F495716
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1790 | 508 | 3580 | 56 |
Family's Representative Sequence
| Representative Sequence | 3300005441|Ga0070700_100401125|Ga0070700_1004011252 |
| Length | 61 |
| Sequence | MPNHLTPEELSKELGLDRQEVIRVCVQEGVPIYQGKIDKTLFQAQLQALGTAGQAQPQAAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 113 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 131 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 132 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 133 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 134 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 135 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 136 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 137 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 138 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 139 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 162 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 169 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 244 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 245 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 247 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 248 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 255 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 256 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 260 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 261 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 262 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 264 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 265 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 266 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 267 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 268 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 269 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 270 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 273 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 280 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 283 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 285 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 290 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 292 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 293 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 294 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 295 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 298 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 299 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 300 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 304 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 305 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 306 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 307 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 311 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 312 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 313 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 314 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 315 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 316 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 317 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 318 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 319 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 320 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 321 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 322 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 323 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 324 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 325 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 326 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 327 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 328 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 329 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 330 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 331 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 332 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 333 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 334 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 335 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 336 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 337 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 338 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 339 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 340 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 341 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 342 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 343 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 344 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 345 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 346 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 347 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 348 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 349 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 350 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 351 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 352 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 353 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 354 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 355 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 356 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 430 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 431 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 432 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 433 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 434 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 435 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 438 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 439 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 440 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 441 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 442 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 443 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 444 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 468 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 469 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 470 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 478 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 479 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 480 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 481 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 496 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 497 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 508 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.43 |
| Metatranscriptomes | 2.57 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.73 |
| Nodule | 0 |
| Rhizoplane | 9.83 |
| Rhizosphere | 88.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070700_100401125 | 3300005441 | Bacteria | 1031 |
| 2 | JGI24746J21847_1048614 | 3300001977 | Unclassified | 595 |
| 3 | JGI24747J21853_1016955 | 3300001978 | Bacteria | 773 |
| 4 | JGI24737J22298_10178942 | 3300001990 | Bacteria | 626 |
| 5 | JGI24743J22301_10129190 | 3300001991 | Bacteria | 557 |
| 6 | JGI24749J21850_1029563 | 3300002076 | Bacteria | 785 |
| 7 | JGI24744J21845_10003592 | 3300002077 | Bacteria | 3197 |
| 8 | JGI24742J22300_10036530 | 3300002244 | Bacteria | 868 |
| 9 | JGI24742J22300_10038740 | 3300002244 | Bacteria | 846 |
| 10 | rootL2_10091144 | 3300003322 | Bacteria | 1801 |
| 11 | JGI25407J50210_10162221 | 3300003373 | Bacteria | 551 |
| 12 | JGI25404J52841_10036040 | 3300003659 | Bacteria | 1053 |
| 13 | Ga0058860_10026662 | 3300004801 | Unclassified | 543 |
| 14 | Ga0070658_10083898 | 3300005327 | Bacteria | 2619 |
| 15 | Ga0070658_10505778 | 3300005327 | Bacteria | 1044 |
| 16 | Ga0070676_10275815 | 3300005328 | Bacteria | 1131 |
| 17 | Ga0070683_100067793 | 3300005329 | Bacteria | 3324 |
| 18 | Ga0070690_100028453 | 3300005330 | Bacteria | 3462 |
| 19 | Ga0070670_101468243 | 3300005331 | Bacteria | 626 |
| 20 | Ga0070677_10102324 | 3300005333 | Bacteria | 1265 |
| 21 | Ga0070677_10465098 | 3300005333 | Bacteria | 679 |
| 22 | Ga0068869_100279703 | 3300005334 | Bacteria | 1342 |
| 23 | Ga0068869_100986668 | 3300005334 | Bacteria | 733 |
| 24 | Ga0068869_101240832 | 3300005334 | Bacteria | 656 |
| 25 | Ga0070666_10080620 | 3300005335 | Unclassified | 2225 |
| 26 | Ga0070680_100012321 | 3300005336 | Bacteria | 6640 |
| 27 | Ga0070680_100067747 | 3300005336 | Bacteria | 2928 |
| 28 | Ga0070680_100433055 | 3300005336 | Bacteria | 1123 |
| 29 | Ga0070680_100623767 | 3300005336 | Bacteria | 926 |
| 30 | Ga0070680_100860718 | 3300005336 | Bacteria | 782 |
| 31 | Ga0070680_101286639 | 3300005336 | Bacteria | 633 |
| 32 | Ga0070682_100016493 | 3300005337 | Bacteria | 4295 |
| 33 | Ga0070682_100054134 | 3300005337 | Bacteria | 2516 |
| 34 | Ga0070682_100083590 | 3300005337 | Bacteria | 2072 |
| 35 | Ga0070682_100176053 | 3300005337 | Bacteria | 1490 |
| 36 | Ga0070682_101425419 | 3300005337 | Bacteria | 593 |
| 37 | Ga0068868_100067114 | 3300005338 | Bacteria | 2854 |
| 38 | Ga0068868_100168372 | 3300005338 | Bacteria | 1813 |
| 39 | Ga0068868_100438390 | 3300005338 | Bacteria | 1134 |
| 40 | Ga0070660_100022594 | 3300005339 | Bacteria | 4653 |
| 41 | Ga0070660_100209107 | 3300005339 | Bacteria | 1584 |
| 42 | Ga0070660_100557123 | 3300005339 | Bacteria | 956 |
| 43 | Ga0070660_100641984 | 3300005339 | Bacteria | 889 |
| 44 | Ga0070660_100808125 | 3300005339 | Unclassified | 789 |
| 45 | Ga0070660_101316321 | 3300005339 | Bacteria | 613 |
| 46 | Ga0070689_100032361 | 3300005340 | Bacteria | 3976 |
| 47 | Ga0070689_100510160 | 3300005340 | Bacteria | 1031 |
| 48 | Ga0070691_10086670 | 3300005341 | Bacteria | 1539 |
| 49 | Ga0070687_101064337 | 3300005343 | Bacteria | 590 |
| 50 | Ga0070687_101216447 | 3300005343 | Unclassified | 556 |
| 51 | Ga0070661_100063325 | 3300005344 | Bacteria | 2716 |
| 52 | Ga0070661_100615782 | 3300005344 | Bacteria | 879 |
| 53 | Ga0070661_100906759 | 3300005344 | Bacteria | 728 |
| 54 | Ga0070661_101471510 | 3300005344 | Unclassified | 574 |
| 55 | Ga0070692_10038074 | 3300005345 | Unclassified | 2449 |
| 56 | Ga0070668_100225980 | 3300005347 | Bacteria | 1546 |
| 57 | Ga0070669_100578565 | 3300005353 | Bacteria | 939 |
| 58 | Ga0070669_100648897 | 3300005353 | Bacteria | 888 |
| 59 | Ga0070669_101391106 | 3300005353 | Unclassified | 609 |
| 60 | Ga0070675_100032562 | 3300005354 | Bacteria | 4220 |
| 61 | Ga0070675_100269191 | 3300005354 | Bacteria | 1495 |
| 62 | Ga0070675_100286508 | 3300005354 | Unclassified | 1449 |
| 63 | Ga0070671_100033028 | 3300005355 | Bacteria | 4277 |
| 64 | Ga0070671_100033063 | 3300005355 | Bacteria | 4275 |
| 65 | Ga0070671_100095902 | 3300005355 | Bacteria | 2487 |
| 66 | Ga0070671_101671482 | 3300005355 | Bacteria | 565 |
| 67 | Ga0070674_100005001 | 3300005356 | Bacteria | 7605 |
| 68 | Ga0070674_100461248 | 3300005356 | Bacteria | 1051 |
| 69 | Ga0070673_100195570 | 3300005364 | Bacteria | 1739 |
| 70 | Ga0070673_100388952 | 3300005364 | Bacteria | 1245 |
| 71 | Ga0070673_100831512 | 3300005364 | Bacteria | 854 |
| 72 | Ga0070673_100834817 | 3300005364 | Bacteria | 852 |
| 73 | Ga0070673_101454465 | 3300005364 | Bacteria | 646 |
| 74 | Ga0070688_100083124 | 3300005365 | Bacteria | 2077 |
| 75 | Ga0070688_101702608 | 3300005365 | Unclassified | 516 |
| 76 | Ga0070659_100034381 | 3300005366 | Bacteria | 3942 |
| 77 | Ga0070659_100975608 | 3300005366 | Bacteria | 743 |
| 78 | Ga0070659_101226432 | 3300005366 | Bacteria | 664 |
| 79 | Ga0070667_101143302 | 3300005367 | Bacteria | 728 |
| 80 | Ga0070703_10012916 | 3300005406 | Bacteria | 2367 |
| 81 | Ga0070703_10231426 | 3300005406 | Bacteria | 741 |
| 82 | Ga0070703_10415645 | 3300005406 | Bacteria | 589 |
| 83 | Ga0070709_10005698 | 3300005434 | Bacteria | 6754 |
| 84 | Ga0070709_10052234 | 3300005434 | Bacteria | 2568 |
| 85 | Ga0070709_10140929 | 3300005434 | Bacteria | 1657 |
| 86 | Ga0070709_10511238 | 3300005434 | Bacteria | 914 |
| 87 | Ga0070709_10582036 | 3300005434 | Bacteria | 860 |
| 88 | Ga0070714_100001612 | 3300005435 | Bacteria | 16395 |
| 89 | Ga0070714_100006822 | 3300005435 | Bacteria | 8848 |
| 90 | Ga0070714_100014480 | 3300005435 | Bacteria | 6335 |
| 91 | Ga0070714_100034986 | 3300005435 | Bacteria | 4208 |
| 92 | Ga0070714_100039441 | 3300005435 | Bacteria | 3976 |
| 93 | Ga0070714_100062196 | 3300005435 | Bacteria | 3208 |
| 94 | Ga0070714_100108329 | 3300005435 | Bacteria | 2456 |
| 95 | Ga0070714_100190311 | 3300005435 | Bacteria | 1872 |
| 96 | Ga0070714_100234528 | 3300005435 | Bacteria | 1691 |
| 97 | Ga0070714_100259453 | 3300005435 | Unclassified | 1609 |
| 98 | Ga0070714_100808327 | 3300005435 | Bacteria | 908 |
| 99 | Ga0070713_100012818 | 3300005436 | Bacteria | 6164 |
| 100 | Ga0070713_100025980 | 3300005436 | Bacteria | 4589 |
| 101 | Ga0070713_100091162 | 3300005436 | Bacteria | 2622 |
| 102 | Ga0070713_100099214 | 3300005436 | Bacteria | 2519 |
| 103 | Ga0070713_100160590 | 3300005436 | Bacteria | 2006 |
| 104 | Ga0070713_100261316 | 3300005436 | Bacteria | 1582 |
| 105 | Ga0070713_100367076 | 3300005436 | Bacteria | 1338 |
| 106 | Ga0070713_100554481 | 3300005436 | Bacteria | 1088 |
| 107 | Ga0070713_100903245 | 3300005436 | Bacteria | 850 |
| 108 | Ga0070713_101271457 | 3300005436 | Unclassified | 713 |
| 109 | Ga0070710_10001306 | 3300005437 | Bacteria | 11777 |
| 110 | Ga0070710_10007464 | 3300005437 | Bacteria | 5295 |
| 111 | Ga0070710_10250259 | 3300005437 | Bacteria | 1139 |
| 112 | Ga0070710_10389972 | 3300005437 | Bacteria | 931 |
| 113 | Ga0070710_10715643 | 3300005437 | Bacteria | 708 |
| 114 | Ga0070710_10903341 | 3300005437 | Unclassified | 638 |
| 115 | Ga0070710_10909301 | 3300005437 | Bacteria | 636 |
| 116 | Ga0070701_10591086 | 3300005438 | Bacteria | 734 |
| 117 | Ga0070701_10669392 | 3300005438 | Bacteria | 695 |
| 118 | Ga0070701_10819569 | 3300005438 | Bacteria | 636 |
| 119 | Ga0070711_100013670 | 3300005439 | Bacteria | 5100 |
| 120 | Ga0070711_100016837 | 3300005439 | Bacteria | 4646 |
| 121 | Ga0070711_100020555 | 3300005439 | Bacteria | 4256 |
| 122 | Ga0070711_100079548 | 3300005439 | Bacteria | 2332 |
| 123 | Ga0070711_100721311 | 3300005439 | Bacteria | 841 |
| 124 | Ga0070711_100741224 | 3300005439 | Bacteria | 830 |
| 125 | Ga0070711_101264160 | 3300005439 | Bacteria | 640 |
| 126 | Ga0070705_100063810 | 3300005440 | Bacteria | 2198 |
| 127 | Ga0070705_100171300 | 3300005440 | Bacteria | 1461 |
| 128 | Ga0070705_100324585 | 3300005440 | Bacteria | 1113 |
| 129 | Ga0070705_100550422 | 3300005440 | Unclassified | 884 |
| 130 | Ga0070705_100885761 | 3300005440 | Unclassified | 717 |
| 131 | Ga0070705_101578107 | 3300005440 | Bacteria | 552 |
| 132 | Ga0070700_100006069 | 3300005441 | Bacteria | 6432 |
| 133 | Ga0070700_100449788 | 3300005441 | Bacteria | 980 |
| 134 | Ga0070700_100901886 | 3300005441 | Bacteria | 720 |
| 135 | Ga0070700_101226974 | 3300005441 | Bacteria | 627 |
| 136 | Ga0070694_100006994 | 3300005444 | Bacteria | 6860 |
| 137 | Ga0070694_100238868 | 3300005444 | Unclassified | 1370 |
| 138 | Ga0070694_100951663 | 3300005444 | Unclassified | 711 |
| 139 | Ga0070694_101958939 | 3300005444 | Unclassified | 501 |
| 140 | Ga0070708_100120073 | 3300005445 | Bacteria | 2424 |
| 141 | Ga0070708_100146282 | 3300005445 | Bacteria | 2195 |
| 142 | Ga0070708_100180628 | 3300005445 | Unclassified | 1972 |
| 143 | Ga0070708_100229094 | 3300005445 | Bacteria | 1743 |
| 144 | Ga0070708_100333774 | 3300005445 | Bacteria | 1429 |
| 145 | Ga0070708_100371625 | 3300005445 | Bacteria | 1348 |
| 146 | Ga0070708_100560246 | 3300005445 | Bacteria | 1078 |
| 147 | Ga0070708_101172842 | 3300005445 | Bacteria | 719 |
| 148 | Ga0070708_101348185 | 3300005445 | Bacteria | 666 |
| 149 | Ga0070708_101987053 | 3300005445 | Unclassified | 538 |
| 150 | Ga0070663_100051962 | 3300005455 | Bacteria | 2921 |
| 151 | Ga0070678_100158820 | 3300005456 | Bacteria | 1829 |
| 152 | Ga0070678_100212788 | 3300005456 | Bacteria | 1603 |
| 153 | Ga0070678_100251223 | 3300005456 | Bacteria | 1483 |
| 154 | Ga0070678_100660657 | 3300005456 | Bacteria | 938 |
| 155 | Ga0070678_101385879 | 3300005456 | Bacteria | 656 |
| 156 | Ga0070678_101782474 | 3300005456 | Bacteria | 580 |
| 157 | Ga0070662_100450671 | 3300005457 | Bacteria | 1068 |
| 158 | Ga0070662_101003088 | 3300005457 | Bacteria | 715 |
| 159 | Ga0070681_10049123 | 3300005458 | Bacteria | 4215 |
| 160 | Ga0070681_10058032 | 3300005458 | Bacteria | 3851 |
| 161 | Ga0070681_10156680 | 3300005458 | Bacteria | 2202 |
| 162 | Ga0070681_10359146 | 3300005458 | Bacteria | 1367 |
| 163 | Ga0070681_11044004 | 3300005458 | Unclassified | 737 |
| 164 | Ga0070681_11894441 | 3300005458 | Bacteria | 524 |
| 165 | Ga0068867_100087002 | 3300005459 | Unclassified | 2365 |
| 166 | Ga0068867_100200655 | 3300005459 | Unclassified | 1597 |
| 167 | Ga0070685_10059828 | 3300005466 | Unclassified | 2225 |
| 168 | Ga0070706_100005941 | 3300005467 | Bacteria | 11541 |
| 169 | Ga0070706_100016460 | 3300005467 | Bacteria | 6833 |
| 170 | Ga0070706_100017080 | 3300005467 | Bacteria | 6704 |
| 171 | Ga0070706_100107671 | 3300005467 | Unclassified | 2593 |
| 172 | Ga0070706_100153993 | 3300005467 | Bacteria | 2146 |
| 173 | Ga0070706_100508344 | 3300005467 | Bacteria | 1121 |
| 174 | Ga0070706_100550886 | 3300005467 | Bacteria | 1073 |
| 175 | Ga0070706_101523629 | 3300005467 | Bacteria | 611 |
| 176 | Ga0070706_101597429 | 3300005467 | Unclassified | 595 |
| 177 | Ga0070706_101774773 | 3300005467 | Bacteria | 561 |
| 178 | Ga0070707_100001116 | 3300005468 | Bacteria | 26505 |
| 179 | Ga0070707_100002726 | 3300005468 | Bacteria | 16796 |
| 180 | Ga0070707_100004597 | 3300005468 | Bacteria | 12914 |
| 181 | Ga0070707_100065690 | 3300005468 | Bacteria | 3486 |
| 182 | Ga0070707_100126263 | 3300005468 | Bacteria | 2486 |
| 183 | Ga0070707_100653591 | 3300005468 | Unclassified | 1014 |
| 184 | Ga0070707_100813928 | 3300005468 | Unclassified | 898 |
| 185 | Ga0070707_101051699 | 3300005468 | Bacteria | 780 |
| 186 | Ga0070707_101475020 | 3300005468 | Bacteria | 647 |
| 187 | Ga0070707_101628331 | 3300005468 | Bacteria | 613 |
| 188 | Ga0070707_101811471 | 3300005468 | Bacteria | 578 |
| 189 | Ga0070698_100001818 | 3300005471 | Bacteria | 23727 |
| 190 | Ga0070698_100068930 | 3300005471 | Bacteria | 3553 |
| 191 | Ga0070698_100070866 | 3300005471 | Bacteria | 3497 |
| 192 | Ga0070698_100081594 | 3300005471 | Bacteria | 3228 |
| 193 | Ga0070698_100224119 | 3300005471 | Bacteria | 1813 |
| 194 | Ga0070698_100264670 | 3300005471 | Archaea | 1651 |
| 195 | Ga0070698_100547204 | 3300005471 | Bacteria | 1097 |
| 196 | Ga0070698_100970761 | 3300005471 | Bacteria | 796 |
| 197 | Ga0070698_101420625 | 3300005471 | Unclassified | 645 |
| 198 | Ga0070699_100008589 | 3300005518 | Bacteria | 8852 |
| 199 | Ga0070699_100021417 | 3300005518 | Bacteria | 5575 |
| 200 | Ga0070699_100077528 | 3300005518 | Bacteria | 2893 |
| 201 | Ga0070699_100447006 | 3300005518 | Bacteria | 1171 |
| 202 | Ga0070699_100596007 | 3300005518 | Bacteria | 1007 |
| 203 | Ga0070699_100603673 | 3300005518 | Bacteria | 1001 |
| 204 | Ga0070699_101757676 | 3300005518 | Bacteria | 568 |
| 205 | Ga0070679_100016558 | 3300005530 | Bacteria | 7117 |
| 206 | Ga0070679_100058865 | 3300005530 | Bacteria | 3829 |
| 207 | Ga0070679_100098276 | 3300005530 | Bacteria | 2915 |
| 208 | Ga0070679_100393218 | 3300005530 | Bacteria | 1332 |
| 209 | Ga0070679_100691282 | 3300005530 | Bacteria | 963 |
| 210 | Ga0070679_100765106 | 3300005530 | Bacteria | 909 |
| 211 | Ga0070679_100814414 | 3300005530 | Bacteria | 877 |
| 212 | Ga0070679_101234373 | 3300005530 | Bacteria | 693 |
| 213 | Ga0070684_100030393 | 3300005535 | Bacteria | 4589 |
| 214 | Ga0070684_100038632 | 3300005535 | Bacteria | 4102 |
| 215 | Ga0070684_100174055 | 3300005535 | Bacteria | 1956 |
| 216 | Ga0070684_100288905 | 3300005535 | Bacteria | 1503 |
| 217 | Ga0070684_100589108 | 3300005535 | Bacteria | 1034 |
| 218 | Ga0070684_101119842 | 3300005535 | Unclassified | 740 |
| 219 | Ga0070697_100209001 | 3300005536 | Bacteria | 1661 |
| 220 | Ga0070697_100342388 | 3300005536 | Bacteria | 1290 |
| 221 | Ga0068853_100156719 | 3300005539 | Unclassified | 2052 |
| 222 | Ga0068853_101055956 | 3300005539 | Bacteria | 783 |
| 223 | Ga0070672_100137555 | 3300005543 | Unclassified | 2012 |
| 224 | Ga0070672_100364294 | 3300005543 | Bacteria | 1234 |
| 225 | Ga0070672_102015564 | 3300005543 | Bacteria | 520 |
| 226 | Ga0070686_100001847 | 3300005544 | Bacteria | 11811 |
| 227 | Ga0070695_100000005 | 3300005545 | Bacteria | 97484 |
| 228 | Ga0070695_100024161 | 3300005545 | Bacteria | 3741 |
| 229 | Ga0070695_100422896 | 3300005545 | Bacteria | 1015 |
| 230 | Ga0070695_100551843 | 3300005545 | Bacteria | 898 |
| 231 | Ga0070695_100799124 | 3300005545 | Unclassified | 756 |
| 232 | Ga0070696_100149142 | 3300005546 | Unclassified | 1715 |
| 233 | Ga0070696_100161223 | 3300005546 | Bacteria | 1652 |
| 234 | Ga0070696_100532324 | 3300005546 | Bacteria | 939 |
| 235 | Ga0070696_100553588 | 3300005546 | Bacteria | 922 |
| 236 | Ga0070696_100924306 | 3300005546 | Unclassified | 725 |
| 237 | Ga0070696_101216703 | 3300005546 | Bacteria | 637 |
| 238 | Ga0070693_100010553 | 3300005547 | Bacteria | 4632 |
| 239 | Ga0070693_100279221 | 3300005547 | Bacteria | 1118 |
| 240 | Ga0070693_100320990 | 3300005547 | Bacteria | 1051 |
| 241 | Ga0070693_100610165 | 3300005547 | Bacteria | 789 |
| 242 | Ga0070665_100026234 | 3300005548 | Bacteria | 5868 |
| 243 | Ga0070665_100198118 | 3300005548 | Bacteria | 2009 |
| 244 | Ga0070665_101134344 | 3300005548 | Bacteria | 793 |
| 245 | Ga0070704_100017479 | 3300005549 | Bacteria | 4561 |
| 246 | Ga0070704_100118053 | 3300005549 | Bacteria | 2032 |
| 247 | Ga0070704_100166190 | 3300005549 | Bacteria | 1750 |
| 248 | Ga0070704_100566368 | 3300005549 | Bacteria | 994 |
| 249 | Ga0070704_101892852 | 3300005549 | Bacteria | 553 |
