_0216321_377_976 177
43 3300048916 Ga0496113_0197455 Ga0496113_0197455_987_1586 177
44 3300048917 Ga0496114_0065928 Ga0496114_0065928_2196_2795 177
45 3300048918 Ga0496115_0001497 Ga0496115_0001497_4393_4992 177
46 3300021377 Ga0213874_10020432 Ga0213874_100204322 179
47 3300046533 Ga0495640_0046380 Ga0495640_0046380_2462_3001 179
48 3300046680 Ga0495646_0210213 Ga0495646_0210213_11_550 179
49 3300046684 Ga0495669_0050303 Ga0495669_0050303_1178_1786 179
50 3300046533 Ga0495640_0206452 Ga0495640_0206452_677_1222 181
51 3300048929 Ga0496126_0964446 Ga0496126_0964446_65_616 181
52 3300048905 Ga0496102_0171207 Ga0496102_0171207_465_1031 182
53 3300046684 Ga0495669_0347624 Ga0495669_0347624_156_707 183
54 3300005435 Ga0070714_100508149 Ga0070714_1005081492 184
55 3300042439 Ga0439464_0160469 Ga0439464_0160469_128_682 184
56 3300046616 Ga0495668_0475102 Ga0495668_0475102_20_577 184
57 3300046683 Ga0495658_0237902 Ga0495658_0237902_562_1131 184
58 3300046684 Ga0495669_0028505 Ga0495669_0028505_1848_2417 184
59 3300046692 Ga0495671_0364914 Ga0495671_0364914_120_677 184
60 3300047445 Ga0495677_0073571 Ga0495677_0073571_25_582 184
61 3300048927 Ga0496124_0789310 Ga0496124_0789310_16_570 184
62 3300049572 Ga0501036_0237091 Ga0501036_0237091_165_719 184
63 3300050493 nmdc:mga0k408_404724_c1 nmdc:mga0k408_404724_c1_227_781 184
64 3300053079 Ga0500610_0229951 Ga0500610_0229951_286_840 184
65 3300053080 Ga0500635_0264846 Ga0500635_0264846_96_653 184
66 3300053090 Ga0500646_0159789 Ga0500646_0159789_26_583 184
67 3300053134 Ga0500658_0078768 Ga0500658_0078768_825_1382 184
68 3300005841 Ga0068863_100988687 Ga0068863_1009886872 192
69 3300006237 Ga0097621_100023922 Ga0097621_1000239227 192
70 3300013296 Ga0157374_10007618 Ga0157374_100076187 192
71 3300013306 Ga0163162_10548363 Ga0163162_105483632 192
72 3300014745 Ga0157377_10166455 Ga0157377_101664552 192
73 3300048918 Ga0496115_0323333 Ga0496115_0323333_287_901 192
74 iso_pu_bacteria 2728368998 2728754058 192
75 3300046809 Ga0495600_0337440 Ga0495600_0337440_248_835 195
76 iso_pu_bacteria 2507262055 2507507143 195
77 iso_pu_bacteria 2508501009 2508541193 195
78 iso_pu_bacteria 2508501042 2508693471 195
79 iso_pu_bacteria 2511231028 2511397690 195
80 iso_pu_bacteria 2513237092 2513629119 195
81 iso_pu_bacteria 2513237094 2513637240 195
82 iso_pu_bacteria 2513237095 2513651633 195
83 iso_pu_bacteria 2513237102 2513703050 195
84 iso_pu_bacteria 2513237104 2513717399 195
85 iso_pu_bacteria 2513237139 2513876795 195
86 iso_pu_bacteria 2515154112 2515628830 195
87 iso_pu_bacteria 2517093001 2517107386 195
88 iso_pu_bacteria 2524023205 2524439532 195
89 iso_pu_bacteria 2528768022 2528850996 195
90 iso_pu_bacteria 2617270735 2617348040 195
91 iso_pu_bacteria 2617270741 2617377728 195
92 iso_pu_bacteria 2744054633 2745081805 195
93 iso_pu_bacteria 2791355196 2793065995 195
94 iso_pu_bacteria 2802429603 2805918775 195
95 iso_pu_bacteria 2816332527 2818243226 195
96 iso_pu_bacteria 2824600985 2824605473 195
97 iso_pu_bacteria 2824609381 2824614811 195
98 iso_pu_bacteria 2824617872 2824622627 195
99 iso_pu_bacteria 2824626560 2824631790 195
100 iso_pu_bacteria 2824635225 2824638958 195
101 iso_pu_bacteria 2824644064 2824648105 195
102 iso_pu_bacteria 2824653114 2824658062 195
103 iso_pu_bacteria 2824661429 2824667904 195
104 iso_pu_bacteria 2824671348 2824673935 195
105 iso_pu_bacteria 2824679649 2824681684 195
106 iso_pu_bacteria 2824687955 2824690617 195
107 iso_pu_bacteria 2824696289 2824698138 195
108 iso_pu_bacteria 2824704595 2824707479 195
109 iso_pu_bacteria 2824714736 2824717942 195
110 iso_pu_bacteria 2824723954 2824727785 195
111 iso_pu_bacteria 2824732956 2824736672 195
112 iso_pu_bacteria 2824746037 2824746414 195
113 iso_pu_bacteria 2824753945 2824759260 195
114 iso_pu_bacteria 2824763712 2824769568 195
115 iso_pu_bacteria 2824773399 2824776151 195
116 iso_pu_bacteria 2838122688 2838126991 195
117 iso_pu_bacteria 2841941048 2841945529 195
118 iso_pu_bacteria 2841949485 2841954745 195
119 iso_pu_bacteria 2841957949 2841965839 195
120 iso_pu_bacteria 2841966195 2841972470 195
121 iso_pu_bacteria 2841974524 2841980554 195
122 iso_pu_bacteria 2841983080 2841988725 195
123 iso_pu_bacteria 2842038055 2842045014 195
124 iso_pu_bacteria 2842045827 2842052800 195
125 iso_pu_bacteria 2844315083 2844320544 195
126 iso_pu_bacteria 2847930680 2847938087 195
127 iso_pu_bacteria 2847939898 2847940003 195
128 iso_pu_bacteria 2849076700 2849077797 195
129 iso_pu_bacteria 2857509624 2857510974 195
130 iso_pu_bacteria 2874590934 2874596112 195
131 iso_pu_bacteria 2874612657 2874619022 195
132 iso_pu_bacteria 2874620515 2874625872 195
133 iso_pu_bacteria 2874628541 2874633156 195
134 iso_pu_bacteria 2874645413 2874650936 195
135 iso_pu_bacteria 2876761206 2876769121 195
136 iso_pu_bacteria 2876771140 2876776060 195
137 iso_pu_bacteria 2876818435 2876820668 195
138 iso_pu_bacteria 2879074833 2879080149 195
139 iso_pu_bacteria 2879083081 2879084366 195
140 iso_pu_bacteria 2879099564 2879101094 195
141 iso_pu_bacteria 2879127579 2879129922 195
142 iso_pu_bacteria 2879142872 2879147400 195
143 iso_pu_bacteria 2881364244 2881369391 195
144 iso_pu_bacteria 2881665667 2881672265 195
145 iso_pu_bacteria 2885366525 2885368481 195
146 iso_pu_bacteria 2885409591 2885410066 195
147 iso_pu_bacteria 2888378607 2888386037 195
148 iso_pu_bacteria 2888388044 2888392249 195
149 iso_pu_bacteria 2888419890 2888426153 195
150 iso_pu_bacteria 2903727486 2903732835 195
151 iso_pu_bacteria 2904666416 2904673768 195
152 iso_pu_bacteria 2904711408 2904717587 195
153 iso_pu_bacteria 2906602504 2906605634 195
154 iso_pu_bacteria 2906626472 2906628012 195
155 iso_pu_bacteria 2906643746 2906644067 195
156 iso_pu_bacteria 2908775508 2908782227 195
157 iso_pu_bacteria 2922368715 2922376365 195
158 iso_pu_bacteria 2922393267 2922399918 195
159 iso_pu_bacteria 2929615660 2929624021 195
160 iso_pu_bacteria 2929624759 2929633162 195
161 iso_pu_bacteria 2932784394 2932792668 195
162 iso_pu_bacteria 2932794094 2932797864 195
163 iso_pu_bacteria 2932801729 2932806399 195
164 iso_pu_bacteria 2932809354 2932815241 195
165 iso_pu_bacteria 2932818245 2932824480 195
166 iso_pu_bacteria 2932828146 2932832121 195
167 iso_pu_bacteria 2933577622 2933585922 195
168 iso_pu_bacteria 2935608549 2935610478 195
169 iso_pu_bacteria 2935616580 2935622059 195
170 iso_pu_bacteria 2935638405 2935643930 195
171 iso_pu_bacteria 2935648319 2935654320 195
172 iso_pu_bacteria 2935656913 2935663200 195
173 iso_pu_bacteria 2935665750 2935669154 195
174 iso_pu_bacteria 2935675223 2935683288 195
175 iso_pu_bacteria 2935684952 2935692229 195
176 iso_pu_bacteria 2935694250 2935700600 195
177 iso_pu_bacteria 2935703347 2935708770 195
178 iso_pu_bacteria 2935713505 2935720533 195
179 iso_pu_bacteria 2935722832 2935729814 195
180 iso_pu_bacteria 2935732158 2935739204 195
181 iso_pu_bacteria 2935741537 2935748255 195
182 iso_pu_bacteria 2935750917 2935758458 195
183 iso_pu_bacteria 2935760218 2935766115 195
184 iso_pu_bacteria 2935769743 2935770995 195
185 iso_pu_bacteria 2935777560 2935781162 195
186 iso_pu_bacteria 2935785616 2935786304 195
187 iso_pu_bacteria 2935793552 2935793899 195
188 iso_pu_bacteria 2935801545 2935805870 195
189 iso_pu_bacteria 2935810662 2935815571 195
190 iso_pu_bacteria 2935819856 2935823639 195
191 iso_pu_bacteria 2935827899 2935833182 195
192 iso_pu_bacteria 2935837841 2935843247 195
193 iso_pu_bacteria 2935847175 2935849165 195
194 iso_pu_bacteria 2935855204 2935860306 195
195 iso_pu_bacteria 2935864058 2935867704 195
196 iso_pu_bacteria 2935873716 2935878487 195
197 iso_pu_bacteria 2935883170 2935888406 195
198 iso_pu_bacteria 2935908558 2935912745 195
199 iso_pu_bacteria 2935916978 2935922936 195
200 iso_pu_bacteria 2935926038 2935930361 195
201 iso_pu_bacteria 2935934488 2935939261 195
202 iso_pu_bacteria 2935942939 2935946209 195
203 iso_pu_bacteria 2935951376 2935955546 195
204 iso_pu_bacteria 2935959822 2935966857 195
205 iso_pu_bacteria 2935967501 2935972083 195
206 iso_pu_bacteria 2935975950 2935976017 195
207 iso_pu_bacteria 2935984226 2935986492 195
208 iso_pu_bacteria 2935992306 2935998630 195
209 iso_pu_bacteria 2936002035 2936006936 195
210 iso_pu_bacteria 2936011229 2936017356 195
211 iso_pu_bacteria 2936019824 2936025858 195
212 iso_pu_bacteria 2936028420 2936034734 195
213 iso_pu_bacteria 2936037263 2936040809 195
214 iso_pu_bacteria 2936046547 2936052791 195
215 iso_pu_bacteria 2936055302 2936059986 195
216 iso_pu_bacteria 2940556831 2940564362 195
217 iso_pu_bacteria 2941531003 2941531742 195
218 iso_pu_bacteria 2941538514 2941544793 195
219 iso_pu_bacteria 3005483717 3005488395 195
220 iso_pu_bacteria 3005587118 3005594385 195
221 iso_pu_bacteria 3005594810 3005600937 195
222 iso_pu_bacteria 3005710791 3005716330 195
223 iso_pu_bacteria 3005718088 3005723721 195
224 iso_pu_bacteria 8016511872 8016520044 195
225 iso_pu_bacteria 8016522445 8016527964 195
226 iso_pu_bacteria 8016530956 8016533087 195
227 iso_pu_bacteria 8016539877 8016546321 195
228 iso_pu_bacteria 8016548790 8016555807 195
229 iso_pu_bacteria 8016566248 8016571400 195
230 iso_pu_bacteria 8016575299 8016575660 195
231 iso_pu_bacteria 8016583857 8016595052 195
232 iso_pu_bacteria 8016595262 8016601858 195
233 iso_pu_bacteria 8016603502 8016608391 195
234 iso_pu_bacteria 8016613128 8016616475 195
235 iso_pu_bacteria 8016622563 8016624663 195
236 iso_pu_bacteria 8016630954 8016638154 195
237 iso_pu_bacteria 8017057580 8017065509 195
238 iso_pu_bacteria 8019530166 8019532885 195
239 iso_pu_bacteria 8019538911 8019546966 195
240 iso_pu_bacteria 8019547302 8019551702 195
241 iso_pu_bacteria 8019576017 8019584913 195
242 iso_pu_bacteria 8019586578 8019592867 195
243 iso_pu_bacteria 8019597564 8019598591 195
244 iso_pu_bacteria 8019608314 8019609783 195
245 iso_pu_bacteria 8019619141 8019620368 195
246 iso_pu_bacteria 8019629233 8019632735 195
247 iso_pu_bacteria 8019638758 8019647195 195
248 iso_pu_bacteria 8019648815 8019655491 195
249 iso_pu_bacteria 8019659431 8019660600 195
250 iso_pu_bacteria 8019668869 8019670021 195
251 iso_pu_bacteria 8019678201 8019686081 195
252 iso_pu_bacteria 8055742211 8055744507 195
253 iso_pu_bacteria 8056967851 8056970450 195
254 3300007076 Ga0075435_100260755 Ga0075435_1002607552 196
255 3300025906 Ga0207699_10596127 Ga0207699_105961272 196
256 3300025922 Ga0207646_10179696 Ga0207646_101796963 196
257 3300044694 Ga0466963_0077502 Ga0466963_0077502_294_911 196
258 3300045976 Ga0466967_0106705 Ga0466967_0106705_1807_2424 196
259 3300050513 nmdc:mga0rr50_38374_c1 nmdc:mga0rr50_38374_c1_2431_3024 196
260 iso_pu_bacteria 2524023210 2524469204 196
261 iso_pu_bacteria 2903768456 2903770070 196
262 iso_pu_bacteria 8006926726 8006932597 196
263 iso_pu_bacteria 8056681323 8056682138 196
264 3300039447 Ga0436361_0214631 Ga0436361_0214631_36_656 197
265 iso_pu_bacteria 2508501128 2509147089 197
266 iso_pu_bacteria 2513237096 2513655818 197
267 iso_pu_bacteria 2513237098 2513672017 197
268 iso_pu_bacteria 2513237101 2513696478 197
269 iso_pu_bacteria 2513237137 2513856686 197
270 iso_pu_bacteria 2513237141 2513887520 197
271 iso_pu_bacteria 2513237145 2513917269 197
272 iso_pu_bacteria 2517572143 2517895447 197
273 iso_pu_bacteria 2524023228 2524539623 197
274 iso_pu_bacteria 2643221651 2644287320 197
275 iso_pu_bacteria 2667528175 2671122123 197
276 iso_pu_bacteria 2721755755 2723842984 197
277 iso_pu_bacteria 2728368998 2728754396 197
278 iso_pu_bacteria 2791355197 2793069426 197
279 iso_pu_bacteria 2791355199 2793082461 197
280 iso_pu_bacteria 2874604998 2874606361 197
281 iso_pu_bacteria 2876808645 2876809330 197
282 iso_pu_bacteria 2879110137 2879118134 197
283 iso_pu_bacteria 2885374607 2885382181 197
284 iso_pu_bacteria 2885383462 2885383694 197
285 iso_pu_bacteria 2889033259 2889033719 197
286 iso_pu_bacteria 2889033259 2889042250 197
287 iso_pu_bacteria 2903748898 2903751328 197
288 iso_pu_bacteria 2904690495 2904698792 197
289 iso_pu_bacteria 2904699407 2904710913 197
290 iso_pu_bacteria 2906610324 2906615932 197
291 iso_pu_bacteria 2906635258 2906639029 197
292 iso_pu_bacteria 2906660503 2906662077 197
293 iso_pu_bacteria 2908756301 2908758043 197
294 iso_pu_bacteria 2922361189 2922367080 197
295 iso_pu_bacteria 2922386360 2922390142 197
296 iso_pu_bacteria 2922425934 2922432095 197
297 iso_pu_bacteria 2935630451 2935631028 197
298 iso_pu_bacteria 2941507105 2941507680 197
299 iso_pu_bacteria 2941515067 2941516107 197
300 iso_pu_bacteria 2941523033 2941523185 197
301 iso_pu_bacteria 3005474847 3005476882 197
302 iso_pu_bacteria 8006964411 8006966618 197
303 iso_pu_bacteria 8006984368 8006989462 197
304 iso_pu_bacteria 8006994254 8006997929 197
305 iso_pu_bacteria 8019555841 8019564142 197
306 iso_pu_bacteria 8019565922 8019574218 197
307 iso_pu_bacteria 8056673599 8056674957 197
308 iso_pu_bacteria 8056689827 8056694586 197
309 3300005434 Ga0070709_10447408 Ga0070709_104474081 198
310 3300005435 Ga0070714_100106539 Ga0070714_1001065393 198
311 3300005436 Ga0070713_100014512 Ga0070713_1000145125 198
312 3300005439 Ga0070711_100231149 Ga0070711_1002311492 198
313 3300006871 Ga0075434_100023687 Ga0075434_1000236874 198
314 3300009545 Ga0105237_10234989 Ga0105237_102349892 198
315 3300009551 Ga0105238_10600758 Ga0105238_106007581 198
316 3300017792 Ga0163161_10831299 Ga0163161_108312991 198
317 3300025916 Ga0207663_10459399 Ga0207663_104593992 198
318 3300025928 Ga0207700_10020194 Ga0207700_100201942 198
