F495716

General Info

Members Datasets Scaffolds Average Seq Length
1790 508 3580 56

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100401125|Ga0070700_1004011252
Length 61
Sequence MPNHLTPEELSKELGLDRQEVIRVCVQEGVPIYQGKIDKTLFQAQLQALGTAGQAQPQAAL

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
131 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
132 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
133 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
134 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
135 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
136 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
137 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
138 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
139 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
157 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
162 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
169 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
243 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
244 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
245 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
246 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
247 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
248 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
249 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
250 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
251 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
252 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
253 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
254 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
258 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
259 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
267 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
268 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
269 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
270 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
271 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
272 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
273 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
274 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
275 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
276 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
277 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
278 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
280 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
281 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
282 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
283 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
284 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
285 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
286 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
287 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
288 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
289 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
290 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
292 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
293 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
294 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
295 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
304 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
305 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
306 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
307 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
308 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
309 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
310 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
311 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
312 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
313 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
314 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
315 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
316 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
317 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
318 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
319 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
320 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
321 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
322 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
323 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
324 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
325 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
326 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
327 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
328 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
329 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
330 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
331 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
332 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
333 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
334 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
335 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
336 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
337 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
338 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
339 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
340 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
341 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
342 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
343 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
344 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
345 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
346 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
347 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
348 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
349 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
350 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
351 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
352 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
353 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
354 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
355 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
356 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
357 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
358 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
359 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
360 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
361 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
362 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
363 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
364 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
365 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
366 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
367 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
368 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
369 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
370 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
371 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
372 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
373 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
374 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
375 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
376 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
377 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
378 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
379 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
380 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
381 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
382 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
383 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
384 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
385 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
386 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
387 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
388 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
389 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
390 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
391 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
392 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
393 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
394 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
395 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
396 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
397 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
398 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
399 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
400 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
401 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
402 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
403 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
404 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