| 250 | Ga0068855_100076265 | 3300005563 | Bacteria | 3891 |
| 251 | Ga0068855_100809736 | 3300005563 | Bacteria | 995 |
| 252 | Ga0068855_100905259 | 3300005563 | Bacteria | 932 |
| 253 | Ga0068855_101185266 | 3300005563 | Bacteria | 795 |
| 254 | Ga0068855_101455072 | 3300005563 | Bacteria | 705 |
| 255 | Ga0068855_101616811 | 3300005563 | Bacteria | 663 |
| 256 | Ga0070664_100626125 | 3300005564 | Bacteria | 999 |
| 257 | Ga0070664_101116768 | 3300005564 | Bacteria | 743 |
| 258 | Ga0070664_102072552 | 3300005564 | Unclassified | 540 |
| 259 | Ga0068857_100307574 | 3300005577 | Bacteria | 1462 |
| 260 | Ga0068857_101946336 | 3300005577 | Unclassified | 576 |
| 261 | Ga0068854_100392018 | 3300005578 | Bacteria | 1147 |
| 262 | Ga0068854_101473511 | 3300005578 | Bacteria | 617 |
| 263 | Ga0068856_100034234 | 3300005614 | Bacteria | 4976 |
| 264 | Ga0068856_100069684 | 3300005614 | Bacteria | 3477 |
| 265 | Ga0068856_100082822 | 3300005614 | Bacteria | 3184 |
| 266 | Ga0068856_100191552 | 3300005614 | Bacteria | 2058 |
| 267 | Ga0068856_100248954 | 3300005614 | Bacteria | 1792 |
| 268 | Ga0068856_100341259 | 3300005614 | Bacteria | 1516 |
| 269 | Ga0068856_100401206 | 3300005614 | Bacteria | 1391 |
| 270 | Ga0068856_100477401 | 3300005614 | Bacteria | 1268 |
| 271 | Ga0068856_100569816 | 3300005614 | Bacteria | 1153 |
| 272 | Ga0068856_100755407 | 3300005614 | Bacteria | 992 |
| 273 | Ga0068856_100854556 | 3300005614 | Unclassified | 929 |
| 274 | Ga0068856_100930482 | 3300005614 | Bacteria | 888 |
| 275 | Ga0068856_102294030 | 3300005614 | Bacteria | 548 |
| 276 | Ga0068856_102407227 | 3300005614 | Bacteria | 534 |
| 277 | Ga0070702_100028675 | 3300005615 | Bacteria | 3018 |
| 278 | Ga0070702_100409223 | 3300005615 | Bacteria | 973 |
| 279 | Ga0070702_100565110 | 3300005615 | Bacteria | 847 |
| 280 | Ga0068852_100877005 | 3300005616 | Bacteria | 914 |
| 281 | Ga0068852_101453369 | 3300005616 | Bacteria | 708 |
| 282 | Ga0068859_100108825 | 3300005617 | Unclassified | 2833 |
| 283 | Ga0068864_100479883 | 3300005618 | Bacteria | 1193 |
| 284 | Ga0068864_100708168 | 3300005618 | Bacteria | 984 |
| 285 | Ga0068866_10033457 | 3300005718 | Bacteria | 2494 |
| 286 | Ga0068866_10177917 | 3300005718 | Bacteria | 1254 |
| 287 | Ga0068861_100063568 | 3300005719 | Bacteria | 2837 |
| 288 | Ga0068861_101518106 | 3300005719 | Bacteria | 658 |
| 289 | Ga0068851_10189284 | 3300005834 | Bacteria | 1143 |
| 290 | Ga0068870_10208524 | 3300005840 | Bacteria | 1189 |
| 291 | Ga0068863_100239616 | 3300005841 | Bacteria | 1751 |
| 292 | Ga0068863_100259997 | 3300005841 | Bacteria | 1678 |
| 293 | Ga0068863_102584730 | 3300005841 | Unclassified | 517 |
| 294 | Ga0068858_100895036 | 3300005842 | Bacteria | 868 |
| 295 | Ga0068860_100051850 | 3300005843 | Bacteria | 3903 |
| 296 | Ga0068860_100746623 | 3300005843 | Bacteria | 990 |
| 297 | Ga0068862_100982905 | 3300005844 | Bacteria | 834 |
| 298 | Ga0068862_101420508 | 3300005844 | Bacteria | 698 |
| 299 | Ga0081455_10020437 | 3300005937 | Bacteria | 6234 |
| 300 | Ga0081455_10020619 | 3300005937 | Bacteria | 6200 |
| 301 | Ga0081455_10108857 | 3300005937 | Bacteria | 2206 |
| 302 | Ga0081455_10213301 | 3300005937 | Unclassified | 1437 |
| 303 | Ga0081455_10356485 | 3300005937 | Viruses | 1030 |
| 304 | Ga0081538_10029358 | 3300005981 | Bacteria | 3758 |
| 305 | Ga0081538_10066336 | 3300005981 | Unclassified | 2024 |
| 306 | Ga0081538_10161978 | 3300005981 | Bacteria | 992 |
| 307 | Ga0081538_10212734 | 3300005981 | Bacteria | 777 |
| 308 | Ga0081540_1004661 | 3300005983 | Bacteria | 10374 |
| 309 | Ga0081540_1048522 | 3300005983 | Bacteria | 2126 |
| 310 | Ga0081540_1265075 | 3300005983 | Unclassified | 596 |
| 311 | Ga0081539_10014095 | 3300005985 | Bacteria | 5945 |
| 312 | Ga0081539_10071976 | 3300005985 | Bacteria | 1850 |
| 313 | Ga0070717_10008509 | 3300006028 | Bacteria | 7663 |
| 314 | Ga0070717_10009572 | 3300006028 | Bacteria | 7288 |
| 315 | Ga0070717_10128713 | 3300006028 | Bacteria | 2175 |
| 316 | Ga0070717_10148806 | 3300006028 | Bacteria | 2025 |
| 317 | Ga0070717_10170441 | 3300006028 | Bacteria | 1893 |
| 318 | Ga0070717_10385383 | 3300006028 | Bacteria | 1257 |
| 319 | Ga0070717_10493056 | 3300006028 | Bacteria | 1107 |
| 320 | Ga0070717_10541002 | 3300006028 | Unclassified | 1054 |
| 321 | Ga0070717_10755438 | 3300006028 | Unclassified | 884 |
| 322 | Ga0075365_10021013 | 3300006038 | Bacteria | 4062 |
| 323 | Ga0075365_10061283 | 3300006038 | Bacteria | 2512 |
| 324 | Ga0075368_10037491 | 3300006042 | Bacteria | 1896 |
| 325 | Ga0075364_10061285 | 3300006051 | Bacteria | 2467 |
| 326 | Ga0075364_10615757 | 3300006051 | Bacteria | 742 |
| 327 | Ga0075432_10030528 | 3300006058 | Bacteria | 1862 |
| 328 | Ga0075432_10105773 | 3300006058 | Unclassified | 1044 |
| 329 | Ga0075432_10202231 | 3300006058 | Bacteria | 786 |
| 330 | Ga0070715_10000411 | 3300006163 | Bacteria | 10899 |
| 331 | Ga0070715_10071420 | 3300006163 | Bacteria | 1552 |
| 332 | Ga0070716_100003224 | 3300006173 | Bacteria | 7656 |
| 333 | Ga0070716_100004028 | 3300006173 | Bacteria | 6976 |
| 334 | Ga0070716_100117441 | 3300006173 | Unclassified | 1659 |
| 335 | Ga0070716_100356144 | 3300006173 | Bacteria | 1038 |
| 336 | Ga0070716_100362605 | 3300006173 | Bacteria | 1030 |
| 337 | Ga0070716_100403046 | 3300006173 | Bacteria | 984 |
| 338 | Ga0070716_100955972 | 3300006173 | Bacteria | 674 |
| 339 | Ga0070716_101330834 | 3300006173 | Unclassified | 582 |
| 340 | Ga0070716_101331103 | 3300006173 | Bacteria | 582 |
| 341 | Ga0070716_101629147 | 3300006173 | Bacteria | 531 |
| 342 | Ga0070712_100036499 | 3300006175 | Bacteria | 3345 |
| 343 | Ga0070712_100044870 | 3300006175 | Bacteria | 3049 |
| 344 | Ga0070712_100062735 | 3300006175 | Bacteria | 2629 |
| 345 | Ga0070712_100138374 | 3300006175 | Bacteria | 1855 |
| 346 | Ga0070712_100290695 | 3300006175 | Bacteria | 1319 |
| 347 | Ga0070712_100301792 | 3300006175 | Bacteria | 1296 |
| 348 | Ga0070712_101003101 | 3300006175 | Unclassified | 722 |
| 349 | Ga0070712_101071532 | 3300006175 | Unclassified | 699 |
| 350 | Ga0075362_10010441 | 3300006177 | Bacteria | 3626 |
| 351 | Ga0097621_100027775 | 3300006237 | Bacteria | 4453 |
| 352 | Ga0097621_100069381 | 3300006237 | Bacteria | 2910 |
| 353 | Ga0097621_100350317 | 3300006237 | Bacteria | 1313 |
| 354 | Ga0097621_102080695 | 3300006237 | Bacteria | 543 |
| 355 | Ga0068871_100015524 | 3300006358 | Bacteria | 5703 |
| 356 | Ga0068871_100037623 | 3300006358 | Bacteria | 3860 |
| 357 | Ga0068871_100176749 | 3300006358 | Bacteria | 1833 |
| 358 | Ga0068871_100727559 | 3300006358 | Unclassified | 911 |
| 359 | Ga0068871_100951470 | 3300006358 | Bacteria | 798 |
| 360 | Ga0075428_100738413 | 3300006844 | Bacteria | 1048 |
| 361 | Ga0075428_100937113 | 3300006844 | Bacteria | 918 |
| 362 | Ga0075428_101032923 | 3300006844 | Bacteria | 869 |
| 363 | Ga0075428_101137444 | 3300006844 | Unclassified | 824 |
| 364 | Ga0075428_102114165 | 3300006844 | Bacteria | 582 |
| 365 | Ga0075428_102492511 | 3300006844 | Bacteria | 530 |
| 366 | Ga0075430_100082886 | 3300006846 | Bacteria | 2687 |
| 367 | Ga0075431_100046434 | 3300006847 | Bacteria | 4478 |
| 368 | Ga0075431_100129178 | 3300006847 | Bacteria | 2607 |
| 369 | Ga0075431_100198360 | 3300006847 | Bacteria | 2054 |
| 370 | Ga0075431_100881721 | 3300006847 | Bacteria | 865 |
| 371 | Ga0075431_101389175 | 3300006847 | Unclassified | 662 |
| 372 | Ga0075431_102065393 | 3300006847 | Unclassified | 525 |
| 373 | Ga0075433_10010520 | 3300006852 | Bacteria | 7431 |
| 374 | Ga0075433_10083582 | 3300006852 | Bacteria | 2818 |
| 375 | Ga0075433_10313819 | 3300006852 | Bacteria | 1387 |
| 376 | Ga0075433_10940014 | 3300006852 | Bacteria | 754 |
| 377 | Ga0075433_10967560 | 3300006852 | Bacteria | 742 |
| 378 | Ga0075434_100062436 | 3300006871 | Bacteria | 3708 |
| 379 | Ga0075434_100083511 | 3300006871 | Bacteria | 3191 |
| 380 | Ga0075434_100114729 | 3300006871 | Bacteria | 2707 |
| 381 | Ga0075434_100263741 | 3300006871 | Bacteria | 1742 |
| 382 | Ga0075434_101326636 | 3300006871 | Bacteria | 730 |
| 383 | Ga0075434_101335367 | 3300006871 | Bacteria | 728 |
| 384 | Ga0075434_101879194 | 3300006871 | Unclassified | 605 |
| 385 | Ga0075434_101957542 | 3300006871 | Bacteria | 592 |
| 386 | Ga0075434_102540257 | 3300006871 | Bacteria | 513 |
| 387 | Ga0075429_100462076 | 3300006880 | Bacteria | 1112 |
| 388 | Ga0075429_100731047 | 3300006880 | Bacteria | 867 |
| 389 | Ga0075429_101467374 | 3300006880 | Bacteria | 594 |
| 390 | Ga0075429_101778150 | 3300006880 | Bacteria | 535 |
| 391 | Ga0068865_100002569 | 3300006881 | Bacteria | 10774 |
| 392 | Ga0068865_100211781 | 3300006881 | Bacteria | 1511 |
| 393 | Ga0068865_100486787 | 3300006881 | Bacteria | 1026 |
| 394 | Ga0068865_102183233 | 3300006881 | Bacteria | 504 |
| 395 | Ga0075436_100005290 | 3300006914 | Bacteria | 8878 |
| 396 | Ga0075436_100014092 | 3300006914 | Bacteria | 5472 |
| 397 | Ga0075436_100115804 | 3300006914 | Bacteria | 1873 |
| 398 | Ga0075436_100408801 | 3300006914 | Bacteria | 984 |
| 399 | Ga0075436_100767237 | 3300006914 | Unclassified | 717 |
| 400 | Ga0075436_101090722 | 3300006914 | Bacteria | 601 |
| 401 | Ga0097620_100108824 | 3300006931 | Unclassified | 2833 |
| 402 | Ga0075435_100029772 | 3300007076 | Bacteria | 4287 |
| 403 | Ga0075435_100059064 | 3300007076 | Bacteria | 3108 |
| 404 | Ga0075435_100123865 | 3300007076 | Bacteria | 2159 |
| 405 | Ga0075435_100462203 | 3300007076 | Bacteria | 1095 |
| 406 | Ga0075435_100616040 | 3300007076 | Unclassified | 942 |
| 407 | Ga0075435_100675940 | 3300007076 | Unclassified | 897 |
| 408 | Ga0075435_100706151 | 3300007076 | Unclassified | 877 |
| 409 | Ga0075435_101049143 | 3300007076 | Bacteria | 712 |
| 410 | Ga0075435_101582264 | 3300007076 | Unclassified | 575 |
| 411 | Ga0099794_10345463 | 3300007265 | Bacteria | 774 |
| 412 | Ga0099795_10153195 | 3300007788 | Bacteria | 946 |
| 413 | Ga0105251_10465950 | 3300009011 | Bacteria | 587 |
| 414 | Ga0105240_10026970 | 3300009093 | Bacteria | 7530 |
| 415 | Ga0105240_10086355 | 3300009093 | Bacteria | 3842 |
| 416 | Ga0105240_10466016 | 3300009093 | Bacteria | 1411 |
| 417 | Ga0105240_10714686 | 3300009093 | Bacteria | 1092 |
| 418 | Ga0105240_11235172 | 3300009093 | Bacteria | 790 |
| 419 | Ga0105240_11912422 | 3300009093 | Bacteria | 617 |
| 420 | Ga0111539_10026259 | 3300009094 | Bacteria | 7124 |
| 421 | Ga0111539_10311132 | 3300009094 | Bacteria | 1833 |
| 422 | Ga0111539_10422037 | 3300009094 | Bacteria | 1553 |
| 423 | Ga0105245_10006470 | 3300009098 | Bacteria | 10302 |
| 424 | Ga0105245_10016352 | 3300009098 | Bacteria | 6469 |
| 425 | Ga0105245_10032981 | 3300009098 | Bacteria | 4586 |
| 426 | Ga0105245_10093167 | 3300009098 | Bacteria | 2775 |
| 427 | Ga0105245_10217624 | 3300009098 | Bacteria | 1841 |
| 428 | Ga0105245_10647743 | 3300009098 | Unclassified | 1086 |
| 429 | Ga0105245_10920262 | 3300009098 | Bacteria | 917 |
| 430 | Ga0105245_11112558 | 3300009098 | Bacteria | 836 |
| 431 | Ga0105245_11173832 | 3300009098 | Bacteria | 815 |
| 432 | Ga0105247_10039193 | 3300009101 | Bacteria | 2894 |
| 433 | Ga0105247_10041124 | 3300009101 | Unclassified | 2828 |
| 434 | Ga0105247_10455354 | 3300009101 | Bacteria | 923 |
| 435 | Ga0105247_10628807 | 3300009101 | Bacteria | 799 |
| 436 | Ga0114129_10014214 | 3300009147 | Bacteria | 11342 |
| 437 | Ga0114129_10028533 | 3300009147 | Bacteria | 7907 |
| 438 | Ga0114129_10176020 | 3300009147 | Bacteria | 2914 |
| 439 | Ga0114129_10333560 | 3300009147 | Bacteria | 2013 |
| 440 | Ga0114129_10443997 | 3300009147 | Bacteria | 1703 |
| 441 | Ga0114129_11481715 | 3300009147 | Unclassified | 834 |
| 442 | Ga0114129_12161052 | 3300009147 | Bacteria | 670 |
| 443 | Ga0114129_12273645 | 3300009147 | Bacteria | 651 |
| 444 | Ga0114129_12636026 | 3300009147 | Bacteria | 599 |
| 445 | Ga0105243_10006582 | 3300009148 | Bacteria | 8978 |
| 446 | Ga0105243_10176379 | 3300009148 | Bacteria | 1855 |
| 447 | Ga0105243_10472913 | 3300009148 | Bacteria | 1181 |
| 448 | Ga0105243_10920157 | 3300009148 | Bacteria | 871 |
| 449 | Ga0105243_11232722 | 3300009148 | Bacteria | 763 |
| 450 | Ga0105243_11766009 | 3300009148 | Bacteria | 649 |
| 451 | Ga0105241_10010431 | 3300009174 | Bacteria | 6818 |
| 452 | Ga0105241_10225695 | 3300009174 | Bacteria | 1577 |
| 453 | Ga0105241_11189493 | 3300009174 | Unclassified | 722 |
| 454 | Ga0105242_10189764 | 3300009176 | Bacteria | 1819 |
| 455 | Ga0105242_10232541 | 3300009176 | Bacteria | 1653 |
| 456 | Ga0105242_10611090 | 3300009176 | Bacteria | 1054 |
| 457 | Ga0105242_11904192 | 3300009176 | Bacteria | 635 |
| 458 | Ga0105242_12037709 | 3300009176 | Unclassified | 617 |
| 459 | Ga0105242_12283825 | 3300009176 | Bacteria | 587 |
| 460 | Ga0105248_10049097 | 3300009177 | Bacteria | 4734 |
| 461 | Ga0105248_10305897 | 3300009177 | Bacteria | 1790 |
| 462 | Ga0105248_10322552 | 3300009177 | Bacteria | 1740 |
| 463 | Ga0105248_10970970 | 3300009177 | Bacteria | 960 |
| 464 | Ga0105248_11825226 | 3300009177 | Unclassified | 690 |
| 465 | Ga0105248_11914902 | 3300009177 | Unclassified | 673 |
| 466 | Ga0105248_12234074 | 3300009177 | Bacteria | 623 |
| 467 | Ga0105248_12822677 | 3300009177 | Bacteria | 554 |
| 468 | Ga0105237_10016127 | 3300009545 | Bacteria | 7770 |
| 469 | Ga0105237_10082158 | 3300009545 | Bacteria | 3213 |
| 470 | Ga0105237_11400414 | 3300009545 | Unclassified | 706 |
| 471 | Ga0105237_11677159 | 3300009545 | Unclassified | 643 |
| 472 | Ga0105238_10270449 | 3300009551 | Bacteria | 1680 |
| 473 | Ga0105249_10530734 | 3300009553 | Bacteria | 1225 |
| 474 | Ga0105249_11370788 | 3300009553 | Bacteria | 779 |
| 475 | Ga0105249_11793470 | 3300009553 | Bacteria | 686 |
| 476 | Ga0099796_10246869 | 3300010159 | Unclassified | 740 |
| 477 | Ga0105239_10047664 | 3300010375 | Bacteria | 4696 |
| 478 | Ga0105239_10082773 | 3300010375 | Bacteria | 3534 |
| 479 | Ga0105239_10896385 | 3300010375 | Bacteria | 1018 |
| 480 | Ga0105239_10973953 | 3300010375 | Unclassified | 975 |
| 481 | Ga0105239_11374835 | 3300010375 | Bacteria | 815 |
| 482 | Ga0105239_13455417 | 3300010375 | Unclassified | 514 |
| 483 | Ga0105246_10015657 | 3300011119 | Bacteria | 4792 |
| 484 | Ga0105246_10154906 | 3300011119 | Unclassified | 1739 |
| 485 | Ga0105246_10155850 | 3300011119 | Bacteria | 1734 |
| 486 | Ga0105246_10421196 | 3300011119 | Bacteria | 1114 |
| 487 | Ga0105246_10447504 | 3300011119 | Bacteria | 1085 |
| 488 | Ga0105246_11429931 | 3300011119 | Bacteria | 646 |
| 489 | Ga0105246_11560348 | 3300011119 | Bacteria | 622 |
| 490 | Ga0157336_1020165 | 3300012477 | Unclassified | 597 |
| 491 | Ga0157318_1024722 | 3300012482 | Bacteria | 558 |
| 492 | Ga0157321_1030441 | 3300012487 | Bacteria | 548 |
| 493 | Ga0157335_1004864 | 3300012492 | Unclassified | 920 |
| 494 | Ga0157319_1008123 | 3300012497 | Bacteria | 796 |
| 495 | Ga0157347_1011762 | 3300012502 | Bacteria | 934 |
| 496 | Ga0157339_1019802 | 3300012505 | Bacteria | 705 |
| 497 | Ga0157342_1022454 | 3300012507 | Bacteria | 743 |
| 498 | Ga0157315_1027696 | 3300012508 | Unclassified | 644 |
| 499 | Ga0157326_1040471 | 3300012513 | Bacteria | 652 |
| 500 | Ga0157373_10274124 | 3300013100 | Unclassified | 1195 |
| 501 | Ga0157373_10361112 | 3300013100 | Bacteria | 1037 |
| 502 | Ga0157373_10885394 | 3300013100 | Bacteria | 662 |
| 503 | Ga0157371_10044697 | 3300013102 | Bacteria | 3153 |
| 504 | Ga0157371_10343760 | 3300013102 | Bacteria | 1085 |
| 505 | Ga0157371_10377891 | 3300013102 | Unclassified | 1034 |
| 506 | Ga0157370_10189800 | 3300013104 | Bacteria | 1908 |
| 507 | Ga0157370_10325820 | 3300013104 | Bacteria | 1417 |
| 508 | Ga0157370_10872670 | 3300013104 | Bacteria | 817 |
| 509 | Ga0157370_11020394 | 3300013104 | Unclassified | 749 |
| 510 | Ga0157370_11229979 | 3300013104 | Bacteria | 675 |
| 511 | Ga0157370_11394070 | 3300013104 | Bacteria | 631 |
| 512 | Ga0157369_10080357 | 3300013105 | Bacteria | 3491 |
| 513 | Ga0157369_10120813 | 3300013105 | Bacteria | 2780 |
| 514 | Ga0157369_10138075 | 3300013105 | Bacteria | 2580 |
| 515 | Ga0157369_10269526 | 3300013105 | Bacteria | 1774 |
| 516 | Ga0157369_10726452 | 3300013105 | Bacteria | 1022 |
| 517 | Ga0157369_11010926 | 3300013105 | Bacteria | 851 |
| 518 | Ga0157369_11128225 | 3300013105 | Unclassified | 801 |
| 519 | Ga0157369_12651350 | 3300013105 | Unclassified | 506 |
| 520 | Ga0157374_10020635 | 3300013296 | Bacteria | 5851 |
| 521 | Ga0157374_10095491 | 3300013296 | Unclassified | 2843 |
| 522 | Ga0157374_10173495 | 3300013296 | Bacteria | 2104 |
| 523 | Ga0157374_10268809 | 3300013296 | Bacteria | 1681 |
| 524 | Ga0157374_11308648 | 3300013296 | Bacteria | 747 |
| 525 | Ga0157378_10086458 | 3300013297 | Bacteria | 2842 |
| 526 | Ga0157378_11253976 | 3300013297 | Bacteria | 782 |
| 527 | Ga0157378_11257669 | 3300013297 | Bacteria | 780 |
| 528 | Ga0157378_11848308 | 3300013297 | Bacteria | 653 |
| 529 | Ga0157378_11947405 | 3300013297 | Bacteria | 637 |
| 530 | Ga0163162_10051975 | 3300013306 | Bacteria | 4114 |
| 531 | Ga0163162_10322659 | 3300013306 | Bacteria | 1677 |
| 532 | Ga0163162_10876998 | 3300013306 | Bacteria | 1011 |
| 533 | Ga0163162_11863027 | 3300013306 | Bacteria | 688 |
| 534 | Ga0157372_10160028 | 3300013307 | Bacteria | 2602 |
| 535 | Ga0157372_10196442 | 3300013307 | Bacteria | 2337 |
| 536 | Ga0157372_10276342 | 3300013307 | Unclassified | 1953 |
| 537 | Ga0157372_10413923 | 3300013307 | Bacteria | 1571 |
| 538 | Ga0157372_10502340 | 3300013307 | Bacteria | 1414 |
| 539 | Ga0157372_10944775 | 3300013307 | Bacteria | 999 |
| 540 | Ga0157372_11030418 | 3300013307 | Bacteria | 953 |
| 541 | Ga0157372_11511173 | 3300013307 | Bacteria | 774 |
| 542 | Ga0157375_10006851 | 3300013308 | Bacteria | 9931 |
| 543 | Ga0157375_10009400 | 3300013308 | Bacteria | 8582 |
| 544 | Ga0157375_10374897 | 3300013308 | Bacteria | 1589 |
| 545 | Ga0157375_11214135 | 3300013308 | Bacteria | 885 |
| 546 | Ga0157375_13660397 | 3300013308 | Unclassified | 511 |
| 547 | Ga0163163_10687593 | 3300014325 | Bacteria | 1087 |
| 548 | Ga0163163_12793379 | 3300014325 | Bacteria | 545 |
| 549 | Ga0157380_10059961 | 3300014326 | Bacteria | 3039 |
| 550 | Ga0157380_10342071 | 3300014326 | Bacteria | 1396 |
| 551 | Ga0157380_11218644 | 3300014326 | Bacteria | 797 |
| 552 | Ga0157380_11419542 | 3300014326 | Unclassified | 745 |
| 553 | Ga0182008_10006258 | 3300014497 | Bacteria | 6685 |
| 554 | Ga0182008_10062492 | 3300014497 | Bacteria | 1835 |
| 555 | Ga0182008_10084390 | 3300014497 | Bacteria | 1564 |
| 556 | Ga0182008_10471947 | 3300014497 | Bacteria | 685 |
| 557 | Ga0182008_10544273 | 3300014497 | Bacteria | 644 |
| 558 | Ga0182008_10813649 | 3300014497 | Bacteria | 543 |
| 559 | Ga0157377_10004537 | 3300014745 | Bacteria | 6412 |
| 560 | Ga0157377_10079857 | 3300014745 | Bacteria | 1909 |
| 561 | Ga0157377_10550329 | 3300014745 | Bacteria | 815 |
| 562 | Ga0157379_10130378 | 3300014968 | Bacteria | 2263 |
| 563 | Ga0157379_10963677 | 3300014968 | Bacteria | 812 |
| 564 | Ga0157379_11507908 | 3300014968 | Bacteria | 654 |
| 565 | Ga0157379_11532306 | 3300014968 | Bacteria | 649 |
| 566 | Ga0157376_10012855 | 3300014969 | Bacteria | 6227 |
| 567 | Ga0157376_10149906 | 3300014969 | Bacteria | 2102 |
| 568 | Ga0157376_10195967 | 3300014969 | Bacteria | 1856 |
| 569 | Ga0157376_10421366 | 3300014969 | Bacteria | 1296 |
| 570 | Ga0157376_10841849 | 3300014969 | Bacteria | 932 |
| 571 | Ga0157376_12005172 | 3300014969 | Bacteria | 616 |
| 572 | Ga0157376_12624430 | 3300014969 | Bacteria | 544 |
| 573 | Ga0182006_1002844 | 3300015261 | Bacteria | 9220 |
| 574 | Ga0182006_1038260 | 3300015261 | Bacteria | 1897 |
| 575 | Ga0182006_1119563 | 3300015261 | Bacteria | 916 |
| 576 | Ga0182007_10055135 | 3300015262 | Unclassified | 1307 |
| 577 | Ga0182007_10300293 | 3300015262 | Bacteria | 589 |
| 578 | Ga0182005_1135682 | 3300015265 | Bacteria | 708 |
| 579 | Ga0182005_1183412 | 3300015265 | Archaea | 622 |
| 580 | Ga0163161_10333234 | 3300017792 | Bacteria | 1202 |
| 581 | Ga0163161_10528693 | 3300017792 | Unclassified | 964 |
| 582 | Ga0163161_10989445 | 3300017792 | Bacteria | 717 |
| 583 | Ga0197907_10415719 | 3300020069 | Unclassified | 502 |
| 584 | Ga0197907_10599385 | 3300020069 | Bacteria | 932 |
| 585 | Ga0197907_10712153 | 3300020069 | Bacteria | 628 |
| 586 | Ga0197907_10912859 | 3300020069 | Bacteria | 715 |
| 587 | Ga0197907_10976367 | 3300020069 | Bacteria | 1132 |
| 588 | Ga0197907_11296060 | 3300020069 | Bacteria | 847 |
| 589 | Ga0206356_10713961 | 3300020070 | Unclassified | 502 |
| 590 | Ga0206356_10765291 | 3300020070 | Unclassified | 625 |
| 591 | Ga0206356_11023176 | 3300020070 | Bacteria | 1856 |
| 592 | Ga0206355_1068348 | 3300020076 | Bacteria | 732 |
| 593 | Ga0206355_1148949 | 3300020076 | Bacteria | 668 |
| 594 | Ga0206355_1158685 | 3300020076 | Unclassified | 530 |
| 595 | Ga0206355_1187411 | 3300020076 | Bacteria | 567 |
| 596 | Ga0206351_10128392 | 3300020077 | Unclassified | 823 |
| 597 | Ga0206351_10481373 | 3300020077 | Bacteria | 774 |
| 598 | Ga0206352_11289281 | 3300020078 | Bacteria | 609 |
| 599 | Ga0206350_11155711 | 3300020080 | Bacteria | 1011 |
| 600 | Ga0206350_11268713 | 3300020080 | Unclassified | 529 |
| 601 | Ga0206350_11419901 | 3300020080 | Bacteria | 500 |
| 602 | Ga0206354_10205280 | 3300020081 | Unclassified | 1457 |
| 603 | Ga0206354_10380699 | 3300020081 | Bacteria | 1514 |
| 604 | Ga0206354_10993587 | 3300020081 | Bacteria | 699 |
| 605 | Ga0206354_11373038 | 3300020081 | Bacteria | 757 |
| 606 | Ga0206354_11465929 | 3300020081 | Bacteria | 573 |
| 607 | Ga0206354_11603311 | 3300020081 | Unclassified | 1007 |
| 608 | Ga0206353_10651477 | 3300020082 | Unclassified | 1087 |
| 609 | Ga0206353_11608935 | 3300020082 | Bacteria | 3585 |
| 610 | Ga0206353_11750180 | 3300020082 | Bacteria | 902 |
| 611 | Ga0206353_11814207 | 3300020082 | Bacteria | 1819 |
| 612 | Ga0154015_1105780 | 3300020610 | Bacteria | 508 |
| 613 | Ga0213874_10085357 | 3300021377 | Bacteria | 1029 |
| 614 | Ga0224712_10061397 | 3300022467 | Bacteria | 1499 |
| 615 | Ga0224712_10093615 | 3300022467 | Bacteria | 1263 |
| 616 | Ga0224712_10223881 | 3300022467 | Bacteria | 862 |
| 617 | Ga0224712_10532951 | 3300022467 | Bacteria | 569 |