319 3300025929 Ga0207664_10137539 Ga0207664_101375393 198
320 3300037853 Ga0436364_0714264 Ga0436364_0714264_251_853 198
321 3300047317 Ga0495604_0100091 Ga0495604_0100091_1125_1733 198
322 3300048907 Ga0496104_0000069 Ga0496104_0000069_936_1532 198
323 3300048907 Ga0496104_0244626 Ga0496104_0244626_229_825 198
324 3300048908 Ga0496105_0002028 Ga0496105_0002028_8275_8871 198
325 3300048908 Ga0496105_0161008 Ga0496105_0161008_646_1242 198
326 3300048917 Ga0496114_0032707 Ga0496114_0032707_147_743 198
327 3300048918 Ga0496115_0014260 Ga0496115_0014260_4376_4972 198
328 3300048922 Ga0496119_0004322 Ga0496119_0004322_9065_9661 198
329 3300050512 nmdc:mga0n895_14332_c1 nmdc:mga0n895_14332_c1_5383_5985 198
330 3300001979 JGI24740J21852_10093049 JGI24740J21852_100930491 199
331 3300001989 JGI24739J22299_10073834 JGI24739J22299_100738342 199
332 3300002067 JGI24735J21928_10056643 JGI24735J21928_100566432 199
333 3300003214 JGI25165J46597_1004815 JGI25165J46597_10048152 199
334 3300003215 JGI25153J46596_10008025 JGI25153J46596_100080252 199
335 3300003215 JGI25153J46596_10021145 JGI25153J46596_100211452 199
336 3300003354 JGI25160J50197_1002006 JGI25160J50197_10020062 199
337 3300003354 JGI25160J50197_1020040 JGI25160J50197_10200402 199
338 3300003759 Ga0055525_1005132 Ga0055525_10051322 199
339 3300003771 Ga0055526_1032557 Ga0055526_10325572 199
340 3300003771 Ga0055526_1053039 Ga0055526_10530392 199
341 3300003775 Ga0055524_1043256 Ga0055524_10432562 199
342 3300003794 Ga0055531_10008593 Ga0055531_100085932 199
343 3300005262 Ga0065165_1002451 Ga0065165_100245113 199
344 3300005262 Ga0065165_1002611 Ga0065165_100261114 199
345 3300005262 Ga0065165_1003698 Ga0065165_10036982 199
346 3300005262 Ga0065165_1032389 Ga0065165_10323892 199
347 3300005328 Ga0070676_10246739 Ga0070676_102467392 199
348 3300005330 Ga0070690_100085021 Ga0070690_1000850211 199
349 3300005336 Ga0070680_100850116 Ga0070680_1008501161 199
350 3300005341 Ga0070691_10192339 Ga0070691_101923391 199
351 3300005347 Ga0070668_100043305 Ga0070668_1000433052 199
352 3300005355 Ga0070671_100664784 Ga0070671_1006647841 199
353 3300005356 Ga0070674_100206666 Ga0070674_1002066662 199
354 3300005366 Ga0070659_100663637 Ga0070659_1006636371 199
355 3300005434 Ga0070709_10017233 Ga0070709_100172332 199
356 3300005436 Ga0070713_100305526 Ga0070713_1003055262 199
357 3300005437 Ga0070710_10261085 Ga0070710_102610852 199
358 3300005438 Ga0070701_10250245 Ga0070701_102502452 199
359 3300005455 Ga0070663_100258536 Ga0070663_1002585361 199
360 3300005455 Ga0070663_100816585 Ga0070663_1008165851 199
361 3300005455 Ga0070663_100883963 Ga0070663_1008839631 199
362 3300005458 Ga0070681_10041826 Ga0070681_100418264 199
363 3300005458 Ga0070681_10117787 Ga0070681_101177871 199
364 3300005466 Ga0070685_10520085 Ga0070685_105200851 199
365 3300005471 Ga0070698_100256842 Ga0070698_1002568422 199
366 3300005530 Ga0070679_100581139 Ga0070679_1005811391 199
367 3300005535 Ga0070684_100043585 Ga0070684_1000435852 199
368 3300005535 Ga0070684_101032896 Ga0070684_1010328961 199
369 3300005536 Ga0070697_100034848 Ga0070697_1000348482 199
370 3300005539 Ga0068853_100991364 Ga0068853_1009913641 199
371 3300005543 Ga0070672_100029567 Ga0070672_1000295672 199
372 3300005548 Ga0070665_100430402 Ga0070665_1004304022 199
373 3300005548 Ga0070665_100769820 Ga0070665_1007698202 199
374 3300005548 Ga0070665_100922947 Ga0070665_1009229471 199
375 3300005614 Ga0068856_100514096 Ga0068856_1005140962 199
376 3300005615 Ga0070702_100016652 Ga0070702_1000166522 199
377 3300005616 Ga0068852_100005393 Ga0068852_1000053934 199
378 3300005616 Ga0068852_100828087 Ga0068852_1008280872 199
379 3300005841 Ga0068863_100246090 Ga0068863_1002460902 199
380 3300006028 Ga0070717_10610335 Ga0070717_106103352 199
381 3300006038 Ga0075365_10038304 Ga0075365_100383043 199
382 3300006038 Ga0075365_10343482 Ga0075365_103434822 199
383 3300006038 Ga0075365_10458362 Ga0075365_104583621 199
384 3300006048 Ga0075363_100144620 Ga0075363_1001446202 199
385 3300006051 Ga0075364_10102762 Ga0075364_101027622 199
386 3300006051 Ga0075364_10266151 Ga0075364_102661512 199
387 3300006163 Ga0070715_10287884 Ga0070715_102878842 199
388 3300006163 Ga0070715_10297031 Ga0070715_102970311 199
389 3300006175 Ga0070712_100037108 Ga0070712_1000371082 199
390 3300006177 Ga0075362_10275439 Ga0075362_102754391 199
391 3300006186 Ga0075369_10035188 Ga0075369_100351882 199
392 3300006186 Ga0075369_10274705 Ga0075369_102747051 199
393 3300006195 Ga0075366_10134751 Ga0075366_101347512 199
394 3300006353 Ga0075370_10033798 Ga0075370_100337982 199
395 3300006353 Ga0075370_10349343 Ga0075370_103493432 199
396 3300006881 Ga0068865_100571982 Ga0068865_1005719821 199
397 3300006941 Ga0099825_1015919 Ga0099825_10159192 199
398 3300006942 Ga0099824_1028363 Ga0099824_10283631 199
399 3300006944 Ga0099823_1063315 Ga0099823_10633151 199
400 3300009093 Ga0105240_10018407 Ga0105240_100184075 199
401 3300009093 Ga0105240_11129475 Ga0105240_111294751 199
402 3300009098 Ga0105245_10300323 Ga0105245_103003232 199
403 3300009148 Ga0105243_10126375 Ga0105243_101263752 199
404 3300009174 Ga0105241_10057681 Ga0105241_100576812 199
405 3300009174 Ga0105241_10178213 Ga0105241_101782132 199
406 3300009174 Ga0105241_10461296 Ga0105241_104612962 199
407 3300009174 Ga0105241_10750691 Ga0105241_107506912 199
408 3300009176 Ga0105242_10057151 Ga0105242_100571514 199
409 3300009177 Ga0105248_10108895 Ga0105248_101088954 199
410 3300009177 Ga0105248_10258573 Ga0105248_102585732 199
411 3300009545 Ga0105237_10016328 Ga0105237_100163282 199
412 3300009545 Ga0105237_10414071 Ga0105237_104140712 199
413 3300009551 Ga0105238_10170267 Ga0105238_101702672 199
414 3300009553 Ga0105249_10721690 Ga0105249_107216902 199
415 3300010375 Ga0105239_10117394 Ga0105239_101173941 199
416 3300010375 Ga0105239_10139090 Ga0105239_101390903 199
417 3300010375 Ga0105239_10201246 Ga0105239_102012462 199
418 3300010375 Ga0105239_10377607 Ga0105239_103776072 199
419 3300010375 Ga0105239_11222313 Ga0105239_112223131 199
420 3300011119 Ga0105246_10400002 Ga0105246_104000022 199
421 3300011119 Ga0105246_10549288 Ga0105246_105492882 199
422 3300013104 Ga0157370_11017251 Ga0157370_110172511 199
423 3300013105 Ga0157369_10426866 Ga0157369_104268662 199
424 3300013296 Ga0157374_10395252 Ga0157374_103952522 199
425 3300013297 Ga0157378_10275117 Ga0157378_102751172 199
426 3300013306 Ga0163162_10364985 Ga0163162_103649852 199
427 3300013306 Ga0163162_11517043 Ga0163162_115170431 199
428 3300014497 Ga0182008_10145084 Ga0182008_101450842 199
429 3300014968 Ga0157379_10240892 Ga0157379_102408922 199
430 3300015261 Ga0182006_1118523 Ga0182006_11185232 199
431 3300017792 Ga0163161_10326252 Ga0163161_103262521 199
432 3300017792 Ga0163161_10362385 Ga0163161_103623851 199
433 3300020070 Ga0206356_10310093 Ga0206356_103100932 199
434 3300020082 Ga0206353_11784540 Ga0206353_117845402 199
435 3300021320 Ga0214544_1000136 Ga0214544_10001363 199
436 3300021321 Ga0214542_1000127 Ga0214542_10001273 199
437 3300021324 Ga0214545_1000063 Ga0214545_100006395 199
438 3300021327 Ga0214543_1014866 Ga0214543_10148663 199
439 3300022467 Ga0224712_10083188 Ga0224712_100831882 199
440 3300025230 Ga0209563_109501 Ga0209563_1095012 199
441 3300025253 Ga0209677_108643 Ga0209677_1086433 199
442 3300025254 Ga0209148_1000879 Ga0209148_100087920 199
443 3300025261 Ga0209233_1002427 Ga0209233_10024273 199
444 3300025261 Ga0209233_1014216 Ga0209233_10142162 199
445 3300025261 Ga0209233_1016287 Ga0209233_10162871 199
446 3300025272 Ga0209455_1001366 Ga0209455_10013667 199
447 3300025273 Ga0209673_1019322 Ga0209673_10193222 199
448 3300025284 Ga0209130_1046517 Ga0209130_10465171 199
449 3300025295 Ga0209564_1000602 Ga0209564_100060218 199
450 3300025295 Ga0209564_1006952 Ga0209564_10069524 199
451 3300025295 Ga0209564_1026798 Ga0209564_10267982 199
452 3300025297 Ga0209758_1000011 Ga0209758_1000011900 199
453 3300025297 Ga0209758_1000455 Ga0209758_10004552 199
454 3300025297 Ga0209758_1007373 Ga0209758_10073731 199
455 3300025297 Ga0209758_1011599 Ga0209758_10115992 199
456 3300025297 Ga0209758_1035461 Ga0209758_10354612 199
457 3300025299 Ga0209256_1002822 Ga0209256_10028223 199
458 3300025299 Ga0209256_1035913 Ga0209256_10359132 199
459 3300025302 Ga0207426_1000505 Ga0207426_100050517 199
460 3300025302 Ga0207426_1000551 Ga0207426_100055116 199
461 3300025302 Ga0207426_1001912 Ga0207426_10019123 199
462 3300025302 Ga0207426_1112932 Ga0207426_11129321 199
463 3300025303 Ga0209051_1094255 Ga0209051_10942552 199
464 3300025304 Ga0209257_1003002 Ga0209257_10030022 199
465 3300025304 Ga0209257_1019280 Ga0209257_10192802 199
466 3300025304 Ga0209257_1069568 Ga0209257_10695682 199
467 3300025903 Ga0207680_10140852 Ga0207680_101408521 199
468 3300025904 Ga0207647_10003320 Ga0207647_100033202 199
469 3300025906 Ga0207699_10052724 Ga0207699_100527243 199
470 3300025906 Ga0207699_10238831 Ga0207699_102388312 199
471 3300025909 Ga0207705_10039590 Ga0207705_100395903 199
472 3300025910 Ga0207684_10337259 Ga0207684_103372592 199
473 3300025911 Ga0207654_10042854 Ga0207654_100428541 199
474 3300025911 Ga0207654_10110845 Ga0207654_101108452 199
475 3300025911 Ga0207654_10325079 Ga0207654_103250792 199
476 3300025912 Ga0207707_10592111 Ga0207707_105921111 199
477 3300025913 Ga0207695_10000157 Ga0207695_1000015795 199
478 3300025914 Ga0207671_10009946 Ga0207671_100099465 199
479 3300025915 Ga0207693_10015868 Ga0207693_100158682 199
480 3300025916 Ga0207663_10062505 Ga0207663_100625052 199
481 3300025917 Ga0207660_10604613 Ga0207660_106046132 199
482 3300025918 Ga0207662_10202162 Ga0207662_102021622 199
483 3300025919 Ga0207657_10136834 Ga0207657_101368342 199
484 3300025919 Ga0207657_10612208 Ga0207657_106122081 199
485 3300025920 Ga0207649_10148623 Ga0207649_101486232 199
486 3300025921 Ga0207652_10912363 Ga0207652_109123631 199
487 3300025924 Ga0207694_10025055 Ga0207694_100250553 199
488 3300025924 Ga0207694_10518528 Ga0207694_105185282 199
489 3300025927 Ga0207687_10060872 Ga0207687_100608723 199
490 3300025928 Ga0207700_10172234 Ga0207700_101722342 199
491 3300025932 Ga0207690_10359279 Ga0207690_103592792 199
492 3300025935 Ga0207709_10030496 Ga0207709_100304962 199
493 3300025935 Ga0207709_10171538 Ga0207709_101715382 199
494 3300025938 Ga0207704_10423169 Ga0207704_104231692 199
495 3300025939 Ga0207665_10408302 Ga0207665_104083022 199
496 3300025940 Ga0207691_10013516 Ga0207691_100135168 199
497 3300025941 Ga0207711_10084823 Ga0207711_100848233 199
498 3300025944 Ga0207661_10026657 Ga0207661_100266572 199
499 3300025945 Ga0207679_10407203 Ga0207679_104072032 199
500 3300025949 Ga0207667_10708850 Ga0207667_107088501 199
501 3300025961 Ga0207712_10592788 Ga0207712_105927881 199
502 3300025972 Ga0207668_10110094 Ga0207668_101100942 199
503 3300026041 Ga0207639_10041161 Ga0207639_100411613 199
504 3300026067 Ga0207678_10198446 Ga0207678_101984462 199
505 3300026078 Ga0207702_10552873 Ga0207702_105528731 199
506 3300026089 Ga0207648_10010726 Ga0207648_100107268 199
507 3300026089 Ga0207648_10787138 Ga0207648_107871381 199
508 3300026116 Ga0207674_10092698 Ga0207674_100926982 199
509 3300026116 Ga0207674_10342575 Ga0207674_103425752 199
510 3300026121 Ga0207683_10110225 Ga0207683_101102252 199
511 3300026142 Ga0207698_10059039 Ga0207698_100590392 199
512 3300027296 Ga0209389_1001313 Ga0209389_100131316 199
513 3300027296 Ga0209389_1001336 Ga0209389_100133616 199
514 3300027357 Ga0209589_1004535 Ga0209589_10045353 199
515 3300027361 Ga0209489_100050 Ga0209489_100050145 199
516 3300027361 Ga0209489_104795 Ga0209489_10479519 199
517 3300027363 Ga0209700_100016 Ga0209700_100016253 199
518 3300027866 Ga0209813_10043201 Ga0209813_100432012 199
519 3300028379 Ga0268266_10581825 Ga0268266_105818252 199
520 3300031239 Ga0265328_10000055 Ga0265328_1000005567 199
521 3300031239 Ga0265328_10038546 Ga0265328_100385462 199
522 3300031548 Ga0307408_100870530 Ga0307408_1008705301 199
523 3300031595 Ga0265313_10171333 Ga0265313_101713331 199
524 3300033180 Ga0307510_10052759 Ga0307510_100527593 199
525 3300033180 Ga0307510_10240950 Ga0307510_102409501 199
526 3300037312 Ga0395899_0426396 Ga0395899_0426396_76_675 199
527 3300037418 Ga0395900_0001409 Ga0395900_0001409_7858_8457 199
528 3300037466 Ga0395898_0016001 Ga0395898_0016001_4734_5333 199
529 3300037466 Ga0395898_0450917 Ga0395898_0450917_499_1098 199
530 3300037466 Ga0395898_0847546 Ga0395898_0847546_203_802 199
531 3300037471 Ga0395905_0022704 Ga0395905_0022704_3290_3889 199
532 3300037471 Ga0395905_0209687 Ga0395905_0209687_702_1301 199
533 3300037853 Ga0436364_1290753 Ga0436364_1290753_1065_1667 199
534 3300038443 Ga0395901_0118315 Ga0395901_0118315_268_867 199
535 3300039437 Ga0436365_0718616 Ga0436365_0718616_3054_3653 199
536 3300039450 Ga0436363_0057188 Ga0436363_0057188_376_975 199
537 3300041456 Ga0451795_1269232 Ga0451795_1269232_36_635 199
538 3300041459 Ga0451800_1245814 Ga0451800_1245814_171_770 199
539 3300041491 Ga0451833_1413762 Ga0451833_1413762_113_712 199
540 3300041492 Ga0451835_0009829 Ga0451835_0009829_151_750 199
541 3300041498 Ga0451841_0980059 Ga0451841_0980059_55_654 199
542 3300041507 Ga0451851_0421058 Ga0451851_0421058_67_666 199
543 3300041511 Ga0451855_1803437 Ga0451855_1803437_101_700 199
544 3300042012 Ga0439455_0076042 Ga0439455_0076042_105_704 199
545 3300044658 Ga0466972_0002296 Ga0466972_0002296_6439_7038 199
546 3300044658 Ga0466972_0002508 Ga0466972_0002508_6632_7231 199
547 3300044683 Ga0466965_0040508 Ga0466965_0040508_1136_1735 199
548 3300044683 Ga0466965_0188537 Ga0466965_0188537_349_948 199
549 3300044684 Ga0466966_0001161 Ga0466966_0001161_14767_15366 199
550 3300044693 Ga0466961_0000122 Ga0466961_0000122_22899_23498 199
551 3300044693 Ga0466961_0109605 Ga0466961_0109605_264_863 199
552 3300044693 Ga0466961_0117507 Ga0466961_0117507_907_1527 199
553 3300044693 Ga0466961_0132983 Ga0466961_0132983_205_804 199
554 3300044694 Ga0466963_0141905 Ga0466963_0141905_332_931 199
555 3300044706 Ga0466964_0100364 Ga0466964_0100364_212_811 199
556 3300044719 Ga0466971_0328087 Ga0466971_0328087_19_618 199
557 3300044735 Ga0466968_0075537 Ga0466968_0075537_429_1028 199
558 3300044735 Ga0466968_0256153 Ga0466968_0256153_11_610 199
559 3300044765 Ga0466970_0254556 Ga0466970_0254556_75_674 199
560 3300044842 Ga0466957_0033326 Ga0466957_0033326_1001_1600 199
561 3300044901 Ga0466960_0164191 Ga0466960_0164191_214_813 199
562 3300045049 Ga0466959_0031376 Ga0466959_0031376_846_1445 199
563 3300045976 Ga0466967_0007117 Ga0466967_0007117_5939_6538 199
564 3300045976 Ga0466967_0051636 Ga0466967_0051636_2891_3490 199
565 3300046452 Ga0495617_096590 Ga0495617_096590_35_634 199
566 3300046454 Ga0495592_0100066 Ga0495592_0100066_230_829 199
567 3300046460 Ga0495638_0013901 Ga0495638_0013901_4019_4618 199
568 3300046462 Ga0495651_0102783 Ga0495651_0102783_780_1379 199
569 3300046473 Ga0495582_0255736 Ga0495582_0255736_85_684 199
570 3300046477 Ga0495664_0028238 Ga0495664_0028238_1678_2277 199
571 3300046506 Ga0495583_0066842 Ga0495583_0066842_590_1189 199
572 3300046507 Ga0495606_0001165 Ga0495606_0001165_27486_28085 199
573 3300046507 Ga0495606_0057024 Ga0495606_0057024_677_1276 199
574 3300046511 Ga0495608_0127357 Ga0495608_0127357_978_1577 199
575 3300046512 Ga0495610_0101016 Ga0495610_0101016_142_741 199
576 3300046514 Ga0495618_0180921 Ga0495618_0180921_423_1022 199
577 3300046515 Ga0495620_0074997 Ga0495620_0074997_286_885 199
578 3300046517 Ga0495630_0172807 Ga0495630_0172807_373_972 199
579 3300046522 Ga0495643_0006526 Ga0495643_0006526_2136_2735 199
580 3300046522 Ga0495643_0077701 Ga0495643_0077701_873_1472 199
581 3300046524 Ga0495648_0001607 Ga0495648_0001607_301_900 199
582 3300046524 Ga0495648_0120840 Ga0495648_0120840_623_1222 199
583 3300046529 Ga0495652_0080914 Ga0495652_0080914_148_747 199
584 3300046535 Ga0495586_0452994 Ga0495586_0452994_47_646 199
585 3300046536 Ga0495587_0071501 Ga0495587_0071501_370_969 199
586 3300046538 Ga0495609_0076111 Ga0495609_0076111_433_1032 199
587 3300046542 Ga0495597_0072882 Ga0495597_0072882_567_1166 199
588 3300046543 Ga0495645_0097937 Ga0495645_0097937_400_999 199
589 3300046557 Ga0495622_0202431 Ga0495622_0202431_162_761 199
590 3300046616 Ga0495668_0266383 Ga0495668_0266383_149_748 199
591 3300046642 Ga0495634_0160568 Ga0495634_0160568_709_1308 199
592 3300046642 Ga0495634_0207835 Ga0495634_0207835_71_670 199
593 3300046665 Ga0495661_0216994 Ga0495661_0216994_170_769 199
594 3300046674 Ga0495588_0071367 Ga0495588_0071367_560_1159 199
595 3300046675 Ga0495657_0073411 Ga0495657_0073411_565_1164 199
596 3300046678 Ga0495599_0057760 Ga0495599_0057760_1161_1760 199
597 3300046679 Ga0495623_0109486 Ga0495623_0109486_417_1016 199
598 3300046680 Ga0495646_0112490 Ga0495646_0112490_737_1336 199
599 3300046680 Ga0495646_0201686 Ga0495646_0201686_314_913 199
600 3300046684 Ga0495669_0155461 Ga0495669_0155461_400_999 199
601 3300046689 Ga0495613_0068687 Ga0495613_0068687_1930_2529 199
602 3300046694 Ga0495649_0058471 Ga0495649_0058471_1330_1929 199
603 3300046794 Ga0495589_0081267 Ga0495589_0081267_587_1186 199
604 3300046809 Ga0495600_0011987 Ga0495600_0011987_2569_3168 199
605 3300046809 Ga0495600_0502733 Ga0495600_0502733_38_637 199
606 3300047315 Ga0495581_0136915 Ga0495581_0136915_728_1327 199
607 3300047317 Ga0495604_0093657 Ga0495604_0093657_1507_2106 199
608 3300047317 Ga0495604_0333366 Ga0495604_0333366_399_998 199
609 3300047319 Ga0495674_0018772 Ga0495674_0018772_4349_4948 199
610 3300047320 Ga0495672_0033034 Ga0495672_0033034_1380_1979 199
611 3300047322 Ga0495680_0059483 Ga0495680_0059483_71_670 199
612 3300047323 Ga0495683_0268783 Ga0495683_0268783_28_627 199
613 3300047443 Ga0495687_006361 Ga0495687_006361_4253_4852 199
614 3300047444 Ga0495675_0239919 Ga0495675_0239919_145_744 199
615 3300047471 Ga0495684_0174848 Ga0495684_0174848_77_676 199
616 3300047673 Ga0495593_0225388 Ga0495593_0225388_108_707 199
617 3300048088 Ga0495602_0024322 Ga0495602_0024322_1888_2487 199
618 3300048091 Ga0495626_0078552 Ga0495626_0078552_468_1067 199
619 3300048904 Ga0496101_0463384 Ga0496101_0463384_80_679 199
620 3300048904 Ga0496101_0548522 Ga0496101_0548522_64_663 199
621 3300048905 Ga0496102_0510705 Ga0496102_0510705_443_1042 199
622 3300048905 Ga0496102_0658222 Ga0496102_0658222_290_889 199
623 3300048905 Ga0496102_0676882 Ga0496102_0676882_346_945 199
624 3300048905 Ga0496102_0712275 Ga0496102_0712275_129_728 199
625 3300048906 Ga0496103_0109410 Ga0496103_0109410_1033_1632 199
626 3300048907 Ga0496104_0024223 Ga0496104_0024223_3217_3816 199
627 3300048907 Ga0496104_1017755 Ga0496104_1017755_82_681 199
628 3300048908 Ga0496105_0036501 Ga0496105_0036501_2833_3432 199
629 3300048909 Ga0496106_0060391 Ga0496106_0060391_405_1004 199
630 3300048913 Ga0496110_0470706 Ga0496110_0470706_461_1060 199
631 3300048914 Ga0496111_0470712 Ga0496111_0470712_314_913 199
632 3300048915 Ga0496112_0144824 Ga0496112_0144824_483_1082 199
633 3300048915 Ga0496112_0325415 Ga0496112_0325415_750_1349 199
634 3300048916 Ga0496113_0110315 Ga0496113_0110315_336_935 199
635 3300048916 Ga0496113_0523193 Ga0496113_0523193_117_716 199
636 3300048917 Ga0496114_0166482 Ga0496114_0166482_189_788 199
637 3300048921 Ga0496118_0248905 Ga0496118_0248905_90_689 199
638 3300048922 Ga0496119_0017486 Ga0496119_0017486_3965_4564 199
639 3300048923 Ga0496120_0032833 Ga0496120_0032833_129_728 199
640 3300048923 Ga0496120_0076945 Ga0496120_0076945_529_1128 199
641 3300048924 Ga0496121_0021799 Ga0496121_0021799_5412_6011 199
642 3300048924 Ga0496121_0046842 Ga0496121_0046842_3046_3648 199
643 3300048924 Ga0496121_0200920 Ga0496121_0200920_26_625 199
644 3300048925 Ga0496122_0362827 Ga0496122_0362827_134_733 199
645 3300048926 Ga0496123_0119933 Ga0496123_0119933_229_831 199
646 3300048929 Ga0496126_0103744 Ga0496126_0103744_88_687 199
647 3300048929 Ga0496126_0162968 Ga0496126_0162968_47_646 199
648 3300048929 Ga0496126_0259698 Ga0496126_0259698_265_864 199
649 3300049460 Ga0495682_0064517 Ga0495682_0064517_578_1177 199
650 3300049460 Ga0495682_0079238 Ga0495682_0079238_21_620 199
651 3300050489 nmdc:mga03683_221296_c1 nmdc:mga03683_221296_c1_103_702 199
652 3300050489 nmdc:mga03683_31688_c2 nmdc:mga03683_31688_c2_64_663 199
653 3300050491 nmdc:mga00v17_197769_c1 nmdc:mga00v17_197769_c1_424_1023 199
654 3300050492 nmdc:mga0yw44_206148_c1 nmdc:mga0yw44_206148_c1_164_763 199
655 3300050492 nmdc:mga0yw44_653483_c1 nmdc:mga0yw44_653483_c1_51_653 199
656 3300050493 nmdc:mga0k408_179750_c1 nmdc:mga0k408_179750_c1_156_755 199
657 3300050493 nmdc:mga0k408_73021_c1 nmdc:mga0k408_73021_c1_425_1024 199
658 3300050495 nmdc:mga04h51_51193_c1 nmdc:mga04h51_51193_c1_478_1077 199
659 3300050496 nmdc:mga07m45_113399_c1 nmdc:mga07m45_113399_c1_233_832 199
660 3300050496 nmdc:mga07m45_114194_c1 nmdc:mga07m45_114194_c1_561_1160 199
661 3300050496 nmdc:mga07m45_25255_c1 nmdc:mga07m45_25255_c1_1004_1603 199
662 3300050512 nmdc:mga0n895_659535_c1 nmdc:mga0n895_659535_c1_390_989 199
663 3300050516 nmdc:mga0sz30_124765_c1 nmdc:mga0sz30_124765_c1_478_1077 199
664 3300050516 nmdc:mga0sz30_12648_c1 nmdc:mga0sz30_12648_c1_485_1084 199
665 3300053080 Ga0500635_0105523 Ga0500635_0105523_152_751 199
666 3300053085 Ga0495619_0209198 Ga0495619_0209198_193_792 199
667 3300053086 Ga0500578_0080223 Ga0500578_0080223_1382_1981 199
668 3300053086 Ga0500578_0222128 Ga0500578_0222128_307_906 199
669 3300053087 Ga0500643_000042 Ga0500643_000042_135365_135964 199
670 3300053091 Ga0500647_0043524 Ga0500647_0043524_1538_2137 199
671 3300053092 Ga0500583_0059693 Ga0500583_0059693_1078_1677 199
672 3300053093 Ga0500651_0194250 Ga0500651_0194250_104_703 199
673 3300053094 Ga0500566_0000264 Ga0500566_0000264_9290_9889 199
674 3300053095 Ga0500640_127660 Ga0500640_127660_116_715 199
675 3300053096 Ga0500641_0090325 Ga0500641_0090325_623_1222 199
676 3300053103 Ga0500555_048190 Ga0500555_048190_80_679 199
677 3300053104 Ga0500556_0115124 Ga0500556_0115124_132_731 199
678 3300053105 Ga0500557_000006 Ga0500557_000006_20650_21249 199
679 3300053109 Ga0500569_060197 Ga0500569_060197_100_699 199
680 3300053119 Ga0500595_101390 Ga0500595_101390_28_627 199
681 3300053121 Ga0500607_049421 Ga0500607_049421_555_1154 199
682 3300053122 Ga0500608_092484 Ga0500608_092484_79_678 199
683 3300053130 Ga0500642_0000068 Ga0500642_0000068_8297_8896 199
684 3300053130 Ga0500642_0077068 Ga0500642_0077068_281_880 199
685 3300053134 Ga0500658_0087456 Ga0500658_0087456_653_1252 199
686 3300053136 Ga0500559_0041811 Ga0500559_0041811_884_1483 199
687 3300053136 Ga0500559_0101422 Ga0500559_0101422_103_702 199
688 3300053138 Ga0500564_042947 Ga0500564_042947_1133_1732 199
689 3300053139 Ga0500568_0007584 Ga0500568_0007584_4669_5268 199
690 3300053143 Ga0500579_134954 Ga0500579_134954_236_835 199
691 3300053145 Ga0500586_000095 Ga0500586_000095_8890_9489 199
692 3300053148 Ga0500590_025218 Ga0500590_025218_1091_1690 199
693 3300053155 Ga0500620_006327 Ga0500620_006327_711_1310 199
694 3300053156 Ga0500622_0026006 Ga0500622_0026006_1683_2282 199
695 3300053158 Ga0500627_0168806 Ga0500627_0168806_84_683 199
696 3300053160 Ga0500633_0038617 Ga0500633_0038617_149_748 199
697 3300053162 Ga0500638_048030 Ga0500638_048030_733_1332 199
698 3300053163 Ga0500639_194307 Ga0500639_194307_217_816 199
699 3300053177 Ga0500636_0007750 Ga0500636_0007750_3594_4193 199
700 3300053722 Ga0500649_085632 Ga0500649_085632_504_1103 199
701 3300053725 Ga0500576_163874 Ga0500576_163874_101_700 199
702 3300053729 Ga0500625_011281 Ga0500625_011281_2507_3106 199
703 3300053730 Ga0500645_068952 Ga0500645_068952_365_964 199
704 3300053731 Ga0500609_006564 Ga0500609_006564_91_690 199
705 3300005327 Ga0070658_10395391 Ga0070658_103953911 200
706 3300005354 Ga0070675_100927245 Ga0070675_1009272451 200
707 3300005356 Ga0070674_100798562 Ga0070674_1007985621 200
708 3300005366 Ga0070659_100501538 Ga0070659_1005015382 200
709 3300005367 Ga0070667_100549321 Ga0070667_1005493211 200
710 3300005440 Ga0070705_100206883 Ga0070705_1002068832 200
711 3300005445 Ga0070708_100522450 Ga0070708_1005224501 200
712 3300005455 Ga0070663_100225602 Ga0070663_1002256021 200
713 3300005456 Ga0070678_100282665 Ga0070678_1002826652 200
714 3300005468 Ga0070707_100121925 Ga0070707_1001219253 200
715 3300005614 Ga0068856_100000217 Ga0068856_10000021719 200
716 3300005718 Ga0068866_10057212 Ga0068866_100572122 200
717 3300005840 Ga0068870_10497570 Ga0068870_104975702 200
718 3300005842 Ga0068858_100441351 Ga0068858_1004413512 200
719 3300005983 Ga0081540_1012457 Ga0081540_10124575 200
720 3300006038 Ga0075365_10137806 Ga0075365_101378063 200
721 3300006048 Ga0075363_100073623 Ga0075363_1000736232 200
722 3300006048 Ga0075363_100180615 Ga0075363_1001806151 200
723 3300006178 Ga0075367_10030061 Ga0075367_100300612 200
724 3300006844 Ga0075428_100652061 Ga0075428_1006520612 200
725 3300006871 Ga0075434_100093534 Ga0075434_1000935344 200
726 3300006881 Ga0068865_100004347 Ga0068865_1000043479 200
727 3300007788 Ga0099795_10150480 Ga0099795_101504802 200
728 3300009094 Ga0111539_10997827 Ga0111539_109978271 200
729 3300009098 Ga0105245_10282136 Ga0105245_102821362 200
730 3300009148 Ga0105243_11399399 Ga0105243_113993991 200
731 3300010159 Ga0099796_10226005 Ga0099796_102260052 200
732 3300013308 Ga0157375_11359337 Ga0157375_113593371 200
733 3300014326 Ga0157380_10054606 Ga0157380_100546061 200
734 3300014969 Ga0157376_10460283 Ga0157376_104602832 200
735 3300025315 Ga0207697_10090967 Ga0207697_100909672 200
736 3300025901 Ga0207688_10066881 Ga0207688_100668812 200
737 3300025901 Ga0207688_10544015 Ga0207688_105440151 200
738 3300025908 Ga0207643_10314459 Ga0207643_103144592 200
739 3300025913 Ga0207695_10321131 Ga0207695_103211311 200
740 3300025915 Ga0207693_10387227 Ga0207693_103872271 200
741 3300025922 Ga0207646_10034318 Ga0207646_100343182 200
742 3300025923 Ga0207681_10082915 Ga0207681_100829152 200
743 3300025937 Ga0207669_11020477 Ga0207669_110204771 200
744 3300025940 Ga0207691_10577453 Ga0207691_105774532 200
745 3300025949 Ga0207667_10332090 Ga0207667_103320901 200
746 3300025960 Ga0207651_10140997 Ga0207651_101409972 200
747 3300025981 Ga0207640_10050789 Ga0207640_100507891 200
748 3300026035 Ga0207703_10782073 Ga0207703_107820732 200
749 3300026067 Ga0207678_10094920 Ga0207678_100949202 200
750 3300026078 Ga0207702_10004131 Ga0207702_100041312 200
751 3300027907 Ga0207428_10137746 Ga0207428_101377462 200
752 3300031616 Ga0307508_10081178 Ga0307508_100811782 200
753 3300031711 Ga0265314_10030942 Ga0265314_100309425 200
754 3300031730 Ga0307516_10012479 Ga0307516_100124796 200
755 3300035086 Ga0373934_0022147 Ga0373934_0022147_629_1231 200
756 3300035117 Ga0373953_0085182 Ga0373953_0085182_241_843 200
757 3300035118 Ga0373954_0007143 Ga0373954_0007143_1392_1994 200
758 3300035119 Ga0373956_0019483 Ga0373956_0019483_311_913 200