| 618 | Ga0224712_10533197 | 3300022467 | Bacteria | 569 |
| 619 | Ga0207653_10075233 | 3300025885 | Bacteria | 1160 |
| 620 | Ga0207682_10102324 | 3300025893 | Bacteria | 1253 |
| 621 | Ga0207682_10421608 | 3300025893 | Bacteria | 631 |
| 622 | Ga0207692_10010787 | 3300025898 | Bacteria | 3866 |
| 623 | Ga0207692_10019501 | 3300025898 | Bacteria | 3066 |
| 624 | Ga0207692_10094073 | 3300025898 | Bacteria | 1631 |
| 625 | Ga0207692_10240974 | 3300025898 | Bacteria | 1080 |
| 626 | Ga0207692_10262257 | 3300025898 | Bacteria | 1039 |
| 627 | Ga0207692_10285656 | 3300025898 | Bacteria | 1000 |
| 628 | Ga0207692_10327388 | 3300025898 | Bacteria | 939 |
| 629 | Ga0207692_10343219 | 3300025898 | Bacteria | 919 |
| 630 | Ga0207692_10838051 | 3300025898 | Unclassified | 603 |
| 631 | Ga0207642_10023373 | 3300025899 | Bacteria | 2468 |
| 632 | Ga0207642_10334657 | 3300025899 | Bacteria | 888 |
| 633 | Ga0207710_10085677 | 3300025900 | Bacteria | 1468 |
| 634 | Ga0207710_10180769 | 3300025900 | Bacteria | 1035 |
| 635 | Ga0207710_10188880 | 3300025900 | Bacteria | 1014 |
| 636 | Ga0207688_10084658 | 3300025901 | Bacteria | 1815 |
| 637 | Ga0207688_10349015 | 3300025901 | Bacteria | 911 |
| 638 | Ga0207688_10524598 | 3300025901 | Bacteria | 743 |
| 639 | Ga0207688_10596282 | 3300025901 | Bacteria | 696 |
| 640 | Ga0207680_10469580 | 3300025903 | Bacteria | 894 |
| 641 | Ga0207647_10098484 | 3300025904 | Bacteria | 1738 |
| 642 | Ga0207647_10652721 | 3300025904 | Unclassified | 577 |
| 643 | Ga0207685_10200136 | 3300025905 | Bacteria | 938 |
| 644 | Ga0207699_10004728 | 3300025906 | Bacteria | 6506 |
| 645 | Ga0207699_10012388 | 3300025906 | Bacteria | 4338 |
| 646 | Ga0207699_10074686 | 3300025906 | Bacteria | 2083 |
| 647 | Ga0207699_10168694 | 3300025906 | Bacteria | 1463 |
| 648 | Ga0207699_10207042 | 3300025906 | Bacteria | 1332 |
| 649 | Ga0207699_10462396 | 3300025906 | Bacteria | 912 |
| 650 | Ga0207645_10261918 | 3300025907 | Bacteria | 1146 |
| 651 | Ga0207645_10637199 | 3300025907 | Bacteria | 724 |
| 652 | Ga0207643_10063461 | 3300025908 | Bacteria | 2112 |
| 653 | Ga0207705_10542226 | 3300025909 | Bacteria | 904 |
| 654 | Ga0207705_10562132 | 3300025909 | Unclassified | 887 |
| 655 | Ga0207705_10929291 | 3300025909 | Bacteria | 673 |
| 656 | Ga0207705_11429295 | 3300025909 | Bacteria | 525 |
| 657 | Ga0207684_10008813 | 3300025910 | Bacteria | 8956 |
| 658 | Ga0207684_10030845 | 3300025910 | Bacteria | 4562 |
| 659 | Ga0207684_10143351 | 3300025910 | Bacteria | 2054 |
| 660 | Ga0207684_10342575 | 3300025910 | Bacteria | 1287 |
| 661 | Ga0207684_10605041 | 3300025910 | Bacteria | 936 |
| 662 | Ga0207684_11129376 | 3300025910 | Bacteria | 651 |
| 663 | Ga0207654_10083163 | 3300025911 | Bacteria | 1932 |
| 664 | Ga0207654_10236968 | 3300025911 | Bacteria | 1218 |
| 665 | Ga0207707_10018185 | 3300025912 | Bacteria | 6125 |
| 666 | Ga0207707_10092180 | 3300025912 | Bacteria | 2648 |
| 667 | Ga0207707_10138889 | 3300025912 | Bacteria | 2125 |
| 668 | Ga0207707_10478112 | 3300025912 | Bacteria | 1064 |
| 669 | Ga0207707_10488359 | 3300025912 | Bacteria | 1051 |
| 670 | Ga0207707_11600806 | 3300025912 | Bacteria | 513 |
| 671 | Ga0207695_10173737 | 3300025913 | Bacteria | 2078 |
| 672 | Ga0207695_10181618 | 3300025913 | Bacteria | 2025 |
| 673 | Ga0207695_10470553 | 3300025913 | Bacteria | 1139 |
| 674 | Ga0207695_10807905 | 3300025913 | Bacteria | 818 |
| 675 | Ga0207695_11088388 | 3300025913 | Unclassified | 679 |
| 676 | Ga0207695_11409856 | 3300025913 | Unclassified | 577 |
| 677 | Ga0207671_10031915 | 3300025914 | Bacteria | 3923 |
| 678 | Ga0207671_10265899 | 3300025914 | Bacteria | 1350 |
| 679 | Ga0207693_10000807 | 3300025915 | Bacteria | 28042 |
| 680 | Ga0207693_10000924 | 3300025915 | Bacteria | 26395 |
| 681 | Ga0207693_10002104 | 3300025915 | Bacteria | 17374 |
| 682 | Ga0207693_10041055 | 3300025915 | Bacteria | 3644 |
| 683 | Ga0207693_10117679 | 3300025915 | Bacteria | 2087 |
| 684 | Ga0207693_10165785 | 3300025915 | Bacteria | 1739 |
| 685 | Ga0207693_10703607 | 3300025915 | Unclassified | 782 |
| 686 | Ga0207693_10863242 | 3300025915 | Unclassified | 695 |
| 687 | Ga0207663_10009751 | 3300025916 | Bacteria | 5082 |
| 688 | Ga0207663_10015616 | 3300025916 | Bacteria | 4193 |
| 689 | Ga0207663_10030655 | 3300025916 | Bacteria | 3174 |
| 690 | Ga0207663_10085866 | 3300025916 | Bacteria | 2073 |
| 691 | Ga0207663_10120700 | 3300025916 | Bacteria | 1795 |
| 692 | Ga0207663_11264317 | 3300025916 | Unclassified | 594 |
| 693 | Ga0207660_10458774 | 3300025917 | Bacteria | 1031 |
| 694 | Ga0207660_10480598 | 3300025917 | Bacteria | 1007 |
| 695 | Ga0207660_10675849 | 3300025917 | Bacteria | 842 |
| 696 | Ga0207660_10713297 | 3300025917 | Bacteria | 818 |
| 697 | Ga0207660_10759840 | 3300025917 | Bacteria | 791 |
| 698 | Ga0207662_10090539 | 3300025918 | Bacteria | 1881 |
| 699 | Ga0207662_10408574 | 3300025918 | Bacteria | 922 |
| 700 | Ga0207657_10000486 | 3300025919 | Bacteria | 41915 |
| 701 | Ga0207657_10103420 | 3300025919 | Bacteria | 2361 |
| 702 | Ga0207657_10236712 | 3300025919 | Bacteria | 1459 |
| 703 | Ga0207657_10402986 | 3300025919 | Bacteria | 1076 |
| 704 | Ga0207657_10518444 | 3300025919 | Bacteria | 933 |
| 705 | Ga0207649_10539432 | 3300025920 | Bacteria | 891 |
| 706 | Ga0207649_10914043 | 3300025920 | Unclassified | 688 |
| 707 | Ga0207649_11614115 | 3300025920 | Unclassified | 513 |
| 708 | Ga0207652_10027118 | 3300025921 | Bacteria | 4773 |
| 709 | Ga0207652_10105223 | 3300025921 | Bacteria | 2497 |
| 710 | Ga0207652_10730436 | 3300025921 | Bacteria | 882 |
| 711 | Ga0207652_10766881 | 3300025921 | Bacteria | 858 |
| 712 | Ga0207646_10001597 | 3300025922 | Bacteria | 27663 |
| 713 | Ga0207646_10005168 | 3300025922 | Bacteria | 13814 |
| 714 | Ga0207646_10007573 | 3300025922 | Bacteria | 11004 |
| 715 | Ga0207646_10110622 | 3300025922 | Bacteria | 2465 |
| 716 | Ga0207646_10200810 | 3300025922 | Unclassified | 1801 |
| 717 | Ga0207646_10373300 | 3300025922 | Bacteria | 1289 |
| 718 | Ga0207646_10480098 | 3300025922 | Unclassified | 1121 |
| 719 | Ga0207646_10535826 | 3300025922 | Bacteria | 1053 |
| 720 | Ga0207646_11219829 | 3300025922 | Bacteria | 659 |
| 721 | Ga0207646_11309568 | 3300025922 | Bacteria | 632 |
| 722 | Ga0207646_11661720 | 3300025922 | Unclassified | 549 |
| 723 | Ga0207646_11881329 | 3300025922 | Unclassified | 510 |
| 724 | Ga0207681_10079267 | 3300025923 | Bacteria | 2314 |
| 725 | Ga0207694_10134949 | 3300025924 | Bacteria | 1981 |
| 726 | Ga0207650_11268989 | 3300025925 | Bacteria | 627 |
| 727 | Ga0207659_10065504 | 3300025926 | Bacteria | 2633 |
| 728 | Ga0207659_10140631 | 3300025926 | Bacteria | 1873 |
| 729 | Ga0207687_10055681 | 3300025927 | Bacteria | 2772 |
| 730 | Ga0207687_10134605 | 3300025927 | Unclassified | 1868 |
| 731 | Ga0207687_10245456 | 3300025927 | Bacteria | 1421 |
| 732 | Ga0207687_10289592 | 3300025927 | Bacteria | 1316 |
| 733 | Ga0207687_10635357 | 3300025927 | Bacteria | 902 |
| 734 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 735 | Ga0207700_10020161 | 3300025928 | Bacteria | 4521 |
| 736 | Ga0207700_10067077 | 3300025928 | Bacteria | 2745 |
| 737 | Ga0207700_10071397 | 3300025928 | Bacteria | 2673 |
| 738 | Ga0207700_10187646 | 3300025928 | Bacteria | 1735 |
| 739 | Ga0207700_10381320 | 3300025928 | Bacteria | 1233 |
| 740 | Ga0207700_10538567 | 3300025928 | Unclassified | 1035 |
| 741 | Ga0207700_11567284 | 3300025928 | Bacteria | 583 |
| 742 | Ga0207664_10009662 | 3300025929 | Bacteria | 6780 |
| 743 | Ga0207664_10039265 | 3300025929 | Bacteria | 3675 |
| 744 | Ga0207664_10053974 | 3300025929 | Bacteria | 3183 |
| 745 | Ga0207664_10067139 | 3300025929 | Bacteria | 2877 |
| 746 | Ga0207664_10111665 | 3300025929 | Bacteria | 2274 |
| 747 | Ga0207664_10128895 | 3300025929 | Bacteria | 2127 |
| 748 | Ga0207664_10138713 | 3300025929 | Bacteria | 2054 |
| 749 | Ga0207664_10282510 | 3300025929 | Bacteria | 1457 |
| 750 | Ga0207664_10347889 | 3300025929 | Bacteria | 1312 |
| 751 | Ga0207664_10384019 | 3300025929 | Bacteria | 1247 |
| 752 | Ga0207664_11170519 | 3300025929 | Unclassified | 686 |
| 753 | Ga0207664_11193741 | 3300025929 | Bacteria | 679 |
| 754 | Ga0207644_10062612 | 3300025931 | Bacteria | 2699 |
| 755 | Ga0207644_10066090 | 3300025931 | Bacteria | 2632 |
| 756 | Ga0207644_10303177 | 3300025931 | Bacteria | 1288 |
| 757 | Ga0207644_10587920 | 3300025931 | Unclassified | 924 |
| 758 | Ga0207690_10107160 | 3300025932 | Bacteria | 2006 |
| 759 | Ga0207690_10456443 | 3300025932 | Bacteria | 1028 |
| 760 | Ga0207690_10811228 | 3300025932 | Bacteria | 774 |
| 761 | Ga0207706_10314683 | 3300025933 | Bacteria | 1363 |
| 762 | Ga0207686_10066786 | 3300025934 | Bacteria | 2298 |
| 763 | Ga0207686_10076457 | 3300025934 | Bacteria | 2171 |
| 764 | Ga0207686_10679632 | 3300025934 | Bacteria | 817 |
| 765 | Ga0207686_10680495 | 3300025934 | Bacteria | 816 |
| 766 | Ga0207686_10683756 | 3300025934 | Bacteria | 814 |
| 767 | Ga0207709_10268584 | 3300025935 | Bacteria | 1254 |
| 768 | Ga0207709_10279248 | 3300025935 | Bacteria | 1233 |
| 769 | Ga0207709_10394335 | 3300025935 | Bacteria | 1057 |
| 770 | Ga0207709_10763306 | 3300025935 | Bacteria | 778 |
| 771 | Ga0207670_10051744 | 3300025936 | Bacteria | 2759 |
| 772 | Ga0207670_11107102 | 3300025936 | Bacteria | 669 |
| 773 | Ga0207669_10925531 | 3300025937 | Bacteria | 729 |
| 774 | Ga0207669_11908502 | 3300025937 | Bacteria | 508 |
| 775 | Ga0207704_10006080 | 3300025938 | Bacteria | 5596 |
| 776 | Ga0207704_10153130 | 3300025938 | Bacteria | 1630 |
| 777 | Ga0207704_10163892 | 3300025938 | Bacteria | 1585 |
| 778 | Ga0207665_10000058 | 3300025939 | Bacteria | 72882 |
| 779 | Ga0207665_10001956 | 3300025939 | Bacteria | 13858 |
| 780 | Ga0207665_10010709 | 3300025939 | Bacteria | 6023 |
| 781 | Ga0207665_10116071 | 3300025939 | Bacteria | 1886 |
| 782 | Ga0207665_10485646 | 3300025939 | Bacteria | 952 |
| 783 | Ga0207665_10499185 | 3300025939 | Bacteria | 940 |
| 784 | Ga0207665_10550787 | 3300025939 | Bacteria | 896 |
| 785 | Ga0207665_10870171 | 3300025939 | Bacteria | 714 |
| 786 | Ga0207665_11102259 | 3300025939 | Bacteria | 633 |
| 787 | Ga0207691_10093311 | 3300025940 | Bacteria | 2696 |
| 788 | Ga0207691_10376604 | 3300025940 | Unclassified | 1212 |
| 789 | Ga0207691_11230497 | 3300025940 | Bacteria | 620 |
| 790 | Ga0207711_10023157 | 3300025941 | Bacteria | 5198 |
| 791 | Ga0207711_10154130 | 3300025941 | Unclassified | 2075 |
| 792 | Ga0207711_10223640 | 3300025941 | Bacteria | 1722 |
| 793 | Ga0207711_10494608 | 3300025941 | Bacteria | 1140 |
| 794 | Ga0207711_10527299 | 3300025941 | Bacteria | 1101 |
| 795 | Ga0207711_10910387 | 3300025941 | Bacteria | 818 |
| 796 | Ga0207689_10052839 | 3300025942 | Bacteria | 3347 |
| 797 | Ga0207689_10474564 | 3300025942 | Bacteria | 1047 |
| 798 | Ga0207689_11324315 | 3300025942 | Bacteria | 605 |
| 799 | Ga0207661_10066647 | 3300025944 | Bacteria | 2925 |
| 800 | Ga0207661_10179085 | 3300025944 | Bacteria | 1850 |
| 801 | Ga0207661_10374989 | 3300025944 | Bacteria | 1287 |
| 802 | Ga0207661_10506112 | 3300025944 | Bacteria | 1104 |
| 803 | Ga0207661_11030941 | 3300025944 | Bacteria | 758 |
| 804 | Ga0207661_12121611 | 3300025944 | Unclassified | 508 |
| 805 | Ga0207679_10879573 | 3300025945 | Bacteria | 819 |
| 806 | Ga0207679_11371973 | 3300025945 | Bacteria | 649 |
| 807 | Ga0207679_12084956 | 3300025945 | Unclassified | 515 |
| 808 | Ga0207667_10721663 | 3300025949 | Bacteria | 998 |
| 809 | Ga0207667_11060276 | 3300025949 | Unclassified | 795 |
| 810 | Ga0207667_11545816 | 3300025949 | Bacteria | 633 |
| 811 | Ga0207667_11848469 | 3300025949 | Bacteria | 567 |
| 812 | Ga0207651_10278459 | 3300025960 | Bacteria | 1381 |
| 813 | Ga0207651_10376333 | 3300025960 | Bacteria | 1202 |
| 814 | Ga0207712_10226975 | 3300025961 | Bacteria | 1497 |
| 815 | Ga0207668_10127346 | 3300025972 | Bacteria | 1939 |
| 816 | Ga0207640_10840104 | 3300025981 | Bacteria | 798 |
| 817 | Ga0207640_10867086 | 3300025981 | Unclassified | 786 |
| 818 | Ga0207658_12106996 | 3300025986 | Bacteria | 512 |
| 819 | Ga0207677_10099472 | 3300026023 | Bacteria | 2136 |
| 820 | Ga0207677_10146512 | 3300026023 | Bacteria | 1815 |
| 821 | Ga0207677_11165409 | 3300026023 | Bacteria | 704 |
| 822 | Ga0207677_11412994 | 3300026023 | Bacteria | 641 |
| 823 | Ga0207703_10147797 | 3300026035 | Bacteria | 2046 |
| 824 | Ga0207639_10165616 | 3300026041 | Bacteria | 1867 |
| 825 | Ga0207678_10020158 | 3300026067 | Bacteria | 5856 |
| 826 | Ga0207678_11748936 | 3300026067 | Bacteria | 545 |
| 827 | Ga0207708_10029459 | 3300026075 | Bacteria | 4162 |
| 828 | Ga0207708_10142622 | 3300026075 | Bacteria | 1881 |
| 829 | Ga0207708_10310172 | 3300026075 | Bacteria | 1285 |
| 830 | Ga0207708_10478009 | 3300026075 | Bacteria | 1041 |
| 831 | Ga0207708_10783262 | 3300026075 | Bacteria | 820 |
| 832 | Ga0207708_11274288 | 3300026075 | Bacteria | 644 |
| 833 | Ga0207708_11893952 | 3300026075 | Bacteria | 523 |
| 834 | Ga0207702_10005430 | 3300026078 | Bacteria | 11159 |
| 835 | Ga0207702_10133803 | 3300026078 | Bacteria | 2234 |
| 836 | Ga0207702_10175527 | 3300026078 | Bacteria | 1969 |
| 837 | Ga0207702_10251346 | 3300026078 | Bacteria | 1660 |
| 838 | Ga0207702_10337847 | 3300026078 | Bacteria | 1438 |
| 839 | Ga0207702_10346138 | 3300026078 | Bacteria | 1421 |
| 840 | Ga0207702_10365103 | 3300026078 | Bacteria | 1385 |
| 841 | Ga0207702_10774701 | 3300026078 | Bacteria | 948 |
| 842 | Ga0207702_10805454 | 3300026078 | Bacteria | 929 |
| 843 | Ga0207702_11349379 | 3300026078 | Bacteria | 707 |
| 844 | Ga0207702_11788227 | 3300026078 | Bacteria | 607 |
| 845 | Ga0207702_12452752 | 3300026078 | Unclassified | 508 |
| 846 | Ga0207641_10349890 | 3300026088 | Bacteria | 1408 |
| 847 | Ga0207641_10741395 | 3300026088 | Bacteria | 969 |
| 848 | Ga0207648_10001479 | 3300026089 | Bacteria | 25851 |
| 849 | Ga0207648_10414264 | 3300026089 | Bacteria | 1223 |
| 850 | Ga0207676_10829413 | 3300026095 | Bacteria | 903 |
| 851 | Ga0207674_10459809 | 3300026116 | Bacteria | 1230 |
| 852 | Ga0207674_11432069 | 3300026116 | Unclassified | 660 |
| 853 | Ga0207675_100045622 | 3300026118 | Bacteria | 4095 |
| 854 | Ga0207675_100648569 | 3300026118 | Bacteria | 1062 |
| 855 | Ga0207683_10000336 | 3300026121 | Bacteria | 42739 |
| 856 | Ga0207683_10000966 | 3300026121 | Bacteria | 26320 |
| 857 | Ga0207683_10293865 | 3300026121 | Bacteria | 1486 |
| 858 | Ga0207683_10440091 | 3300026121 | Bacteria | 1201 |
| 859 | Ga0207683_10451140 | 3300026121 | Bacteria | 1186 |
| 860 | Ga0207683_11170572 | 3300026121 | Bacteria | 713 |
| 861 | Ga0209966_1053207 | 3300027695 | Bacteria | 864 |
| 862 | Ga0209813_10171589 | 3300027866 | Bacteria | 788 |
| 863 | Ga0209974_10460877 | 3300027876 | Bacteria | 505 |
| 864 | Ga0207428_10006507 | 3300027907 | Bacteria | 10782 |
| 865 | Ga0207428_10029205 | 3300027907 | Bacteria | 4573 |
| 866 | Ga0207428_10195808 | 3300027907 | Bacteria | 1522 |
| 867 | Ga0207428_10258429 | 3300027907 | Bacteria | 1297 |
| 868 | Ga0207428_10635776 | 3300027907 | Bacteria | 767 |
| 869 | Ga0207428_10825408 | 3300027907 | Unclassified | 658 |
| 870 | Ga0268266_10379883 | 3300028379 | Bacteria | 1332 |
| 871 | Ga0268266_10836009 | 3300028379 | Bacteria | 890 |
| 872 | Ga0268266_11005121 | 3300028379 | Bacteria | 807 |
| 873 | Ga0268265_10376761 | 3300028380 | Bacteria | 1304 |
| 874 | Ga0268265_11977020 | 3300028380 | Bacteria | 590 |
| 875 | Ga0268264_10052067 | 3300028381 | Bacteria | 3413 |
| 876 | Ga0265337_1067003 | 3300028556 | Unclassified | 989 |
| 877 | Ga0265326_10120259 | 3300028558 | Unclassified | 747 |
| 878 | Ga0265326_10144018 | 3300028558 | Bacteria | 680 |
| 879 | Ga0265319_1016012 | 3300028563 | Bacteria | 2883 |
| 880 | Ga0265319_1156879 | 3300028563 | Bacteria | 704 |
| 881 | Ga0265334_10014972 | 3300028573 | Bacteria | 3227 |
| 882 | Ga0265318_10369950 | 3300028577 | Unclassified | 523 |
| 883 | Ga0265323_10173361 | 3300028653 | Bacteria | 685 |
| 884 | Ga0265322_10216270 | 3300028654 | Unclassified | 549 |
| 885 | Ga0265336_10001679 | 3300028666 | Bacteria | 9775 |
| 886 | Ga0265336_10029316 | 3300028666 | Unclassified | 1717 |
| 887 | Ga0265338_10003865 | 3300028800 | Bacteria | 20766 |
| 888 | Ga0265338_10004114 | 3300028800 | Bacteria | 19928 |
| 889 | Ga0265338_10097542 | 3300028800 | Bacteria | 2407 |
| 890 | Ga0265324_10148462 | 3300029957 | Unclassified | 796 |
| 891 | Ga0265330_10005447 | 3300031235 | Bacteria | 6349 |
| 892 | Ga0265339_10003346 | 3300031249 | Bacteria | 11226 |
| 893 | Ga0265327_10046422 | 3300031251 | Unclassified | 2299 |
| 894 | Ga0307408_100276341 | 3300031548 | Unclassified | 1397 |
| 895 | Ga0265313_10009625 | 3300031595 | Bacteria | 6250 |
| 896 | Ga0265314_10371032 | 3300031711 | Unclassified | 781 |
| 897 | Ga0265342_10022365 | 3300031712 | Bacteria | 4020 |
| 898 | Ga0307413_10447126 | 3300031824 | Bacteria | 1025 |
| 899 | Ga0307406_10734701 | 3300031901 | Bacteria | 827 |
| 900 | Ga0307407_10030113 | 3300031903 | Bacteria | 2925 |
| 901 | Ga0307412_10363106 | 3300031911 | Bacteria | 1167 |
| 902 | Ga0307412_10644355 | 3300031911 | Bacteria | 903 |
| 903 | Ga0307412_11662510 | 3300031911 | Bacteria | 584 |
| 904 | Ga0307409_100051516 | 3300031995 | Bacteria | 3151 |
| 905 | Ga0307409_100176643 | 3300031995 | Bacteria | 1886 |
| 906 | Ga0307409_100230698 | 3300031995 | Bacteria | 1678 |
| 907 | Ga0307409_100503556 | 3300031995 | Bacteria | 1180 |
| 908 | Ga0307409_100662188 | 3300031995 | Bacteria | 1039 |
| 909 | Ga0307409_100926126 | 3300031995 | Bacteria | 886 |
| 910 | Ga0307409_101396935 | 3300031995 | Unclassified | 726 |
| 911 | Ga0307409_102511669 | 3300031995 | Bacteria | 544 |
| 912 | Ga0307409_102966286 | 3300031995 | Bacteria | 501 |
| 913 | Ga0307416_100450949 | 3300032002 | Bacteria | 1339 |
| 914 | Ga0307416_100550001 | 3300032002 | Bacteria | 1227 |
| 915 | Ga0307416_100629888 | 3300032002 | Bacteria | 1155 |
| 916 | Ga0307416_101078898 | 3300032002 | Bacteria | 907 |
| 917 | Ga0307414_11081184 | 3300032004 | Bacteria | 740 |
| 918 | Ga0307414_11743633 | 3300032004 | Unclassified | 581 |
| 919 | Ga0307414_11926713 | 3300032004 | Bacteria | 552 |
| 920 | Ga0307415_100194861 | 3300032126 | Bacteria | 1602 |
| 921 | Ga0307415_100291982 | 3300032126 | Bacteria | 1346 |
| 922 | Ga0307415_100930597 | 3300032126 | Bacteria | 803 |
| 923 | Ga0316583_10258442 | 3300032133 | Unclassified | 603 |
| 924 | Ga0373948_0148597 | 3300034817 | Bacteria | 584 |
| 925 | Ga0373959_0054848 | 3300034820 | Bacteria | 869 |
| 926 | Ga0373959_0065496 | 3300034820 | Unclassified | 812 |
| 927 | Ga0373938_0196926 | 3300034957 | Bacteria | 557 |
| 928 | Ga0373928_0248298 | 3300035084 | Bacteria | 529 |
| 929 | Ga0373929_0038574 | 3300035085 | Bacteria | 1052 |
| 930 | Ga0373929_0077209 | 3300035085 | Bacteria | 806 |
| 931 | Ga0373934_0172223 | 3300035086 | Bacteria | 889 |
| 932 | Ga0373934_0483998 | 3300035086 | Bacteria | 520 |
| 933 | Ga0373940_0030290 | 3300035088 | Bacteria | 1439 |
| 934 | Ga0373940_0055002 | 3300035088 | Bacteria | 1126 |
| 935 | Ga0373940_0259277 | 3300035088 | Unclassified | 588 |
| 936 | Ga0373949_0086305 | 3300035090 | Unclassified | 843 |
| 937 | Ga0373949_0101023 | 3300035090 | Bacteria | 790 |
| 938 | Ga0373951_0282638 | 3300035091 | Bacteria | 507 |
| 939 | Ga0373932_0015407 | 3300035112 | Bacteria | 1938 |
| 940 | Ga0373936_0479861 | 3300035113 | Bacteria | 577 |
| 941 | Ga0373939_0269160 | 3300035114 | Bacteria | 669 |
| 942 | Ga0373941_0043704 | 3300035115 | Bacteria | 1396 |
| 943 | Ga0373941_0074037 | 3300035115 | Bacteria | 1137 |
| 944 | Ga0373941_0353631 | 3300035115 | Bacteria | 598 |
| 945 | Ga0373941_0354939 | 3300035115 | Bacteria | 597 |
| 946 | Ga0373953_0196457 | 3300035117 | Bacteria | 872 |
| 947 | Ga0373953_0479189 | 3300035117 | Bacteria | 551 |
| 948 | Ga0373957_0212255 | 3300035120 | Unclassified | 809 |
| 949 | Ga0373960_0195177 | 3300035121 | Unclassified | 713 |
| 950 | Ga0373960_0240966 | 3300035121 | Bacteria | 654 |
| 951 | Ga0373943_0139427 | 3300035170 | Bacteria | 1305 |
| 952 | Ga0373943_0141453 | 3300035170 | Bacteria | 1297 |
| 953 | Ga0373943_0521122 | 3300035170 | Unclassified | 696 |
| 954 | Ga0373946_0154898 | 3300035171 | Bacteria | 1072 |
| 955 | Ga0373955_0093261 | 3300035172 | Bacteria | 1719 |
| 956 | Ga0373942_0034443 | 3300035207 | Bacteria | 1355 |
| 957 | Ga0373942_0045711 | 3300035207 | Bacteria | 1211 |
| 958 | Ga0373961_0034707 | 3300035241 | Bacteria | 1427 |
| 959 | Ga0373961_0325153 | 3300035241 | Bacteria | 574 |
| 960 | Ga0373962_0073173 | 3300035242 | Bacteria | 1028 |
| 961 | Ga0373924_0098360 | 3300035410 | Bacteria | 1257 |
| 962 | Ga0373931_0019574 | 3300035691 | Bacteria | 3381 |
| 963 | Ga0373931_0033045 | 3300035691 | Bacteria | 2679 |
| 964 | Ga0373931_0144160 | 3300035691 | Bacteria | 1383 |
| 965 | Ga0373931_0345405 | 3300035691 | Unclassified | 930 |
| 966 | Ga0373931_0380598 | 3300035691 | Bacteria | 890 |
| 967 | Ga0373931_0422794 | 3300035691 | Bacteria | 847 |
| 968 | Ga0373931_0455315 | 3300035691 | Bacteria | 819 |
| 969 | Ga0373935_0052968 | 3300035692 | Bacteria | 2581 |
| 970 | Ga0373935_0837623 | 3300035692 | Bacteria | 680 |
| 971 | Ga0373933_0309184 | 3300035724 | Unclassified | 1024 |
| 972 | Ga0373933_0588774 | 3300035724 | Bacteria | 730 |
| 973 | Ga0373947_0190601 | 3300035725 | Bacteria | 1338 |
| 974 | Ga0373947_0548662 | 3300035725 | Bacteria | 787 |
| 975 | Ga0373937_0002464 | 3300036401 | Bacteria | 15386 |
| 976 | Ga0373937_0233521 | 3300036401 | Unclassified | 1732 |
| 977 | Ga0373937_0271071 | 3300036401 | Unclassified | 1602 |
| 978 | Ga0373925_0136982 | 3300037068 | Bacteria | 1914 |
| 979 | Ga0373925_0204883 | 3300037068 | Bacteria | 1570 |
| 980 | Ga0373925_0346253 | 3300037068 | Bacteria | 1206 |
| 981 | Ga0395899_0031469 | 3300037312 | Bacteria | 3987 |
| 982 | Ga0395899_0034136 | 3300037312 | Bacteria | 3819 |
| 983 | Ga0395899_0043891 | 3300037312 | Bacteria | 3332 |
| 984 | Ga0395899_0057550 | 3300037312 | Bacteria | 2870 |
| 985 | Ga0395899_0065359 | 3300037312 | Bacteria | 2673 |
| 986 | Ga0395899_0087833 | 3300037312 | Bacteria | 2256 |
| 987 | Ga0395899_0143943 | 3300037312 | Unclassified | 1694 |
| 988 | Ga0395899_0237483 | 3300037312 | Bacteria | 1256 |
| 989 | Ga0395899_0259443 | 3300037312 | Unclassified | 1189 |
| 990 | Ga0395899_0288125 | 3300037312 | Unclassified | 1115 |
| 991 | Ga0395899_0352059 | 3300037312 | Bacteria | 985 |
| 992 | Ga0395899_0495672 | 3300037312 | Unclassified | 793 |
| 993 | Ga0395899_0554141 | 3300037312 | Bacteria | 738 |
| 994 | Ga0395899_0575662 | 3300037312 | Unclassified | 720 |
| 995 | Ga0395899_0929114 | 3300037312 | Bacteria | 529 |
| 996 | Ga0395900_0002317 | 3300037418 | Bacteria | 21119 |
| 997 | Ga0395900_0003596 | 3300037418 | Bacteria | 16662 |
| 998 | Ga0395900_0005500 | 3300037418 | Bacteria | 13258 |
| 999 | Ga0395900_0006561 | 3300037418 | Bacteria | 12123 |
| 1000 | Ga0395900_0007355 | 3300037418 | Bacteria | 11384 |
| 1001 | Ga0395900_0030414 | 3300037418 | Bacteria | 5546 |
| 1002 | Ga0395900_0092124 | 3300037418 | Bacteria | 3114 |
| 1003 | Ga0395900_0138465 | 3300037418 | Bacteria | 2493 |
| 1004 | Ga0395900_0161221 | 3300037418 | Unclassified | 2287 |
| 1005 | Ga0395900_0163977 | 3300037418 | Bacteria | 2266 |
| 1006 | Ga0395900_0186802 | 3300037418 | Bacteria | 2103 |
| 1007 | Ga0395900_0225896 | 3300037418 | Bacteria | 1885 |
| 1008 | Ga0395900_0318042 | 3300037418 | Bacteria | 1537 |
| 1009 | Ga0395900_0419059 | 3300037418 | Bacteria | 1300 |
| 1010 | Ga0395900_0526589 | 3300037418 | Unclassified | 1129 |
| 1011 | Ga0395900_0810967 | 3300037418 | Bacteria | 863 |
| 1012 | Ga0395900_0976638 | 3300037418 | Bacteria | 768 |
| 1013 | Ga0395900_1347952 | 3300037418 | Bacteria | 627 |
| 1014 | Ga0395900_1513732 | 3300037418 | Bacteria | 583 |
| 1015 | Ga0395898_0002928 | 3300037466 | Bacteria | 19413 |
| 1016 | Ga0395898_0005497 | 3300037466 | Bacteria | 13684 |
| 1017 | Ga0395898_0007699 | 3300037466 | Bacteria | 11437 |
| 1018 | Ga0395898_0011504 | 3300037466 | Bacteria | 9189 |
| 1019 | Ga0395898_0017360 | 3300037466 | Bacteria | 7351 |
| 1020 | Ga0395898_0017648 | 3300037466 | Bacteria | 7285 |
| 1021 | Ga0395898_0044942 | 3300037466 | Bacteria | 4342 |
| 1022 | Ga0395898_0072989 | 3300037466 | Bacteria | 3314 |
| 1023 | Ga0395898_0076407 | 3300037466 | Bacteria | 3234 |
| 1024 | Ga0395898_0077931 | 3300037466 | Bacteria | 3199 |
| 1025 | Ga0395898_0131358 | 3300037466 | Bacteria | 2398 |
| 1026 | Ga0395898_0142627 | 3300037466 | Bacteria | 2293 |
| 1027 | Ga0395898_0267353 | 3300037466 | Bacteria | 1631 |
| 1028 | Ga0395898_0327083 | 3300037466 | Unclassified | 1462 |
| 1029 | Ga0395898_0350929 | 3300037466 | Bacteria | 1407 |
| 1030 | Ga0395898_0379529 | 3300037466 | Bacteria | 1348 |
| 1031 | Ga0395898_0757608 | 3300037466 | Unclassified | 912 |
| 1032 | Ga0395898_1409451 | 3300037466 | Unclassified | 624 |
| 1033 | Ga0395898_1948504 | 3300037466 | Bacteria | 507 |
| 1034 | Ga0395905_0000698 | 3300037471 | Bacteria | 44490 |
| 1035 | Ga0395905_0002827 | 3300037471 | Bacteria | 19021 |
| 1036 | Ga0395905_0004158 | 3300037471 | Bacteria | 15144 |
| 1037 | Ga0395905_0005462 | 3300037471 | Bacteria | 12965 |
| 1038 | Ga0395905_0010671 | 3300037471 | Bacteria | 8910 |
| 1039 | Ga0395905_0023407 | 3300037471 | Bacteria | 5837 |
| 1040 | Ga0395905_0029867 | 3300037471 | Bacteria | 5138 |
| 1041 | Ga0395905_0079110 | 3300037471 | Bacteria | 3081 |
| 1042 | Ga0395905_0089827 | 3300037471 | Bacteria | 2879 |
| 1043 | Ga0395905_0111130 | 3300037471 | Bacteria | 2573 |
| 1044 | Ga0395905_0336919 | 3300037471 | Bacteria | 1399 |
| 1045 | Ga0395905_1018305 | 3300037471 | Bacteria | 731 |
| 1046 | Ga0395901_0001102 | 3300038443 | Bacteria | 28752 |
| 1047 | Ga0395901_0002126 | 3300038443 | Bacteria | 20297 |
| 1048 | Ga0395901_0002813 | 3300038443 | Bacteria | 17572 |
| 1049 | Ga0395901_0007390 | 3300038443 | Bacteria | 11084 |
| 1050 | Ga0395901_0012117 | 3300038443 | Bacteria | 8747 |
| 1051 | Ga0395901_0019191 | 3300038443 | Bacteria | 6989 |
| 1052 | Ga0395901_0042603 | 3300038443 | Bacteria | 4707 |
| 1053 | Ga0395901_0043416 | 3300038443 | Bacteria | 4663 |
| 1054 | Ga0395901_0087341 | 3300038443 | Bacteria | 3261 |
| 1055 | Ga0395901_0088539 | 3300038443 | Bacteria | 3238 |
| 1056 | Ga0395901_0099635 | 3300038443 | Bacteria | 3047 |
| 1057 | Ga0395901_0150684 | 3300038443 | Bacteria | 2444 |
| 1058 | Ga0395901_0191471 | 3300038443 | Bacteria | 2145 |
| 1059 | Ga0395901_0248811 | 3300038443 | Bacteria | 1852 |
| 1060 | Ga0395901_0317611 | 3300038443 | Bacteria | 1612 |
| 1061 | Ga0395901_0338879 | 3300038443 | Bacteria | 1553 |
| 1062 | Ga0395901_0367396 | 3300038443 | Bacteria | 1482 |
| 1063 | Ga0395901_0389792 | 3300038443 | Unclassified | 1432 |
| 1064 | Ga0395901_0447404 | 3300038443 | Unclassified | 1322 |
| 1065 | Ga0395901_0634942 | 3300038443 | Bacteria | 1073 |
| 1066 | Ga0395901_1098888 | 3300038443 | Bacteria | 766 |
| 1067 | Ga0395901_1153524 | 3300038443 | Bacteria | 743 |
| 1068 | Ga0395901_1258516 | 3300038443 | Unclassified | 703 |
| 1069 | Ga0395901_1744204 | 3300038443 | Bacteria | 573 |
| 1070 | Ga0395901_2080438 | 3300038443 | Unclassified | 513 |
| 1071 | Ga0436363_0575511 | 3300039450 | Bacteria | 1441 |
| 1072 | Ga0439438_092942 | 3300041405 | Bacteria | 734 |
| 1073 | Ga0439461_0002163 | 3300041410 | Bacteria | 3114 |
| 1074 | Ga0439461_0030378 | 3300041410 | Bacteria | 1123 |
| 1075 | Ga0439466_0156092 | 3300041411 | Bacteria | 698 |
| 1076 | Ga0439465_0094353 | 3300041413 | Bacteria | 1027 |
| 1077 | Ga0451789_0931210 | 3300041443 | Archaea | 871 |
| 1078 | Ga0451800_0626990 | 3300041459 | Unclassified | 615 |
| 1079 | Ga0451800_1510129 | 3300041459 | Unclassified | 809 |
| 1080 | Ga0451807_1287325 | 3300041486 | Bacteria | 669 |
| 1081 | Ga0451833_0099372 | 3300041491 | Bacteria | 531 |
| 1082 | Ga0451839_0645495 | 3300041496 | Unclassified | 554 |
| 1083 | Ga0451847_0684522 | 3300041503 | Bacteria | 565 |
| 1084 | Ga0451849_0924877 | 3300041505 | Bacteria | 535 |
| 1085 | Ga0451853_1843922 | 3300041512 | Bacteria | 1281 |
| 1086 | Ga0451853_1871389 | 3300041512 | Bacteria | 586 |
| 1087 | Ga0439431_0138357 | 3300041997 | Bacteria | 687 |
| 1088 | Ga0439433_0101055 | 3300041999 | Unclassified | 716 |
| 1089 | Ga0439437_003758 | 3300042000 | Unclassified | 1641 |
| 1090 | Ga0439441_011079 | 3300042001 | Bacteria | 1525 |
| 1091 | Ga0439448_0020940 | 3300042005 | Bacteria | 2027 |
| 1092 | Ga0439448_0023535 | 3300042005 | Bacteria | 1922 |
| 1093 | Ga0439448_0332760 | 3300042005 | Bacteria | 541 |
| 1094 | Ga0439450_036950 | 3300042008 | Bacteria | 1120 |
| 1095 | Ga0439455_0025882 | 3300042012 | Bacteria | 1429 |
| 1096 | Ga0439455_0030751 | 3300042012 | Unclassified | 1334 |
| 1097 | Ga0439463_026392 | 3300042016 | Archaea | 1459 |
| 1098 | Ga0450915_010080 | 3300042119 | Bacteria | 655 |
| 1099 | Ga0450917_003609 | 3300042120 | Bacteria | 1122 |
| 1100 | Ga0450923_036325 | 3300042125 | Bacteria | 1022 |
| 1101 | Ga0450888_003542 | 3300042126 | Bacteria | 1588 |
| 1102 | Ga0450892_025811 | 3300042130 | Unclassified | 598 |
| 1103 | Ga0450900_079428 | 3300042136 | Bacteria | 526 |
| 1104 | Ga0450910_037728 | 3300042147 | Bacteria | 774 |
| 1105 | Ga0439446_0001843 | 3300042156 | Bacteria | 4965 |
| 1106 | Ga0439458_0001865 | 3300042157 | Bacteria | 5233 |
| 1107 | Ga0439434_0011303 | 3300042435 | Bacteria | 2638 |
| 1108 | Ga0439434_0273306 | 3300042435 | Bacteria | 581 |
| 1109 | Ga0439444_0020048 | 3300042437 | Bacteria | 1173 |
| 1110 | Ga0439459_0088222 | 3300042438 | Bacteria | 742 |
| 1111 | Ga0439459_0147883 | 3300042438 | Bacteria | 612 |
| 1112 | Ga0439460_0050102 | 3300042461 | Bacteria | 1250 |
| 1113 | Ga0439460_0226440 | 3300042461 | Bacteria | 642 |
| 1114 | Ga0450916_023532 | 3300042530 | Bacteria | 860 |
| 1115 | Ga0450918_027058 | 3300042531 | Unclassified | 1008 |
| 1116 | Ga0439440_0203594 | 3300042993 | Bacteria | 588 |
| 1117 | Ga0439440_0295012 | 3300042993 | Unclassified | 504 |
| 1118 | Ga0466969_0000416 | 3300044656 | Bacteria | 23320 |
| 1119 | Ga0466969_0183031 | 3300044656 | Bacteria | 959 |
| 1120 | Ga0466972_0021651 | 3300044658 | Bacteria | 3204 |
| 1121 | Ga0466972_0118110 | 3300044658 | Bacteria | 1251 |
| 1122 | Ga0466972_0605835 | 3300044658 | Bacteria | 518 |
| 1123 | Ga0466965_0012753 | 3300044683 | Bacteria | 3958 |
| 1124 | Ga0466965_0066969 | 3300044683 | Bacteria | 1802 |
| 1125 | Ga0466965_0316550 | 3300044683 | Bacteria | 849 |
| 1126 | Ga0466966_0586673 | 3300044684 | Unclassified | 671 |
| 1127 | Ga0466961_0000463 | 3300044693 | Bacteria | 25666 |
| 1128 | Ga0466961_0002397 | 3300044693 | Bacteria | 11644 |
| 1129 | Ga0466961_0018213 | 3300044693 | Bacteria | 4515 |
| 1130 | Ga0466961_0057813 | 3300044693 | Bacteria | 2468 |
| 1131 | Ga0466961_0137595 | 3300044693 | Bacteria | 1530 |
| 1132 | Ga0466961_0170653 | 3300044693 | Bacteria | 1353 |
| 1133 | Ga0466963_0000055 | 3300044694 | Bacteria | 37968 |
| 1134 | Ga0466963_0004827 | 3300044694 | Bacteria | 7860 |
| 1135 | Ga0466963_0012434 | 3300044694 | Bacteria | 5210 |
| 1136 | Ga0466963_0015842 | 3300044694 | Bacteria | 4679 |
| 1137 | Ga0466963_0022743 | 3300044694 | Bacteria | 3973 |
| 1138 | Ga0466963_0023942 | 3300044694 | Bacteria | 3883 |
| 1139 | Ga0466963_0033848 | 3300044694 | Bacteria | 3321 |
| 1140 | Ga0466963_0050054 | 3300044694 | Bacteria | 2765 |
| 1141 | Ga0466963_0064761 | 3300044694 | Bacteria | 2449 |
| 1142 | Ga0466963_0072063 | 3300044694 | Bacteria | 2326 |
| 1143 | Ga0466963_0100496 | 3300044694 | Bacteria | 1979 |
| 1144 | Ga0466963_0226574 | 3300044694 | Unclassified | 1309 |
| 1145 | Ga0466963_0252889 | 3300044694 | Unclassified | 1236 |
| 1146 | Ga0466963_0296732 | 3300044694 | Unclassified | 1136 |
| 1147 | Ga0466963_0431087 | 3300044694 | Bacteria | 930 |
| 1148 | Ga0466963_1132171 | 3300044694 | Unclassified | 550 |
| 1149 | Ga0466964_0009411 | 3300044706 | Bacteria | 3678 |
| 1150 | Ga0466964_0011536 | 3300044706 | Bacteria | 3340 |
| 1151 | Ga0466964_0018416 | 3300044706 | Bacteria | 2680 |
| 1152 | Ga0466964_0021550 | 3300044706 | Bacteria | 2493 |
| 1153 | Ga0466964_0043695 | 3300044706 | Unclassified | 1818 |
| 1154 | Ga0466964_0044614 | 3300044706 | Bacteria | 1801 |
| 1155 | Ga0466964_0051059 | 3300044706 | Bacteria | 1697 |
| 1156 | Ga0466964_0056924 | 3300044706 | Bacteria | 1617 |
| 1157 | Ga0466964_0074116 | 3300044706 | Bacteria | 1446 |
| 1158 | Ga0466964_0151865 | 3300044706 | Bacteria | 1074 |
| 1159 | Ga0466964_0166246 | 3300044706 | Bacteria | 1035 |
| 1160 | Ga0466964_0210594 | 3300044706 | Bacteria | 939 |
| 1161 | Ga0466964_0444768 | 3300044706 | Unclassified | 686 |
| 1162 | Ga0453684_0702652 | 3300044712 | Bacteria | 1099 |
| 1163 | Ga0466971_0006844 | 3300044719 | Bacteria | 4959 |
| 1164 | Ga0466971_0014728 | 3300044719 | Bacteria | 3442 |
| 1165 | Ga0466971_0042499 | 3300044719 | Bacteria | 2042 |
| 1166 | Ga0466971_0149105 | 3300044719 | Bacteria | 1091 |
| 1167 | Ga0466971_0235099 | 3300044719 | Bacteria | 871 |
| 1168 | Ga0466971_0259620 | 3300044719 | Unclassified | 829 |
| 1169 | Ga0466971_0303512 | 3300044719 | Unclassified | 767 |
| 1170 | Ga0466971_0409493 | 3300044719 | Bacteria | 662 |
| 1171 | Ga0466968_0000852 | 3300044735 | Bacteria | 10683 |
| 1172 | Ga0466968_0003464 | 3300044735 | Bacteria | 5841 |
| 1173 | Ga0466968_0019156 | 3300044735 | Bacteria | 2753 |
| 1174 | Ga0466968_0070119 | 3300044735 | Bacteria | 1524 |
| 1175 | Ga0466968_0161887 | 3300044735 | Bacteria | 1033 |
| 1176 | Ga0466968_0590580 | 3300044735 | Bacteria | 560 |
| 1177 | Ga0466970_0027540 | 3300044765 | Bacteria | 2982 |
| 1178 | Ga0466970_0038297 | 3300044765 | Bacteria | 2543 |
| 1179 | Ga0466970_0227888 | 3300044765 | Bacteria | 1041 |
| 1180 | Ga0466970_0298449 | 3300044765 | Bacteria | 908 |
| 1181 | Ga0466970_0575684 | 3300044765 | Bacteria | 652 |
| 1182 | Ga0466957_0005164 | 3300044842 | Bacteria | 7299 |
| 1183 | Ga0466957_0006754 | 3300044842 | Bacteria | 6481 |
| 1184 | Ga0466957_0030978 | 3300044842 | Bacteria | 3195 |
| 1185 | Ga0466957_0073228 | 3300044842 | Bacteria | 2123 |
| 1186 | Ga0466957_0233465 | 3300044842 | Bacteria | 1218 |
| 1187 | Ga0466957_0729073 | 3300044842 | Bacteria | 701 |
| 1188 | Ga0466960_0028038 | 3300044901 | Bacteria | 2575 |
| 1189 | Ga0466960_0094462 | 3300044901 | Bacteria | 1530 |
| 1190 | Ga0466960_0168260 | 3300044901 | Bacteria | 1182 |
| 1191 | Ga0466960_0201029 | 3300044901 | Bacteria | 1089 |
| 1192 | Ga0466960_0208085 | 3300044901 | Bacteria | 1071 |
| 1193 | Ga0466960_0276693 | 3300044901 | Bacteria | 940 |
| 1194 | Ga0466960_0895369 | 3300044901 | Unclassified | 541 |
| 1195 | Ga0466960_0942844 | 3300044901 | Bacteria | 528 |
| 1196 | Ga0466959_0007192 | 3300045049 | Bacteria | 7796 |
| 1197 | Ga0466959_0012300 | 3300045049 | Bacteria | 6178 |
| 1198 | Ga0466959_0093916 | 3300045049 | Bacteria | 2152 |
| 1199 | Ga0466959_0135018 | 3300045049 | Bacteria | 1747 |
| 1200 | Ga0466959_0411749 | 3300045049 | Bacteria | 918 |
| 1201 | Ga0466959_0468675 | 3300045049 | Bacteria | 853 |
| 1202 | Ga0466959_1012098 | 3300045049 | Bacteria | 553 |
| 1203 | Ga0451576_0140420 | 3300045051 | Bacteria | 2519 |
| 1204 | Ga0451576_0759758 | 3300045051 | Bacteria | 1018 |
| 1205 | Ga0451576_1217744 | 3300045051 | Bacteria | 786 |
| 1206 | Ga0466958_0003853 | 3300045836 | Bacteria | 7846 |
| 1207 | Ga0466958_0009051 | 3300045836 | Bacteria | 5530 |
| 1208 | Ga0466958_0011141 | 3300045836 | Bacteria | 5058 |
| 1209 | Ga0466958_0037204 | 3300045836 | Bacteria | 2915 |
| 1210 | Ga0466958_0125048 | 3300045836 | Bacteria | 1612 |
| 1211 | Ga0466958_0149446 | 3300045836 | Unclassified | 1473 |
| 1212 | Ga0466958_0272504 | 3300045836 | Bacteria | 1084 |
| 1213 | Ga0466958_0314234 | 3300045836 | Bacteria | 1006 |
| 1214 | Ga0466958_0343730 | 3300045836 | Unclassified | 960 |
| 1215 | Ga0466958_0492483 | 3300045836 | Unclassified | 795 |
| 1216 | Ga0466967_0001501 | 3300045976 | Bacteria | 13628 |
| 1217 | Ga0466967_0010040 | 3300045976 | Bacteria | 7073 |
| 1218 | Ga0466967_0012011 | 3300045976 | Bacteria | 6600 |
| 1219 | Ga0466967_0013350 | 3300045976 | Bacteria | 6342 |
| 1220 | Ga0466967_0014574 | 3300045976 | Bacteria | 6130 |
| 1221 | Ga0466967_0015086 | 3300045976 | Bacteria | 6045 |
| 1222 | Ga0466967_0026921 | 3300045976 | Bacteria | 4773 |
| 1223 | Ga0466967_0046495 | 3300045976 | Bacteria | 3779 |
| 1224 | Ga0466967_0081187 | 3300045976 | Bacteria | 2928 |
| 1225 | Ga0466967_0141208 | 3300045976 | Bacteria | 2243 |
| 1226 | Ga0466967_0143713 | 3300045976 | Bacteria | 2224 |
| 1227 | Ga0466967_0154470 | 3300045976 | Bacteria | 2148 |
| 1228 | Ga0466967_0155326 | 3300045976 | Bacteria | 2142 |
| 1229 | Ga0466967_0190169 | 3300045976 | Unclassified | 1939 |
| 1230 | Ga0466967_0195071 | 3300045976 | Bacteria | 1915 |
| 1231 | Ga0466967_0203512 | 3300045976 | Bacteria | 1875 |
| 1232 | Ga0466967_0473293 | 3300045976 | Unclassified | 1226 |
| 1233 | Ga0466967_0474254 | 3300045976 | Bacteria | 1225 |
| 1234 | Ga0466967_0557080 | 3300045976 | Bacteria | 1128 |
| 1235 | Ga0466967_0678245 | 3300045976 | Bacteria | 1020 |
| 1236 | Ga0466967_0742320 | 3300045976 | Bacteria | 973 |
| 1237 | Ga0466967_1416322 | 3300045976 | Archaea | 692 |
| 1238 | Ga0466967_1427188 | 3300045976 | Bacteria | 689 |
| 1239 | Ga0495627_192704 | 3300046453 | Bacteria | 563 |
| 1240 | Ga0495592_0000082 | 3300046454 | Bacteria | 83312 |
| 1241 | Ga0495592_0044892 | 3300046454 | Bacteria | 3300 |
| 1242 | Ga0495592_0134802 | 3300046454 | Bacteria | 1723 |
| 1243 | Ga0495592_0296900 | 3300046454 | Bacteria | 1051 |
| 1244 | Ga0495592_0388926 | 3300046454 | Bacteria | 886 |
| 1245 | Ga0495603_0012630 | 3300046455 | Bacteria | 5108 |
| 1246 | Ga0495603_0023587 | 3300046455 | Bacteria | 3721 |
| 1247 | Ga0495603_0047153 | 3300046455 | Bacteria | 2567 |
| 1248 | Ga0495603_0452266 | 3300046455 | Unclassified | 735 |
| 1249 | Ga0495629_0150626 | 3300046459 | Unclassified | 1617 |
| 1250 | Ga0495629_0217503 | 3300046459 | Bacteria | 1318 |
| 1251 | Ga0495641_0033810 | 3300046461 | Bacteria | 2423 |
| 1252 | Ga0495641_0035320 | 3300046461 | Unclassified | 2358 |
| 1253 | Ga0495641_0040645 | 3300046461 | Bacteria | 2162 |
| 1254 | Ga0495641_0106426 | 3300046461 | Bacteria | 1251 |
| 1255 | Ga0495641_0119238 | 3300046461 | Bacteria | 1177 |
| 1256 | Ga0495641_0164231 | 3300046461 | Bacteria | 993 |
| 1257 | Ga0495651_0000080 | 3300046462 | Bacteria | 70453 |
| 1258 | Ga0495653_0001358 | 3300046463 | Bacteria | 19003 |
| 1259 | Ga0495653_0136939 | 3300046463 | Bacteria | 1726 |
| 1260 | Ga0495653_0248072 | 3300046463 | Bacteria | 1183 |
| 1261 | Ga0495580_0473412 | 3300046472 | Unclassified | 838 |
| 1262 | Ga0495580_0547410 | 3300046472 | Bacteria | 769 |
| 1263 | Ga0495582_0063737 | 3300046473 | Bacteria | 2036 |
| 1264 | Ga0495582_0075739 | 3300046473 | Bacteria | 1864 |
| 1265 | Ga0495582_0075882 | 3300046473 | Bacteria | 1862 |
| 1266 | Ga0495582_0097235 | 3300046473 | Bacteria | 1646 |
| 1267 | Ga0495582_0141954 | 3300046473 | Bacteria | 1361 |
| 1268 | Ga0495582_0406229 | 3300046473 | Bacteria | 785 |
| 1269 | Ga0495582_0409955 | 3300046473 | Bacteria | 782 |
| 1270 | Ga0495605_0071165 | 3300046474 | Unclassified | 1643 |
| 1271 | Ga0495605_0194995 | 3300046474 | Bacteria | 885 |
| 1272 | Ga0495605_0415478 | 3300046474 | Bacteria | 558 |
| 1273 | Ga0495639_0198301 | 3300046475 | Bacteria | 982 |
| 1274 | Ga0495662_0032448 | 3300046476 | Bacteria | 2522 |
| 1275 | Ga0495662_0081926 | 3300046476 | Bacteria | 1570 |
| 1276 | Ga0495662_0183815 | 3300046476 | Bacteria | 1030 |
| 1277 | Ga0495664_0201599 | 3300046477 | Bacteria | 1205 |
| 1278 | Ga0495664_0297874 | 3300046477 | Bacteria | 974 |
| 1279 | Ga0495584_0006888 | 3300046491 | Bacteria | 5939 |
| 1280 | Ga0495584_0137112 | 3300046491 | Bacteria | 1242 |
| 1281 | Ga0495584_0188904 | 3300046491 | Unclassified | 1047 |
| 1282 | Ga0495584_0510498 | 3300046491 | Unclassified | 612 |
| 1283 | Ga0495584_0608259 | 3300046491 | Bacteria | 557 |
| 1284 | Ga0495585_0026440 | 3300046492 | Bacteria | 3314 |
| 1285 | Ga0495585_0173844 | 3300046492 | Unclassified | 1111 |
| 1286 | Ga0495585_0207059 | 3300046492 | Bacteria | 996 |
| 1287 | Ga0495594_0080117 | 3300046499 | Bacteria | 1823 |
| 1288 | Ga0495594_0309286 | 3300046499 | Unclassified | 900 |
| 1289 | Ga0495594_0541916 | 3300046499 | Unclassified | 660 |
| 1290 | Ga0495596_0068080 | 3300046500 | Bacteria | 1384 |
| 1291 | Ga0495596_0074307 | 3300046500 | Unclassified | 1320 |
| 1292 | Ga0495596_0090321 | 3300046500 | Bacteria | 1189 |
| 1293 | Ga0495596_0206579 | 3300046500 | Bacteria | 763 |
| 1294 | Ga0495596_0225540 | 3300046500 | Unclassified | 728 |
| 1295 | Ga0495607_0017149 | 3300046501 | Bacteria | 4659 |
| 1296 | Ga0495607_0383903 | 3300046501 | Bacteria | 642 |
| 1297 | Ga0495608_0000669 | 3300046511 | Bacteria | 23647 |
| 1298 | Ga0495608_0062795 | 3300046511 | Bacteria | 2439 |
| 1299 | Ga0495608_0332216 | 3300046511 | Bacteria | 937 |
| 1300 | Ga0495608_0339871 | 3300046511 | Unclassified | 925 |
| 1301 | Ga0495608_0382795 | 3300046511 | Bacteria | 862 |
| 1302 | Ga0495616_0155699 | 3300046513 | Bacteria | 1031 |
| 1303 | Ga0495618_0055679 | 3300046514 | Bacteria | 2504 |
| 1304 | Ga0495618_0293440 | 3300046514 | Bacteria | 1011 |
| 1305 | Ga0495618_0924765 | 3300046514 | Unclassified | 502 |
| 1306 | Ga0495620_0200860 | 3300046515 | Bacteria | 767 |
| 1307 | Ga0495628_0000292 | 3300046516 | Bacteria | 45065 |
| 1308 | Ga0495628_0181774 | 3300046516 | Unclassified | 1590 |
| 1309 | Ga0495628_0939071 | 3300046516 | Bacteria | 598 |
| 1310 | Ga0495630_0022995 | 3300046517 | Bacteria | 4605 |
| 1311 | Ga0495630_0052669 | 3300046517 | Bacteria | 3047 |
| 1312 | Ga0495630_0222274 | 3300046517 | Bacteria | 1442 |
| 1313 | Ga0495630_0326377 | 3300046517 | Unclassified | 1173 |
| 1314 | Ga0495630_0449794 | 3300046517 | Bacteria | 987 |
| 1315 | Ga0495630_0932770 | 3300046517 | Bacteria | 661 |
| 1316 | Ga0495631_0120537 | 3300046518 | Bacteria | 1128 |
| 1317 | Ga0495631_0217528 | 3300046518 | Bacteria | 816 |
| 1318 | Ga0495637_0209108 | 3300046520 | Bacteria | 714 |
| 1319 | Ga0495637_0225667 | 3300046520 | Bacteria | 680 |
| 1320 | Ga0495637_0346992 | 3300046520 | Unclassified | 521 |
| 1321 | Ga0495644_0020660 | 3300046523 | Bacteria | 2512 |
| 1322 | Ga0495644_0074931 | 3300046523 | Bacteria | 1274 |
| 1323 | Ga0495644_0139131 | 3300046523 | Bacteria | 927 |
| 1324 | Ga0495663_0021460 | 3300046525 | Bacteria | 1860 |
| 1325 | Ga0495663_0043246 | 3300046525 | Bacteria | 1375 |
| 1326 | Ga0495663_0382055 | 3300046525 | Unclassified | 516 |
| 1327 | Ga0495666_0139807 | 3300046526 | Bacteria | 1129 |
| 1328 | Ga0495652_0000847 | 3300046529 | Bacteria | 35270 |
| 1329 | Ga0495652_0097098 | 3300046529 | Bacteria | 2397 |
| 1330 | Ga0495652_0310659 | 3300046529 | Bacteria | 1142 |
| 1331 | Ga0495665_0171582 | 3300046531 | Unclassified | 1129 |
| 1332 | Ga0495665_0541543 | 3300046531 | Bacteria | 585 |
| 1333 | Ga0495640_0016924 | 3300046533 | Bacteria | 5444 |
| 1334 | Ga0495640_0100761 | 3300046533 | Bacteria | 1896 |
| 1335 | Ga0495640_0488913 | 3300046533 | Unclassified | 750 |
| 1336 | Ga0495586_0057390 | 3300046535 | Bacteria | 2112 |
| 1337 | Ga0495587_0000060 | 3300046536 | Bacteria | 93780 |
| 1338 | Ga0495587_0087898 | 3300046536 | Bacteria | 1798 |
| 1339 | Ga0495609_0041212 | 3300046538 | Bacteria | 2076 |
| 1340 | Ga0495609_0098830 | 3300046538 | Bacteria | 1265 |
| 1341 | Ga0495609_0177073 | 3300046538 | Bacteria | 899 |
| 1342 | Ga0495609_0276571 | 3300046538 | Bacteria | 687 |
| 1343 | Ga0495645_0000038 | 3300046543 | Bacteria | 96124 |
| 1344 | Ga0495645_0079531 | 3300046543 | Bacteria | 2354 |
| 1345 | Ga0495622_0149429 | 3300046557 | Unclassified | 1058 |
| 1346 | Ga0495667_0073429 | 3300046559 | Bacteria | 2228 |
| 1347 | Ga0495667_0202357 | 3300046559 | Bacteria | 1271 |
| 1348 | Ga0495667_0226025 | 3300046559 | Unclassified | 1194 |
| 1349 | Ga0495656_0007613 | 3300046615 | Bacteria | 3835 |
| 1350 | Ga0495656_0048507 | 3300046615 | Bacteria | 1805 |
| 1351 | Ga0495656_0089683 | 3300046615 | Bacteria | 1404 |
| 1352 | Ga0495656_0324951 | 3300046615 | Unclassified | 793 |
| 1353 | Ga0495656_0694494 | 3300046615 | Bacteria | 547 |
| 1354 | Ga0495634_0027105 | 3300046642 | Bacteria | 3990 |
| 1355 | Ga0495634_0186140 | 3300046642 | Bacteria | 1297 |
| 1356 | Ga0495634_0370747 | 3300046642 | Unclassified | 854 |