759 3300035692 Ga0373935_0364244 Ga0373935_0364244_49_651 200
760 3300035724 Ga0373933_0056075 Ga0373933_0056075_1573_2175 200
761 3300036401 Ga0373937_0242409 Ga0373937_0242409_504_1106 200
762 3300046455 Ga0495603_0083545 Ga0495603_0083545_56_658 200
763 3300046462 Ga0495651_0018521 Ga0495651_0018521_1808_2410 200
764 3300046475 Ga0495639_0020088 Ga0495639_0020088_2127_2729 200
765 3300046507 Ga0495606_0160737 Ga0495606_0160737_244_846 200
766 3300046514 Ga0495618_0027782 Ga0495618_0027782_58_660 200
767 3300046518 Ga0495631_0192977 Ga0495631_0192977_220_825 200
768 3300046522 Ga0495643_0166971 Ga0495643_0166971_296_898 200
769 3300046529 Ga0495652_0029642 Ga0495652_0029642_435_1037 200
770 3300046533 Ga0495640_0048913 Ga0495640_0048913_2155_2757 200
771 3300046535 Ga0495586_0145771 Ga0495586_0145771_509_1111 200
772 3300046535 Ga0495586_0182301 Ga0495586_0182301_240_845 200
773 3300046536 Ga0495587_0005400 Ga0495587_0005400_4204_4806 200
774 3300046543 Ga0495645_0013919 Ga0495645_0013919_444_1046 200
775 3300046559 Ga0495667_0006655 Ga0495667_0006655_5822_6424 200
776 3300046616 Ga0495668_0032483 Ga0495668_0032483_1757_2359 200
777 3300046642 Ga0495634_0020585 Ga0495634_0020585_3272_3874 200
778 3300046675 Ga0495657_0009904 Ga0495657_0009904_1223_1825 200
779 3300046679 Ga0495623_0008151 Ga0495623_0008151_4838_5440 200
780 3300046680 Ga0495646_0012636 Ga0495646_0012636_4526_5128 200
781 3300046809 Ga0495600_0007519 Ga0495600_0007519_2814_3416 200
782 3300046809 Ga0495600_0104558 Ga0495600_0104558_15_629 200
783 3300047317 Ga0495604_0015618 Ga0495604_0015618_5041_5643 200
784 3300047319 Ga0495674_0007311 Ga0495674_0007311_4606_5208 200
785 3300047319 Ga0495674_0492951 Ga0495674_0492951_12_626 200
786 3300047320 Ga0495672_0058738 Ga0495672_0058738_1456_2058 200
787 3300047444 Ga0495675_0009301 Ga0495675_0009301_2259_2861 200
788 3300047447 Ga0495685_136405 Ga0495685_136405_99_701 200
789 3300047471 Ga0495684_0007463 Ga0495684_0007463_4140_4742 200
790 3300048088 Ga0495602_0020065 Ga0495602_0020065_1680_2282 200
791 3300048905 Ga0496102_0303152 Ga0496102_0303152_712_1326 200
792 3300048905 Ga0496102_0581536 Ga0496102_0581536_213_815 200
793 3300048911 Ga0496108_0273262 Ga0496108_0273262_490_1104 200
794 3300048914 Ga0496111_0576079 Ga0496111_0576079_112_714 200
795 3300048915 Ga0496112_0000092 Ga0496112_0000092_32169_32771 200
796 3300048916 Ga0496113_0473984 Ga0496113_0473984_212_814 200
797 3300048917 Ga0496114_0105449 Ga0496114_0105449_974_1588 200
798 3300048922 Ga0496119_0036093 Ga0496119_0036093_296_898 200
799 3300048929 Ga0496126_0035540 Ga0496126_0035540_788_1396 200
800 3300050494 nmdc:mga06z11_61537_c1 nmdc:mga06z11_61537_c1_961_1563 200
801 3300050511 nmdc:mga08y16_884119_c1 nmdc:mga08y16_884119_c1_132_734 200
802 3300050512 nmdc:mga0n895_29483_c1 nmdc:mga0n895_29483_c1_130_732 200
803 3300053077 Ga0495601_0069652 Ga0495601_0069652_706_1308 200
804 3300053078 Ga0495612_0003490 Ga0495612_0003490_1525_2127 200
805 3300053084 Ga0495595_0122241 Ga0495595_0122241_504_1106 200
806 3300053085 Ga0495619_0147365 Ga0495619_0147365_823_1437 200
807 3300053139 Ga0500568_0171546 Ga0500568_0171546_126_728 200
808 3300053163 Ga0500639_178363 Ga0500639_178363_101_703 200
809 iso_pu_bacteria 8002060224 8002062311 200
810 3300001979 JGI24740J21852_10014946 JGI24740J21852_100149462 201
811 3300001990 JGI24737J22298_10020398 JGI24737J22298_100203982 201
812 3300003203 JGI25406J46586_10000042 JGI25406J46586_1000004246 201
813 3300003215 JGI25153J46596_10087656 JGI25153J46596_100876561 201
814 3300003659 JGI25404J52841_10006334 JGI25404J52841_100063342 201
815 3300003659 JGI25404J52841_10034536 JGI25404J52841_100345362 201
816 3300003659 JGI25404J52841_10041845 JGI25404J52841_100418451 201
817 3300003752 Ga0055539_1001331 Ga0055539_10013316 201
818 3300005295 Ga0065707_10038970 Ga0065707_100389701 201
819 3300005327 Ga0070658_10135114 Ga0070658_101351142 201
820 3300005328 Ga0070676_10154307 Ga0070676_101543072 201
821 3300005329 Ga0070683_100109347 Ga0070683_1001093471 201
822 3300005334 Ga0068869_100066490 Ga0068869_1000664902 201
823 3300005334 Ga0068869_100068209 Ga0068869_1000682093 201
824 3300005334 Ga0068869_100112284 Ga0068869_1001122842 201
825 3300005336 Ga0070680_100088958 Ga0070680_1000889582 201
826 3300005337 Ga0070682_100163478 Ga0070682_1001634782 201
827 3300005338 Ga0068868_100058744 Ga0068868_1000587442 201
828 3300005339 Ga0070660_100030069 Ga0070660_1000300691 201
829 3300005340 Ga0070689_100701727 Ga0070689_1007017271 201
830 3300005344 Ga0070661_100035244 Ga0070661_1000352441 201
831 3300005344 Ga0070661_100149211 Ga0070661_1001492112 201
832 3300005347 Ga0070668_100370558 Ga0070668_1003705582 201
833 3300005347 Ga0070668_100664503 Ga0070668_1006645031 201
834 3300005347 Ga0070668_100944900 Ga0070668_1009449001 201
835 3300005355 Ga0070671_100283396 Ga0070671_1002833962 201
836 3300005355 Ga0070671_100470937 Ga0070671_1004709371 201
837 3300005355 Ga0070671_101282978 Ga0070671_1012829781 201
838 3300005356 Ga0070674_100064690 Ga0070674_1000646902 201
839 3300005356 Ga0070674_100688739 Ga0070674_1006887391 201
840 3300005366 Ga0070659_100745771 Ga0070659_1007457711 201
841 3300005367 Ga0070667_100303983 Ga0070667_1003039832 201
842 3300005434 Ga0070709_10000380 Ga0070709_100003802 201
843 3300005434 Ga0070709_10004357 Ga0070709_100043575 201
844 3300005434 Ga0070709_10011774 Ga0070709_100117743 201
845 3300005434 Ga0070709_10202467 Ga0070709_102024672 201
846 3300005434 Ga0070709_10394478 Ga0070709_103944782 201
847 3300005434 Ga0070709_10771121 Ga0070709_107711211 201
848 3300005435 Ga0070714_100011779 Ga0070714_1000117794 201
849 3300005435 Ga0070714_100043286 Ga0070714_1000432862 201
850 3300005435 Ga0070714_100051414 Ga0070714_1000514142 201
851 3300005435 Ga0070714_100572839 Ga0070714_1005728392 201
852 3300005435 Ga0070714_101053565 Ga0070714_1010535651 201
853 3300005436 Ga0070713_100002836 Ga0070713_1000028363 201
854 3300005436 Ga0070713_100004693 Ga0070713_1000046932 201
855 3300005436 Ga0070713_100028325 Ga0070713_1000283253 201
856 3300005436 Ga0070713_100036343 Ga0070713_1000363434 201
857 3300005436 Ga0070713_100200837 Ga0070713_1002008372 201
858 3300005436 Ga0070713_100209153 Ga0070713_1002091532 201
859 3300005437 Ga0070710_10000933 Ga0070710_100009332 201
860 3300005437 Ga0070710_10001211 Ga0070710_100012112 201
861 3300005439 Ga0070711_100004399 Ga0070711_1000043995 201
862 3300005439 Ga0070711_100007412 Ga0070711_1000074123 201
863 3300005439 Ga0070711_100009990 Ga0070711_1000099905 201
864 3300005439 Ga0070711_100222809 Ga0070711_1002228092 201
865 3300005439 Ga0070711_100455851 Ga0070711_1004558512 201
866 3300005439 Ga0070711_100540110 Ga0070711_1005401101 201
867 3300005441 Ga0070700_100071377 Ga0070700_1000713772 201
868 3300005444 Ga0070694_100257396 Ga0070694_1002573961 201
869 3300005455 Ga0070663_100089893 Ga0070663_1000898932 201
870 3300005455 Ga0070663_100123601 Ga0070663_1001236012 201
871 3300005455 Ga0070663_100341193 Ga0070663_1003411932 201
872 3300005455 Ga0070663_100372050 Ga0070663_1003720501 201
873 3300005456 Ga0070678_100181322 Ga0070678_1001813223 201
874 3300005456 Ga0070678_100303358 Ga0070678_1003033581 201
875 3300005457 Ga0070662_100057253 Ga0070662_1000572532 201
876 3300005457 Ga0070662_100097475 Ga0070662_1000974752 201
877 3300005458 Ga0070681_10188605 Ga0070681_101886052 201
878 3300005458 Ga0070681_10435840 Ga0070681_104358402 201
879 3300005467 Ga0070706_100131890 Ga0070706_1001318902 201
880 3300005468 Ga0070707_100674806 Ga0070707_1006748062 201
881 3300005471 Ga0070698_100896333 Ga0070698_1008963332 201
882 3300005518 Ga0070699_100068026 Ga0070699_1000680262 201
883 3300005530 Ga0070679_100020904 Ga0070679_1000209046 201
884 3300005530 Ga0070679_100223109 Ga0070679_1002231092 201
885 3300005530 Ga0070679_100466946 Ga0070679_1004669462 201
886 3300005535 Ga0070684_100030973 Ga0070684_1000309733 201
887 3300005536 Ga0070697_101055700 Ga0070697_1010557001 201
888 3300005539 Ga0068853_100025492 Ga0068853_1000254922 201
889 3300005539 Ga0068853_100043569 Ga0068853_1000435692 201
890 3300005539 Ga0068853_100081244 Ga0068853_1000812444 201
891 3300005539 Ga0068853_100308800 Ga0068853_1003088002 201
892 3300005539 Ga0068853_100866771 Ga0068853_1008667712 201
893 3300005543 Ga0070672_100875699 Ga0070672_1008756992 201
894 3300005545 Ga0070695_100181288 Ga0070695_1001812882 201
895 3300005546 Ga0070696_100217077 Ga0070696_1002170772 201
896 3300005547 Ga0070693_100042510 Ga0070693_1000425103 201
897 3300005547 Ga0070693_100099385 Ga0070693_1000993852 201
898 3300005548 Ga0070665_100030244 Ga0070665_1000302442 201
899 3300005548 Ga0070665_100038083 Ga0070665_1000380834 201
900 3300005548 Ga0070665_100144019 Ga0070665_1001440192 201
901 3300005548 Ga0070665_100250045 Ga0070665_1002500452 201
902 3300005548 Ga0070665_100326616 Ga0070665_1003266162 201
903 3300005548 Ga0070665_100393302 Ga0070665_1003933022 201
904 3300005548 Ga0070665_100844626 Ga0070665_1008446262 201
905 3300005549 Ga0070704_100808971 Ga0070704_1008089712 201
906 3300005563 Ga0068855_100027933 Ga0068855_1000279332 201
907 3300005563 Ga0068855_100049446 Ga0068855_1000494462 201
908 3300005563 Ga0068855_100068968 Ga0068855_1000689682 201
909 3300005563 Ga0068855_100186192 Ga0068855_1001861923 201
910 3300005563 Ga0068855_100398121 Ga0068855_1003981212 201
911 3300005564 Ga0070664_100288344 Ga0070664_1002883441 201
912 3300005577 Ga0068857_100010524 Ga0068857_1000105243 201
913 3300005577 Ga0068857_100084190 Ga0068857_1000841903 201
914 3300005577 Ga0068857_100095363 Ga0068857_1000953632 201
915 3300005577 Ga0068857_100134916 Ga0068857_1001349162 201
916 3300005577 Ga0068857_100173848 Ga0068857_1001738482 201
917 3300005578 Ga0068854_100144658 Ga0068854_1001446582 201
918 3300005578 Ga0068854_100184670 Ga0068854_1001846702 201
919 3300005578 Ga0068854_100324336 Ga0068854_1003243362 201
920 3300005614 Ga0068856_100003953 Ga0068856_1000039532 201
921 3300005614 Ga0068856_100033390 Ga0068856_1000333904 201
922 3300005614 Ga0068856_100607455 Ga0068856_1006074552 201
923 3300005616 Ga0068852_100032679 Ga0068852_1000326792 201
924 3300005616 Ga0068852_100118243 Ga0068852_1001182432 201
925 3300005616 Ga0068852_100875035 Ga0068852_1008750352 201
926 3300005617 Ga0068859_100026003 Ga0068859_1000260032 201
927 3300005617 Ga0068859_100068312 Ga0068859_1000683122 201
928 3300005617 Ga0068859_100272587 Ga0068859_1002725872 201
929 3300005617 Ga0068859_100325615 Ga0068859_1003256152 201
930 3300005618 Ga0068864_100118727 Ga0068864_1001187272 201
931 3300005618 Ga0068864_100771107 Ga0068864_1007711072 201
932 3300005719 Ga0068861_100079783 Ga0068861_1000797831 201
933 3300005719 Ga0068861_100139587 Ga0068861_1001395874 201
934 3300005719 Ga0068861_100320045 Ga0068861_1003200452 201
935 3300005719 Ga0068861_100668591 Ga0068861_1006685912 201
936 3300005719 Ga0068861_100880465 Ga0068861_1008804651 201
937 3300005834 Ga0068851_10089407 Ga0068851_100894072 201
938 3300005840 Ga0068870_10173473 Ga0068870_101734732 201
939 3300005841 Ga0068863_100278770 Ga0068863_1002787702 201
940 3300005841 Ga0068863_100293003 Ga0068863_1002930032 201
941 3300005841 Ga0068863_101017083 Ga0068863_1010170832 201
942 3300005842 Ga0068858_100057906 Ga0068858_1000579062 201
943 3300005842 Ga0068858_100078178 Ga0068858_1000781783 201
944 3300005842 Ga0068858_100126924 Ga0068858_1001269242 201
945 3300005842 Ga0068858_100264428 Ga0068858_1002644282 201
946 3300005842 Ga0068858_100590804 Ga0068858_1005908041 201
947 3300005843 Ga0068860_100000280 Ga0068860_10000028029 201
948 3300005843 Ga0068860_100298239 Ga0068860_1002982392 201
949 3300005843 Ga0068860_100789512 Ga0068860_1007895121 201
950 3300005844 Ga0068862_100138012 Ga0068862_1001380122 201
951 3300005844 Ga0068862_100454852 Ga0068862_1004548522 201
952 3300005937 Ga0081455_10360995 Ga0081455_103609952 201
953 3300005981 Ga0081538_10030517 Ga0081538_100305174 201
954 3300005983 Ga0081540_1000914 Ga0081540_10009146 201
955 3300005983 Ga0081540_1002541 Ga0081540_10025418 201
956 3300005983 Ga0081540_1004331 Ga0081540_10043312 201
957 3300005983 Ga0081540_1006771 Ga0081540_10067712 201
958 3300005983 Ga0081540_1011082 Ga0081540_10110823 201
959 3300005983 Ga0081540_1032224 Ga0081540_10322243 201
960 3300005983 Ga0081540_1035306 Ga0081540_10353062 201
961 3300005983 Ga0081540_1064864 Ga0081540_10648642 201
962 3300005983 Ga0081540_1107981 Ga0081540_11079812 201
963 3300005985 Ga0081539_10000099 Ga0081539_10000099183 201
964 3300005985 Ga0081539_10001660 Ga0081539_1000166021 201
965 3300005985 Ga0081539_10050340 Ga0081539_100503402 201
966 3300006028 Ga0070717_10000851 Ga0070717_1000085115 201
967 3300006028 Ga0070717_10007189 Ga0070717_100071894 201
968 3300006028 Ga0070717_10109964 Ga0070717_101099642 201
969 3300006028 Ga0070717_10218673 Ga0070717_102186731 201
970 3300006028 Ga0070717_10604749 Ga0070717_106047492 201
971 3300006038 Ga0075365_10036550 Ga0075365_100365504 201
972 3300006038 Ga0075365_10095420 Ga0075365_100954202 201
973 3300006042 Ga0075368_10018984 Ga0075368_100189842 201
974 3300006048 Ga0075363_100087120 Ga0075363_1000871202 201
975 3300006048 Ga0075363_100090134 Ga0075363_1000901342 201
976 3300006051 Ga0075364_10017356 Ga0075364_100173562 201
977 3300006051 Ga0075364_10083514 Ga0075364_100835142 201
978 3300006163 Ga0070715_10003420 Ga0070715_100034203 201
979 3300006173 Ga0070716_100006081 Ga0070716_1000060813 201