| 1357 | Ga0495611_0056994 | 3300046648 | Bacteria | 1770 |
| 1358 | Ga0495635_0960076 | 3300046663 | Unclassified | 545 |
| 1359 | Ga0495659_0016528 | 3300046664 | Bacteria | 2435 |
| 1360 | Ga0495659_0210461 | 3300046664 | Bacteria | 800 |
| 1361 | Ga0495659_0498739 | 3300046664 | Bacteria | 533 |
| 1362 | Ga0495661_0153986 | 3300046665 | Bacteria | 1240 |
| 1363 | Ga0495661_0251189 | 3300046665 | Bacteria | 903 |
| 1364 | Ga0495588_0320285 | 3300046674 | Bacteria | 815 |
| 1365 | Ga0495588_0765290 | 3300046674 | Bacteria | 505 |
| 1366 | Ga0495657_0072449 | 3300046675 | Bacteria | 2247 |
| 1367 | Ga0495657_0870746 | 3300046675 | Unclassified | 513 |
| 1368 | Ga0495599_0000402 | 3300046678 | Bacteria | 24769 |
| 1369 | Ga0495599_0109298 | 3300046678 | Bacteria | 1722 |
| 1370 | Ga0495599_0748211 | 3300046678 | Bacteria | 561 |
| 1371 | Ga0495623_0000442 | 3300046679 | Bacteria | 27277 |
| 1372 | Ga0495623_0115030 | 3300046679 | Unclassified | 1626 |
| 1373 | Ga0495623_0618460 | 3300046679 | Unclassified | 561 |
| 1374 | Ga0495646_0001935 | 3300046680 | Bacteria | 12469 |
| 1375 | Ga0495646_0034453 | 3300046680 | Bacteria | 3144 |
| 1376 | Ga0495647_0081820 | 3300046681 | Unclassified | 1310 |
| 1377 | Ga0495647_0368004 | 3300046681 | Bacteria | 656 |
| 1378 | Ga0495647_0404826 | 3300046681 | Bacteria | 627 |
| 1379 | Ga0495658_0091213 | 3300046683 | Bacteria | 1804 |
| 1380 | Ga0495658_0331320 | 3300046683 | Bacteria | 966 |
| 1381 | Ga0495658_1114994 | 3300046683 | Unclassified | 503 |
| 1382 | Ga0495669_0080687 | 3300046684 | Bacteria | 1493 |
| 1383 | Ga0495669_0273532 | 3300046684 | Bacteria | 812 |
| 1384 | Ga0495613_0095654 | 3300046689 | Bacteria | 2148 |
| 1385 | Ga0495613_0184169 | 3300046689 | Bacteria | 1478 |
| 1386 | Ga0495613_0299055 | 3300046689 | Unclassified | 1114 |
| 1387 | Ga0495624_0016447 | 3300046690 | Bacteria | 4979 |
| 1388 | Ga0495624_0073326 | 3300046690 | Bacteria | 2128 |
| 1389 | Ga0495624_0081739 | 3300046690 | Bacteria | 2001 |
| 1390 | Ga0495624_0084327 | 3300046690 | Bacteria | 1964 |
| 1391 | Ga0495624_0332030 | 3300046690 | Unclassified | 915 |
| 1392 | Ga0495670_0587640 | 3300046691 | Bacteria | 606 |
| 1393 | Ga0495670_0664294 | 3300046691 | Bacteria | 568 |
| 1394 | Ga0495670_0739145 | 3300046691 | Bacteria | 537 |
| 1395 | Ga0495649_0537186 | 3300046694 | Unclassified | 580 |
| 1396 | Ga0495589_0118734 | 3300046794 | Bacteria | 1274 |
| 1397 | Ga0495589_0147174 | 3300046794 | Bacteria | 1126 |
| 1398 | Ga0495600_0194009 | 3300046809 | Bacteria | 1305 |
| 1399 | Ga0495581_0739244 | 3300047315 | Bacteria | 566 |
| 1400 | Ga0495604_0000043 | 3300047317 | Bacteria | 116335 |
| 1401 | Ga0495604_0124988 | 3300047317 | Bacteria | 1856 |
| 1402 | Ga0495604_0518901 | 3300047317 | Bacteria | 771 |
| 1403 | Ga0495604_0896618 | 3300047317 | Bacteria | 554 |
| 1404 | Ga0495636_0031764 | 3300047318 | Bacteria | 2166 |
| 1405 | Ga0495636_0186929 | 3300047318 | Bacteria | 942 |
| 1406 | Ga0495674_0044574 | 3300047319 | Bacteria | 3943 |
| 1407 | Ga0495674_0126352 | 3300047319 | Bacteria | 2157 |
| 1408 | Ga0495674_0868492 | 3300047319 | Unclassified | 698 |
| 1409 | Ga0495674_1134840 | 3300047319 | Unclassified | 593 |
| 1410 | Ga0495676_0019485 | 3300047321 | Bacteria | 5966 |
| 1411 | Ga0495676_0040517 | 3300047321 | Bacteria | 3843 |
| 1412 | Ga0495676_0095220 | 3300047321 | Bacteria | 2216 |
| 1413 | Ga0495676_0123134 | 3300047321 | Unclassified | 1883 |
| 1414 | Ga0495676_0330612 | 3300047321 | Bacteria | 1022 |
| 1415 | Ga0495676_0477333 | 3300047321 | Bacteria | 820 |
| 1416 | Ga0495676_0744133 | 3300047321 | Unclassified | 633 |
| 1417 | Ga0495680_0006459 | 3300047322 | Bacteria | 10885 |
| 1418 | Ga0495680_0171499 | 3300047322 | Bacteria | 1571 |
| 1419 | Ga0495680_0352631 | 3300047322 | Unclassified | 1024 |
| 1420 | Ga0495680_0487984 | 3300047322 | Bacteria | 838 |
| 1421 | Ga0495680_0604546 | 3300047322 | Unclassified | 733 |
| 1422 | Ga0495680_0622766 | 3300047322 | Bacteria | 720 |
| 1423 | Ga0495680_0877799 | 3300047322 | Bacteria | 581 |
| 1424 | Ga0495680_0972480 | 3300047322 | Unclassified | 544 |
| 1425 | Ga0495675_0000827 | 3300047444 | Bacteria | 19000 |
| 1426 | Ga0495675_0143261 | 3300047444 | Unclassified | 1480 |
| 1427 | Ga0495675_0825353 | 3300047444 | Bacteria | 512 |
| 1428 | Ga0495677_0067675 | 3300047445 | Bacteria | 1329 |
| 1429 | Ga0495677_0111106 | 3300047445 | Bacteria | 1042 |
| 1430 | Ga0495684_0094459 | 3300047471 | Bacteria | 2264 |
| 1431 | Ga0495684_0137542 | 3300047471 | Bacteria | 1833 |
| 1432 | Ga0495684_0154760 | 3300047471 | Unclassified | 1713 |
| 1433 | Ga0495684_0820352 | 3300047471 | Bacteria | 606 |
| 1434 | Ga0495593_0093855 | 3300047673 | Unclassified | 1544 |
| 1435 | Ga0495602_0000536 | 3300048088 | Bacteria | 35263 |
| 1436 | Ga0495602_0153916 | 3300048088 | Bacteria | 1803 |
| 1437 | Ga0495602_0579235 | 3300048088 | Unclassified | 774 |
| 1438 | Ga0495614_0184469 | 3300048089 | Unclassified | 939 |
| 1439 | Ga0495614_0543121 | 3300048089 | Bacteria | 555 |
| 1440 | Ga0495614_0664212 | 3300048089 | Bacteria | 503 |
| 1441 | Ga0495626_0114301 | 3300048091 | Bacteria | 1166 |
| 1442 | Ga0496100_0027778 | 3300048903 | Bacteria | 3482 |
| 1443 | Ga0496100_0087791 | 3300048903 | Bacteria | 2115 |
| 1444 | Ga0496100_0091814 | 3300048903 | Bacteria | 2073 |
| 1445 | Ga0496100_0119505 | 3300048903 | Bacteria | 1841 |
| 1446 | Ga0496100_0564080 | 3300048903 | Bacteria | 882 |
| 1447 | Ga0496100_0774148 | 3300048903 | Bacteria | 751 |
| 1448 | Ga0496100_0841435 | 3300048903 | Unclassified | 719 |
| 1449 | Ga0496100_1147873 | 3300048903 | Bacteria | 612 |
| 1450 | Ga0496100_1276301 | 3300048903 | Bacteria | 579 |
| 1451 | Ga0496101_0001928 | 3300048904 | Bacteria | 12558 |
| 1452 | Ga0496101_0019452 | 3300048904 | Bacteria | 4636 |
| 1453 | Ga0496101_0044578 | 3300048904 | Bacteria | 3174 |
| 1454 | Ga0496101_0082788 | 3300048904 | Bacteria | 2374 |
| 1455 | Ga0496101_0118264 | 3300048904 | Bacteria | 2001 |
| 1456 | Ga0496101_0148669 | 3300048904 | Bacteria | 1790 |
| 1457 | Ga0496101_0218654 | 3300048904 | Bacteria | 1478 |
| 1458 | Ga0496101_0252591 | 3300048904 | Bacteria | 1374 |
| 1459 | Ga0496101_0407155 | 3300048904 | Bacteria | 1071 |
| 1460 | Ga0496101_0972216 | 3300048904 | Bacteria | 668 |
| 1461 | Ga0496102_0021784 | 3300048905 | Bacteria | 5671 |
| 1462 | Ga0496102_0028158 | 3300048905 | Bacteria | 5019 |
| 1463 | Ga0496102_0031232 | 3300048905 | Bacteria | 4776 |
| 1464 | Ga0496102_0118855 | 3300048905 | Bacteria | 2467 |
| 1465 | Ga0496102_0197463 | 3300048905 | Bacteria | 1896 |
| 1466 | Ga0496102_0403585 | 3300048905 | Bacteria | 1285 |
| 1467 | Ga0496102_0403760 | 3300048905 | Bacteria | 1284 |
| 1468 | Ga0496102_0806104 | 3300048905 | Bacteria | 861 |
| 1469 | Ga0496102_0837813 | 3300048905 | Bacteria | 842 |
| 1470 | Ga0496102_1116413 | 3300048905 | Bacteria | 708 |
| 1471 | Ga0496102_1171634 | 3300048905 | Unclassified | 688 |
| 1472 | Ga0496102_1566673 | 3300048905 | Unclassified | 577 |
| 1473 | Ga0496103_0003123 | 3300048906 | Bacteria | 10187 |
| 1474 | Ga0496103_0003893 | 3300048906 | Bacteria | 9084 |
| 1475 | Ga0496103_0004055 | 3300048906 | Bacteria | 8904 |
| 1476 | Ga0496103_0011785 | 3300048906 | Bacteria | 5186 |
| 1477 | Ga0496103_0038013 | 3300048906 | Bacteria | 2952 |
| 1478 | Ga0496103_0091563 | 3300048906 | Bacteria | 1919 |
| 1479 | Ga0496103_0211979 | 3300048906 | Bacteria | 1245 |
| 1480 | Ga0496103_0245340 | 3300048906 | Bacteria | 1152 |
| 1481 | Ga0496104_0000566 | 3300048907 | Bacteria | 31603 |
| 1482 | Ga0496104_0001456 | 3300048907 | Bacteria | 20455 |
| 1483 | Ga0496104_0013980 | 3300048907 | Bacteria | 7241 |
| 1484 | Ga0496104_0018210 | 3300048907 | Bacteria | 6406 |
| 1485 | Ga0496104_0045934 | 3300048907 | Bacteria | 4109 |
| 1486 | Ga0496104_0116458 | 3300048907 | Bacteria | 2565 |
| 1487 | Ga0496104_0136337 | 3300048907 | Bacteria | 2358 |
| 1488 | Ga0496104_0185869 | 3300048907 | Bacteria | 1989 |
| 1489 | Ga0496104_0353239 | 3300048907 | Bacteria | 1383 |
| 1490 | Ga0496104_1025443 | 3300048907 | Bacteria | 729 |
| 1491 | Ga0496104_1279916 | 3300048907 | Bacteria | 636 |
| 1492 | Ga0496105_0001017 | 3300048908 | Bacteria | 19386 |
| 1493 | Ga0496105_0002560 | 3300048908 | Bacteria | 13204 |
| 1494 | Ga0496105_0022998 | 3300048908 | Bacteria | 5053 |
| 1495 | Ga0496105_0029105 | 3300048908 | Bacteria | 4520 |
| 1496 | Ga0496105_0085833 | 3300048908 | Bacteria | 2601 |
| 1497 | Ga0496105_0116043 | 3300048908 | Bacteria | 2208 |
| 1498 | Ga0496105_0123614 | 3300048908 | Bacteria | 2133 |
| 1499 | Ga0496105_0257711 | 3300048908 | Bacteria | 1411 |
| 1500 | Ga0496105_0316639 | 3300048908 | Bacteria | 1251 |
| 1501 | Ga0496105_0375538 | 3300048908 | Bacteria | 1132 |
| 1502 | Ga0496105_1330285 | 3300048908 | Unclassified | 523 |
| 1503 | Ga0496106_0001733 | 3300048909 | Bacteria | 16292 |
| 1504 | Ga0496106_0026652 | 3300048909 | Bacteria | 4304 |
| 1505 | Ga0496106_0030904 | 3300048909 | Bacteria | 3992 |
| 1506 | Ga0496106_0049470 | 3300048909 | Bacteria | 3167 |
| 1507 | Ga0496106_0138258 | 3300048909 | Bacteria | 1915 |
| 1508 | Ga0496106_0204403 | 3300048909 | Bacteria | 1572 |
| 1509 | Ga0496106_0209315 | 3300048909 | Bacteria | 1553 |
| 1510 | Ga0496106_0229480 | 3300048909 | Bacteria | 1482 |
| 1511 | Ga0496106_0309242 | 3300048909 | Bacteria | 1268 |
| 1512 | Ga0496106_0333298 | 3300048909 | Unclassified | 1218 |
| 1513 | Ga0496106_0333553 | 3300048909 | Unclassified | 1218 |
| 1514 | Ga0496106_1536508 | 3300048909 | Bacteria | 511 |
| 1515 | Ga0496107_0002910 | 3300048910 | Bacteria | 11318 |
| 1516 | Ga0496107_0048698 | 3300048910 | Bacteria | 3054 |
| 1517 | Ga0496107_0074565 | 3300048910 | Bacteria | 2469 |
| 1518 | Ga0496107_0090486 | 3300048910 | Bacteria | 2235 |
| 1519 | Ga0496107_0101698 | 3300048910 | Bacteria | 2107 |
| 1520 | Ga0496107_0345269 | 3300048910 | Bacteria | 1107 |
| 1521 | Ga0496107_0378205 | 3300048910 | Bacteria | 1053 |
| 1522 | Ga0496107_0430976 | 3300048910 | Bacteria | 980 |
| 1523 | Ga0496107_1214011 | 3300048910 | Unclassified | 542 |
| 1524 | Ga0496107_1256002 | 3300048910 | Unclassified | 531 |
| 1525 | Ga0496108_0000906 | 3300048911 | Bacteria | 23091 |
| 1526 | Ga0496108_0021413 | 3300048911 | Bacteria | 5314 |
| 1527 | Ga0496108_0040487 | 3300048911 | Bacteria | 3884 |
| 1528 | Ga0496108_0101435 | 3300048911 | Bacteria | 2455 |
| 1529 | Ga0496108_0136966 | 3300048911 | Bacteria | 2107 |
| 1530 | Ga0496108_0224676 | 3300048911 | Unclassified | 1632 |
| 1531 | Ga0496108_0278016 | 3300048911 | Bacteria | 1458 |
| 1532 | Ga0496108_0284340 | 3300048911 | Bacteria | 1440 |
| 1533 | Ga0496108_0650150 | 3300048911 | Bacteria | 916 |
| 1534 | Ga0496109_0005563 | 3300048912 | Bacteria | 10549 |
| 1535 | Ga0496109_0010078 | 3300048912 | Bacteria | 8064 |
| 1536 | Ga0496109_0115763 | 3300048912 | Bacteria | 2494 |
| 1537 | Ga0496109_0134057 | 3300048912 | Bacteria | 2313 |
| 1538 | Ga0496109_0147897 | 3300048912 | Bacteria | 2198 |
| 1539 | Ga0496109_0166610 | 3300048912 | Bacteria | 2066 |
| 1540 | Ga0496109_0188421 | 3300048912 | Bacteria | 1938 |
| 1541 | Ga0496109_0226420 | 3300048912 | Bacteria | 1759 |
| 1542 | Ga0496109_0230128 | 3300048912 | Bacteria | 1744 |
| 1543 | Ga0496109_0270418 | 3300048912 | Bacteria | 1601 |
| 1544 | Ga0496109_0388509 | 3300048912 | Bacteria | 1318 |
| 1545 | Ga0496109_0433311 | 3300048912 | Bacteria | 1242 |
| 1546 | Ga0496109_0935892 | 3300048912 | Bacteria | 804 |
| 1547 | Ga0496109_1604541 | 3300048912 | Unclassified | 585 |
| 1548 | Ga0496109_1665387 | 3300048912 | Bacteria | 572 |
| 1549 | Ga0496110_0000951 | 3300048913 | Bacteria | 20276 |
| 1550 | Ga0496110_0000997 | 3300048913 | Bacteria | 19893 |
| 1551 | Ga0496110_0007809 | 3300048913 | Bacteria | 8573 |
| 1552 | Ga0496110_0016084 | 3300048913 | Bacteria | 6238 |
| 1553 | Ga0496110_0019409 | 3300048913 | Bacteria | 5719 |
| 1554 | Ga0496110_0028156 | 3300048913 | Bacteria | 4823 |
| 1555 | Ga0496110_0112830 | 3300048913 | Bacteria | 2444 |
| 1556 | Ga0496110_0162280 | 3300048913 | Bacteria | 2026 |
| 1557 | Ga0496110_0172469 | 3300048913 | Bacteria | 1963 |
| 1558 | Ga0496110_0206655 | 3300048913 | Unclassified | 1785 |
| 1559 | Ga0496110_0262342 | 3300048913 | Unclassified | 1572 |
| 1560 | Ga0496110_0266325 | 3300048913 | Bacteria | 1560 |
| 1561 | Ga0496110_0353477 | 3300048913 | Bacteria | 1339 |
| 1562 | Ga0496110_0747526 | 3300048913 | Bacteria | 881 |
| 1563 | Ga0496110_1085697 | 3300048913 | Bacteria | 708 |
| 1564 | Ga0496110_1219960 | 3300048913 | Bacteria | 661 |
| 1565 | Ga0496111_0000512 | 3300048914 | Bacteria | 20026 |
| 1566 | Ga0496111_0002184 | 3300048914 | Bacteria | 11720 |
| 1567 | Ga0496111_0005450 | 3300048914 | Bacteria | 8153 |
| 1568 | Ga0496111_0005744 | 3300048914 | Bacteria | 8004 |
| 1569 | Ga0496111_0069745 | 3300048914 | Bacteria | 2556 |
| 1570 | Ga0496111_0071179 | 3300048914 | Bacteria | 2531 |
| 1571 | Ga0496111_0184054 | 3300048914 | Bacteria | 1553 |
| 1572 | Ga0496111_0213360 | 3300048914 | Bacteria | 1434 |
| 1573 | Ga0496111_0349097 | 3300048914 | Bacteria | 1095 |
| 1574 | Ga0496111_0667003 | 3300048914 | Unclassified | 758 |
| 1575 | Ga0496111_0771088 | 3300048914 | Unclassified | 697 |
| 1576 | Ga0496111_1041846 | 3300048914 | Unclassified | 585 |
| 1577 | Ga0496112_0004731 | 3300048915 | Bacteria | 11598 |
| 1578 | Ga0496112_0009224 | 3300048915 | Bacteria | 8869 |
| 1579 | Ga0496112_0027466 | 3300048915 | Bacteria | 5487 |
| 1580 | Ga0496112_0090427 | 3300048915 | Bacteria | 3030 |
| 1581 | Ga0496112_0247526 | 3300048915 | Bacteria | 1734 |
| 1582 | Ga0496112_0327220 | 3300048915 | Bacteria | 1476 |
| 1583 | Ga0496112_0458615 | 3300048915 | Bacteria | 1212 |
| 1584 | Ga0496112_0609221 | 3300048915 | Bacteria | 1023 |
| 1585 | Ga0496112_0689329 | 3300048915 | Unclassified | 950 |
| 1586 | Ga0496112_1896331 | 3300048915 | Bacteria | 507 |
| 1587 | Ga0496113_0010891 | 3300048916 | Bacteria | 6034 |
| 1588 | Ga0496113_0046582 | 3300048916 | Bacteria | 3219 |
| 1589 | Ga0496113_0068476 | 3300048916 | Bacteria | 2694 |
| 1590 | Ga0496113_0138314 | 3300048916 | Bacteria | 1915 |
| 1591 | Ga0496113_0167297 | 3300048916 | Bacteria | 1740 |
| 1592 | Ga0496113_0178578 | 3300048916 | Bacteria | 1683 |
| 1593 | Ga0496113_0230956 | 3300048916 | Unclassified | 1475 |
| 1594 | Ga0496113_0351649 | 3300048916 | Unclassified | 1182 |
| 1595 | Ga0496113_0353400 | 3300048916 | Bacteria | 1179 |
| 1596 | Ga0496113_0615307 | 3300048916 | Bacteria | 869 |
| 1597 | Ga0496113_0672453 | 3300048916 | Bacteria | 827 |
| 1598 | Ga0496113_0796285 | 3300048916 | Bacteria | 751 |
| 1599 | Ga0496114_0002097 | 3300048917 | Bacteria | 15151 |
| 1600 | Ga0496114_0017867 | 3300048917 | Bacteria | 5732 |
| 1601 | Ga0496114_0036750 | 3300048917 | Bacteria | 4049 |
| 1602 | Ga0496114_0074651 | 3300048917 | Bacteria | 2855 |
| 1603 | Ga0496114_0140476 | 3300048917 | Bacteria | 2091 |
| 1604 | Ga0496114_0189445 | 3300048917 | Bacteria | 1799 |
| 1605 | Ga0496114_0296012 | 3300048917 | Bacteria | 1428 |
| 1606 | Ga0496114_0344674 | 3300048917 | Bacteria | 1317 |
| 1607 | Ga0496114_0353092 | 3300048917 | Bacteria | 1300 |
| 1608 | Ga0496114_1026679 | 3300048917 | Bacteria | 708 |
| 1609 | Ga0496115_0044549 | 3300048918 | Bacteria | 3539 |
| 1610 | Ga0496115_0055048 | 3300048918 | Bacteria | 3195 |
| 1611 | Ga0496115_0113403 | 3300048918 | Bacteria | 2227 |
| 1612 | Ga0496115_0261104 | 3300048918 | Bacteria | 1424 |
| 1613 | Ga0496115_0413339 | 3300048918 | Bacteria | 1093 |
| 1614 | Ga0501298_146661 | 3300049521 | Bacteria | 574 |
| 1615 | Ga0501031_0069984 | 3300049568 | Bacteria | 2285 |
| 1616 | Ga0501031_0446109 | 3300049568 | Bacteria | 836 |
| 1617 | Ga0501031_1043944 | 3300049568 | Bacteria | 522 |
| 1618 | Ga0501032_0148468 | 3300049569 | Bacteria | 1542 |
| 1619 | Ga0501032_1051003 | 3300049569 | Unclassified | 511 |
| 1620 | Ga0501033_0163192 | 3300049570 | Bacteria | 1603 |
| 1621 | Ga0501036_0036730 | 3300049572 | Bacteria | 4146 |
| 1622 | Ga0501037_0211779 | 3300049573 | Bacteria | 1366 |
| 1623 | Ga0501038_0058270 | 3300049574 | Bacteria | 3312 |
| 1624 | Ga0501039_0038129 | 3300049575 | Bacteria | 3712 |
| 1625 | Ga0501039_0764607 | 3300049575 | Bacteria | 754 |
| 1626 | Ga0501040_0015402 | 3300049576 | Bacteria | 5056 |
| 1627 | Ga0501040_0182121 | 3300049576 | Bacteria | 1489 |
| 1628 | Ga0501041_0007471 | 3300049577 | Bacteria | 6416 |
| 1629 | Ga0501041_0111005 | 3300049577 | Bacteria | 1701 |
| 1630 | Ga0501041_0374915 | 3300049577 | Bacteria | 900 |
| 1631 | Ga0501041_0783530 | 3300049577 | Unclassified | 611 |
| 1632 | Ga0501042_0070432 | 3300049578 | Bacteria | 2501 |
| 1633 | Ga0501042_0314460 | 3300049578 | Bacteria | 1131 |
| 1634 | Ga0501042_1331879 | 3300049578 | Bacteria | 524 |
| 1635 | Ga0501046_0083004 | 3300049580 | Bacteria | 2474 |
| 1636 | Ga0501046_0240151 | 3300049580 | Bacteria | 1336 |
| 1637 | Ga0501048_0014730 | 3300049582 | Bacteria | 5786 |
| 1638 | Ga0501048_1103511 | 3300049582 | Bacteria | 571 |
| 1639 | Ga0501048_1233917 | 3300049582 | Bacteria | 538 |
| 1640 | Ga0501067_0018931 | 3300049583 | Bacteria | 3809 |
| 1641 | Ga0501067_0223514 | 3300049583 | Bacteria | 1048 |
| 1642 | Ga0501067_0237108 | 3300049583 | Bacteria | 1015 |
| 1643 | Ga0501067_0573987 | 3300049583 | Bacteria | 632 |
| 1644 | Ga0501067_0649454 | 3300049583 | Bacteria | 592 |
| 1645 | Ga0501068_0137175 | 3300049584 | Bacteria | 1532 |
| 1646 | Ga0501069_0073814 | 3300049585 | Unclassified | 1913 |
| 1647 | Ga0501069_0099093 | 3300049585 | Bacteria | 1653 |
| 1648 | Ga0501069_0296145 | 3300049585 | Bacteria | 948 |
| 1649 | Ga0501070_0228267 | 3300049586 | Bacteria | 1526 |
| 1650 | Ga0501070_0666027 | 3300049586 | Unclassified | 825 |
| 1651 | Ga0501071_0004656 | 3300049587 | Bacteria | 8714 |
| 1652 | Ga0501071_0217034 | 3300049587 | Bacteria | 1439 |
| 1653 | Ga0501071_0617298 | 3300049587 | Bacteria | 834 |
| 1654 | Ga0501072_0003264 | 3300049588 | Bacteria | 12190 |
| 1655 | Ga0501073_0401459 | 3300049589 | Unclassified | 947 |
| 1656 | Ga0501073_0916399 | 3300049589 | Bacteria | 603 |
| 1657 | Ga0501074_0080528 | 3300049590 | Bacteria | 2336 |
| 1658 | Ga0501074_0461938 | 3300049590 | Bacteria | 900 |
| 1659 | Ga0501075_0018170 | 3300049591 | Bacteria | 5085 |
| 1660 | Ga0501075_0135269 | 3300049591 | Bacteria | 1878 |
| 1661 | Ga0501075_1256954 | 3300049591 | Bacteria | 561 |
| 1662 | Ga0501076_0001105 | 3300049592 | Bacteria | 17776 |
| 1663 | Ga0501076_0700221 | 3300049592 | Bacteria | 836 |
| 1664 | Ga0501077_0042502 | 3300049593 | Bacteria | 2890 |
| 1665 | Ga0501202_215196 | 3300049652 | Bacteria | 530 |
| 1666 | Ga0501233_184621 | 3300049668 | Bacteria | 599 |
| 1667 | Ga0501225_0251116 | 3300049705 | Bacteria | 582 |
| 1668 | Ga0501079_0037266 | 3300049741 | Bacteria | 3747 |
| 1669 | Ga0501079_0134259 | 3300049741 | Bacteria | 1926 |
| 1670 | Ga0501079_0527929 | 3300049741 | Bacteria | 928 |
| 1671 | Ga0501080_0071893 | 3300049742 | Bacteria | 3218 |
| 1672 | Ga0501081_0058177 | 3300049743 | Bacteria | 2674 |
| 1673 | Ga0501081_0215914 | 3300049743 | Bacteria | 1394 |
| 1674 | Ga0501081_0359080 | 3300049743 | Bacteria | 1074 |
| 1675 | Ga0501083_0321516 | 3300049744 | Bacteria | 1006 |
| 1676 | Ga0501083_1142710 | 3300049744 | Bacteria | 507 |
| 1677 | Ga0501035_0252438 | 3300049822 | Bacteria | 1497 |
| 1678 | Ga0501035_0567365 | 3300049822 | Bacteria | 928 |
| 1679 | Ga0501044_0287075 | 3300049823 | Bacteria | 1578 |
| 1680 | Ga0501045_0005351 | 3300049824 | Bacteria | 8893 |
| 1681 | Ga0501045_1314436 | 3300049824 | Bacteria | 526 |
| 1682 | Ga0501045_1330375 | 3300049824 | Bacteria | 522 |
| 1683 | nmdc:mga03683_49432_c1 | 3300050489 | Bacteria | 1751 |
| 1684 | nmdc:mga00v17_11157_c1 | 3300050491 | Bacteria | 4932 |
| 1685 | nmdc:mga00v17_727885_c1 | 3300050491 | Bacteria | 635 |
| 1686 | nmdc:mga0yw44_32896_c1 | 3300050492 | Bacteria | 3025 |
| 1687 | nmdc:mga0yw44_615987_c1 | 3300050492 | Unclassified | 738 |
| 1688 | nmdc:mga04h51_296052_c1 | 3300050495 | Bacteria | 658 |
| 1689 | nmdc:mga05p37_13294_c1 | 3300050507 | Bacteria | 9857 |
| 1690 | nmdc:mga05p37_167787_c1 | 3300050507 | Bacteria | 2678 |
| 1691 | nmdc:mga05p37_1895896_c1 | 3300050507 | Bacteria | 570 |
| 1692 | nmdc:mga05p37_2114232_c1 | 3300050507 | Unclassified | 527 |
| 1693 | nmdc:mga05p37_244057_c1 | 3300050507 | Bacteria | 2158 |
| 1694 | nmdc:mga05p37_314764_c1 | 3300050507 | Bacteria | 1854 |
| 1695 | nmdc:mga05p37_68166_c1 | 3300050507 | Bacteria | 4376 |
| 1696 | nmdc:mga05p37_706369_c1 | 3300050507 | Bacteria | 1119 |
| 1697 | nmdc:mga09592_151081_c1 | 3300050508 | Bacteria | 2004 |
| 1698 | nmdc:mga09592_619081_c1 | 3300050508 | Bacteria | 926 |
| 1699 | nmdc:mga09592_874890_c1 | 3300050508 | Unclassified | 756 |
| 1700 | nmdc:mga0qj67_108618_c1 | 3300050509 | Bacteria | 2239 |
| 1701 | nmdc:mga06r32_10690_c1 | 3300050510 | Bacteria | 8271 |
| 1702 | nmdc:mga06r32_1301213_c1 | 3300050510 | Bacteria | 671 |
| 1703 | nmdc:mga06r32_1883578_c1 | 3300050510 | Unclassified | 533 |
| 1704 | nmdc:mga06r32_43491_c1 | 3300050510 | Bacteria | 4274 |
| 1705 | nmdc:mga06r32_639830_c1 | 3300050510 | Bacteria | 1032 |
| 1706 | nmdc:mga06r32_825230_c1 | 3300050510 | Bacteria | 887 |
| 1707 | nmdc:mga08y16_1564151_c1 | 3300050511 | Bacteria | 618 |
| 1708 | nmdc:mga08y16_18761_c1 | 3300050511 | Bacteria | 7288 |
| 1709 | nmdc:mga08y16_196041_c1 | 3300050511 | Bacteria | 2093 |
| 1710 | nmdc:mga08y16_491918_c1 | 3300050511 | Bacteria | 1247 |
| 1711 | nmdc:mga08y16_79427_c1 | 3300050511 | Bacteria | 3419 |
| 1712 | nmdc:mga0n895_1116647_c1 | 3300050512 | Bacteria | 765 |
| 1713 | nmdc:mga0n895_135876_c1 | 3300050512 | Bacteria | 2485 |
| 1714 | nmdc:mga0n895_1588271_c1 | 3300050512 | Bacteria | 619 |
| 1715 | nmdc:mga0n895_160159_c1 | 3300050512 | Bacteria | 2282 |
| 1716 | nmdc:mga0n895_1637059_c1 | 3300050512 | Unclassified | 607 |
| 1717 | nmdc:mga0n895_182761_c1 | 3300050512 | Bacteria | 2128 |
| 1718 | nmdc:mga0n895_19407_c1 | 3300050512 | Bacteria | 6319 |
| 1719 | nmdc:mga0n895_2162655_c1 | 3300050512 | Bacteria | 512 |
| 1720 | nmdc:mga0n895_34144_c1 | 3300050512 | Bacteria | 4895 |
| 1721 | nmdc:mga0n895_7715_c1 | 3300050512 | Bacteria | 9261 |
| 1722 | nmdc:mga0rr50_1205443_c1 | 3300050513 | Bacteria | 643 |
| 1723 | nmdc:mga0rr50_1395326_c1 | 3300050513 | Unclassified | 593 |
| 1724 | nmdc:mga0rr50_294586_c1 | 3300050513 | Bacteria | 1356 |
| 1725 | nmdc:mga0rr50_44331_c1 | 3300050513 | Bacteria | 3262 |
| 1726 | nmdc:mga0rr50_49718_c1 | 3300050513 | Bacteria | 3105 |
| 1727 | nmdc:mga0rr50_519956_c1 | 3300050513 | Bacteria | 1012 |
| 1728 | nmdc:mga0rr50_81771_c1 | 3300050513 | Bacteria | 2494 |
| 1729 | nmdc:mga0rr50_993710_c1 | 3300050513 | Unclassified | 715 |
| 1730 | nmdc:mga08x19_18831_c1 | 3300050514 | Bacteria | 4232 |
| 1731 | nmdc:mga08x19_29425_c1 | 3300050514 | Bacteria | 3445 |
| 1732 | nmdc:mga08x19_43212_c1 | 3300050514 | Bacteria | 2875 |
| 1733 | nmdc:mga08x19_449879_c1 | 3300050514 | Bacteria | 906 |
| 1734 | nmdc:mga08x19_486783_c1 | 3300050514 | Bacteria | 870 |
| 1735 | nmdc:mga08x19_718350_c1 | 3300050514 | Bacteria | 709 |
| 1736 | nmdc:mga08x19_783501_c1 | 3300050514 | Unclassified | 677 |
| 1737 | nmdc:mga08x19_951266_c1 | 3300050514 | Bacteria | 610 |
| 1738 | nmdc:mga0a205_122897_c1 | 3300050515 | Bacteria | 2495 |
| 1739 | nmdc:mga0a205_1436974_c1 | 3300050515 | Bacteria | 538 |
| 1740 | nmdc:mga0a205_188932_c1 | 3300050515 | Bacteria | 1953 |
| 1741 | nmdc:mga0a205_266846_c1 | 3300050515 | Bacteria | 1589 |
| 1742 | nmdc:mga0a205_31020_c1 | 3300050515 | Bacteria | 5120 |
| 1743 | nmdc:mga0a205_798610_c1 | 3300050515 | Bacteria | 791 |
| 1744 | nmdc:mga0a205_90380_c1 | 3300050515 | Bacteria | 2959 |
| 1745 | Ga0495601_0000178 | 3300053077 | Bacteria | 33686 |
| 1746 | Ga0495601_0363711 | 3300053077 | Bacteria | 940 |
| 1747 | Ga0495601_0429289 | 3300053077 | Unclassified | 855 |
| 1748 | Ga0495601_0492742 | 3300053077 | Unclassified | 791 |
| 1749 | Ga0495601_0774783 | 3300053077 | Bacteria | 610 |
| 1750 | Ga0495601_0777679 | 3300053077 | Unclassified | 608 |
| 1751 | Ga0495601_0828522 | 3300053077 | Bacteria | 586 |
| 1752 | Ga0495612_0017228 | 3300053078 | Bacteria | 2894 |
| 1753 | Ga0495612_0124556 | 3300053078 | Bacteria | 1110 |
| 1754 | Ga0495595_0083745 | 3300053084 | Unclassified | 1523 |
| 1755 | Ga0495595_0156310 | 3300053084 | Bacteria | 1124 |
| 1756 | Ga0495595_0308993 | 3300053084 | Unclassified | 796 |
| 1757 | Ga0495619_0004567 | 3300053085 | Bacteria | 8847 |
| 1758 | Ga0495619_0049368 | 3300053085 | Bacteria | 2775 |
| 1759 | Ga0495619_0515847 | 3300053085 | Bacteria | 821 |
| 1760 | Ga0501084_0009069 | 3300054114 | Bacteria | 8230 |
| 1761 | Ga0501084_0182568 | 3300054114 | Bacteria | 1771 |
| 1762 | Ga0501084_0438645 | 3300054114 | Unclassified | 1104 |
| 1763 | Ga0501084_0685089 | 3300054114 | Bacteria | 865 |
| 1764 | Ga0501084_1245950 | 3300054114 | Bacteria | 624 |
| 1765 | Ga0590071_026629 | 3300059421 | Bacteria | 1372 |
| 1766 | Ga0590075_005904 | 3300059424 | Bacteria | 2896 |
| 1767 | Ga0590075_026904 | 3300059424 | Bacteria | 1449 |
| 1768 | Ga0587080_178597 | 3300059503 | Bacteria | 508 |
| 1769 | Ga0587083_0027321 | 3300059505 | Bacteria | 1109 |
| 1770 | Ga0587083_0223707 | 3300059505 | Bacteria | 549 |
| 1771 | Ga0587085_041965 | 3300059506 | Bacteria | 801 |
| 1772 | Ga0587086_092311 | 3300059507 | Bacteria | 548 |
| 1773 | Ga0587069_156302 | 3300059642 | Unclassified | 510 |
| 1774 | Ga0587075_152295 | 3300059644 | Unclassified | 501 |
| 1775 | Ga0587079_201834 | 3300059647 | Unclassified | 543 |
| 1776 | Ga0587114_105860 | 3300059655 | Unclassified | 554 |
| 1777 | Ga0587111_0148806 | 3300060346 | Bacteria | 627 |
| 1778 | Ga0501082_0190537 | 3300060353 | Bacteria | 1784 |
| 1779 | Ga0501082_1078213 | 3300060353 | Bacteria | 702 |
| 1780 | Ga0466962_0003839 | 3300061719 | Bacteria | 7180 |
| 1781 | Ga0466962_0009515 | 3300061719 | Bacteria | 4660 |
| 1782 | Ga0466962_0041609 | 3300061719 | Bacteria | 2198 |
| 1783 | Ga0466962_0045217 | 3300061719 | Bacteria | 2105 |
| 1784 | Ga0466962_0276730 | 3300061719 | Unclassified | 828 |
| 1785 | Ga0530510_0007146 | 3300061734 | Bacteria | 7770 |
| 1786 | Ga0530510_0035687 | 3300061734 | Bacteria | 3584 |
| 1787 | Ga0530510_0226665 | 3300061734 | Bacteria | 1390 |
| 1788 | Ga0530510_0238099 | 3300061734 | Bacteria | 1355 |
| 1789 | Ga0530510_0405050 | 3300061734 | Bacteria | 1029 |
| 1790 | Ga0530510_0921447 | 3300061734 | Bacteria | 668 |
| 1791 | Ga0070700_100401125 | |||
| 1792 | JGI24746J21847_1048614 | |||
| 1793 | JGI24747J21853_1016955 | |||
| 1794 | JGI24737J22298_10178942 | |||
| 1795 | JGI24743J22301_10129190 | |||
| 1796 | JGI24749J21850_1029563 | |||
| 1797 | JGI24744J21845_10003592 | |||
| 1798 | JGI24742J22300_10036530 | |||
| 1799 | JGI24742J22300_10038740 | |||
| 1800 | rootL2_10091144 | |||
| 1801 | JGI25407J50210_10162221 | |||
| 1802 | JGI25404J52841_10036040 | |||
| 1803 | Ga0058860_10026662 | |||
| 1804 | Ga0070658_10083898 | |||
| 1805 | Ga0070658_10505778 | |||
| 1806 | Ga0070676_10275815 | |||
| 1807 | Ga0070683_100067793 | |||
| 1808 | Ga0070690_100028453 | |||
| 1809 | Ga0070670_101468243 | |||
| 1810 | Ga0070677_10102324 | |||
| 1811 | Ga0070677_10465098 | |||
| 1812 | Ga0068869_100279703 | |||
| 1813 | Ga0068869_100986668 | |||
| 1814 | Ga0068869_101240832 | |||
| 1815 | Ga0070666_10080620 | |||
| 1816 | Ga0070680_100012321 | |||
| 1817 | Ga0070680_100067747 | |||
| 1818 | Ga0070680_100433055 | |||
| 1819 | Ga0070680_100623767 | |||
| 1820 | Ga0070680_100860718 | |||
| 1821 | Ga0070680_101286639 | |||
| 1822 | Ga0070682_100016493 | |||
| 1823 | Ga0070682_100054134 | |||
| 1824 | Ga0070682_100083590 | |||
| 1825 | Ga0070682_100176053 | |||
| 1826 | Ga0070682_101425419 | |||
| 1827 | Ga0068868_100067114 | |||
| 1828 | Ga0068868_100168372 | |||
| 1829 | Ga0068868_100438390 | |||
| 1830 | Ga0070660_100022594 | |||
| 1831 | Ga0070660_100209107 | |||
| 1832 | Ga0070660_100557123 | |||
| 1833 | Ga0070660_100641984 | |||
| 1834 | Ga0070660_100808125 | |||
| 1835 | Ga0070660_101316321 | |||
| 1836 | Ga0070689_100032361 | |||
| 1837 | Ga0070689_100510160 | |||
| 1838 | Ga0070691_10086670 | |||
| 1839 | Ga0070687_101064337 | |||
| 1840 | Ga0070687_101216447 | |||
| 1841 | Ga0070661_100063325 | |||
| 1842 | Ga0070661_100615782 | |||
| 1843 | Ga0070661_100906759 | |||
| 1844 | Ga0070661_101471510 | |||
| 1845 | Ga0070692_10038074 | |||
| 1846 | Ga0070668_100225980 | |||
| 1847 | Ga0070669_100578565 | |||
| 1848 | Ga0070669_100648897 | |||
| 1849 | Ga0070669_101391106 | |||
| 1850 | Ga0070675_100032562 | |||
| 1851 | Ga0070675_100269191 | |||
| 1852 | Ga0070675_100286508 | |||
| 1853 | Ga0070671_100033028 | |||
| 1854 | Ga0070671_100033063 | |||
| 1855 | Ga0070671_100095902 | |||
| 1856 | Ga0070671_101671482 | |||
| 1857 | Ga0070674_100005001 | |||
| 1858 | Ga0070674_100461248 | |||
| 1859 | Ga0070673_100195570 | |||
| 1860 | Ga0070673_100388952 | |||
| 1861 | Ga0070673_100831512 | |||
| 1862 | Ga0070673_100834817 | |||
| 1863 | Ga0070673_101454465 | |||
| 1864 | Ga0070688_100083124 | |||
| 1865 | Ga0070688_101702608 | |||
| 1866 | Ga0070659_100034381 | |||
| 1867 | Ga0070659_100975608 | |||
| 1868 | Ga0070659_101226432 | |||
| 1869 | Ga0070667_101143302 | |||
| 1870 | Ga0070703_10012916 | |||
| 1871 | Ga0070703_10231426 | |||
| 1872 | Ga0070703_10415645 | |||
| 1873 | Ga0070709_10005698 | |||
| 1874 | Ga0070709_10052234 | |||
| 1875 | Ga0070709_10140929 | |||
| 1876 | Ga0070709_10511238 | |||
| 1877 | Ga0070709_10582036 | |||
| 1878 | Ga0070714_100001612 | |||
| 1879 | Ga0070714_100006822 | |||
| 1880 | Ga0070714_100014480 | |||
| 1881 | Ga0070714_100034986 | |||
| 1882 | Ga0070714_100039441 | |||
| 1883 | Ga0070714_100062196 | |||
| 1884 | Ga0070714_100108329 | |||
| 1885 | Ga0070714_100190311 | |||
| 1886 | Ga0070714_100234528 | |||
| 1887 | Ga0070714_100259453 | |||
| 1888 | Ga0070714_100808327 | |||
| 1889 | Ga0070713_100012818 | |||
| 1890 | Ga0070713_100025980 | |||
| 1891 | Ga0070713_100091162 | |||
| 1892 | Ga0070713_100099214 | |||
| 1893 | Ga0070713_100160590 | |||
| 1894 | Ga0070713_100261316 | |||
| 1895 | Ga0070713_100367076 | |||
| 1896 | Ga0070713_100554481 | |||
| 1897 | Ga0070713_100903245 | |||
| 1898 | Ga0070713_101271457 | |||
| 1899 | Ga0070710_10001306 | |||
| 1900 | Ga0070710_10007464 | |||
| 1901 | Ga0070710_10250259 | |||
| 1902 | Ga0070710_10389972 | |||
| 1903 | Ga0070710_10715643 | |||
| 1904 | Ga0070710_10903341 | |||
| 1905 | Ga0070710_10909301 | |||
| 1906 | Ga0070701_10591086 | |||
| 1907 | Ga0070701_10669392 | |||
| 1908 | Ga0070701_10819569 | |||
| 1909 | Ga0070711_100013670 | |||
| 1910 | Ga0070711_100016837 | |||
| 1911 | Ga0070711_100020555 | |||
| 1912 | Ga0070711_100079548 | |||
| 1913 | Ga0070711_100721311 | |||
| 1914 | Ga0070711_100741224 | |||
| 1915 | Ga0070711_101264160 | |||
| 1916 | Ga0070705_100063810 | |||
| 1917 | Ga0070705_100171300 | |||
| 1918 | Ga0070705_100324585 | |||
| 1919 | Ga0070705_100550422 | |||
| 1920 | Ga0070705_100885761 | |||
| 1921 | Ga0070705_101578107 | |||
| 1922 | Ga0070700_100006069 | |||
| 1923 | Ga0070700_100449788 | |||
| 1924 | Ga0070700_100901886 | |||
| 1925 | Ga0070700_101226974 | |||
| 1926 | Ga0070694_100006994 | |||
| 1927 | Ga0070694_100238868 | |||
| 1928 | Ga0070694_100951663 | |||
| 1929 | Ga0070694_101958939 | |||
| 1930 | Ga0070708_100120073 | |||
| 1931 | Ga0070708_100146282 | |||
| 1932 | Ga0070708_100180628 | |||
| 1933 | Ga0070708_100229094 | |||
| 1934 | Ga0070708_100333774 | |||
| 1935 | Ga0070708_100371625 | |||
| 1936 | Ga0070708_100560246 | |||
| 1937 | Ga0070708_101172842 | |||
| 1938 | Ga0070708_101348185 | |||
| 1939 | Ga0070708_101987053 | |||
| 1940 | Ga0070663_100051962 | |||
| 1941 | Ga0070678_100158820 | |||
| 1942 | Ga0070678_100212788 | |||
| 1943 | Ga0070678_100251223 | |||
| 1944 | Ga0070678_100660657 | |||
| 1945 | Ga0070678_101385879 | |||
| 1946 | Ga0070678_101782474 | |||
| 1947 | Ga0070662_100450671 | |||
| 1948 | Ga0070662_101003088 | |||
| 1949 | Ga0070681_10049123 | |||
| 1950 | Ga0070681_10058032 | |||
| 1951 | Ga0070681_10156680 | |||
| 1952 | Ga0070681_10359146 | |||
| 1953 | Ga0070681_11044004 | |||
| 1954 | Ga0070681_11894441 | |||
| 1955 | Ga0068867_100087002 | |||
| 1956 | Ga0068867_100200655 | |||
| 1957 | Ga0070685_10059828 | |||
| 1958 | Ga0070706_100005941 | |||
| 1959 | Ga0070706_100016460 | |||
| 1960 | Ga0070706_100017080 | |||
| 1961 | Ga0070706_100107671 | |||
| 1962 | Ga0070706_100153993 | |||
| 1963 | Ga0070706_100508344 | |||
| 1964 | Ga0070706_100550886 | |||
| 1965 | Ga0070706_101523629 | |||
| 1966 | Ga0070706_101597429 | |||
| 1967 | Ga0070706_101774773 | |||
| 1968 | Ga0070707_100001116 | |||
| 1969 | Ga0070707_100002726 | |||
| 1970 | Ga0070707_100004597 | |||
| 1971 | Ga0070707_100065690 | |||
| 1972 | Ga0070707_100126263 | |||
| 1973 | Ga0070707_100653591 | |||
| 1974 | Ga0070707_100813928 | |||
| 1975 | Ga0070707_101051699 | |||
| 1976 | Ga0070707_101475020 | |||
| 1977 | Ga0070707_101628331 | |||
| 1978 | Ga0070707_101811471 | |||
| 1979 | Ga0070698_100001818 | |||
| 1980 | Ga0070698_100068930 | |||
| 1981 | Ga0070698_100070866 | |||
| 1982 | Ga0070698_100081594 | |||
| 1983 | Ga0070698_100224119 | |||
| 1984 | Ga0070698_100264670 | |||
| 1985 | Ga0070698_100547204 | |||
| 1986 | Ga0070698_100970761 | |||
| 1987 | Ga0070698_101420625 | |||
| 1988 | Ga0070699_100008589 | |||
| 1989 | Ga0070699_100021417 | |||
| 1990 | Ga0070699_100077528 | |||
| 1991 | Ga0070699_100447006 | |||
| 1992 | Ga0070699_100596007 | |||
| 1993 | Ga0070699_100603673 | |||
| 1994 | Ga0070699_101757676 | |||
| 1995 | Ga0070679_100016558 | |||
| 1996 | Ga0070679_100058865 | |||
| 1997 | Ga0070679_100098276 | |||
| 1998 | Ga0070679_100393218 | |||
| 1999 | Ga0070679_100691282 | |||
| 2000 | Ga0070679_100765106 | |||
| 2001 | Ga0070679_100814414 | |||
| 2002 | Ga0070679_101234373 | |||
| 2003 | Ga0070684_100030393 | |||
| 2004 | Ga0070684_100038632 | |||
| 2005 | Ga0070684_100174055 | |||
| 2006 | Ga0070684_100288905 | |||
| 2007 | Ga0070684_100589108 | |||
| 2008 | Ga0070684_101119842 | |||
| 2009 | Ga0070697_100209001 | |||
| 2010 | Ga0070697_100342388 | |||
| 2011 | Ga0068853_100156719 | |||
| 2012 | Ga0068853_101055956 | |||
| 2013 | Ga0070672_100137555 | |||
| 2014 | Ga0070672_100364294 | |||
| 2015 | Ga0070672_102015564 | |||
| 2016 | Ga0070686_100001847 | |||
| 2017 | Ga0070695_100000005 | |||
| 2018 | Ga0070695_100024161 | |||
| 2019 | Ga0070695_100422896 | |||
| 2020 | Ga0070695_100551843 | |||
| 2021 | Ga0070695_100799124 | |||
| 2022 | Ga0070696_100149142 | |||
| 2023 | Ga0070696_100161223 | |||
| 2024 | Ga0070696_100532324 | |||
| 2025 | Ga0070696_100553588 | |||
| 2026 | Ga0070696_100924306 | |||
| 2027 | Ga0070696_101216703 | |||
| 2028 | Ga0070693_100010553 | |||
| 2029 | Ga0070693_100279221 | |||
| 2030 | Ga0070693_100320990 | |||
| 2031 | Ga0070693_100610165 | |||
| 2032 | Ga0070665_100026234 | |||
| 2033 | Ga0070665_100198118 | |||
| 2034 | Ga0070665_101134344 | |||
| 2035 | Ga0070704_100017479 | |||
| 2036 | Ga0070704_100118053 | |||
| 2037 | Ga0070704_100166190 | |||
| 2038 | Ga0070704_100566368 | |||
| 2039 | Ga0070704_101892852 | |||
| 2040 | Ga0068855_100076265 | |||
| 2041 | Ga0068855_100809736 | |||
| 2042 | Ga0068855_100905259 | |||
| 2043 | Ga0068855_101185266 | |||
| 2044 | Ga0068855_101455072 | |||
| 2045 | Ga0068855_101616811 | |||
| 2046 | Ga0070664_100626125 | |||
| 2047 | Ga0070664_101116768 | |||
| 2048 | Ga0070664_102072552 | |||
| 2049 | Ga0068857_100307574 | |||
| 2050 | Ga0068857_101946336 | |||
| 2051 | Ga0068854_100392018 | |||
| 2052 | Ga0068854_101473511 | |||
| 2053 | Ga0068856_100034234 | |||
| 2054 | Ga0068856_100069684 | |||
| 2055 | Ga0068856_100082822 | |||
| 2056 | Ga0068856_100191552 | |||
| 2057 | Ga0068856_100248954 | |||
| 2058 | Ga0068856_100341259 | |||
| 2059 | Ga0068856_100401206 | |||
| 2060 | Ga0068856_100477401 | |||
| 2061 | Ga0068856_100569816 | |||
| 2062 | Ga0068856_100755407 | |||
| 2063 | Ga0068856_100854556 | |||
| 2064 | Ga0068856_100930482 | |||
| 2065 | Ga0068856_102294030 | |||
| 2066 | Ga0068856_102407227 | |||
| 2067 | Ga0070702_100028675 | |||
| 2068 | Ga0070702_100409223 | |||
| 2069 | Ga0070702_100565110 | |||
| 2070 | Ga0068852_100877005 | |||
| 2071 | Ga0068852_101453369 | |||
| 2072 | Ga0068859_100108825 | |||
| 2073 | Ga0068864_100479883 | |||
| 2074 | Ga0068864_100708168 | |||
| 2075 | Ga0068866_10033457 | |||
| 2076 | Ga0068866_10177917 | |||
| 2077 | Ga0068861_100063568 | |||
| 2078 | Ga0068861_101518106 | |||
| 2079 | Ga0068851_10189284 | |||
| 2080 | Ga0068870_10208524 | |||
| 2081 | Ga0068863_100239616 | |||
| 2082 | Ga0068863_100259997 | |||
| 2083 | Ga0068863_102584730 | |||
| 2084 | Ga0068858_100895036 | |||
| 2085 | Ga0068860_100051850 | |||
| 2086 | Ga0068860_100746623 | |||
| 2087 | Ga0068862_100982905 | |||
| 2088 | Ga0068862_101420508 | |||
| 2089 | Ga0081455_10020437 | |||
| 2090 | Ga0081455_10020619 | |||
| 2091 | Ga0081455_10108857 | |||
| 2092 | Ga0081455_10213301 | |||
| 2093 | Ga0081455_10356485 | |||
| 2094 | Ga0081538_10029358 | |||
| 2095 | Ga0081538_10066336 | |||
| 2096 | Ga0081538_10161978 | |||
| 2097 | Ga0081538_10212734 | |||
| 2098 | Ga0081540_1004661 | |||
| 2099 | Ga0081540_1048522 | |||
| 2100 | Ga0081540_1265075 | |||
| 2101 | Ga0081539_10014095 | |||
| 2102 | Ga0081539_10071976 | |||
| 2103 | Ga0070717_10008509 | |||
| 2104 | Ga0070717_10009572 | |||
| 2105 | Ga0070717_10128713 | |||
| 2106 | Ga0070717_10148806 | |||
| 2107 | Ga0070717_10170441 | |||
| 2108 | Ga0070717_10385383 | |||
| 2109 | Ga0070717_10493056 | |||
| 2110 | Ga0070717_10541002 | |||
| 2111 | Ga0070717_10755438 | |||
| 2112 | Ga0075365_10021013 | |||
| 2113 | Ga0075365_10061283 | |||
| 2114 | Ga0075368_10037491 | |||
| 2115 | Ga0075364_10061285 | |||
| 2116 | Ga0075364_10615757 | |||
| 2117 | Ga0075432_10030528 | |||
| 2118 | Ga0075432_10105773 | |||
| 2119 | Ga0075432_10202231 | |||
| 2120 | Ga0070715_10000411 | |||
| 2121 | Ga0070715_10071420 | |||
| 2122 | Ga0070716_100003224 | |||
| 2123 | Ga0070716_100004028 | |||
| 2124 | Ga0070716_100117441 | |||
| 2125 | Ga0070716_100356144 | |||
| 2126 | Ga0070716_100362605 | |||
| 2127 | Ga0070716_100403046 | |||
| 2128 | Ga0070716_100955972 | |||
| 2129 | Ga0070716_101330834 | |||
| 2130 | Ga0070716_101331103 | |||
| 2131 | Ga0070716_101629147 | |||
| 2132 | Ga0070712_100036499 | |||
| 2133 | Ga0070712_100044870 | |||
| 2134 | Ga0070712_100062735 | |||
| 2135 | Ga0070712_100138374 | |||
| 2136 | Ga0070712_100290695 | |||
| 2137 | Ga0070712_100301792 | |||
| 2138 | Ga0070712_101003101 | |||
| 2139 | Ga0070712_101071532 | |||
| 2140 | Ga0075362_10010441 | |||
| 2141 | Ga0097621_100027775 | |||
| 2142 | Ga0097621_100069381 | |||
| 2143 | Ga0097621_100350317 | |||
| 2144 | Ga0097621_102080695 | |||
| 2145 | Ga0068871_100015524 | |||
| 2146 | Ga0068871_100037623 | |||
| 2147 | Ga0068871_100176749 | |||
| 2148 | Ga0068871_100727559 | |||
| 2149 | Ga0068871_100951470 | |||
| 2150 | Ga0075428_100738413 | |||
| 2151 | Ga0075428_100937113 | |||
| 2152 | Ga0075428_101032923 | |||
| 2153 | Ga0075428_101137444 | |||
| 2154 | Ga0075428_102114165 | |||
| 2155 | Ga0075428_102492511 | |||
| 2156 | Ga0075430_100082886 | |||
| 2157 | Ga0075431_100046434 | |||
| 2158 | Ga0075431_100129178 | |||
| 2159 | Ga0075431_100198360 | |||
| 2160 | Ga0075431_100881721 | |||
| 2161 | Ga0075431_101389175 | |||
| 2162 | Ga0075431_102065393 | |||
| 2163 | Ga0075433_10010520 | |||
| 2164 | Ga0075433_10083582 | |||
| 2165 | Ga0075433_10313819 | |||
| 2166 | Ga0075433_10940014 | |||
| 2167 | Ga0075433_10967560 | |||
| 2168 | Ga0075434_100062436 | |||
| 2169 | Ga0075434_100083511 | |||
| 2170 | Ga0075434_100114729 | |||
| 2171 | Ga0075434_100263741 | |||
| 2172 | Ga0075434_101326636 | |||
| 2173 | Ga0075434_101335367 | |||
| 2174 | Ga0075434_101879194 | |||
| 2175 | Ga0075434_101957542 | |||
| 2176 | Ga0075434_102540257 | |||
| 2177 | Ga0075429_100462076 | |||
| 2178 | Ga0075429_100731047 | |||
| 2179 | Ga0075429_101467374 | |||
| 2180 | Ga0075429_101778150 | |||
| 2181 | Ga0068865_100002569 | |||
| 2182 | Ga0068865_100211781 | |||
| 2183 | Ga0068865_100486787 | |||
| 2184 | Ga0068865_102183233 | |||
| 2185 | Ga0075436_100005290 | |||
| 2186 | Ga0075436_100014092 | |||
| 2187 | Ga0075436_100115804 | |||
| 2188 | Ga0075436_100408801 | |||
| 2189 | Ga0075436_100767237 | |||
| 2190 | Ga0075436_101090722 | |||
| 2191 | Ga0097620_100108824 | |||
| 2192 | Ga0075435_100029772 | |||
| 2193 | Ga0075435_100059064 | |||
| 2194 | Ga0075435_100123865 | |||
| 2195 | Ga0075435_100462203 | |||
| 2196 | Ga0075435_100616040 | |||
| 2197 | Ga0075435_100675940 | |||
| 2198 | Ga0075435_100706151 | |||
| 2199 | Ga0075435_101049143 | |||
| 2200 | Ga0075435_101582264 | |||
| 2201 | Ga0099794_10345463 | |||
| 2202 | Ga0099795_10153195 | |||
| 2203 | Ga0105251_10465950 | |||
| 2204 | Ga0105240_10026970 | |||
| 2205 | Ga0105240_10086355 | |||
| 2206 | Ga0105240_10466016 | |||
| 2207 | Ga0105240_10714686 | |||
| 2208 | Ga0105240_11235172 | |||
| 2209 | Ga0105240_11912422 | |||
| 2210 | Ga0111539_10026259 | |||
| 2211 | Ga0111539_10311132 | |||
| 2212 | Ga0111539_10422037 | |||
| 2213 | Ga0105245_10006470 | |||
| 2214 | Ga0105245_10016352 | |||
| 2215 | Ga0105245_10032981 | |||
| 2216 | Ga0105245_10093167 | |||
| 2217 | Ga0105245_10217624 | |||
| 2218 | Ga0105245_10647743 | |||
| 2219 | Ga0105245_10920262 | |||
| 2220 | Ga0105245_11112558 | |||
| 2221 | Ga0105245_11173832 | |||
| 2222 | Ga0105247_10039193 | |||
| 2223 | Ga0105247_10041124 | |||
| 2224 | Ga0105247_10455354 | |||
| 2225 | Ga0105247_10628807 | |||
| 2226 | Ga0114129_10014214 | |||
| 2227 | Ga0114129_10028533 | |||
| 2228 | Ga0114129_10176020 | |||
| 2229 | Ga0114129_10333560 | |||
| 2230 | Ga0114129_10443997 | |||
| 2231 | Ga0114129_11481715 | |||
| 2232 | Ga0114129_12161052 | |||
| 2233 | Ga0114129_12273645 | |||
| 2234 | Ga0114129_12636026 | |||
| 2235 | Ga0105243_10006582 | |||
| 2236 | Ga0105243_10176379 | |||
| 2237 | Ga0105243_10472913 | |||
| 2238 | Ga0105243_10920157 | |||
| 2239 | Ga0105243_11232722 | |||
| 2240 | Ga0105243_11766009 | |||
| 2241 | Ga0105241_10010431 | |||
| 2242 | Ga0105241_10225695 | |||
| 2243 | Ga0105241_11189493 | |||
| 2244 | Ga0105242_10189764 | |||
| 2245 | Ga0105242_10232541 | |||
| 2246 | Ga0105242_10611090 | |||
| 2247 | Ga0105242_11904192 | |||
| 2248 | Ga0105242_12037709 | |||
| 2249 | Ga0105242_12283825 | |||
| 2250 | Ga0105248_10049097 | |||
| 2251 | Ga0105248_10305897 | |||
| 2252 | Ga0105248_10322552 | |||
| 2253 | Ga0105248_10970970 | |||
| 2254 | Ga0105248_11825226 | |||
| 2255 | Ga0105248_11914902 | |||
| 2256 | Ga0105248_12234074 | |||
| 2257 | Ga0105248_12822677 | |||
| 2258 | Ga0105237_10016127 | |||
| 2259 | Ga0105237_10082158 | |||
| 2260 | Ga0105237_11400414 | |||
| 2261 | Ga0105237_11677159 | |||
| 2262 | Ga0105238_10270449 | |||
| 2263 | Ga0105249_10530734 | |||
| 2264 | Ga0105249_11370788 | |||
| 2265 | Ga0105249_11793470 | |||
| 2266 | Ga0099796_10246869 | |||
| 2267 | Ga0105239_10047664 | |||
| 2268 | Ga0105239_10082773 | |||
| 2269 | Ga0105239_10896385 | |||
| 2270 | Ga0105239_10973953 | |||
| 2271 | Ga0105239_11374835 | |||
| 2272 | Ga0105239_13455417 | |||
| 2273 | Ga0105246_10015657 | |||
| 2274 | Ga0105246_10154906 | |||
| 2275 | Ga0105246_10155850 | |||
| 2276 | Ga0105246_10421196 | |||
| 2277 | Ga0105246_10447504 | |||
| 2278 | Ga0105246_11429931 | |||
| 2279 | Ga0105246_11560348 | |||
| 2280 | Ga0157336_1020165 | |||
| 2281 | Ga0157318_1024722 | |||
| 2282 | Ga0157321_1030441 | |||
| 2283 | Ga0157335_1004864 | |||
| 2284 | Ga0157319_1008123 | |||
| 2285 | Ga0157347_1011762 | |||
| 2286 | Ga0157339_1019802 | |||
| 2287 | Ga0157342_1022454 | |||
| 2288 | Ga0157315_1027696 | |||
| 2289 | Ga0157326_1040471 | |||
| 2290 | Ga0157373_10274124 | |||
| 2291 | Ga0157373_10361112 | |||
| 2292 | Ga0157373_10885394 | |||
| 2293 | Ga0157371_10044697 | |||
| 2294 | Ga0157371_10343760 | |||
| 2295 | Ga0157371_10377891 | |||
| 2296 | Ga0157370_10189800 | |||
| 2297 | Ga0157370_10325820 | |||
| 2298 | Ga0157370_10872670 | |||
| 2299 | Ga0157370_11020394 | |||
| 2300 | Ga0157370_11229979 | |||
| 2301 | Ga0157370_11394070 | |||
| 2302 | Ga0157369_10080357 | |||
| 2303 | Ga0157369_10120813 | |||
| 2304 | Ga0157369_10138075 | |||
| 2305 | Ga0157369_10269526 | |||
| 2306 | Ga0157369_10726452 | |||
| 2307 | Ga0157369_11010926 | |||
| 2308 | Ga0157369_11128225 | |||