980 3300006173 Ga0070716_100022965 Ga0070716_1000229654 201
981 3300006173 Ga0070716_100189762 Ga0070716_1001897622 201
982 3300006173 Ga0070716_100347908 Ga0070716_1003479081 201
983 3300006175 Ga0070712_100077589 Ga0070712_1000775892 201
984 3300006175 Ga0070712_100956264 Ga0070712_1009562641 201
985 3300006178 Ga0075367_10040767 Ga0075367_100407672 201
986 3300006178 Ga0075367_10151055 Ga0075367_101510552 201
987 3300006178 Ga0075367_10172004 Ga0075367_101720042 201
988 3300006186 Ga0075369_10018979 Ga0075369_100189793 201
989 3300006186 Ga0075369_10021022 Ga0075369_100210223 201
990 3300006195 Ga0075366_10069831 Ga0075366_100698312 201
991 3300006195 Ga0075366_10081157 Ga0075366_100811572 201
992 3300006195 Ga0075366_10135136 Ga0075366_101351361 201
993 3300006195 Ga0075366_10169494 Ga0075366_101694942 201
994 3300006195 Ga0075366_10181274 Ga0075366_101812742 201
995 3300006195 Ga0075366_10278812 Ga0075366_102788121 201
996 3300006237 Ga0097621_100999238 Ga0097621_1009992381 201
997 3300006353 Ga0075370_10077347 Ga0075370_100773472 201
998 3300006353 Ga0075370_10255625 Ga0075370_102556251 201
999 3300006353 Ga0075370_10381482 Ga0075370_103814821 201
1000 3300006358 Ga0068871_100121740 Ga0068871_1001217402 201
1001 3300006358 Ga0068871_100245021 Ga0068871_1002450212 201
1002 3300006358 Ga0068871_100621906 Ga0068871_1006219062 201
1003 3300006847 Ga0075431_100665681 Ga0075431_1006656811 201
1004 3300006871 Ga0075434_100130919 Ga0075434_1001309192 201
1005 3300006871 Ga0075434_100249421 Ga0075434_1002494212 201
1006 3300006881 Ga0068865_100150935 Ga0068865_1001509353 201
1007 3300006881 Ga0068865_100404314 Ga0068865_1004043142 201
1008 3300006914 Ga0075436_100102897 Ga0075436_1001028973 201
1009 3300006931 Ga0097620_100026006 Ga0097620_1000260062 201
1010 3300006931 Ga0097620_100068312 Ga0097620_1000683124 201
1011 3300006931 Ga0097620_100272574 Ga0097620_1002725742 201
1012 3300006931 Ga0097620_100325598 Ga0097620_1003255982 201
1013 3300006942 Ga0099824_1030197 Ga0099824_10301971 201
1014 3300006943 Ga0099822_1011366 Ga0099822_10113664 201
1015 3300007076 Ga0075435_100649584 Ga0075435_1006495842 201
1016 3300007265 Ga0099794_10053926 Ga0099794_100539262 201
1017 3300007265 Ga0099794_10134058 Ga0099794_101340582 201
1018 3300007265 Ga0099794_10213087 Ga0099794_102130871 201
1019 3300007788 Ga0099795_10011772 Ga0099795_100117724 201
1020 3300007788 Ga0099795_10018762 Ga0099795_100187622 201
1021 3300009036 Ga0105244_10130491 Ga0105244_101304912 201
1022 3300009092 Ga0105250_10038359 Ga0105250_100383592 201
1023 3300009092 Ga0105250_10186600 Ga0105250_101866001 201
1024 3300009093 Ga0105240_10005613 Ga0105240_1000561310 201
1025 3300009093 Ga0105240_10093752 Ga0105240_100937522 201
1026 3300009093 Ga0105240_10183196 Ga0105240_101831962 201
1027 3300009093 Ga0105240_10261289 Ga0105240_102612892 201
1028 3300009094 Ga0111539_10405041 Ga0111539_104050412 201
1029 3300009098 Ga0105245_10143282 Ga0105245_101432823 201
1030 3300009098 Ga0105245_10241082 Ga0105245_102410822 201
1031 3300009098 Ga0105245_10718052 Ga0105245_107180522 201
1032 3300009098 Ga0105245_10728216 Ga0105245_107282162 201
1033 3300009101 Ga0105247_10040165 Ga0105247_100401651 201
1034 3300009101 Ga0105247_10181498 Ga0105247_101814981 201
1035 3300009101 Ga0105247_10203963 Ga0105247_102039631 201
1036 3300009147 Ga0114129_10203191 Ga0114129_102031912 201
1037 3300009148 Ga0105243_10334231 Ga0105243_103342312 201
1038 3300009148 Ga0105243_10386232 Ga0105243_103862322 201
1039 3300009174 Ga0105241_10009918 Ga0105241_100099184 201
1040 3300009174 Ga0105241_10148190 Ga0105241_101481902 201
1041 3300009176 Ga0105242_10273389 Ga0105242_102733892 201
1042 3300009177 Ga0105248_10194704 Ga0105248_101947043 201
1043 3300009177 Ga0105248_10549999 Ga0105248_105499991 201
1044 3300009177 Ga0105248_10664245 Ga0105248_106642452 201
1045 3300009177 Ga0105248_10726179 Ga0105248_107261791 201
1046 3300009177 Ga0105248_10753057 Ga0105248_107530572 201
1047 3300009177 Ga0105248_11071797 Ga0105248_110717972 201
1048 3300009545 Ga0105237_10049985 Ga0105237_100499852 201
1049 3300009545 Ga0105237_10081699 Ga0105237_100816992 201
1050 3300009545 Ga0105237_10235500 Ga0105237_102355002 201
1051 3300009545 Ga0105237_10262921 Ga0105237_102629212 201
1052 3300009545 Ga0105237_11133239 Ga0105237_111332391 201
1053 3300009551 Ga0105238_10000577 Ga0105238_1000057738 201
1054 3300009551 Ga0105238_10021436 Ga0105238_100214362 201
1055 3300009551 Ga0105238_10114871 Ga0105238_101148711 201
1056 3300009551 Ga0105238_10439031 Ga0105238_104390312 201
1057 3300009553 Ga0105249_10472924 Ga0105249_104729242 201
1058 3300010159 Ga0099796_10037817 Ga0099796_100378172 201
1059 3300010159 Ga0099796_10071598 Ga0099796_100715982 201
1060 3300010159 Ga0099796_10125134 Ga0099796_101251342 201
1061 3300010159 Ga0099796_10148153 Ga0099796_101481532 201
1062 3300010375 Ga0105239_10123302 Ga0105239_101233022 201
1063 3300010375 Ga0105239_10125916 Ga0105239_101259162 201
1064 3300010375 Ga0105239_10160857 Ga0105239_101608572 201
1065 3300010375 Ga0105239_10164521 Ga0105239_101645212 201
1066 3300010375 Ga0105239_10493715 Ga0105239_104937152 201
1067 3300010375 Ga0105239_10661704 Ga0105239_106617042 201
1068 3300010375 Ga0105239_10729951 Ga0105239_107299512 201
1069 3300011119 Ga0105246_10035006 Ga0105246_100350062 201
1070 3300011119 Ga0105246_10094802 Ga0105246_100948022 201
1071 3300011119 Ga0105246_10112304 Ga0105246_101123042 201
1072 3300011119 Ga0105246_10339635 Ga0105246_103396352 201
1073 3300012483 Ga0157337_1013156 Ga0157337_10131561 201
1074 3300013100 Ga0157373_10495387 Ga0157373_104953872 201
1075 3300013104 Ga0157370_10063235 Ga0157370_100632352 201
1076 3300013104 Ga0157370_10072033 Ga0157370_100720332 201
1077 3300013104 Ga0157370_10097521 Ga0157370_100975213 201
1078 3300013105 Ga0157369_10010776 Ga0157369_100107769 201
1079 3300013105 Ga0157369_10083426 Ga0157369_100834262 201
1080 3300013105 Ga0157369_10865464 Ga0157369_108654641 201
1081 3300013296 Ga0157374_10213862 Ga0157374_102138622 201
1082 3300013296 Ga0157374_10379073 Ga0157374_103790732 201
1083 3300013296 Ga0157374_10481947 Ga0157374_104819472 201
1084 3300013296 Ga0157374_10737787 Ga0157374_107377872 201
1085 3300013297 Ga0157378_10028135 Ga0157378_100281352 201
1086 3300013297 Ga0157378_10174818 Ga0157378_101748183 201
1087 3300013297 Ga0157378_10235317 Ga0157378_102353172 201
1088 3300013297 Ga0157378_10371609 Ga0157378_103716092 201
1089 3300013297 Ga0157378_10829708 Ga0157378_108297082 201
1090 3300013306 Ga0163162_10038265 Ga0163162_100382653 201
1091 3300013306 Ga0163162_10077090 Ga0163162_100770904 201
1092 3300013306 Ga0163162_10187116 Ga0163162_101871162 201
1093 3300013306 Ga0163162_10313269 Ga0163162_103132692 201
1094 3300013306 Ga0163162_11180599 Ga0163162_111805991 201
1095 3300013307 Ga0157372_10144125 Ga0157372_101441253 201
1096 3300013307 Ga0157372_10700413 Ga0157372_107004132 201
1097 3300013308 Ga0157375_10730746 Ga0157375_107307462 201
1098 3300013308 Ga0157375_11269099 Ga0157375_112690991 201
1099 3300014325 Ga0163163_10127341 Ga0163163_101273413 201
1100 3300014326 Ga0157380_10080105 Ga0157380_100801052 201
1101 3300014326 Ga0157380_10766140 Ga0157380_107661402 201
1102 3300014745 Ga0157377_10330358 Ga0157377_103303582 201
1103 3300014968 Ga0157379_10049039 Ga0157379_100490393 201
1104 3300014968 Ga0157379_10059103 Ga0157379_100591033 201
1105 3300014968 Ga0157379_11496434 Ga0157379_114964341 201
1106 3300014969 Ga0157376_10091881 Ga0157376_100918812 201
1107 3300014969 Ga0157376_10672891 Ga0157376_106728912 201
1108 3300014969 Ga0157376_10680553 Ga0157376_106805532 201
1109 3300017792 Ga0163161_10016201 Ga0163161_100162011 201
1110 3300017792 Ga0163161_10410958 Ga0163161_104109581 201
1111 3300020081 Ga0206354_10849355 Ga0206354_108493551 201
1112 3300021361 Ga0213872_10061429 Ga0213872_100614292 201
1113 3300021361 Ga0213872_10201526 Ga0213872_102015261 201
1114 3300021377 Ga0213874_10010634 Ga0213874_100106343 201
1115 3300021384 Ga0213876_10003500 Ga0213876_100035006 201
1116 3300021384 Ga0213876_10069173 Ga0213876_100691731 201
1117 3300021384 Ga0213876_10272938 Ga0213876_102729382 201
1118 3300021384 Ga0213876_10345555 Ga0213876_103455551 201
1119 3300021388 Ga0213875_10019412 Ga0213875_100194122 201
1120 3300021441 Ga0213871_10012173 Ga0213871_100121732 201
1121 3300025253 Ga0209677_102922 Ga0209677_1029227 201
1122 3300025254 Ga0209148_1020491 Ga0209148_10204911 201
1123 3300025261 Ga0209233_1000753 Ga0209233_100075311 201
1124 3300025272 Ga0209455_1004258 Ga0209455_10042583 201
1125 3300025272 Ga0209455_1018520 Ga0209455_10185202 201
1126 3300025297 Ga0209758_1010431 Ga0209758_10104313 201
1127 3300025297 Ga0209758_1045155 Ga0209758_10451552 201
1128 3300025315 Ga0207697_10114127 Ga0207697_101141271 201
1129 3300025321 Ga0207656_10072619 Ga0207656_100726192 201
1130 3300025898 Ga0207692_10000726 Ga0207692_100007267 201
1131 3300025898 Ga0207692_10028535 Ga0207692_100285352 201
1132 3300025898 Ga0207692_10199355 Ga0207692_101993551 201
1133 3300025900 Ga0207710_10030771 Ga0207710_100307712 201
1134 3300025900 Ga0207710_10075752 Ga0207710_100757522 201
1135 3300025900 Ga0207710_10175022 Ga0207710_101750222 201
1136 3300025901 Ga0207688_10237010 Ga0207688_102370102 201
1137 3300025903 Ga0207680_10077450 Ga0207680_100774503 201
1138 3300025904 Ga0207647_10015241 Ga0207647_100152414 201
1139 3300025904 Ga0207647_10211861 Ga0207647_102118612 201
1140 3300025904 Ga0207647_10285561 Ga0207647_102855612 201
1141 3300025905 Ga0207685_10013389 Ga0207685_100133892 201
1142 3300025905 Ga0207685_10077657 Ga0207685_100776572 201
1143 3300025906 Ga0207699_10008623 Ga0207699_100086233 201
1144 3300025906 Ga0207699_10012451 Ga0207699_100124513 201
1145 3300025906 Ga0207699_10052098 Ga0207699_100520981 201
1146 3300025906 Ga0207699_10052507 Ga0207699_100525072 201
1147 3300025906 Ga0207699_10128526 Ga0207699_101285262 201
1148 3300025906 Ga0207699_10391886 Ga0207699_103918862 201
1149 3300025907 Ga0207645_10066938 Ga0207645_100669382 201
1150 3300025908 Ga0207643_10155034 Ga0207643_101550342 201
1151 3300025909 Ga0207705_10302883 Ga0207705_103028832 201
1152 3300025911 Ga0207654_10000358 Ga0207654_100003584 201
1153 3300025911 Ga0207654_10059283 Ga0207654_100592832 201
1154 3300025911 Ga0207654_10102165 Ga0207654_101021653 201
1155 3300025912 Ga0207707_10000183 Ga0207707_1000018342 201
1156 3300025912 Ga0207707_10071470 Ga0207707_100714702 201
1157 3300025912 Ga0207707_10183103 Ga0207707_101831032 201
1158 3300025913 Ga0207695_10002150 Ga0207695_1000215018 201
1159 3300025913 Ga0207695_10508089 Ga0207695_105080892 201
1160 3300025914 Ga0207671_10014366 Ga0207671_100143663 201
1161 3300025914 Ga0207671_10179830 Ga0207671_101798301 201
1162 3300025914 Ga0207671_10208073 Ga0207671_102080731 201
1163 3300025914 Ga0207671_10370424 Ga0207671_103704242 201
1164 3300025915 Ga0207693_10000269 Ga0207693_1000026918 201
1165 3300025915 Ga0207693_10032441 Ga0207693_100324411 201
1166 3300025915 Ga0207693_10136401 Ga0207693_101364012 201
1167 3300025916 Ga0207663_10000096 Ga0207663_1000009620 201
1168 3300025916 Ga0207663_10002855 Ga0207663_100028552 201
1169 3300025916 Ga0207663_10028303 Ga0207663_100283032 201
1170 3300025916 Ga0207663_10037012 Ga0207663_100370122 201
1171 3300025916 Ga0207663_10043990 Ga0207663_100439902 201
1172 3300025918 Ga0207662_10490002 Ga0207662_104900022 201
1173 3300025919 Ga0207657_10006462 Ga0207657_100064629 201
1174 3300025919 Ga0207657_10458734 Ga0207657_104587341 201
1175 3300025920 Ga0207649_10026710 Ga0207649_100267101 201
1176 3300025920 Ga0207649_10090245 Ga0207649_100902452 201
1177 3300025921 Ga0207652_10153229 Ga0207652_101532293 201
1178 3300025921 Ga0207652_10189329 Ga0207652_101893291 201
1179 3300025921 Ga0207652_10228921 Ga0207652_102289212 201
1180 3300025921 Ga0207652_10402680 Ga0207652_104026802 201
1181 3300025923 Ga0207681_10060393 Ga0207681_100603932 201
1182 3300025924 Ga0207694_10000491 Ga0207694_1000049115 201
1183 3300025924 Ga0207694_10109801 Ga0207694_101098012 201
1184 3300025924 Ga0207694_10248776 Ga0207694_102487761 201
1185 3300025924 Ga0207694_10422724 Ga0207694_104227242 201
1186 3300025924 Ga0207694_10577760 Ga0207694_105777601 201
1187 3300025925 Ga0207650_10442919 Ga0207650_104429192 201
1188 3300025925 Ga0207650_10518086 Ga0207650_105180862 201
1189 3300025927 Ga0207687_10101422 Ga0207687_101014222 201
1190 3300025928 Ga0207700_10004115 Ga0207700_100041154 201
1191 3300025928 Ga0207700_10026105 Ga0207700_100261052 201
1192 3300025928 Ga0207700_10052150 Ga0207700_100521503 201
1193 3300025928 Ga0207700_10053842 Ga0207700_100538422 201
1194 3300025928 Ga0207700_10189647 Ga0207700_101896472 201
1195 3300025928 Ga0207700_10223738 Ga0207700_102237382 201
1196 3300025929 Ga0207664_10027009 Ga0207664_100270092 201
1197 3300025929 Ga0207664_10047125 Ga0207664_100471252 201
1198 3300025929 Ga0207664_10051997 Ga0207664_100519973 201
1199 3300025929 Ga0207664_10055299 Ga0207664_100552992 201
1200 3300025929 Ga0207664_10247549 Ga0207664_102475492 201
1201 3300025929 Ga0207664_10569118 Ga0207664_105691181 201
1202 3300025931 Ga0207644_10081518 Ga0207644_100815182 201
1203 3300025932 Ga0207690_10719975 Ga0207690_107199751 201
1204 3300025933 Ga0207706_10029379 Ga0207706_100293796 201
1205 3300025933 Ga0207706_10078177 Ga0207706_100781772 201
1206 3300025933 Ga0207706_10154987 Ga0207706_101549872 201