| 2309 | Ga0157369_12651350 | |||
| 2310 | Ga0157374_10020635 | |||
| 2311 | Ga0157374_10095491 | |||
| 2312 | Ga0157374_10173495 | |||
| 2313 | Ga0157374_10268809 | |||
| 2314 | Ga0157374_11308648 | |||
| 2315 | Ga0157378_10086458 | |||
| 2316 | Ga0157378_11253976 | |||
| 2317 | Ga0157378_11257669 | |||
| 2318 | Ga0157378_11848308 | |||
| 2319 | Ga0157378_11947405 | |||
| 2320 | Ga0163162_10051975 | |||
| 2321 | Ga0163162_10322659 | |||
| 2322 | Ga0163162_10876998 | |||
| 2323 | Ga0163162_11863027 | |||
| 2324 | Ga0157372_10160028 | |||
| 2325 | Ga0157372_10196442 | |||
| 2326 | Ga0157372_10276342 | |||
| 2327 | Ga0157372_10413923 | |||
| 2328 | Ga0157372_10502340 | |||
| 2329 | Ga0157372_10944775 | |||
| 2330 | Ga0157372_11030418 | |||
| 2331 | Ga0157372_11511173 | |||
| 2332 | Ga0157375_10006851 | |||
| 2333 | Ga0157375_10009400 | |||
| 2334 | Ga0157375_10374897 | |||
| 2335 | Ga0157375_11214135 | |||
| 2336 | Ga0157375_13660397 | |||
| 2337 | Ga0163163_10687593 | |||
| 2338 | Ga0163163_12793379 | |||
| 2339 | Ga0157380_10059961 | |||
| 2340 | Ga0157380_10342071 | |||
| 2341 | Ga0157380_11218644 | |||
| 2342 | Ga0157380_11419542 | |||
| 2343 | Ga0182008_10006258 | |||
| 2344 | Ga0182008_10062492 | |||
| 2345 | Ga0182008_10084390 | |||
| 2346 | Ga0182008_10471947 | |||
| 2347 | Ga0182008_10544273 | |||
| 2348 | Ga0182008_10813649 | |||
| 2349 | Ga0157377_10004537 | |||
| 2350 | Ga0157377_10079857 | |||
| 2351 | Ga0157377_10550329 | |||
| 2352 | Ga0157379_10130378 | |||
| 2353 | Ga0157379_10963677 | |||
| 2354 | Ga0157379_11507908 | |||
| 2355 | Ga0157379_11532306 | |||
| 2356 | Ga0157376_10012855 | |||
| 2357 | Ga0157376_10149906 | |||
| 2358 | Ga0157376_10195967 | |||
| 2359 | Ga0157376_10421366 | |||
| 2360 | Ga0157376_10841849 | |||
| 2361 | Ga0157376_12005172 | |||
| 2362 | Ga0157376_12624430 | |||
| 2363 | Ga0182006_1002844 | |||
| 2364 | Ga0182006_1038260 | |||
| 2365 | Ga0182006_1119563 | |||
| 2366 | Ga0182007_10055135 | |||
| 2367 | Ga0182007_10300293 | |||
| 2368 | Ga0182005_1135682 | |||
| 2369 | Ga0182005_1183412 | |||
| 2370 | Ga0163161_10333234 | |||
| 2371 | Ga0163161_10528693 | |||
| 2372 | Ga0163161_10989445 | |||
| 2373 | Ga0197907_10415719 | |||
| 2374 | Ga0197907_10599385 | |||
| 2375 | Ga0197907_10712153 | |||
| 2376 | Ga0197907_10912859 | |||
| 2377 | Ga0197907_10976367 | |||
| 2378 | Ga0197907_11296060 | |||
| 2379 | Ga0206356_10713961 | |||
| 2380 | Ga0206356_10765291 | |||
| 2381 | Ga0206356_11023176 | |||
| 2382 | Ga0206355_1068348 | |||
| 2383 | Ga0206355_1148949 | |||
| 2384 | Ga0206355_1158685 | |||
| 2385 | Ga0206355_1187411 | |||
| 2386 | Ga0206351_10128392 | |||
| 2387 | Ga0206351_10481373 | |||
| 2388 | Ga0206352_11289281 | |||
| 2389 | Ga0206350_11155711 | |||
| 2390 | Ga0206350_11268713 | |||
| 2391 | Ga0206350_11419901 | |||
| 2392 | Ga0206354_10205280 | |||
| 2393 | Ga0206354_10380699 | |||
| 2394 | Ga0206354_10993587 | |||
| 2395 | Ga0206354_11373038 | |||
| 2396 | Ga0206354_11465929 | |||
| 2397 | Ga0206354_11603311 | |||
| 2398 | Ga0206353_10651477 | |||
| 2399 | Ga0206353_11608935 | |||
| 2400 | Ga0206353_11750180 | |||
| 2401 | Ga0206353_11814207 | |||
| 2402 | Ga0154015_1105780 | |||
| 2403 | Ga0213874_10085357 | |||
| 2404 | Ga0224712_10061397 | |||
| 2405 | Ga0224712_10093615 | |||
| 2406 | Ga0224712_10223881 | |||
| 2407 | Ga0224712_10532951 | |||
| 2408 | Ga0224712_10533197 | |||
| 2409 | Ga0207653_10075233 | |||
| 2410 | Ga0207682_10102324 | |||
| 2411 | Ga0207682_10421608 | |||
| 2412 | Ga0207692_10010787 | |||
| 2413 | Ga0207692_10019501 | |||
| 2414 | Ga0207692_10094073 | |||
| 2415 | Ga0207692_10240974 | |||
| 2416 | Ga0207692_10262257 | |||
| 2417 | Ga0207692_10285656 | |||
| 2418 | Ga0207692_10327388 | |||
| 2419 | Ga0207692_10343219 | |||
| 2420 | Ga0207692_10838051 | |||
| 2421 | Ga0207642_10023373 | |||
| 2422 | Ga0207642_10334657 | |||
| 2423 | Ga0207710_10085677 | |||
| 2424 | Ga0207710_10180769 | |||
| 2425 | Ga0207710_10188880 | |||
| 2426 | Ga0207688_10084658 | |||
| 2427 | Ga0207688_10349015 | |||
| 2428 | Ga0207688_10524598 | |||
| 2429 | Ga0207688_10596282 | |||
| 2430 | Ga0207680_10469580 | |||
| 2431 | Ga0207647_10098484 | |||
| 2432 | Ga0207647_10652721 | |||
| 2433 | Ga0207685_10200136 | |||
| 2434 | Ga0207699_10004728 | |||
| 2435 | Ga0207699_10012388 | |||
| 2436 | Ga0207699_10074686 | |||
| 2437 | Ga0207699_10168694 | |||
| 2438 | Ga0207699_10207042 | |||
| 2439 | Ga0207699_10462396 | |||
| 2440 | Ga0207645_10261918 | |||
| 2441 | Ga0207645_10637199 | |||
| 2442 | Ga0207643_10063461 | |||
| 2443 | Ga0207705_10542226 | |||
| 2444 | Ga0207705_10562132 | |||
| 2445 | Ga0207705_10929291 | |||
| 2446 | Ga0207705_11429295 | |||
| 2447 | Ga0207684_10008813 | |||
| 2448 | Ga0207684_10030845 | |||
| 2449 | Ga0207684_10143351 | |||
| 2450 | Ga0207684_10342575 | |||
| 2451 | Ga0207684_10605041 | |||
| 2452 | Ga0207684_11129376 | |||
| 2453 | Ga0207654_10083163 | |||
| 2454 | Ga0207654_10236968 | |||
| 2455 | Ga0207707_10018185 | |||
| 2456 | Ga0207707_10092180 | |||
| 2457 | Ga0207707_10138889 | |||
| 2458 | Ga0207707_10478112 | |||
| 2459 | Ga0207707_10488359 | |||
| 2460 | Ga0207707_11600806 | |||
| 2461 | Ga0207695_10173737 | |||
| 2462 | Ga0207695_10181618 | |||
| 2463 | Ga0207695_10470553 | |||
| 2464 | Ga0207695_10807905 | |||
| 2465 | Ga0207695_11088388 | |||
| 2466 | Ga0207695_11409856 | |||
| 2467 | Ga0207671_10031915 | |||
| 2468 | Ga0207671_10265899 | |||
| 2469 | Ga0207693_10000807 | |||
| 2470 | Ga0207693_10000924 | |||
| 2471 | Ga0207693_10002104 | |||
| 2472 | Ga0207693_10041055 | |||
| 2473 | Ga0207693_10117679 | |||
| 2474 | Ga0207693_10165785 | |||
| 2475 | Ga0207693_10703607 | |||
| 2476 | Ga0207693_10863242 | |||
| 2477 | Ga0207663_10009751 | |||
| 2478 | Ga0207663_10015616 | |||
| 2479 | Ga0207663_10030655 | |||
| 2480 | Ga0207663_10085866 | |||
| 2481 | Ga0207663_10120700 | |||
| 2482 | Ga0207663_11264317 | |||
| 2483 | Ga0207660_10458774 | |||
| 2484 | Ga0207660_10480598 | |||
| 2485 | Ga0207660_10675849 | |||
| 2486 | Ga0207660_10713297 | |||
| 2487 | Ga0207660_10759840 | |||
| 2488 | Ga0207662_10090539 | |||
| 2489 | Ga0207662_10408574 | |||
| 2490 | Ga0207657_10000486 | |||
| 2491 | Ga0207657_10103420 | |||
| 2492 | Ga0207657_10236712 | |||
| 2493 | Ga0207657_10402986 | |||
| 2494 | Ga0207657_10518444 | |||
| 2495 | Ga0207649_10539432 | |||
| 2496 | Ga0207649_10914043 | |||
| 2497 | Ga0207649_11614115 | |||
| 2498 | Ga0207652_10027118 | |||
| 2499 | Ga0207652_10105223 | |||
| 2500 | Ga0207652_10730436 | |||
| 2501 | Ga0207652_10766881 | |||
| 2502 | Ga0207646_10001597 | |||
| 2503 | Ga0207646_10005168 | |||
| 2504 | Ga0207646_10007573 | |||
| 2505 | Ga0207646_10110622 | |||
| 2506 | Ga0207646_10200810 | |||
| 2507 | Ga0207646_10373300 | |||
| 2508 | Ga0207646_10480098 | |||
| 2509 | Ga0207646_10535826 | |||
| 2510 | Ga0207646_11219829 | |||
| 2511 | Ga0207646_11309568 | |||
| 2512 | Ga0207646_11661720 | |||
| 2513 | Ga0207646_11881329 | |||
| 2514 | Ga0207681_10079267 | |||
| 2515 | Ga0207694_10134949 | |||
| 2516 | Ga0207650_11268989 | |||
| 2517 | Ga0207659_10065504 | |||
| 2518 | Ga0207659_10140631 | |||
| 2519 | Ga0207687_10055681 | |||
| 2520 | Ga0207687_10134605 | |||
| 2521 | Ga0207687_10245456 | |||
| 2522 | Ga0207687_10289592 | |||
| 2523 | Ga0207687_10635357 | |||
| 2524 | Ga0207700_10000001 | |||
| 2525 | Ga0207700_10020161 | |||
| 2526 | Ga0207700_10067077 | |||
| 2527 | Ga0207700_10071397 | |||
| 2528 | Ga0207700_10187646 | |||
| 2529 | Ga0207700_10381320 | |||
| 2530 | Ga0207700_10538567 | |||
| 2531 | Ga0207700_11567284 | |||
| 2532 | Ga0207664_10009662 | |||
| 2533 | Ga0207664_10039265 | |||
| 2534 | Ga0207664_10053974 | |||
| 2535 | Ga0207664_10067139 | |||
| 2536 | Ga0207664_10111665 | |||
| 2537 | Ga0207664_10128895 | |||
| 2538 | Ga0207664_10138713 | |||
| 2539 | Ga0207664_10282510 | |||
| 2540 | Ga0207664_10347889 | |||
| 2541 | Ga0207664_10384019 | |||
| 2542 | Ga0207664_11170519 | |||
| 2543 | Ga0207664_11193741 | |||
| 2544 | Ga0207644_10062612 | |||
| 2545 | Ga0207644_10066090 | |||
| 2546 | Ga0207644_10303177 | |||
| 2547 | Ga0207644_10587920 | |||
| 2548 | Ga0207690_10107160 | |||
| 2549 | Ga0207690_10456443 | |||
| 2550 | Ga0207690_10811228 | |||
| 2551 | Ga0207706_10314683 | |||
| 2552 | Ga0207686_10066786 | |||
| 2553 | Ga0207686_10076457 | |||
| 2554 | Ga0207686_10679632 | |||
| 2555 | Ga0207686_10680495 | |||
| 2556 | Ga0207686_10683756 | |||
| 2557 | Ga0207709_10268584 | |||
| 2558 | Ga0207709_10279248 | |||
| 2559 | Ga0207709_10394335 | |||
| 2560 | Ga0207709_10763306 | |||
| 2561 | Ga0207670_10051744 | |||
| 2562 | Ga0207670_11107102 | |||
| 2563 | Ga0207669_10925531 | |||
| 2564 | Ga0207669_11908502 | |||
| 2565 | Ga0207704_10006080 | |||
| 2566 | Ga0207704_10153130 | |||
| 2567 | Ga0207704_10163892 | |||
| 2568 | Ga0207665_10000058 | |||
| 2569 | Ga0207665_10001956 | |||
| 2570 | Ga0207665_10010709 | |||
| 2571 | Ga0207665_10116071 | |||
| 2572 | Ga0207665_10485646 | |||
| 2573 | Ga0207665_10499185 | |||
| 2574 | Ga0207665_10550787 | |||
| 2575 | Ga0207665_10870171 | |||
| 2576 | Ga0207665_11102259 | |||
| 2577 | Ga0207691_10093311 | |||
| 2578 | Ga0207691_10376604 | |||
| 2579 | Ga0207691_11230497 | |||
| 2580 | Ga0207711_10023157 | |||
| 2581 | Ga0207711_10154130 | |||
| 2582 | Ga0207711_10223640 | |||
| 2583 | Ga0207711_10494608 | |||
| 2584 | Ga0207711_10527299 | |||
| 2585 | Ga0207711_10910387 | |||
| 2586 | Ga0207689_10052839 | |||
| 2587 | Ga0207689_10474564 | |||
| 2588 | Ga0207689_11324315 | |||
| 2589 | Ga0207661_10066647 | |||
| 2590 | Ga0207661_10179085 | |||
| 2591 | Ga0207661_10374989 | |||
| 2592 | Ga0207661_10506112 | |||
| 2593 | Ga0207661_11030941 | |||
| 2594 | Ga0207661_12121611 | |||
| 2595 | Ga0207679_10879573 | |||
| 2596 | Ga0207679_11371973 | |||
| 2597 | Ga0207679_12084956 | |||
| 2598 | Ga0207667_10721663 | |||
| 2599 | Ga0207667_11060276 | |||
| 2600 | Ga0207667_11545816 | |||
| 2601 | Ga0207667_11848469 | |||
| 2602 | Ga0207651_10278459 | |||
| 2603 | Ga0207651_10376333 | |||
| 2604 | Ga0207712_10226975 | |||
| 2605 | Ga0207668_10127346 | |||
| 2606 | Ga0207640_10840104 | |||
| 2607 | Ga0207640_10867086 | |||
| 2608 | Ga0207658_12106996 | |||
| 2609 | Ga0207677_10099472 | |||
| 2610 | Ga0207677_10146512 | |||
| 2611 | Ga0207677_11165409 | |||
| 2612 | Ga0207677_11412994 | |||
| 2613 | Ga0207703_10147797 | |||
| 2614 | Ga0207639_10165616 | |||
| 2615 | Ga0207678_10020158 | |||
| 2616 | Ga0207678_11748936 | |||
| 2617 | Ga0207708_10029459 | |||
| 2618 | Ga0207708_10142622 | |||
| 2619 | Ga0207708_10310172 | |||
| 2620 | Ga0207708_10478009 | |||
| 2621 | Ga0207708_10783262 | |||
| 2622 | Ga0207708_11274288 | |||
| 2623 | Ga0207708_11893952 | |||
| 2624 | Ga0207702_10005430 | |||
| 2625 | Ga0207702_10133803 | |||
| 2626 | Ga0207702_10175527 | |||
| 2627 | Ga0207702_10251346 | |||
| 2628 | Ga0207702_10337847 | |||
| 2629 | Ga0207702_10346138 | |||
| 2630 | Ga0207702_10365103 | |||
| 2631 | Ga0207702_10774701 | |||
| 2632 | Ga0207702_10805454 | |||
| 2633 | Ga0207702_11349379 | |||
| 2634 | Ga0207702_11788227 | |||
| 2635 | Ga0207702_12452752 | |||
| 2636 | Ga0207641_10349890 | |||
| 2637 | Ga0207641_10741395 | |||
| 2638 | Ga0207648_10001479 | |||
| 2639 | Ga0207648_10414264 | |||
| 2640 | Ga0207676_10829413 | |||
| 2641 | Ga0207674_10459809 | |||
| 2642 | Ga0207674_11432069 | |||
| 2643 | Ga0207675_100045622 | |||
| 2644 | Ga0207675_100648569 | |||
| 2645 | Ga0207683_10000336 | |||
| 2646 | Ga0207683_10000966 | |||
| 2647 | Ga0207683_10293865 | |||
| 2648 | Ga0207683_10440091 | |||
| 2649 | Ga0207683_10451140 | |||
| 2650 | Ga0207683_11170572 | |||
| 2651 | Ga0209966_1053207 | |||
| 2652 | Ga0209813_10171589 | |||
| 2653 | Ga0209974_10460877 | |||
| 2654 | Ga0207428_10006507 | |||
| 2655 | Ga0207428_10029205 | |||
| 2656 | Ga0207428_10195808 | |||
| 2657 | Ga0207428_10258429 | |||
| 2658 | Ga0207428_10635776 | |||
| 2659 | Ga0207428_10825408 | |||
| 2660 | Ga0268266_10379883 | |||
| 2661 | Ga0268266_10836009 | |||
| 2662 | Ga0268266_11005121 | |||
| 2663 | Ga0268265_10376761 | |||
| 2664 | Ga0268265_11977020 | |||
| 2665 | Ga0268264_10052067 | |||
| 2666 | Ga0265337_1067003 | |||
| 2667 | Ga0265326_10120259 | |||
| 2668 | Ga0265326_10144018 | |||
| 2669 | Ga0265319_1016012 | |||
| 2670 | Ga0265319_1156879 | |||
| 2671 | Ga0265334_10014972 | |||
| 2672 | Ga0265318_10369950 | |||
| 2673 | Ga0265323_10173361 | |||
| 2674 | Ga0265322_10216270 | |||
| 2675 | Ga0265336_10001679 | |||
| 2676 | Ga0265336_10029316 | |||
| 2677 | Ga0265338_10003865 | |||
| 2678 | Ga0265338_10004114 | |||
| 2679 | Ga0265338_10097542 | |||
| 2680 | Ga0265324_10148462 | |||
| 2681 | Ga0265330_10005447 | |||
| 2682 | Ga0265339_10003346 | |||
| 2683 | Ga0265327_10046422 | |||
| 2684 | Ga0307408_100276341 | |||
| 2685 | Ga0265313_10009625 | |||
| 2686 | Ga0265314_10371032 | |||
| 2687 | Ga0265342_10022365 | |||
| 2688 | Ga0307413_10447126 | |||
| 2689 | Ga0307406_10734701 | |||
| 2690 | Ga0307407_10030113 | |||
| 2691 | Ga0307412_10363106 | |||
| 2692 | Ga0307412_10644355 | |||
| 2693 | Ga0307412_11662510 | |||
| 2694 | Ga0307409_100051516 | |||
| 2695 | Ga0307409_100176643 | |||
| 2696 | Ga0307409_100230698 | |||
| 2697 | Ga0307409_100503556 | |||
| 2698 | Ga0307409_100662188 | |||
| 2699 | Ga0307409_100926126 | |||
| 2700 | Ga0307409_101396935 | |||
| 2701 | Ga0307409_102511669 | |||
| 2702 | Ga0307409_102966286 | |||
| 2703 | Ga0307416_100450949 | |||
| 2704 | Ga0307416_100550001 | |||
| 2705 | Ga0307416_100629888 | |||
| 2706 | Ga0307416_101078898 | |||
| 2707 | Ga0307414_11081184 | |||
| 2708 | Ga0307414_11743633 | |||
| 2709 | Ga0307414_11926713 | |||
| 2710 | Ga0307415_100194861 | |||
| 2711 | Ga0307415_100291982 | |||
| 2712 | Ga0307415_100930597 | |||
| 2713 | Ga0316583_10258442 | |||
| 2714 | Ga0373948_0148597 | |||
| 2715 | Ga0373959_0054848 | |||
| 2716 | Ga0373959_0065496 | |||
| 2717 | Ga0373938_0196926 | |||
| 2718 | Ga0373928_0248298 | |||
| 2719 | Ga0373929_0038574 | |||
| 2720 | Ga0373929_0077209 | |||
| 2721 | Ga0373934_0172223 | |||
| 2722 | Ga0373934_0483998 | |||
| 2723 | Ga0373940_0030290 | |||
| 2724 | Ga0373940_0055002 | |||
| 2725 | Ga0373940_0259277 | |||
| 2726 | Ga0373949_0086305 | |||
| 2727 | Ga0373949_0101023 | |||
| 2728 | Ga0373951_0282638 | |||
| 2729 | Ga0373932_0015407 | |||
| 2730 | Ga0373936_0479861 | |||
| 2731 | Ga0373939_0269160 | |||
| 2732 | Ga0373941_0043704 | |||
| 2733 | Ga0373941_0074037 | |||
| 2734 | Ga0373941_0353631 | |||
| 2735 | Ga0373941_0354939 | |||
| 2736 | Ga0373953_0196457 | |||
| 2737 | Ga0373953_0479189 | |||
| 2738 | Ga0373957_0212255 | |||
| 2739 | Ga0373960_0195177 | |||
| 2740 | Ga0373960_0240966 | |||
| 2741 | Ga0373943_0139427 | |||
| 2742 | Ga0373943_0141453 | |||
| 2743 | Ga0373943_0521122 | |||
| 2744 | Ga0373946_0154898 | |||
| 2745 | Ga0373955_0093261 | |||
| 2746 | Ga0373942_0034443 | |||
| 2747 | Ga0373942_0045711 | |||
| 2748 | Ga0373961_0034707 | |||
| 2749 | Ga0373961_0325153 | |||
| 2750 | Ga0373962_0073173 | |||
| 2751 | Ga0373924_0098360 | |||
| 2752 | Ga0373931_0019574 | |||
| 2753 | Ga0373931_0033045 | |||
| 2754 | Ga0373931_0144160 | |||
| 2755 | Ga0373931_0345405 | |||
| 2756 | Ga0373931_0380598 | |||
| 2757 | Ga0373931_0422794 | |||
| 2758 | Ga0373931_0455315 | |||
| 2759 | Ga0373935_0052968 | |||
| 2760 | Ga0373935_0837623 | |||
| 2761 | Ga0373933_0309184 | |||
| 2762 | Ga0373933_0588774 | |||
| 2763 | Ga0373947_0190601 | |||
| 2764 | Ga0373947_0548662 | |||
| 2765 | Ga0373937_0002464 | |||
| 2766 | Ga0373937_0233521 | |||
| 2767 | Ga0373937_0271071 | |||
| 2768 | Ga0373925_0136982 | |||
| 2769 | Ga0373925_0204883 | |||
| 2770 | Ga0373925_0346253 | |||
| 2771 | Ga0395899_0031469 | |||
| 2772 | Ga0395899_0034136 | |||
| 2773 | Ga0395899_0043891 | |||
| 2774 | Ga0395899_0057550 | |||
| 2775 | Ga0395899_0065359 | |||
| 2776 | Ga0395899_0087833 | |||
| 2777 | Ga0395899_0143943 | |||
| 2778 | Ga0395899_0237483 | |||
| 2779 | Ga0395899_0259443 | |||
| 2780 | Ga0395899_0288125 | |||
| 2781 | Ga0395899_0352059 | |||
| 2782 | Ga0395899_0495672 | |||
| 2783 | Ga0395899_0554141 | |||
| 2784 | Ga0395899_0575662 | |||
| 2785 | Ga0395899_0929114 | |||
| 2786 | Ga0395900_0002317 | |||
| 2787 | Ga0395900_0003596 | |||
| 2788 | Ga0395900_0005500 | |||
| 2789 | Ga0395900_0006561 | |||
| 2790 | Ga0395900_0007355 | |||
| 2791 | Ga0395900_0030414 | |||
| 2792 | Ga0395900_0092124 | |||
| 2793 | Ga0395900_0138465 | |||
| 2794 | Ga0395900_0161221 | |||
| 2795 | Ga0395900_0163977 | |||
| 2796 | Ga0395900_0186802 | |||
| 2797 | Ga0395900_0225896 | |||
| 2798 | Ga0395900_0318042 | |||
| 2799 | Ga0395900_0419059 | |||
| 2800 | Ga0395900_0526589 | |||
| 2801 | Ga0395900_0810967 | |||
| 2802 | Ga0395900_0976638 | |||
| 2803 | Ga0395900_1347952 | |||
| 2804 | Ga0395900_1513732 | |||
| 2805 | Ga0395898_0002928 | |||
| 2806 | Ga0395898_0005497 | |||
| 2807 | Ga0395898_0007699 | |||
| 2808 | Ga0395898_0011504 | |||
| 2809 | Ga0395898_0017360 | |||
| 2810 | Ga0395898_0017648 | |||
| 2811 | Ga0395898_0044942 | |||
| 2812 | Ga0395898_0072989 | |||
| 2813 | Ga0395898_0076407 | |||
| 2814 | Ga0395898_0077931 | |||
| 2815 | Ga0395898_0131358 | |||
| 2816 | Ga0395898_0142627 | |||
| 2817 | Ga0395898_0267353 | |||
| 2818 | Ga0395898_0327083 | |||
| 2819 | Ga0395898_0350929 | |||
| 2820 | Ga0395898_0379529 | |||
| 2821 | Ga0395898_0757608 | |||
| 2822 | Ga0395898_1409451 | |||
| 2823 | Ga0395898_1948504 | |||
| 2824 | Ga0395905_0000698 | |||
| 2825 | Ga0395905_0002827 | |||
| 2826 | Ga0395905_0004158 | |||
| 2827 | Ga0395905_0005462 | |||
| 2828 | Ga0395905_0010671 | |||
| 2829 | Ga0395905_0023407 | |||
| 2830 | Ga0395905_0029867 | |||
| 2831 | Ga0395905_0079110 | |||
| 2832 | Ga0395905_0089827 | |||
| 2833 | Ga0395905_0111130 | |||
| 2834 | Ga0395905_0336919 | |||
| 2835 | Ga0395905_1018305 | |||
| 2836 | Ga0395901_0001102 | |||
| 2837 | Ga0395901_0002126 | |||
| 2838 | Ga0395901_0002813 | |||
| 2839 | Ga0395901_0007390 | |||
| 2840 | Ga0395901_0012117 | |||
| 2841 | Ga0395901_0019191 | |||
| 2842 | Ga0395901_0042603 | |||
| 2843 | Ga0395901_0043416 | |||
| 2844 | Ga0395901_0087341 | |||
| 2845 | Ga0395901_0088539 | |||
| 2846 | Ga0395901_0099635 | |||
| 2847 | Ga0395901_0150684 | |||
| 2848 | Ga0395901_0191471 | |||
| 2849 | Ga0395901_0248811 | |||
| 2850 | Ga0395901_0317611 | |||
| 2851 | Ga0395901_0338879 | |||
| 2852 | Ga0395901_0367396 | |||
| 2853 | Ga0395901_0389792 | |||
| 2854 | Ga0395901_0447404 | |||
| 2855 | Ga0395901_0634942 | |||
| 2856 | Ga0395901_1098888 | |||
| 2857 | Ga0395901_1153524 | |||
| 2858 | Ga0395901_1258516 | |||
| 2859 | Ga0395901_1744204 | |||
| 2860 | Ga0395901_2080438 | |||
| 2861 | Ga0436363_0575511 | |||
| 2862 | Ga0439438_092942 | |||
| 2863 | Ga0439461_0002163 | |||
| 2864 | Ga0439461_0030378 | |||
| 2865 | Ga0439466_0156092 | |||
| 2866 | Ga0439465_0094353 | |||
| 2867 | Ga0451789_0931210 | |||
| 2868 | Ga0451800_0626990 | |||
| 2869 | Ga0451800_1510129 | |||
| 2870 | Ga0451807_1287325 | |||
| 2871 | Ga0451833_0099372 | |||
| 2872 | Ga0451839_0645495 | |||
| 2873 | Ga0451847_0684522 | |||
| 2874 | Ga0451849_0924877 | |||
| 2875 | Ga0451853_1843922 | |||
| 2876 | Ga0451853_1871389 | |||
| 2877 | Ga0439431_0138357 | |||
| 2878 | Ga0439433_0101055 | |||
| 2879 | Ga0439437_003758 | |||
| 2880 | Ga0439441_011079 | |||
| 2881 | Ga0439448_0020940 | |||
| 2882 | Ga0439448_0023535 | |||
| 2883 | Ga0439448_0332760 | |||
| 2884 | Ga0439450_036950 | |||
| 2885 | Ga0439455_0025882 | |||
| 2886 | Ga0439455_0030751 | |||
| 2887 | Ga0439463_026392 | |||
| 2888 | Ga0450915_010080 | |||
| 2889 | Ga0450917_003609 | |||
| 2890 | Ga0450923_036325 | |||
| 2891 | Ga0450888_003542 | |||
| 2892 | Ga0450892_025811 | |||
| 2893 | Ga0450900_079428 | |||
| 2894 | Ga0450910_037728 | |||
| 2895 | Ga0439446_0001843 | |||
| 2896 | Ga0439458_0001865 | |||
| 2897 | Ga0439434_0011303 | |||
| 2898 | Ga0439434_0273306 | |||
| 2899 | Ga0439444_0020048 | |||
| 2900 | Ga0439459_0088222 | |||
| 2901 | Ga0439459_0147883 | |||
| 2902 | Ga0439460_0050102 | |||
| 2903 | Ga0439460_0226440 | |||
| 2904 | Ga0450916_023532 | |||
| 2905 | Ga0450918_027058 | |||
| 2906 | Ga0439440_0203594 | |||
| 2907 | Ga0439440_0295012 | |||
| 2908 | Ga0466969_0000416 | |||
| 2909 | Ga0466969_0183031 | |||
| 2910 | Ga0466972_0021651 | |||
| 2911 | Ga0466972_0118110 | |||
| 2912 | Ga0466972_0605835 | |||
| 2913 | Ga0466965_0012753 | |||
| 2914 | Ga0466965_0066969 | |||
| 2915 | Ga0466965_0316550 | |||
| 2916 | Ga0466966_0586673 | |||
| 2917 | Ga0466961_0000463 | |||
| 2918 | Ga0466961_0002397 | |||
| 2919 | Ga0466961_0018213 | |||
| 2920 | Ga0466961_0057813 | |||
| 2921 | Ga0466961_0137595 | |||
| 2922 | Ga0466961_0170653 | |||
| 2923 | Ga0466963_0000055 | |||
| 2924 | Ga0466963_0004827 | |||
| 2925 | Ga0466963_0012434 | |||
| 2926 | Ga0466963_0015842 | |||
| 2927 | Ga0466963_0022743 | |||
| 2928 | Ga0466963_0023942 | |||
| 2929 | Ga0466963_0033848 | |||
| 2930 | Ga0466963_0050054 | |||
| 2931 | Ga0466963_0064761 | |||
| 2932 | Ga0466963_0072063 | |||
| 2933 | Ga0466963_0100496 | |||
| 2934 | Ga0466963_0226574 | |||
| 2935 | Ga0466963_0252889 | |||
| 2936 | Ga0466963_0296732 | |||
| 2937 | Ga0466963_0431087 | |||
| 2938 | Ga0466963_1132171 | |||
| 2939 | Ga0466964_0009411 | |||
| 2940 | Ga0466964_0011536 | |||
| 2941 | Ga0466964_0018416 | |||
| 2942 | Ga0466964_0021550 | |||
| 2943 | Ga0466964_0043695 | |||
| 2944 | Ga0466964_0044614 | |||
| 2945 | Ga0466964_0051059 | |||
| 2946 | Ga0466964_0056924 | |||
| 2947 | Ga0466964_0074116 | |||
| 2948 | Ga0466964_0151865 | |||
| 2949 | Ga0466964_0166246 | |||
| 2950 | Ga0466964_0210594 | |||
| 2951 | Ga0466964_0444768 | |||
| 2952 | Ga0453684_0702652 | |||
| 2953 | Ga0466971_0006844 | |||
| 2954 | Ga0466971_0014728 | |||
| 2955 | Ga0466971_0042499 | |||
| 2956 | Ga0466971_0149105 | |||
| 2957 | Ga0466971_0235099 | |||
| 2958 | Ga0466971_0259620 | |||
| 2959 | Ga0466971_0303512 | |||
| 2960 | Ga0466971_0409493 | |||
| 2961 | Ga0466968_0000852 | |||
| 2962 | Ga0466968_0003464 | |||
| 2963 | Ga0466968_0019156 | |||
| 2964 | Ga0466968_0070119 | |||
| 2965 | Ga0466968_0161887 | |||
| 2966 | Ga0466968_0590580 | |||
| 2967 | Ga0466970_0027540 | |||
| 2968 | Ga0466970_0038297 | |||
| 2969 | Ga0466970_0227888 | |||
| 2970 | Ga0466970_0298449 | |||