1207 3300025933 Ga0207706_10281857 Ga0207706_102818572 201
1208 3300025933 Ga0207706_11145142 Ga0207706_111451421 201
1209 3300025938 Ga0207704_10266735 Ga0207704_102667352 201
1210 3300025939 Ga0207665_10000104 Ga0207665_1000010422 201
1211 3300025940 Ga0207691_10178168 Ga0207691_101781682 201
1212 3300025940 Ga0207691_10290112 Ga0207691_102901122 201
1213 3300025941 Ga0207711_10584149 Ga0207711_105841492 201
1214 3300025942 Ga0207689_10012148 Ga0207689_100121486 201
1215 3300025942 Ga0207689_10098371 Ga0207689_100983713 201
1216 3300025949 Ga0207667_10026442 Ga0207667_100264422 201
1217 3300025949 Ga0207667_10035571 Ga0207667_100355713 201
1218 3300025949 Ga0207667_10045712 Ga0207667_100457122 201
1219 3300025949 Ga0207667_10227765 Ga0207667_102277652 201
1220 3300025961 Ga0207712_10707759 Ga0207712_107077591 201
1221 3300025972 Ga0207668_10037232 Ga0207668_100372324 201
1222 3300025972 Ga0207668_10047986 Ga0207668_100479862 201
1223 3300025972 Ga0207668_10498579 Ga0207668_104985792 201
1224 3300025981 Ga0207640_10010167 Ga0207640_100101673 201
1225 3300025981 Ga0207640_10094168 Ga0207640_100941682 201
1226 3300025981 Ga0207640_10229379 Ga0207640_102293792 201
1227 3300025981 Ga0207640_10381057 Ga0207640_103810572 201
1228 3300025981 Ga0207640_10540992 Ga0207640_105409921 201
1229 3300025986 Ga0207658_10189965 Ga0207658_101899652 201
1230 3300026023 Ga0207677_10046125 Ga0207677_100461253 201
1231 3300026023 Ga0207677_10321373 Ga0207677_103213732 201
1232 3300026023 Ga0207677_10456695 Ga0207677_104566951 201
1233 3300026023 Ga0207677_10606578 Ga0207677_106065781 201
1234 3300026035 Ga0207703_10220030 Ga0207703_102200302 201
1235 3300026035 Ga0207703_10448590 Ga0207703_104485902 201
1236 3300026035 Ga0207703_10855369 Ga0207703_108553692 201
1237 3300026035 Ga0207703_10959786 Ga0207703_109597862 201
1238 3300026041 Ga0207639_10003195 Ga0207639_100031953 201
1239 3300026041 Ga0207639_10127953 Ga0207639_101279532 201
1240 3300026041 Ga0207639_10424083 Ga0207639_104240831 201
1241 3300026041 Ga0207639_11268578 Ga0207639_112685781 201
1242 3300026067 Ga0207678_10014065 Ga0207678_100140657 201
1243 3300026067 Ga0207678_10030744 Ga0207678_100307442 201
1244 3300026067 Ga0207678_10128929 Ga0207678_101289292 201
1245 3300026067 Ga0207678_10218996 Ga0207678_102189962 201
1246 3300026067 Ga0207678_10313947 Ga0207678_103139472 201
1247 3300026075 Ga0207708_10075619 Ga0207708_100756192 201
1248 3300026078 Ga0207702_10000003 Ga0207702_10000003294 201
1249 3300026078 Ga0207702_10032268 Ga0207702_100322682 201
1250 3300026078 Ga0207702_10056601 Ga0207702_100566012 201
1251 3300026078 Ga0207702_10508734 Ga0207702_105087341 201
1252 3300026088 Ga0207641_10225327 Ga0207641_102253272 201
1253 3300026088 Ga0207641_10291486 Ga0207641_102914862 201
1254 3300026088 Ga0207641_10468640 Ga0207641_104686402 201
1255 3300026095 Ga0207676_10042080 Ga0207676_100420803 201
1256 3300026095 Ga0207676_10104775 Ga0207676_101047752 201
1257 3300026095 Ga0207676_10171088 Ga0207676_101710882 201
1258 3300026116 Ga0207674_10085107 Ga0207674_100851072 201
1259 3300026116 Ga0207674_10097807 Ga0207674_100978072 201
1260 3300026116 Ga0207674_10097861 Ga0207674_100978612 201
1261 3300026116 Ga0207674_10382920 Ga0207674_103829202 201
1262 3300026116 Ga0207674_10830721 Ga0207674_108307211 201
1263 3300026118 Ga0207675_100021508 Ga0207675_1000215082 201
1264 3300026118 Ga0207675_100090463 Ga0207675_1000904632 201
1265 3300026118 Ga0207675_100175893 Ga0207675_1001758932 201
1266 3300026118 Ga0207675_100262645 Ga0207675_1002626452 201
1267 3300026118 Ga0207675_100377193 Ga0207675_1003771932 201
1268 3300026118 Ga0207675_100673288 Ga0207675_1006732881 201
1269 3300026121 Ga0207683_10152146 Ga0207683_101521461 201
1270 3300026121 Ga0207683_10209651 Ga0207683_102096512 201
1271 3300026121 Ga0207683_10335122 Ga0207683_103351222 201
1272 3300026121 Ga0207683_10546620 Ga0207683_105466201 201
1273 3300026121 Ga0207683_10696565 Ga0207683_106965652 201
1274 3300026142 Ga0207698_10027042 Ga0207698_100270422 201
1275 3300026142 Ga0207698_10114470 Ga0207698_101144702 201
1276 3300026142 Ga0207698_10607031 Ga0207698_106070312 201
1277 3300027357 Ga0209589_1000002 Ga0209589_100000248 201
1278 3300027361 Ga0209489_100002 Ga0209489_10000248 201
1279 3300027363 Ga0209700_100002 Ga0209700_10000248 201
1280 3300027671 Ga0209588_1007888 Ga0209588_10078882 201
1281 3300027866 Ga0209813_10064452 Ga0209813_100644521 201
1282 3300027866 Ga0209813_10089483 Ga0209813_100894831 201
1283 3300028379 Ga0268266_10049793 Ga0268266_100497932 201
1284 3300028379 Ga0268266_10056532 Ga0268266_100565322 201
1285 3300028379 Ga0268266_10168690 Ga0268266_101686902 201
1286 3300028379 Ga0268266_10313394 Ga0268266_103133942 201
1287 3300028379 Ga0268266_10381673 Ga0268266_103816733 201
1288 3300028379 Ga0268266_10410116 Ga0268266_104101162 201
1289 3300028379 Ga0268266_10468838 Ga0268266_104688381 201
1290 3300028379 Ga0268266_10782305 Ga0268266_107823051 201
1291 3300028379 Ga0268266_11145637 Ga0268266_111456371 201
1292 3300028380 Ga0268265_10442205 Ga0268265_104422052 201
1293 3300028380 Ga0268265_10711658 Ga0268265_107116582 201
1294 3300028381 Ga0268264_10000038 Ga0268264_10000038258 201
1295 3300028381 Ga0268264_10105950 Ga0268264_101059502 201
1296 3300028381 Ga0268264_10270123 Ga0268264_102701231 201
1297 3300028381 Ga0268264_10849473 Ga0268264_108494732 201
1298 3300028381 Ga0268264_10872998 Ga0268264_108729982 201
1299 3300028381 Ga0268264_11301006 Ga0268264_113010062 201
1300 3300028556 Ga0265337_1004994 Ga0265337_10049943 201
1301 3300028558 Ga0265326_10011046 Ga0265326_100110462 201
1302 3300028563 Ga0265319_1004750 Ga0265319_10047503 201
1303 3300028573 Ga0265334_10025808 Ga0265334_100258082 201
1304 3300028577 Ga0265318_10020324 Ga0265318_100203244 201
1305 3300028653 Ga0265323_10000744 Ga0265323_100007443 201
1306 3300028654 Ga0265322_10009604 Ga0265322_100096042 201
1307 3300028666 Ga0265336_10000228 Ga0265336_100002283 201
1308 3300028786 Ga0307517_10007898 Ga0307517_100078988 201
1309 3300028786 Ga0307517_10179540 Ga0307517_101795402 201
1310 3300028800 Ga0265338_10000116 Ga0265338_1000011633 201
1311 3300029957 Ga0265324_10004530 Ga0265324_100045304 201
1312 3300031241 Ga0265325_10033422 Ga0265325_100334222 201
1313 3300031249 Ga0265339_10072795 Ga0265339_100727952 201
1314 3300031250 Ga0265331_10075671 Ga0265331_100756711 201
1315 3300031456 Ga0307513_10235391 Ga0307513_102353912 201
1316 3300031456 Ga0307513_10611121 Ga0307513_106111211 201
1317 3300031507 Ga0307509_10207820 Ga0307509_102078202 201
1318 3300031507 Ga0307509_10271152 Ga0307509_102711522 201
1319 3300031507 Ga0307509_10601610 Ga0307509_106016102 201
1320 3300031548 Ga0307408_100269517 Ga0307408_1002695172 201
1321 3300031616 Ga0307508_10000008 Ga0307508_1000000851 201
1322 3300031616 Ga0307508_10023981 Ga0307508_100239812 201
1323 3300031616 Ga0307508_10338481 Ga0307508_103384812 201
1324 3300031616 Ga0307508_10453554 Ga0307508_104535541 201
1325 3300031712 Ga0265342_10023099 Ga0265342_100230992 201
1326 3300031730 Ga0307516_10005698 Ga0307516_100056986 201
1327 3300031730 Ga0307516_10451226 Ga0307516_104512261 201
1328 3300031824 Ga0307413_10219223 Ga0307413_102192232 201
1329 3300031852 Ga0307410_10504798 Ga0307410_105047982 201
1330 3300031901 Ga0307406_10383675 Ga0307406_103836752 201
1331 3300031903 Ga0307407_10097577 Ga0307407_100975772 201
1332 3300031911 Ga0307412_10299716 Ga0307412_102997162 201
1333 3300031911 Ga0307412_10434443 Ga0307412_104344432 201
1334 3300031911 Ga0307412_10542924 Ga0307412_105429241 201
1335 3300032002 Ga0307416_100368616 Ga0307416_1003686162 201
1336 3300032002 Ga0307416_100704182 Ga0307416_1007041822 201
1337 3300032002 Ga0307416_101122751 Ga0307416_1011227511 201
1338 3300032004 Ga0307414_10943860 Ga0307414_109438601 201
1339 3300032126 Ga0307415_100019725 Ga0307415_1000197252 201
1340 3300032126 Ga0307415_100314809 Ga0307415_1003148092 201
1341 3300033179 Ga0307507_10327767 Ga0307507_103277672 201
1342 3300033180 Ga0307510_10016828 Ga0307510_100168287 201
1343 3300033180 Ga0307510_10098071 Ga0307510_100980712 201
1344 3300033442 Ga0315911_1000004 Ga0315911_1000004316 201
1345 3300035083 Ga0373926_0144211 Ga0373926_0144211_86_694 201
1346 3300035084 Ga0373928_0026296 Ga0373928_0026296_311_916 201
1347 3300035086 Ga0373934_0003099 Ga0373934_0003099_3796_4410 201
1348 3300035086 Ga0373934_0087419 Ga0373934_0087419_138_743 201
1349 3300035089 Ga0373944_0083577 Ga0373944_0083577_404_1018 201
1350 3300035111 Ga0373923_0009432 Ga0373923_0009432_670_1284 201
1351 3300035111 Ga0373923_0022975 Ga0373923_0022975_53_658 201
1352 3300035113 Ga0373936_0007656 Ga0373936_0007656_2737_3342 201
1353 3300035113 Ga0373936_0087446 Ga0373936_0087446_519_1124 201
1354 3300035116 Ga0373945_0013918 Ga0373945_0013918_167_772 201
1355 3300035116 Ga0373945_0020708 Ga0373945_0020708_90_704 201
1356 3300035117 Ga0373953_0000196 Ga0373953_0000196_3146_3760 201
1357 3300035117 Ga0373953_0106647 Ga0373953_0106647_557_1162 201
1358 3300035118 Ga0373954_0001139 Ga0373954_0001139_9090_9704 201
1359 3300035118 Ga0373954_0030823 Ga0373954_0030823_1330_1944 201
1360 3300035119 Ga0373956_0003545 Ga0373956_0003545_3850_4464 201
1361 3300035119 Ga0373956_0027490 Ga0373956_0027490_209_814 201
1362 3300035119 Ga0373956_0315694 Ga0373956_0315694_30_638 201
1363 3300035120 Ga0373957_0088067 Ga0373957_0088067_124_729 201
1364 3300035170 Ga0373943_0006083 Ga0373943_0006083_4300_4914 201
1365 3300035170 Ga0373943_0079033 Ga0373943_0079033_590_1195 201
1366 3300035170 Ga0373943_0158005 Ga0373943_0158005_299_907 201
1367 3300035171 Ga0373946_0027971 Ga0373946_0027971_1290_1904 201
1368 3300035171 Ga0373946_0041939 Ga0373946_0041939_250_870 201
1369 3300035172 Ga0373955_0000407 Ga0373955_0000407_1857_2471 201
1370 3300035172 Ga0373955_0135089 Ga0373955_0135089_346_951 201
1371 3300035242 Ga0373962_0052280 Ga0373962_0052280_459_1079 201
1372 3300035410 Ga0373924_0000379 Ga0373924_0000379_12307_12921 201
1373 3300035410 Ga0373924_0019302 Ga0373924_0019302_905_1510 201
1374 3300035691 Ga0373931_0011456 Ga0373931_0011456_310_930 201
1375 3300035692 Ga0373935_0000493 Ga0373935_0000493_17038_17652 201
1376 3300035692 Ga0373935_0116943 Ga0373935_0116943_522_1127 201
1377 3300035692 Ga0373935_0126052 Ga0373935_0126052_432_1040 201
1378 3300035692 Ga0373935_0701076 Ga0373935_0701076_98_706 201
1379 3300035695 Ga0373927_0000331 Ga0373927_0000331_7264_7878 201
1380 3300035695 Ga0373927_0017298 Ga0373927_0017298_2188_2793 201
1381 3300035695 Ga0373927_0099987 Ga0373927_0099987_560_1180 201
1382 3300035695 Ga0373927_0212010 Ga0373927_0212010_544_1158 201
1383 3300035724 Ga0373933_0000272 Ga0373933_0000272_17072_17677 201
1384 3300035724 Ga0373933_0001601 Ga0373933_0001601_10887_11501 201
1385 3300035724 Ga0373933_0062081 Ga0373933_0062081_1039_1653 201
1386 3300035725 Ga0373947_0002830 Ga0373947_0002830_9284_9898 201
1387 3300035725 Ga0373947_0036532 Ga0373947_0036532_1221_1841 201
1388 3300035725 Ga0373947_0072974 Ga0373947_0072974_1109_1714 201
1389 3300035725 Ga0373947_0124719 Ga0373947_0124719_617_1231 201
1390 3300036401 Ga0373937_0075562 Ga0373937_0075562_961_1575 201
1391 3300036401 Ga0373937_0114039 Ga0373937_0114039_1644_2258 201
1392 3300037068 Ga0373925_0005476 Ga0373925_0005476_6418_7032 201
1393 3300037068 Ga0373925_0115175 Ga0373925_0115175_1117_1725 201
1394 3300037068 Ga0373925_0434489 Ga0373925_0434489_187_807 201
1395 3300037068 Ga0373925_0447373 Ga0373925_0447373_368_988 201
1396 3300037418 Ga0395900_0080025 Ga0395900_0080025_1752_2360 201
1397 3300037418 Ga0395900_0646174 Ga0395900_0646174_307_915 201
1398 3300037466 Ga0395898_0022213 Ga0395898_0022213_182_790 201
1399 3300037466 Ga0395898_0169178 Ga0395898_0169178_965_1573 201
1400 3300037471 Ga0395905_0015288 Ga0395905_0015288_1816_2424 201
1401 3300037853 Ga0436364_1508788 Ga0436364_1508788_318_926 201
1402 3300038443 Ga0395901_0185780 Ga0395901_0185780_362_970 201
1403 3300038443 Ga0395901_0318823 Ga0395901_0318823_321_941 201
1404 3300038443 Ga0395901_0632203 Ga0395901_0632203_191_799 201
1405 3300039437 Ga0436365_0399697 Ga0436365_0399697_12307_12921 201
1406 3300039437 Ga0436365_0399885 Ga0436365_0399885_3315_3929 201
1407 3300039437 Ga0436365_1142792 Ga0436365_1142792_745_1353 201
1408 3300039437 Ga0436365_1622924 Ga0436365_1622924_152_760 201
1409 3300039438 Ga0436360_0221727 Ga0436360_0221727_136_744 201
1410 3300039438 Ga0436360_1241329 Ga0436360_1241329_40_648 201
1411 3300039447 Ga0436361_0596678 Ga0436361_0596678_943_1551 201
1412 3300039447 Ga0436361_0805829 Ga0436361_0805829_601_1209 201
1413 3300039447 Ga0436361_1066979 Ga0436361_1066979_817_1425 201
1414 3300039450 Ga0436363_0658047 Ga0436363_0658047_4505_5113 201
1415 3300039450 Ga0436363_1036919 Ga0436363_1036919_211_825 201
1416 3300039453 Ga0436362_0661692 Ga0436362_0661692_1885_2499 201
1417 3300041413 Ga0439465_0013288 Ga0439465_0013288_1738_2343 201
1418 3300041413 Ga0439465_0069947 Ga0439465_0069947_244_852 201
1419 3300041441 Ga0451787_242297 Ga0451787_242297_216_836 201
1420 3300041443 Ga0451789_0688189 Ga0451789_0688189_102_707 201
1421 3300041453 Ga0451797_1213215 Ga0451797_1213215_57_662 201
1422 3300041486 Ga0451807_1676953 Ga0451807_1676953_37_657 201
1423 3300044656 Ga0466969_0289749 Ga0466969_0289749_94_702 201
1424 3300044694 Ga0466963_0283387 Ga0466963_0283387_493_1101 201
1425 3300044765 Ga0466970_0118069 Ga0466970_0118069_517_1125 201