| 2971 | Ga0466970_0575684 | |||
| 2972 | Ga0466957_0005164 | |||
| 2973 | Ga0466957_0006754 | |||
| 2974 | Ga0466957_0030978 | |||
| 2975 | Ga0466957_0073228 | |||
| 2976 | Ga0466957_0233465 | |||
| 2977 | Ga0466957_0729073 | |||
| 2978 | Ga0466960_0028038 | |||
| 2979 | Ga0466960_0094462 | |||
| 2980 | Ga0466960_0168260 | |||
| 2981 | Ga0466960_0201029 | |||
| 2982 | Ga0466960_0208085 | |||
| 2983 | Ga0466960_0276693 | |||
| 2984 | Ga0466960_0895369 | |||
| 2985 | Ga0466960_0942844 | |||
| 2986 | Ga0466959_0007192 | |||
| 2987 | Ga0466959_0012300 | |||
| 2988 | Ga0466959_0093916 | |||
| 2989 | Ga0466959_0135018 | |||
| 2990 | Ga0466959_0411749 | |||
| 2991 | Ga0466959_0468675 | |||
| 2992 | Ga0466959_1012098 | |||
| 2993 | Ga0451576_0140420 | |||
| 2994 | Ga0451576_0759758 | |||
| 2995 | Ga0451576_1217744 | |||
| 2996 | Ga0466958_0003853 | |||
| 2997 | Ga0466958_0009051 | |||
| 2998 | Ga0466958_0011141 | |||
| 2999 | Ga0466958_0037204 | |||
| 3000 | Ga0466958_0125048 | |||
| 3001 | Ga0466958_0149446 | |||
| 3002 | Ga0466958_0272504 | |||
| 3003 | Ga0466958_0314234 | |||
| 3004 | Ga0466958_0343730 | |||
| 3005 | Ga0466958_0492483 | |||
| 3006 | Ga0466967_0001501 | |||
| 3007 | Ga0466967_0010040 | |||
| 3008 | Ga0466967_0012011 | |||
| 3009 | Ga0466967_0013350 | |||
| 3010 | Ga0466967_0014574 | |||
| 3011 | Ga0466967_0015086 | |||
| 3012 | Ga0466967_0026921 | |||
| 3013 | Ga0466967_0046495 | |||
| 3014 | Ga0466967_0081187 | |||
| 3015 | Ga0466967_0141208 | |||
| 3016 | Ga0466967_0143713 | |||
| 3017 | Ga0466967_0154470 | |||
| 3018 | Ga0466967_0155326 | |||
| 3019 | Ga0466967_0190169 | |||
| 3020 | Ga0466967_0195071 | |||
| 3021 | Ga0466967_0203512 | |||
| 3022 | Ga0466967_0473293 | |||
| 3023 | Ga0466967_0474254 | |||
| 3024 | Ga0466967_0557080 | |||
| 3025 | Ga0466967_0678245 | |||
| 3026 | Ga0466967_0742320 | |||
| 3027 | Ga0466967_1416322 | |||
| 3028 | Ga0466967_1427188 | |||
| 3029 | Ga0495627_192704 | |||
| 3030 | Ga0495592_0000082 | |||
| 3031 | Ga0495592_0044892 | |||
| 3032 | Ga0495592_0134802 | |||
| 3033 | Ga0495592_0296900 | |||
| 3034 | Ga0495592_0388926 | |||
| 3035 | Ga0495603_0012630 | |||
| 3036 | Ga0495603_0023587 | |||
| 3037 | Ga0495603_0047153 | |||
| 3038 | Ga0495603_0452266 | |||
| 3039 | Ga0495629_0150626 | |||
| 3040 | Ga0495629_0217503 | |||
| 3041 | Ga0495641_0033810 | |||
| 3042 | Ga0495641_0035320 | |||
| 3043 | Ga0495641_0040645 | |||
| 3044 | Ga0495641_0106426 | |||
| 3045 | Ga0495641_0119238 | |||
| 3046 | Ga0495641_0164231 | |||
| 3047 | Ga0495651_0000080 | |||
| 3048 | Ga0495653_0001358 | |||
| 3049 | Ga0495653_0136939 | |||
| 3050 | Ga0495653_0248072 | |||
| 3051 | Ga0495580_0473412 | |||
| 3052 | Ga0495580_0547410 | |||
| 3053 | Ga0495582_0063737 | |||
| 3054 | Ga0495582_0075739 | |||
| 3055 | Ga0495582_0075882 | |||
| 3056 | Ga0495582_0097235 | |||
| 3057 | Ga0495582_0141954 | |||
| 3058 | Ga0495582_0406229 | |||
| 3059 | Ga0495582_0409955 | |||
| 3060 | Ga0495605_0071165 | |||
| 3061 | Ga0495605_0194995 | |||
| 3062 | Ga0495605_0415478 | |||
| 3063 | Ga0495639_0198301 | |||
| 3064 | Ga0495662_0032448 | |||
| 3065 | Ga0495662_0081926 | |||
| 3066 | Ga0495662_0183815 | |||
| 3067 | Ga0495664_0201599 | |||
| 3068 | Ga0495664_0297874 | |||
| 3069 | Ga0495584_0006888 | |||
| 3070 | Ga0495584_0137112 | |||
| 3071 | Ga0495584_0188904 | |||
| 3072 | Ga0495584_0510498 | |||
| 3073 | Ga0495584_0608259 | |||
| 3074 | Ga0495585_0026440 | |||
| 3075 | Ga0495585_0173844 | |||
| 3076 | Ga0495585_0207059 | |||
| 3077 | Ga0495594_0080117 | |||
| 3078 | Ga0495594_0309286 | |||
| 3079 | Ga0495594_0541916 | |||
| 3080 | Ga0495596_0068080 | |||
| 3081 | Ga0495596_0074307 | |||
| 3082 | Ga0495596_0090321 | |||
| 3083 | Ga0495596_0206579 | |||
| 3084 | Ga0495596_0225540 | |||
| 3085 | Ga0495607_0017149 | |||
| 3086 | Ga0495607_0383903 | |||
| 3087 | Ga0495608_0000669 | |||
| 3088 | Ga0495608_0062795 | |||
| 3089 | Ga0495608_0332216 | |||
| 3090 | Ga0495608_0339871 | |||
| 3091 | Ga0495608_0382795 | |||
| 3092 | Ga0495616_0155699 | |||
| 3093 | Ga0495618_0055679 | |||
| 3094 | Ga0495618_0293440 | |||
| 3095 | Ga0495618_0924765 | |||
| 3096 | Ga0495620_0200860 | |||
| 3097 | Ga0495628_0000292 | |||
| 3098 | Ga0495628_0181774 | |||
| 3099 | Ga0495628_0939071 | |||
| 3100 | Ga0495630_0022995 | |||
| 3101 | Ga0495630_0052669 | |||
| 3102 | Ga0495630_0222274 | |||
| 3103 | Ga0495630_0326377 | |||
| 3104 | Ga0495630_0449794 | |||
| 3105 | Ga0495630_0932770 | |||
| 3106 | Ga0495631_0120537 | |||
| 3107 | Ga0495631_0217528 | |||
| 3108 | Ga0495637_0209108 | |||
| 3109 | Ga0495637_0225667 | |||
| 3110 | Ga0495637_0346992 | |||
| 3111 | Ga0495644_0020660 | |||
| 3112 | Ga0495644_0074931 | |||
| 3113 | Ga0495644_0139131 | |||
| 3114 | Ga0495663_0021460 | |||
| 3115 | Ga0495663_0043246 | |||
| 3116 | Ga0495663_0382055 | |||
| 3117 | Ga0495666_0139807 | |||
| 3118 | Ga0495652_0000847 | |||
| 3119 | Ga0495652_0097098 | |||
| 3120 | Ga0495652_0310659 | |||
| 3121 | Ga0495665_0171582 | |||
| 3122 | Ga0495665_0541543 | |||
| 3123 | Ga0495640_0016924 | |||
| 3124 | Ga0495640_0100761 | |||
| 3125 | Ga0495640_0488913 | |||
| 3126 | Ga0495586_0057390 | |||
| 3127 | Ga0495587_0000060 | |||
| 3128 | Ga0495587_0087898 | |||
| 3129 | Ga0495609_0041212 | |||
| 3130 | Ga0495609_0098830 | |||
| 3131 | Ga0495609_0177073 | |||
| 3132 | Ga0495609_0276571 | |||
| 3133 | Ga0495645_0000038 | |||
| 3134 | Ga0495645_0079531 | |||
| 3135 | Ga0495622_0149429 | |||
| 3136 | Ga0495667_0073429 | |||
| 3137 | Ga0495667_0202357 | |||
| 3138 | Ga0495667_0226025 | |||
| 3139 | Ga0495656_0007613 | |||
| 3140 | Ga0495656_0048507 | |||
| 3141 | Ga0495656_0089683 | |||
| 3142 | Ga0495656_0324951 | |||
| 3143 | Ga0495656_0694494 | |||
| 3144 | Ga0495634_0027105 | |||
| 3145 | Ga0495634_0186140 | |||
| 3146 | Ga0495634_0370747 | |||
| 3147 | Ga0495611_0056994 | |||
| 3148 | Ga0495635_0960076 | |||
| 3149 | Ga0495659_0016528 | |||
| 3150 | Ga0495659_0210461 | |||
| 3151 | Ga0495659_0498739 | |||
| 3152 | Ga0495661_0153986 | |||
| 3153 | Ga0495661_0251189 | |||
| 3154 | Ga0495588_0320285 | |||
| 3155 | Ga0495588_0765290 | |||
| 3156 | Ga0495657_0072449 | |||
| 3157 | Ga0495657_0870746 | |||
| 3158 | Ga0495599_0000402 | |||
| 3159 | Ga0495599_0109298 | |||
| 3160 | Ga0495599_0748211 | |||
| 3161 | Ga0495623_0000442 | |||
| 3162 | Ga0495623_0115030 | |||
| 3163 | Ga0495623_0618460 | |||
| 3164 | Ga0495646_0001935 | |||
| 3165 | Ga0495646_0034453 | |||
| 3166 | Ga0495647_0081820 | |||
| 3167 | Ga0495647_0368004 | |||
| 3168 | Ga0495647_0404826 | |||
| 3169 | Ga0495658_0091213 | |||
| 3170 | Ga0495658_0331320 | |||
| 3171 | Ga0495658_1114994 | |||
| 3172 | Ga0495669_0080687 | |||
| 3173 | Ga0495669_0273532 | |||
| 3174 | Ga0495613_0095654 | |||
| 3175 | Ga0495613_0184169 | |||
| 3176 | Ga0495613_0299055 | |||
| 3177 | Ga0495624_0016447 | |||
| 3178 | Ga0495624_0073326 | |||
| 3179 | Ga0495624_0081739 | |||
| 3180 | Ga0495624_0084327 | |||
| 3181 | Ga0495624_0332030 | |||
| 3182 | Ga0495670_0587640 | |||
| 3183 | Ga0495670_0664294 | |||
| 3184 | Ga0495670_0739145 | |||
| 3185 | Ga0495649_0537186 | |||
| 3186 | Ga0495589_0118734 | |||
| 3187 | Ga0495589_0147174 | |||
| 3188 | Ga0495600_0194009 | |||
| 3189 | Ga0495581_0739244 | |||
| 3190 | Ga0495604_0000043 | |||
| 3191 | Ga0495604_0124988 | |||
| 3192 | Ga0495604_0518901 | |||
| 3193 | Ga0495604_0896618 | |||
| 3194 | Ga0495636_0031764 | |||
| 3195 | Ga0495636_0186929 | |||
| 3196 | Ga0495674_0044574 | |||
| 3197 | Ga0495674_0126352 | |||
| 3198 | Ga0495674_0868492 | |||
| 3199 | Ga0495674_1134840 | |||
| 3200 | Ga0495676_0019485 | |||
| 3201 | Ga0495676_0040517 | |||
| 3202 | Ga0495676_0095220 | |||
| 3203 | Ga0495676_0123134 | |||
| 3204 | Ga0495676_0330612 | |||
| 3205 | Ga0495676_0477333 | |||
| 3206 | Ga0495676_0744133 | |||
| 3207 | Ga0495680_0006459 | |||
| 3208 | Ga0495680_0171499 | |||
| 3209 | Ga0495680_0352631 | |||
| 3210 | Ga0495680_0487984 | |||
| 3211 | Ga0495680_0604546 | |||
| 3212 | Ga0495680_0622766 | |||
| 3213 | Ga0495680_0877799 | |||
| 3214 | Ga0495680_0972480 | |||
| 3215 | Ga0495675_0000827 | |||
| 3216 | Ga0495675_0143261 | |||
| 3217 | Ga0495675_0825353 | |||
| 3218 | Ga0495677_0067675 | |||
| 3219 | Ga0495677_0111106 | |||
| 3220 | Ga0495684_0094459 | |||
| 3221 | Ga0495684_0137542 | |||
| 3222 | Ga0495684_0154760 | |||
| 3223 | Ga0495684_0820352 | |||
| 3224 | Ga0495593_0093855 | |||
| 3225 | Ga0495602_0000536 | |||
| 3226 | Ga0495602_0153916 | |||
| 3227 | Ga0495602_0579235 | |||
| 3228 | Ga0495614_0184469 | |||
| 3229 | Ga0495614_0543121 | |||
| 3230 | Ga0495614_0664212 | |||
| 3231 | Ga0495626_0114301 | |||
| 3232 | Ga0496100_0027778 | |||
| 3233 | Ga0496100_0087791 | |||
| 3234 | Ga0496100_0091814 | |||
| 3235 | Ga0496100_0119505 | |||
| 3236 | Ga0496100_0564080 | |||
| 3237 | Ga0496100_0774148 | |||
| 3238 | Ga0496100_0841435 | |||
| 3239 | Ga0496100_1147873 | |||
| 3240 | Ga0496100_1276301 | |||
| 3241 | Ga0496101_0001928 | |||
| 3242 | Ga0496101_0019452 | |||
| 3243 | Ga0496101_0044578 | |||
| 3244 | Ga0496101_0082788 | |||
| 3245 | Ga0496101_0118264 | |||
| 3246 | Ga0496101_0148669 | |||
| 3247 | Ga0496101_0218654 | |||
| 3248 | Ga0496101_0252591 | |||
| 3249 | Ga0496101_0407155 | |||
| 3250 | Ga0496101_0972216 | |||
| 3251 | Ga0496102_0021784 | |||
| 3252 | Ga0496102_0028158 | |||
| 3253 | Ga0496102_0031232 | |||
| 3254 | Ga0496102_0118855 | |||
| 3255 | Ga0496102_0197463 | |||
| 3256 | Ga0496102_0403585 | |||
| 3257 | Ga0496102_0403760 | |||
| 3258 | Ga0496102_0806104 | |||
| 3259 | Ga0496102_0837813 | |||
| 3260 | Ga0496102_1116413 | |||
| 3261 | Ga0496102_1171634 | |||
| 3262 | Ga0496102_1566673 | |||
| 3263 | Ga0496103_0003123 | |||
| 3264 | Ga0496103_0003893 | |||
| 3265 | Ga0496103_0004055 | |||
| 3266 | Ga0496103_0011785 | |||
| 3267 | Ga0496103_0038013 | |||
| 3268 | Ga0496103_0091563 | |||
| 3269 | Ga0496103_0211979 | |||
| 3270 | Ga0496103_0245340 | |||
| 3271 | Ga0496104_0000566 | |||
| 3272 | Ga0496104_0001456 | |||
| 3273 | Ga0496104_0013980 | |||
| 3274 | Ga0496104_0018210 | |||
| 3275 | Ga0496104_0045934 | |||
| 3276 | Ga0496104_0116458 | |||
| 3277 | Ga0496104_0136337 | |||
| 3278 | Ga0496104_0185869 | |||
| 3279 | Ga0496104_0353239 | |||
| 3280 | Ga0496104_1025443 | |||
| 3281 | Ga0496104_1279916 | |||
| 3282 | Ga0496105_0001017 | |||
| 3283 | Ga0496105_0002560 | |||
| 3284 | Ga0496105_0022998 | |||
| 3285 | Ga0496105_0029105 | |||
| 3286 | Ga0496105_0085833 | |||
| 3287 | Ga0496105_0116043 | |||
| 3288 | Ga0496105_0123614 | |||
| 3289 | Ga0496105_0257711 | |||
| 3290 | Ga0496105_0316639 | |||
| 3291 | Ga0496105_0375538 | |||
| 3292 | Ga0496105_1330285 | |||
| 3293 | Ga0496106_0001733 | |||
| 3294 | Ga0496106_0026652 | |||
| 3295 | Ga0496106_0030904 | |||
| 3296 | Ga0496106_0049470 | |||
| 3297 | Ga0496106_0138258 | |||
| 3298 | Ga0496106_0204403 | |||
| 3299 | Ga0496106_0209315 | |||
| 3300 | Ga0496106_0229480 | |||
| 3301 | Ga0496106_0309242 | |||
| 3302 | Ga0496106_0333298 | |||
| 3303 | Ga0496106_0333553 | |||
| 3304 | Ga0496106_1536508 | |||
| 3305 | Ga0496107_0002910 | |||
| 3306 | Ga0496107_0048698 | |||
| 3307 | Ga0496107_0074565 | |||
| 3308 | Ga0496107_0090486 | |||
| 3309 | Ga0496107_0101698 | |||
| 3310 | Ga0496107_0345269 | |||
| 3311 | Ga0496107_0378205 | |||
| 3312 | Ga0496107_0430976 | |||
| 3313 | Ga0496107_1214011 | |||
| 3314 | Ga0496107_1256002 | |||
| 3315 | Ga0496108_0000906 | |||
| 3316 | Ga0496108_0021413 | |||
| 3317 | Ga0496108_0040487 | |||
| 3318 | Ga0496108_0101435 | |||
| 3319 | Ga0496108_0136966 | |||
| 3320 | Ga0496108_0224676 | |||
| 3321 | Ga0496108_0278016 | |||
| 3322 | Ga0496108_0284340 | |||
| 3323 | Ga0496108_0650150 | |||
| 3324 | Ga0496109_0005563 | |||
| 3325 | Ga0496109_0010078 | |||
| 3326 | Ga0496109_0115763 | |||
| 3327 | Ga0496109_0134057 | |||
| 3328 | Ga0496109_0147897 | |||
| 3329 | Ga0496109_0166610 | |||
| 3330 | Ga0496109_0188421 | |||
| 3331 | Ga0496109_0226420 | |||
| 3332 | Ga0496109_0230128 | |||
| 3333 | Ga0496109_0270418 | |||
| 3334 | Ga0496109_0388509 | |||
| 3335 | Ga0496109_0433311 | |||
| 3336 | Ga0496109_0935892 | |||
| 3337 | Ga0496109_1604541 | |||
| 3338 | Ga0496109_1665387 | |||
| 3339 | Ga0496110_0000951 | |||
| 3340 | Ga0496110_0000997 | |||
| 3341 | Ga0496110_0007809 | |||
| 3342 | Ga0496110_0016084 | |||
| 3343 | Ga0496110_0019409 | |||
| 3344 | Ga0496110_0028156 | |||
| 3345 | Ga0496110_0112830 | |||
| 3346 | Ga0496110_0162280 | |||
| 3347 | Ga0496110_0172469 | |||
| 3348 | Ga0496110_0206655 | |||
| 3349 | Ga0496110_0262342 | |||
| 3350 | Ga0496110_0266325 | |||
| 3351 | Ga0496110_0353477 | |||
| 3352 | Ga0496110_0747526 | |||
| 3353 | Ga0496110_1085697 | |||
| 3354 | Ga0496110_1219960 | |||
| 3355 | Ga0496111_0000512 | |||
| 3356 | Ga0496111_0002184 | |||
| 3357 | Ga0496111_0005450 | |||
| 3358 | Ga0496111_0005744 | |||
| 3359 | Ga0496111_0069745 | |||
| 3360 | Ga0496111_0071179 | |||
| 3361 | Ga0496111_0184054 | |||
| 3362 | Ga0496111_0213360 | |||
| 3363 | Ga0496111_0349097 | |||
| 3364 | Ga0496111_0667003 | |||
| 3365 | Ga0496111_0771088 | |||
| 3366 | Ga0496111_1041846 | |||
| 3367 | Ga0496112_0004731 | |||
| 3368 | Ga0496112_0009224 | |||
| 3369 | Ga0496112_0027466 | |||
| 3370 | Ga0496112_0090427 | |||
| 3371 | Ga0496112_0247526 | |||
| 3372 | Ga0496112_0327220 | |||
| 3373 | Ga0496112_0458615 | |||
| 3374 | Ga0496112_0609221 | |||
| 3375 | Ga0496112_0689329 | |||
| 3376 | Ga0496112_1896331 | |||
| 3377 | Ga0496113_0010891 | |||
| 3378 | Ga0496113_0046582 | |||
| 3379 | Ga0496113_0068476 | |||
| 3380 | Ga0496113_0138314 | |||
| 3381 | Ga0496113_0167297 | |||
| 3382 | Ga0496113_0178578 | |||
| 3383 | Ga0496113_0230956 | |||
| 3384 | Ga0496113_0351649 | |||
| 3385 | Ga0496113_0353400 | |||
| 3386 | Ga0496113_0615307 | |||
| 3387 | Ga0496113_0672453 | |||
| 3388 | Ga0496113_0796285 | |||
| 3389 | Ga0496114_0002097 | |||
| 3390 | Ga0496114_0017867 | |||
| 3391 | Ga0496114_0036750 | |||
| 3392 | Ga0496114_0074651 | |||
| 3393 | Ga0496114_0140476 | |||
| 3394 | Ga0496114_0189445 | |||
| 3395 | Ga0496114_0296012 | |||
| 3396 | Ga0496114_0344674 | |||
| 3397 | Ga0496114_0353092 | |||
| 3398 | Ga0496114_1026679 | |||
| 3399 | Ga0496115_0044549 | |||
| 3400 | Ga0496115_0055048 | |||
| 3401 | Ga0496115_0113403 | |||
| 3402 | Ga0496115_0261104 | |||
| 3403 | Ga0496115_0413339 | |||
| 3404 | Ga0501298_146661 | |||
| 3405 | Ga0501031_0069984 | |||
| 3406 | Ga0501031_0446109 | |||
| 3407 | Ga0501031_1043944 | |||
| 3408 | Ga0501032_0148468 | |||
| 3409 | Ga0501032_1051003 | |||
| 3410 | Ga0501033_0163192 | |||
| 3411 | Ga0501036_0036730 | |||
| 3412 | Ga0501037_0211779 | |||
| 3413 | Ga0501038_0058270 | |||
| 3414 | Ga0501039_0038129 | |||
| 3415 | Ga0501039_0764607 | |||
| 3416 | Ga0501040_0015402 | |||
| 3417 | Ga0501040_0182121 | |||
| 3418 | Ga0501041_0007471 | |||
| 3419 | Ga0501041_0111005 | |||
| 3420 | Ga0501041_0374915 | |||
| 3421 | Ga0501041_0783530 | |||
| 3422 | Ga0501042_0070432 | |||
| 3423 | Ga0501042_0314460 | |||
| 3424 | Ga0501042_1331879 | |||
| 3425 | Ga0501046_0083004 | |||
| 3426 | Ga0501046_0240151 | |||
| 3427 | Ga0501048_0014730 | |||
| 3428 | Ga0501048_1103511 | |||
| 3429 | Ga0501048_1233917 | |||
| 3430 | Ga0501067_0018931 | |||
| 3431 | Ga0501067_0223514 | |||
| 3432 | Ga0501067_0237108 | |||
| 3433 | Ga0501067_0573987 | |||
| 3434 | Ga0501067_0649454 | |||
| 3435 | Ga0501068_0137175 | |||
| 3436 | Ga0501069_0073814 | |||
| 3437 | Ga0501069_0099093 | |||
| 3438 | Ga0501069_0296145 | |||
| 3439 | Ga0501070_0228267 | |||
| 3440 | Ga0501070_0666027 | |||
| 3441 | Ga0501071_0004656 | |||
| 3442 | Ga0501071_0217034 | |||
| 3443 | Ga0501071_0617298 | |||
| 3444 | Ga0501072_0003264 | |||
| 3445 | Ga0501073_0401459 | |||
| 3446 | Ga0501073_0916399 | |||
| 3447 | Ga0501074_0080528 | |||
| 3448 | Ga0501074_0461938 | |||
| 3449 | Ga0501075_0018170 | |||
| 3450 | Ga0501075_0135269 | |||
| 3451 | Ga0501075_1256954 | |||
| 3452 | Ga0501076_0001105 | |||
| 3453 | Ga0501076_0700221 | |||
| 3454 | Ga0501077_0042502 | |||
| 3455 | Ga0501202_215196 | |||
| 3456 | Ga0501233_184621 | |||
| 3457 | Ga0501225_0251116 | |||
| 3458 | Ga0501079_0037266 | |||
| 3459 | Ga0501079_0134259 | |||
| 3460 | Ga0501079_0527929 | |||
| 3461 | Ga0501080_0071893 | |||
| 3462 | Ga0501081_0058177 | |||
| 3463 | Ga0501081_0215914 | |||
| 3464 | Ga0501081_0359080 | |||
| 3465 | Ga0501083_0321516 | |||
| 3466 | Ga0501083_1142710 | |||
| 3467 | Ga0501035_0252438 | |||
| 3468 | Ga0501035_0567365 | |||
| 3469 | Ga0501044_0287075 | |||
| 3470 | Ga0501045_0005351 | |||
| 3471 | Ga0501045_1314436 | |||
| 3472 | Ga0501045_1330375 | |||
| 3473 | nmdc:mga03683_49432_c1 | |||
| 3474 | nmdc:mga00v17_11157_c1 | |||
| 3475 | nmdc:mga00v17_727885_c1 | |||
| 3476 | nmdc:mga0yw44_32896_c1 | |||
| 3477 | nmdc:mga0yw44_615987_c1 | |||
| 3478 | nmdc:mga04h51_296052_c1 | |||
| 3479 | nmdc:mga05p37_13294_c1 | |||
| 3480 | nmdc:mga05p37_167787_c1 | |||
| 3481 | nmdc:mga05p37_1895896_c1 | |||
| 3482 | nmdc:mga05p37_2114232_c1 | |||
| 3483 | nmdc:mga05p37_244057_c1 | |||
| 3484 | nmdc:mga05p37_314764_c1 | |||
| 3485 | nmdc:mga05p37_68166_c1 | |||
| 3486 | nmdc:mga05p37_706369_c1 | |||
| 3487 | nmdc:mga09592_151081_c1 | |||
| 3488 | nmdc:mga09592_619081_c1 | |||
| 3489 | nmdc:mga09592_874890_c1 | |||
| 3490 | nmdc:mga0qj67_108618_c1 | |||
| 3491 | nmdc:mga06r32_10690_c1 | |||
| 3492 | nmdc:mga06r32_1301213_c1 | |||
| 3493 | nmdc:mga06r32_1883578_c1 | |||
| 3494 | nmdc:mga06r32_43491_c1 | |||
| 3495 | nmdc:mga06r32_639830_c1 | |||
| 3496 | nmdc:mga06r32_825230_c1 | |||
| 3497 | nmdc:mga08y16_1564151_c1 | |||
| 3498 | nmdc:mga08y16_18761_c1 | |||
| 3499 | nmdc:mga08y16_196041_c1 | |||
| 3500 | nmdc:mga08y16_491918_c1 | |||
| 3501 | nmdc:mga08y16_79427_c1 | |||
| 3502 | nmdc:mga0n895_1116647_c1 | |||
| 3503 | nmdc:mga0n895_135876_c1 | |||
| 3504 | nmdc:mga0n895_1588271_c1 | |||
| 3505 | nmdc:mga0n895_160159_c1 | |||
| 3506 | nmdc:mga0n895_1637059_c1 | |||
| 3507 | nmdc:mga0n895_182761_c1 | |||
| 3508 | nmdc:mga0n895_19407_c1 | |||
| 3509 | nmdc:mga0n895_2162655_c1 | |||
| 3510 | nmdc:mga0n895_34144_c1 | |||
| 3511 | nmdc:mga0n895_7715_c1 | |||
| 3512 | nmdc:mga0rr50_1205443_c1 | |||
| 3513 | nmdc:mga0rr50_1395326_c1 | |||
| 3514 | nmdc:mga0rr50_294586_c1 | |||
| 3515 | nmdc:mga0rr50_44331_c1 | |||
| 3516 | nmdc:mga0rr50_49718_c1 | |||
| 3517 | nmdc:mga0rr50_519956_c1 | |||
| 3518 | nmdc:mga0rr50_81771_c1 | |||
| 3519 | nmdc:mga0rr50_993710_c1 | |||
| 3520 | nmdc:mga08x19_18831_c1 | |||
| 3521 | nmdc:mga08x19_29425_c1 | |||
| 3522 | nmdc:mga08x19_43212_c1 | |||
| 3523 | nmdc:mga08x19_449879_c1 | |||
| 3524 | nmdc:mga08x19_486783_c1 | |||
| 3525 | nmdc:mga08x19_718350_c1 | |||
| 3526 | nmdc:mga08x19_783501_c1 | |||
| 3527 | nmdc:mga08x19_951266_c1 | |||
| 3528 | nmdc:mga0a205_122897_c1 | |||
| 3529 | nmdc:mga0a205_1436974_c1 | |||
| 3530 | nmdc:mga0a205_188932_c1 | |||
| 3531 | nmdc:mga0a205_266846_c1 | |||
| 3532 | nmdc:mga0a205_31020_c1 | |||
| 3533 | nmdc:mga0a205_798610_c1 | |||
| 3534 | nmdc:mga0a205_90380_c1 | |||
| 3535 | Ga0495601_0000178 | |||
| 3536 | Ga0495601_0363711 | |||
| 3537 | Ga0495601_0429289 | |||
| 3538 | Ga0495601_0492742 | |||
| 3539 | Ga0495601_0774783 | |||
| 3540 | Ga0495601_0777679 | |||
| 3541 | Ga0495601_0828522 | |||
| 3542 | Ga0495612_0017228 | |||
| 3543 | Ga0495612_0124556 | |||
| 3544 | Ga0495595_0083745 | |||
| 3545 | Ga0495595_0156310 | |||
| 3546 | Ga0495595_0308993 | |||
| 3547 | Ga0495619_0004567 | |||
| 3548 | Ga0495619_0049368 | |||
| 3549 | Ga0495619_0515847 | |||
| 3550 | Ga0501084_0009069 | |||
| 3551 | Ga0501084_0182568 | |||
| 3552 | Ga0501084_0438645 | |||
| 3553 | Ga0501084_0685089 | |||
| 3554 | Ga0501084_1245950 | |||
| 3555 | Ga0590071_026629 | |||
| 3556 | Ga0590075_005904 | |||
| 3557 | Ga0590075_026904 | |||
| 3558 | Ga0587080_178597 | |||
| 3559 | Ga0587083_0027321 | |||
| 3560 | Ga0587083_0223707 | |||
| 3561 | Ga0587085_041965 | |||
| 3562 | Ga0587086_092311 | |||
| 3563 | Ga0587069_156302 | |||
| 3564 | Ga0587075_152295 | |||
| 3565 | Ga0587079_201834 | |||
| 3566 | Ga0587114_105860 | |||
| 3567 | Ga0587111_0148806 | |||
| 3568 | Ga0501082_0190537 | |||
| 3569 | Ga0501082_1078213 | |||
| 3570 | Ga0466962_0003839 | |||
| 3571 | Ga0466962_0009515 | |||
| 3572 | Ga0466962_0041609 | |||
| 3573 | Ga0466962_0045217 | |||
| 3574 | Ga0466962_0276730 | |||
| 3575 | Ga0530510_0007146 | |||
| 3576 | Ga0530510_0035687 | |||
| 3577 | Ga0530510_0226665 | |||
| 3578 | Ga0530510_0238099 | |||
| 3579 | Ga0530510_0405050 | |||
| 3580 | Ga0530510_0921447 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i44-assembly4.cif.gz_H-3 | structure of raca-dna complex; p21 form | 0.8704 | 5 | 33 |
| 4j2n-assembly1.cif.gz_B | crystal structure of mycobacteriophage pukovnik xis | 0.8483 | 1 | 28 |
| 1j9i-assembly1.cif.gz_B | structure of the dna binding domain of the gpnu1 subunit of lambda terminase | 0.7706 | 4 | 51 |
| 4j2n-assembly1.cif.gz_A | crystal structure of mycobacteriophage pukovnik xis | 0.7605 | 1 | 45 |
| 6m62-assembly1.cif.gz_n | cryo-em structure of eukaryotic pre-60s ribosome subunit from saccharomyces cerevisiae rpf2 delta 255-344 strain, c4 state. | 0.7591 | 3 | 46 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0HSY7_140_369_1.10.3260.10 | Mainly Alpha;Orthogonal Bundle;DNA ligase i, domain 1;DNA ligase, ATP-dependent, N-terminal domain | 0.8854 | 7 | 30 | 1.10.3260.10 |
| 5i44H00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8704 | 5 | 33 | 1.10.1660.10 |
| af_Q21657_579_705_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.8095 | 2 | 24 | 2.40.33.20 |
| af_Q9V3F3_173_397_1.25.70.10 | Mainly Alpha;Alpha Horseshoe;Transcription termination factor 3, mitochondrial;Transcription termination factor 3, mitochondrial | 0.8072 | 7 | 27 | 1.25.70.10 |
| af_I6YE30_32_77_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8027 | 5 | 34 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0G9J5-F1-model_v4 | DNA-binding protein | 0.9973 | 1 | 50 |
|
| AF-A0A7V9IY08-F1-model_v4 | Translation initiation factor IF-2 N-terminal domain-containing protein | 0.9633 | 1 | 51 |
|
| AF-A0A7W0G9J5-F1-model_v4 | DNA-binding protein | 0.9592 | 1 | 50 |
|
| AF-A0A7W1S1I8-F1-model_v4 | deleted | 0.949 | 1 | 51 |
|
| AF-A0A7V8VJZ4-F1-model_v4 | DNA-binding protein | 0.949 | 1 | 51 |
|