1426 3300044842 Ga0466957_0159521 Ga0466957_0159521_261_869 201
1427 3300044842 Ga0466957_0694343 Ga0466957_0694343_71_679 201
1428 3300045049 Ga0466959_0420980 Ga0466959_0420980_231_839 201
1429 3300045976 Ga0466967_0333879 Ga0466967_0333879_387_995 201
1430 3300045976 Ga0466967_0991496 Ga0466967_0991496_122_730 201
1431 3300046452 Ga0495617_071502 Ga0495617_071502_507_1115 201
1432 3300046453 Ga0495627_079840 Ga0495627_079840_220_828 201
1433 3300046454 Ga0495592_0006060 Ga0495592_0006060_3780_4394 201
1434 3300046454 Ga0495592_0060220 Ga0495592_0060220_287_901 201
1435 3300046454 Ga0495592_0266270 Ga0495592_0266270_464_1069 201
1436 3300046455 Ga0495603_0000643 Ga0495603_0000643_11898_12512 201
1437 3300046455 Ga0495603_0007318 Ga0495603_0007318_5092_5712 201
1438 3300046455 Ga0495603_0026372 Ga0495603_0026372_918_1526 201
1439 3300046455 Ga0495603_0244015 Ga0495603_0244015_129_737 201
1440 3300046455 Ga0495603_0300588 Ga0495603_0300588_52_657 201
1441 3300046459 Ga0495629_0000423 Ga0495629_0000423_20550_21164 201
1442 3300046459 Ga0495629_0023037 Ga0495629_0023037_590_1195 201
1443 3300046459 Ga0495629_0065217 Ga0495629_0065217_1760_2374 201
1444 3300046459 Ga0495629_0170379 Ga0495629_0170379_69_674 201
1445 3300046460 Ga0495638_0062748 Ga0495638_0062748_41_646 201
1446 3300046460 Ga0495638_0375025 Ga0495638_0375025_19_636 201
1447 3300046461 Ga0495641_0003178 Ga0495641_0003178_4398_5012 201
1448 3300046461 Ga0495641_0047305 Ga0495641_0047305_584_1189 201
1449 3300046461 Ga0495641_0171543 Ga0495641_0171543_61_681 201
1450 3300046462 Ga0495651_0063923 Ga0495651_0063923_663_1277 201
1451 3300046462 Ga0495651_0097792 Ga0495651_0097792_1440_2048 201
1452 3300046463 Ga0495653_0018392 Ga0495653_0018392_1689_2303 201
1453 3300046472 Ga0495580_0001799 Ga0495580_0001799_4242_4847 201
1454 3300046472 Ga0495580_0002433 Ga0495580_0002433_11136_11750 201
1455 3300046472 Ga0495580_0152666 Ga0495580_0152666_824_1432 201
1456 3300046473 Ga0495582_0000166 Ga0495582_0000166_33800_34414 201
1457 3300046473 Ga0495582_0037791 Ga0495582_0037791_1500_2120 201
1458 3300046473 Ga0495582_0142450 Ga0495582_0142450_299_904 201
1459 3300046473 Ga0495582_0577989 Ga0495582_0577989_32_640 201
1460 3300046474 Ga0495605_0067389 Ga0495605_0067389_453_1058 201
1461 3300046474 Ga0495605_0173215 Ga0495605_0173215_151_759 201
1462 3300046475 Ga0495639_0000306 Ga0495639_0000306_11926_12540 201
1463 3300046475 Ga0495639_0015399 Ga0495639_0015399_2477_3085 201
1464 3300046475 Ga0495639_0124853 Ga0495639_0124853_103_708 201
1465 3300046475 Ga0495639_0202963 Ga0495639_0202963_271_885 201
1466 3300046476 Ga0495662_0001733 Ga0495662_0001733_1737_2351 201
1467 3300046477 Ga0495664_0008302 Ga0495664_0008302_1447_2061 201
1468 3300046477 Ga0495664_0011786 Ga0495664_0011786_2159_2764 201
1469 3300046477 Ga0495664_0566331 Ga0495664_0566331_30_653 201
1470 3300046491 Ga0495584_0071051 Ga0495584_0071051_62_670 201
1471 3300046492 Ga0495585_0011742 Ga0495585_0011742_456_1064 201
1472 3300046499 Ga0495594_0114992 Ga0495594_0114992_831_1436 201
1473 3300046499 Ga0495594_0178357 Ga0495594_0178357_311_931 201
1474 3300046499 Ga0495594_0189179 Ga0495594_0189179_216_830 201
1475 3300046501 Ga0495607_0371548 Ga0495607_0371548_16_624 201
1476 3300046507 Ga0495606_0370993 Ga0495606_0370993_58_663 201
1477 3300046511 Ga0495608_0014159 Ga0495608_0014159_2264_2878 201
1478 3300046514 Ga0495618_0141073 Ga0495618_0141073_564_1169 201
1479 3300046516 Ga0495628_0011146 Ga0495628_0011146_5719_6324 201
1480 3300046516 Ga0495628_0033876 Ga0495628_0033876_2424_3038 201
1481 3300046516 Ga0495628_0245871 Ga0495628_0245871_536_1141 201
1482 3300046516 Ga0495628_0424438 Ga0495628_0424438_65_688 201
1483 3300046517 Ga0495630_0019236 Ga0495630_0019236_3165_3770 201
1484 3300046517 Ga0495630_0025234 Ga0495630_0025234_3324_3938 201
1485 3300046517 Ga0495630_0041197 Ga0495630_0041197_782_1402 201
1486 3300046519 Ga0495632_0045002 Ga0495632_0045002_391_996 201
1487 3300046520 Ga0495637_0183975 Ga0495637_0183975_27_635 201
1488 3300046520 Ga0495637_0200816 Ga0495637_0200816_26_631 201
1489 3300046523 Ga0495644_0030518 Ga0495644_0030518_207_815 201
1490 3300046525 Ga0495663_0006353 Ga0495663_0006353_440_1060 201
1491 3300046526 Ga0495666_0221560 Ga0495666_0221560_48_653 201
1492 3300046528 Ga0495642_0136749 Ga0495642_0136749_179_799 201
1493 3300046528 Ga0495642_0153253 Ga0495642_0153253_120_725 201
1494 3300046529 Ga0495652_0017206 Ga0495652_0017206_844_1458 201
1495 3300046529 Ga0495652_0184890 Ga0495652_0184890_538_1143 201
1496 3300046529 Ga0495652_0336032 Ga0495652_0336032_25_630 201
1497 3300046529 Ga0495652_0498270 Ga0495652_0498270_41_655 201
1498 3300046531 Ga0495665_0000104 Ga0495665_0000104_9292_9906 201
1499 3300046531 Ga0495665_0008245 Ga0495665_0008245_4389_4994 201
1500 3300046533 Ga0495640_0003774 Ga0495640_0003774_7063_7677 201
1501 3300046533 Ga0495640_0004857 Ga0495640_0004857_9387_10001 201
1502 3300046536 Ga0495587_0021455 Ga0495587_0021455_1706_2320 201
1503 3300046537 Ga0495598_0054622 Ga0495598_0054622_177_785 201
1504 3300046539 Ga0495621_0056842 Ga0495621_0056842_346_954 201
1505 3300046543 Ga0495645_0012922 Ga0495645_0012922_4787_5392 201
1506 3300046543 Ga0495645_0050490 Ga0495645_0050490_2234_2848 201
1507 3300046543 Ga0495645_0196720 Ga0495645_0196720_523_1128 201
1508 3300046543 Ga0495645_0462691 Ga0495645_0462691_160_777 201
1509 3300046557 Ga0495622_0008182 Ga0495622_0008182_1017_1625 201
1510 3300046557 Ga0495622_0011773 Ga0495622_0011773_3260_3874 201
1511 3300046558 Ga0495633_0055762 Ga0495633_0055762_680_1288 201
1512 3300046558 Ga0495633_0065233 Ga0495633_0065233_761_1381 201
1513 3300046559 Ga0495667_0012970 Ga0495667_0012970_1664_2278 201
1514 3300046559 Ga0495667_0019422 Ga0495667_0019422_1045_1650 201
1515 3300046559 Ga0495667_0263017 Ga0495667_0263017_211_825 201
1516 3300046615 Ga0495656_0018530 Ga0495656_0018530_1262_1867 201
1517 3300046615 Ga0495656_0044808 Ga0495656_0044808_639_1247 201
1518 3300046615 Ga0495656_0046176 Ga0495656_0046176_926_1531 201
1519 3300046642 Ga0495634_0001166 Ga0495634_0001166_22142_22756 201
1520 3300046642 Ga0495634_0003095 Ga0495634_0003095_12254_12868 201
1521 3300046642 Ga0495634_0027792 Ga0495634_0027792_1533_2138 201
1522 3300046648 Ga0495611_0018145 Ga0495611_0018145_732_1340 201
1523 3300046648 Ga0495611_0082437 Ga0495611_0082437_357_965 201
1524 3300046648 Ga0495611_0117002 Ga0495611_0117002_531_1136 201
1525 3300046648 Ga0495611_0137730 Ga0495611_0137730_226_846 201
1526 3300046648 Ga0495611_0173584 Ga0495611_0173584_363_971 201
1527 3300046660 Ga0495625_0464380 Ga0495625_0464380_98_706 201
1528 3300046663 Ga0495635_0005385 Ga0495635_0005385_5865_6479 201
1529 3300046663 Ga0495635_0020868 Ga0495635_0020868_2915_3520 201
1530 3300046674 Ga0495588_0006415 Ga0495588_0006415_4481_5095 201
1531 3300046674 Ga0495588_0023772 Ga0495588_0023772_1171_1779 201
1532 3300046674 Ga0495588_0278065 Ga0495588_0278065_52_660 201
1533 3300046675 Ga0495657_0006260 Ga0495657_0006260_5737_6351 201
1534 3300046678 Ga0495599_0002627 Ga0495599_0002627_8995_9609 201
1535 3300046678 Ga0495599_0023553 Ga0495599_0023553_2523_3128 201
1536 3300046679 Ga0495623_0081378 Ga0495623_0081378_41_655 201
1537 3300046679 Ga0495623_0245280 Ga0495623_0245280_269_874 201
1538 3300046680 Ga0495646_0007324 Ga0495646_0007324_695_1309 201
1539 3300046680 Ga0495646_0009165 Ga0495646_0009165_3854_4468 201
1540 3300046680 Ga0495646_0320992 Ga0495646_0320992_88_693 201
1541 3300046681 Ga0495647_0000279 Ga0495647_0000279_5431_6045 201
1542 3300046681 Ga0495647_0169176 Ga0495647_0169176_255_863 201
1543 3300046683 Ga0495658_0001753 Ga0495658_0001753_6050_6664 201
1544 3300046683 Ga0495658_0027075 Ga0495658_0027075_1953_2558 201
1545 3300046683 Ga0495658_0373899 Ga0495658_0373899_174_788 201
1546 3300046689 Ga0495613_0010689 Ga0495613_0010689_3795_4409 201
1547 3300046689 Ga0495613_0024352 Ga0495613_0024352_2314_2928 201
1548 3300046689 Ga0495613_0059911 Ga0495613_0059911_346_951 201
1549 3300046690 Ga0495624_0003536 Ga0495624_0003536_5277_5891 201
1550 3300046690 Ga0495624_0128140 Ga0495624_0128140_621_1241 201
1551 3300046691 Ga0495670_0104656 Ga0495670_0104656_458_1066 201
1552 3300046694 Ga0495649_0245039 Ga0495649_0245039_114_734 201
1553 3300046794 Ga0495589_0172047 Ga0495589_0172047_167_772 201
1554 3300046794 Ga0495589_0188277 Ga0495589_0188277_101_721 201
1555 3300046794 Ga0495589_0267994 Ga0495589_0267994_96_704 201
1556 3300046809 Ga0495600_0030566 Ga0495600_0030566_2706_3320 201
1557 3300047315 Ga0495581_0001274 Ga0495581_0001274_11926_12540 201
1558 3300047315 Ga0495581_0069513 Ga0495581_0069513_476_1090 201
1559 3300047315 Ga0495581_0355063 Ga0495581_0355063_121_741 201
1560 3300047317 Ga0495604_0023252 Ga0495604_0023252_663_1277 201
1561 3300047317 Ga0495604_0047709 Ga0495604_0047709_42_656 201
1562 3300047317 Ga0495604_0163680 Ga0495604_0163680_353_958 201
1563 3300047319 Ga0495674_0001108 Ga0495674_0001108_9296_9910 201
1564 3300047319 Ga0495674_0013620 Ga0495674_0013620_3805_4410 201
1565 3300047320 Ga0495672_0081722 Ga0495672_0081722_41_685 201
1566 3300047321 Ga0495676_0120116 Ga0495676_0120116_643_1263 201
1567 3300047321 Ga0495676_0213893 Ga0495676_0213893_191_796 201
1568 3300047321 Ga0495676_0222644 Ga0495676_0222644_37_645 201
1569 3300047321 Ga0495676_0237537 Ga0495676_0237537_394_1002 201
1570 3300047321 Ga0495676_0414273 Ga0495676_0414273_147_761 201
1571 3300047322 Ga0495680_0023259 Ga0495680_0023259_873_1487 201
1572 3300047322 Ga0495680_0049923 Ga0495680_0049923_1331_1945 201
1573 3300047323 Ga0495683_0087307 Ga0495683_0087307_632_1240 201
1574 3300047444 Ga0495675_0031499 Ga0495675_0031499_2731_3345 201
1575 3300047445 Ga0495677_0177069 Ga0495677_0177069_96_701 201
1576 3300047447 Ga0495685_084712 Ga0495685_084712_136_741 201
1577 3300047469 Ga0495673_0091133 Ga0495673_0091133_16_621 201
1578 3300047470 Ga0495681_0041391 Ga0495681_0041391_308_916 201
1579 3300047471 Ga0495684_0004305 Ga0495684_0004305_9136_9741 201
1580 3300047471 Ga0495684_0004969 Ga0495684_0004969_7505_8119 201
1581 3300047471 Ga0495684_0068506 Ga0495684_0068506_2073_2687 201
1582 3300047472 Ga0495686_0056468 Ga0495686_0056468_1773_2378 201
1583 3300047472 Ga0495686_0059621 Ga0495686_0059621_463_1074 201
1584 3300047673 Ga0495593_0005960 Ga0495593_0005960_2127_2732 201
1585 3300047673 Ga0495593_0030461 Ga0495593_0030461_1136_1750 201
1586 3300048088 Ga0495602_0071388 Ga0495602_0071388_1689_2303 201
1587 3300048088 Ga0495602_0178469 Ga0495602_0178469_694_1317 201
1588 3300048088 Ga0495602_0348805 Ga0495602_0348805_122_736 201
1589 3300048090 Ga0495615_0099012 Ga0495615_0099012_13_618 201
1590 3300048903 Ga0496100_0026737 Ga0496100_0026737_1363_1986 201
1591 3300048903 Ga0496100_0068392 Ga0496100_0068392_26_634 201
1592 3300048903 Ga0496100_0154041 Ga0496100_0154041_412_1032 201
1593 3300048903 Ga0496100_0169796 Ga0496100_0169796_855_1460 201
1594 3300048903 Ga0496100_0236845 Ga0496100_0236845_23_631 201
1595 3300048903 Ga0496100_0250592 Ga0496100_0250592_393_998 201
1596 3300048904 Ga0496101_0026481 Ga0496101_0026481_746_1366 201
1597 3300048904 Ga0496101_0218397 Ga0496101_0218397_266_871 201
1598 3300048904 Ga0496101_0532423 Ga0496101_0532423_98_706 201
1599 3300048905 Ga0496102_0302013 Ga0496102_0302013_291_896 201
1600 3300048905 Ga0496102_0336242 Ga0496102_0336242_557_1186 201
1601 3300048905 Ga0496102_0374382 Ga0496102_0374382_403_1008 201
1602 3300048905 Ga0496102_0393982 Ga0496102_0393982_554_1174 201
1603 3300048905 Ga0496102_0731202 Ga0496102_0731202_192_797 201
1604 3300048905 Ga0496102_0739674 Ga0496102_0739674_180_800 201
1605 3300048905 Ga0496102_0866495 Ga0496102_0866495_37_666 201
1606 3300048906 Ga0496103_0168973 Ga0496103_0168973_378_998 201
1607 3300048906 Ga0496103_0418269 Ga0496103_0418269_30_650 201
1608 3300048906 Ga0496103_0457087 Ga0496103_0457087_151_759 201
1609 3300048907 Ga0496104_0000126 Ga0496104_0000126_4629_5237 201
1610 3300048907 Ga0496104_0020423 Ga0496104_0020423_4425_5030 201
1611 3300048907 Ga0496104_0069473 Ga0496104_0069473_199_819 201
1612 3300048907 Ga0496104_0270371 Ga0496104_0270371_904_1509 201
1613 3300048907 Ga0496104_0352006 Ga0496104_0352006_165_785 201
1614 3300048908 Ga0496105_0014292 Ga0496105_0014292_11_619 201
1615 3300048908 Ga0496105_0126206 Ga0496105_0126206_611_1231 201
1616 3300048908 Ga0496105_0238303 Ga0496105_0238303_551_1171 201
1617 3300048908 Ga0496105_0256403 Ga0496105_0256403_441_1049 201
1618 3300048909 Ga0496106_0004544 Ga0496106_0004544_2392_3015 201
1619 3300048909 Ga0496106_0005271 Ga0496106_0005271_201_821 201
1620 3300048909 Ga0496106_0035159 Ga0496106_0035159_529_1134 201
1621 3300048909 Ga0496106_0078728 Ga0496106_0078728_590_1210 201
1622 3300048909 Ga0496106_0099436 Ga0496106_0099436_95_703 201
1623 3300048910 Ga0496107_0004055 Ga0496107_0004055_4641_5264 201
1624 3300048910 Ga0496107_0011451 Ga0496107_0011451_214_834 201
1625 3300048910 Ga0496107_0014869 Ga0496107_0014869_3112_3732 201
1626 3300048910 Ga0496107_0331444 Ga0496107_0331444_83_688 201
1627 3300048911 Ga0496108_0000884 Ga0496108_0000884_2657_3280 201
1628 3300048911 Ga0496108_0013923 Ga0496108_0013923_5611_6231 201
1629 3300048911 Ga0496108_0076007 Ga0496108_0076007_1948_2553 201
1630 3300048911 Ga0496108_0154316 Ga0496108_0154316_1069_1674 201
1631 3300048911 Ga0496108_0315879 Ga0496108_0315879_579_1187 201
1632 3300048911 Ga0496108_0696693 Ga0496108_0696693_247_852 201
1633 3300048912 Ga0496109_0000166 Ga0496109_0000166_58396_59019 201
1634 3300048912 Ga0496109_0005742 Ga0496109_0005742_9517_10137 201
1635 3300048912 Ga0496109_0210328 Ga0496109_0210328_803_1411 201
1636 3300048912 Ga0496109_1081603 Ga0496109_1081603_62_667 201
1637 3300048912 Ga0496109_1248153 Ga0496109_1248153_56_661 201
1638 3300048913 Ga0496110_0004672 Ga0496110_0004672_2216_2821 201
1639 3300048913 Ga0496110_0030062 Ga0496110_0030062_3870_4493 201
1640 3300048913 Ga0496110_0051382 Ga0496110_0051382_1863_2483 201
1641 3300048913 Ga0496110_0258575 Ga0496110_0258575_675_1283 201
1642 3300048913 Ga0496110_0379547 Ga0496110_0379547_437_1042 201
1643 3300048913 Ga0496110_0806318 Ga0496110_0806318_186_791 201
1644 3300048914 Ga0496111_0057082 Ga0496111_0057082_2117_2722 201
1645 3300048914 Ga0496111_0169041 Ga0496111_0169041_180_803 201
1646 3300048914 Ga0496111_0264936 Ga0496111_0264936_58_678 201
1647 3300048915 Ga0496112_0001913 Ga0496112_0001913_5769_6392 201
1648 3300048915 Ga0496112_0009707 Ga0496112_0009707_46_651 201
1649 3300048915 Ga0496112_0057575 Ga0496112_0057575_1475_2095 201
1650 3300048915 Ga0496112_0313559 Ga0496112_0313559_209_829 201
1651 3300048915 Ga0496112_0363999 Ga0496112_0363999_169_774 201
1652 3300048915 Ga0496112_0395479 Ga0496112_0395479_482_1090 201
1653 3300048916 Ga0496113_0026817 Ga0496113_0026817_1511_2134 201
1654 3300048916 Ga0496113_0075256 Ga0496113_0075256_1192_1812 201
1655 3300048916 Ga0496113_0143961 Ga0496113_0143961_493_1098 201
1656 3300048916 Ga0496113_0203178 Ga0496113_0203178_785_1558 201
1657 3300048916 Ga0496113_0467907 Ga0496113_0467907_152_772 201
1658 3300048917 Ga0496114_0061856 Ga0496114_0061856_2276_2896 201
1659 3300048917 Ga0496114_0207630 Ga0496114_0207630_86_694 201
1660 3300048918 Ga0496115_0145424 Ga0496115_0145424_417_1037 201
1661 3300048918 Ga0496115_0179211 Ga0496115_0179211_321_935 201
1662 3300048918 Ga0496115_0267078 Ga0496115_0267078_632_1237 201
1663 3300048920 Ga0496117_0182188 Ga0496117_0182188_508_1113 201
1664 3300048921 Ga0496118_0037797 Ga0496118_0037797_1951_2559 201
1665 3300048921 Ga0496118_0180127 Ga0496118_0180127_662_1267 201
1666 3300048921 Ga0496118_0269933 Ga0496118_0269933_266_889 201
1667 3300048921 Ga0496118_0412744 Ga0496118_0412744_49_660 201
1668 3300048924 Ga0496121_0001158 Ga0496121_0001158_9573_10181 201
1669 3300048924 Ga0496121_0036524 Ga0496121_0036524_727_1335 201
1670 3300048924 Ga0496121_0052743 Ga0496121_0052743_380_1024 201
1671 3300048924 Ga0496121_0064779 Ga0496121_0064779_1040_1645 201
1672 3300048924 Ga0496121_0070499 Ga0496121_0070499_808_1413 201
1673 3300048924 Ga0496121_0076273 Ga0496121_0076273_1916_2524 201
1674 3300048924 Ga0496121_0098311 Ga0496121_0098311_831_1436 201
1675 3300048924 Ga0496121_0109790 Ga0496121_0109790_852_1460 201
1676 3300048924 Ga0496121_0118735 Ga0496121_0118735_1201_1809 201
1677 3300048924 Ga0496121_0128458 Ga0496121_0128458_261_866 201
1678 3300048924 Ga0496121_0134288 Ga0496121_0134288_267_911 201
1679 3300048927 Ga0496124_0058489 Ga0496124_0058489_2198_2809 201
1680 3300048927 Ga0496124_0093164 Ga0496124_0093164_1697_2305 201
1681 3300048927 Ga0496124_0162730 Ga0496124_0162730_572_1177 201
1682 3300048927 Ga0496124_0383865 Ga0496124_0383865_271_879 201
1683 3300048928 Ga0496125_0058918 Ga0496125_0058918_849_1460 201
1684 3300048928 Ga0496125_0101612 Ga0496125_0101612_794_1402 201
1685 3300048929 Ga0496126_0021248 Ga0496126_0021248_1875_2480 201
1686 3300048929 Ga0496126_0027564 Ga0496126_0027564_4549_5160 201
1687 3300048929 Ga0496126_0058582 Ga0496126_0058582_1712_2317 201
1688 3300048929 Ga0496126_0154303 Ga0496126_0154303_792_1397 201
1689 3300048929 Ga0496126_0231559 Ga0496126_0231559_293_913 201
1690 3300048929 Ga0496126_0338561 Ga0496126_0338561_146_760 201
1691 3300048929 Ga0496126_0414179 Ga0496126_0414179_201_806 201
1692 3300048929 Ga0496126_0519978 Ga0496126_0519978_314_922 201
1693 3300048929 Ga0496126_0540293 Ga0496126_0540293_226_849 201
1694 3300048929 Ga0496126_0545144 Ga0496126_0545144_251_859 201
1695 3300049459 Ga0495678_084196 Ga0495678_084196_441_1046 201
1696 3300049460 Ga0495682_0193412 Ga0495682_0193412_24_629 201
1697 3300049569 Ga0501032_0580351 Ga0501032_0580351_73_678 201
1698 3300049570 Ga0501033_0150572 Ga0501033_0150572_35_679 201
1699 3300049571 Ga0501034_0034045 Ga0501034_0034045_3713_4357 201
1700 3300049571 Ga0501034_0891912 Ga0501034_0891912_32_679 201
1701 3300049573 Ga0501037_0408957 Ga0501037_0408957_129_734 201
1702 3300049574 Ga0501038_0700286 Ga0501038_0700286_77_682 201
1703 3300049576 Ga0501040_0214192 Ga0501040_0214192_735_1340 201
1704 3300049579 Ga0501043_0756978 Ga0501043_0756978_21_665 201
1705 3300049581 Ga0501047_0015759 Ga0501047_0015759_2365_2979 201
1706 3300049581 Ga0501047_0049372 Ga0501047_0049372_1561_2205 201
1707 3300049585 Ga0501069_0323490 Ga0501069_0323490_201_806 201
1708 3300049586 Ga0501070_0006105 Ga0501070_0006105_894_1508 201
1709 3300049586 Ga0501070_0083794 Ga0501070_0083794_290_934 201
1710 3300049587 Ga0501071_0171870 Ga0501071_0171870_109_714 201
1711 3300049590 Ga0501074_0043902 Ga0501074_0043902_1627_2241 201
1712 3300049590 Ga0501074_0392062 Ga0501074_0392062_80_685 201
1713 3300049822 Ga0501035_0026147 Ga0501035_0026147_4542_5186 201
1714 3300049822 Ga0501035_0483430 Ga0501035_0483430_167_772 201
1715 3300049823 Ga0501044_0105284 Ga0501044_0105284_81_725 201
1716 3300049823 Ga0501044_0452447 Ga0501044_0452447_77_691 201
1717 3300049824 Ga0501045_0734510 Ga0501045_0734510_36_641 201
1718 3300050489 nmdc:mga03683_209889_c1 nmdc:mga03683_209889_c1_78_683 201
1719 3300050489 nmdc:mga03683_353013_c1 nmdc:mga03683_353013_c1_61_669 201
1720 3300050489 nmdc:mga03683_71078_c1 nmdc:mga03683_71078_c1_464_1069 201
1721 3300050490 nmdc:mga03n38_97972_c1 nmdc:mga03n38_97972_c1_85_690 201
1722 3300050491 nmdc:mga00v17_59104_c1 nmdc:mga00v17_59104_c1_935_1540 201
1723 3300050491 nmdc:mga00v17_631294_c1 nmdc:mga00v17_631294_c1_65_670 201
1724 3300050492 nmdc:mga0yw44_247782_c1 nmdc:mga0yw44_247782_c1_502_1128 201
1725 3300050492 nmdc:mga0yw44_629110_c1 nmdc:mga0yw44_629110_c1_26_652 201
1726 3300050493 nmdc:mga0k408_133064_c1 nmdc:mga0k408_133064_c1_549_1154 201
1727 3300050493 nmdc:mga0k408_18926_c1 nmdc:mga0k408_18926_c1_38_646 201
1728 3300050493 nmdc:mga0k408_200604_c1 nmdc:mga0k408_200604_c1_278_883 201
1729 3300050494 nmdc:mga06z11_11035_c1 nmdc:mga06z11_11035_c1_136_741 201
1730 3300050494 nmdc:mga06z11_62894_c1 nmdc:mga06z11_62894_c1_187_795 201
1731 3300050495 nmdc:mga04h51_77007_c1 nmdc:mga04h51_77007_c1_364_969 201
1732 3300050495 nmdc:mga04h51_78702_c1 nmdc:mga04h51_78702_c1_209_817 201
1733 3300050495 nmdc:mga04h51_96333_c1 nmdc:mga04h51_96333_c1_73_678 201
1734 3300050496 nmdc:mga07m45_105569_c1 nmdc:mga07m45_105569_c1_646_1254 201
1735 3300050496 nmdc:mga07m45_108751_c1 nmdc:mga07m45_108751_c1_258_863 201
1736 3300050496 nmdc:mga07m45_35516_c1 nmdc:mga07m45_35516_c1_524_1129 201
1737 3300050496 nmdc:mga07m45_8718_c1 nmdc:mga07m45_8718_c1_2687_3292 201
1738 3300050507 nmdc:mga05p37_349995_c1 nmdc:mga05p37_349995_c1_909_1514 201
1739 3300050509 nmdc:mga0qj67_986413_c1 nmdc:mga0qj67_986413_c1_32_640 201
1740 3300050512 nmdc:mga0n895_124354_c1 nmdc:mga0n895_124354_c1_626_1231 201
1741 3300050512 nmdc:mga0n895_228752_c1 nmdc:mga0n895_228752_c1_964_1569 201
1742 3300050513 nmdc:mga0rr50_175839_c1 nmdc:mga0rr50_175839_c1_387_992 201
1743 3300050513 nmdc:mga0rr50_407471_c1 nmdc:mga0rr50_407471_c1_447_1052 201
1744 3300050514 nmdc:mga08x19_85734_c1 nmdc:mga08x19_85734_c1_235_843 201
1745 3300050515 nmdc:mga0a205_635069_c1 nmdc:mga0a205_635069_c1_203_808 201
1746 3300050516 nmdc:mga0sz30_49132_c1 nmdc:mga0sz30_49132_c1_209_814 201
1747 3300050516 nmdc:mga0sz30_52130_c1 nmdc:mga0sz30_52130_c1_725_1330 201
1748 3300053077 Ga0495601_0112890 Ga0495601_0112890_884_1489 201
1749 3300053077 Ga0495601_0212427 Ga0495601_0212427_41_646 201
1750 3300053077 Ga0495601_0348248 Ga0495601_0348248_182_796 201
1751 3300053078 Ga0495612_0007947 Ga0495612_0007947_554_1159 201
1752 3300053080 Ga0500635_0005867 Ga0500635_0005867_2123_2728 201
1753 3300053080 Ga0500635_0021376 Ga0500635_0021376_281_889 201
1754 3300053083 Ga0495655_0129481 Ga0495655_0129481_47_664 201
1755 3300053084 Ga0495595_0000808 Ga0495595_0000808_2301_2915 201
1756 3300053084 Ga0495595_0347423 Ga0495595_0347423_102_722 201
1757 3300053085 Ga0495619_0032598 Ga0495619_0032598_1062_1676 201
1758 3300053087 Ga0500643_069707 Ga0500643_069707_246_854 201
1759 3300053088 Ga0500644_0111336 Ga0500644_0111336_419_1024 201
1760 3300053091 Ga0500647_0059319 Ga0500647_0059319_586_1191 201
1761 3300053092 Ga0500583_0007131 Ga0500583_0007131_1448_2056 201
1762 3300053094 Ga0500566_0000072 Ga0500566_0000072_10677_11282 201
1763 3300053094 Ga0500566_0002476 Ga0500566_0002476_1736_2353 201
1764 3300053094 Ga0500566_0226593 Ga0500566_0226593_234_842 201
1765 3300053095 Ga0500640_034957 Ga0500640_034957_52_657 201
1766 3300053096 Ga0500641_0006798 Ga0500641_0006798_3228_3833 201
1767 3300053098 Ga0500650_0146739 Ga0500650_0146739_64_672 201
1768 3300053102 Ga0500554_000273 Ga0500554_000273_6161_6769 201
1769 3300053102 Ga0500554_000792 Ga0500554_000792_1933_2550 201
1770 3300053111 Ga0500572_000226 Ga0500572_000226_15910_16533 201
1771 3300053111 Ga0500572_000499 Ga0500572_000499_12046_12651 201
1772 3300053115 Ga0500591_043704 Ga0500591_043704_1076_1681 201
1773 3300053119 Ga0500595_000581 Ga0500595_000581_7962_8579 201
1774 3300053119 Ga0500595_003343 Ga0500595_003343_2192_2797 201
1775 3300053119 Ga0500595_015487 Ga0500595_015487_378_986 201
1776 3300053119 Ga0500595_072996 Ga0500595_072996_389_994 201
1777 3300053119 Ga0500595_097667 Ga0500595_097667_155_763 201
1778 3300053123 Ga0500614_003266 Ga0500614_003266_181_786 201
1779 3300053136 Ga0500559_0000155 Ga0500559_0000155_53162_53785 201
1780 3300053136 Ga0500559_0001312 Ga0500559_0001312_2580_3185 201
1781 3300053147 Ga0500589_142501 Ga0500589_142501_292_897 201
1782 3300053148 Ga0500590_034455 Ga0500590_034455_69_674 201
1783 3300053148 Ga0500590_243575 Ga0500590_243575_23_628 201
1784 3300053150 Ga0500603_000346 Ga0500603_000346_2553_3161 201
1785 3300053150 Ga0500603_000767 Ga0500603_000767_6506_7111 201
1786 3300053150 Ga0500603_022200 Ga0500603_022200_128_736 201
1787 3300053159 Ga0500630_000703 Ga0500630_000703_815_1420 201
1788 3300053162 Ga0500638_000737 Ga0500638_000737_124_741 201
1789 3300053163 Ga0500639_000029 Ga0500639_000029_70853_71458 201
1790 3300053163 Ga0500639_132881 Ga0500639_132881_276_899 201
1791 3300053177 Ga0500636_0141455 Ga0500636_0141455_657_1265 201
1792 3300053177 Ga0500636_0159938 Ga0500636_0159938_83_700 201
1793 3300053178 Ga0500637_0000163 Ga0500637_0000163_3058_3666 201
1794 3300053178 Ga0500637_0094437 Ga0500637_0094437_107_715 201
1795 3300053725 Ga0500576_065134 Ga0500576_065134_144_767 201
1796 3300053725 Ga0500576_163368 Ga0500576_163368_172_777 201
1797 3300053730 Ga0500645_020102 Ga0500645_020102_1383_1991 201
1798 3300053731 Ga0500609_002715 Ga0500609_002715_156_764 201
1799 3300053737 Ga0500601_020389 Ga0500601_020389_31_636 201
1800 3300055283 Ga0500661_003807 Ga0500661_003807_1928_2545 201
1801 3300059503 Ga0587080_088941 Ga0587080_088941_17_625 201
1802 3300060353 Ga0501082_0503461 Ga0501082_0503461_415_1020 201
1803 iso_pu_bacteria 2908739725 2908740947 201
1804 iso_pu_bacteria 8006933436 8006934535 201
1805 iso_pu_bacteria 8006973647 8006974505 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17935

TetR_C_27

Tetracyclin repressor-like, C-terminal domain

84

187

0.98

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

16

62

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crj-assembly1.cif.gz_B crystal structure of a tetr transcription regulator from haloarcula marismortui atcc 43049 0.7862 10 197
2ras-assembly1.cif.gz_A crystal structure of a putative tetr/acrr family transcriptional regulator (saro_0558) from novosphingobium aromaticivorans dsm at 1.80 a resolution 0.781 7 200
3crj-assembly1.cif.gz_B crystal structure of a tetr transcription regulator from haloarcula marismortui atcc 43049 0.7789 10 197
6el2-assembly1.cif.gz_B safadr_lauroyl_coa complex 0.7752 14 197
3dcf-assembly1.cif.gz_B crystal structure of transcriptional regulator of the tetr/acrr family (yp_290855.1) from thermobifida fusca yx-er1 at 2.50 a resolution 0.7687 11 197
ID Description Score Start End Superfamily
4w97A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9764 12 52 1.10.10.60
5ojxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9755 14 62 1.10.10.60
3dcfB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9748 11 52 1.10.10.60
2raeA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9701 12 52 1.10.10.60
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9668 12 58 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A5A7WJM6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.981 1 198 GO:0000976
GO:0003700
AF-A0A657LRB5-F1-model_v4 TetR family transcriptional regulator 0.9804 5 195 GO:0000976
GO:0003700
AF-A0A1I4DDH6-F1-model_v4 DNA-binding transcriptional regulator, AcrR family 0.9755 12 199 GO:0000976
GO:0003700
AF-A0A327KRD9-F1-model_v4 TetR family transcriptional regulator 0.9727 6 195 GO:0000976
GO:0003700
AF-A0A5A7WJM6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9713 1 198 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
92.43 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map