405 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
406 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
407 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
408 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
409 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
410 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
411 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
412 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
413 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
414 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
415 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
416 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
417 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
418 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
419 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
420 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
421 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
422 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
423 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
424 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
425 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
426 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
427 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
428 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
429 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
430 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
431 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
432 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
433 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
434 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
435 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
436 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
437 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
438 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
439 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
440 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
441 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
442 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
443 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
444 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
457 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
458 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
459 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
460 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
461 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
462 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
463 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
464 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
465 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
466 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
467 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
468 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
469 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
470 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
471 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
472 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
473 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
474 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
477 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
478 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
479 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
480 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
481 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
482 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
483 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
484 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
485 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
486 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
487 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
488 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
489 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
490 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
491 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
492 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
493 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
494 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
495 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
496 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
497 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
507 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
508 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 2.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 9.83
Rhizosphere 88.88
Stem 0
Stem Tuber 0
Unclassified 15.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100401125 3300005441 Bacteria 1031
2 JGI24746J21847_1048614 3300001977 Unclassified 595
3 JGI24747J21853_1016955 3300001978 Bacteria 773
4 JGI24737J22298_10178942 3300001990 Bacteria 626
5 JGI24743J22301_10129190 3300001991 Bacteria 557
6 JGI24749J21850_1029563 3300002076 Bacteria 785
7 JGI24744J21845_10003592 3300002077 Bacteria 3197
8 JGI24742J22300_10036530 3300002244 Bacteria 868
9 JGI24742J22300_10038740 3300002244 Bacteria 846
10 rootL2_10091144 3300003322 Bacteria 1801
11 JGI25407J50210_10162221 3300003373 Bacteria 551
12 JGI25404J52841_10036040 3300003659 Bacteria 1053
13 Ga0058860_10026662 3300004801 Unclassified 543
14 Ga0070658_10083898 3300005327 Bacteria 2619
15 Ga0070658_10505778 3300005327 Bacteria 1044
16 Ga0070676_10275815 3300005328 Bacteria 1131
17 Ga0070683_100067793 3300005329 Bacteria 3324
18 Ga0070690_100028453 3300005330 Bacteria 3462
19 Ga0070670_101468243 3300005331 Bacteria 626
20 Ga0070677_10102324 3300005333 Bacteria 1265
21 Ga0070677_10465098 3300005333 Bacteria 679
22 Ga0068869_100279703 3300005334 Bacteria 1342
23 Ga0068869_100986668 3300005334 Bacteria 733
24 Ga0068869_101240832 3300005334 Bacteria 656
25 Ga0070666_10080620 3300005335 Unclassified 2225
26 Ga0070680_100012321 3300005336 Bacteria 6640
27 Ga0070680_100067747 3300005336 Bacteria 2928
28 Ga0070680_100433055 3300005336 Bacteria 1123
29 Ga0070680_100623767 3300005336 Bacteria 926
30 Ga0070680_100860718 3300005336 Bacteria 782
31 Ga0070680_101286639 3300005336 Bacteria 633
32 Ga0070682_100016493 3300005337 Bacteria 4295
33 Ga0070682_100054134 3300005337 Bacteria 2516
34 Ga0070682_100083590 3300005337 Bacteria 2072
35 Ga0070682_100176053 3300005337 Bacteria 1490
36 Ga0070682_101425419 3300005337 Bacteria 593
37 Ga0068868_100067114 3300005338 Bacteria 2854
38 Ga0068868_100168372 3300005338 Bacteria 1813
39 Ga0068868_100438390 3300005338 Bacteria 1134
40 Ga0070660_100022594 3300005339 Bacteria 4653
41 Ga0070660_100209107 3300005339 Bacteria 1584
42 Ga0070660_100557123 3300005339 Bacteria 956
43 Ga0070660_100641984 3300005339 Bacteria 889
44 Ga0070660_100808125 3300005339 Unclassified 789
45 Ga0070660_101316321 3300005339 Bacteria 613
46 Ga0070689_100032361 3300005340 Bacteria 3976
47 Ga0070689_100510160 3300005340 Bacteria 1031
48 Ga0070691_10086670 3300005341 Bacteria 1539
49 Ga0070687_101064337 3300005343 Bacteria 590
50 Ga0070687_101216447 3300005343 Unclassified 556
51 Ga0070661_100063325 3300005344 Bacteria 2716
52 Ga0070661_100615782 3300005344 Bacteria 879
53 Ga0070661_100906759 3300005344 Bacteria 728
54 Ga0070661_101471510 3300005344 Unclassified 574
55 Ga0070692_10038074 3300005345 Unclassified 2449
56 Ga0070668_100225980 3300005347 Bacteria 1546
57 Ga0070669_100578565 3300005353 Bacteria 939
58 Ga0070669_100648897 3300005353 Bacteria 888
59 Ga0070669_101391106 3300005353 Unclassified 609
60 Ga0070675_100032562 3300005354 Bacteria 4220
61 Ga0070675_100269191 3300005354 Bacteria 1495
62 Ga0070675_100286508 3300005354 Unclassified 1449
63 Ga0070671_100033028 3300005355 Bacteria 4277
64 Ga0070671_100033063 3300005355 Bacteria 4275
65 Ga0070671_100095902 3300005355 Bacteria 2487
66 Ga0070671_101671482 3300005355 Bacteria 565
67 Ga0070674_100005001 3300005356 Bacteria 7605
68 Ga0070674_100461248 3300005356 Bacteria 1051
69 Ga0070673_100195570 3300005364 Bacteria 1739
70 Ga0070673_100388952 3300005364 Bacteria 1245
71 Ga0070673_100831512 3300005364 Bacteria 854
72 Ga0070673_100834817 3300005364 Bacteria 852
73 Ga0070673_101454465 3300005364 Bacteria 646
74 Ga0070688_100083124 3300005365 Bacteria 2077
75 Ga0070688_101702608 3300005365 Unclassified 516
76 Ga0070659_100034381 3300005366 Bacteria 3942
77 Ga0070659_100975608 3300005366 Bacteria 743
78 Ga0070659_101226432 3300005366 Bacteria 664
79 Ga0070667_101143302 3300005367 Bacteria 728
80 Ga0070703_10012916 3300005406 Bacteria 2367
81 Ga0070703_10231426 3300005406 Bacteria 741
82 Ga0070703_10415645 3300005406 Bacteria 589
83 Ga0070709_10005698 3300005434 Bacteria 6754
84 Ga0070709_10052234 3300005434 Bacteria 2568
85 Ga0070709_10140929 3300005434 Bacteria 1657
86 Ga0070709_10511238 3300005434 Bacteria 914
87 Ga0070709_10582036 3300005434 Bacteria 860
88 Ga0070714_100001612 3300005435 Bacteria 16395
89 Ga0070714_100006822 3300005435 Bacteria 8848
90 Ga0070714_100014480 3300005435 Bacteria 6335
91 Ga0070714_100034986 3300005435 Bacteria 4208
92 Ga0070714_100039441 3300005435 Bacteria 3976
93 Ga0070714_100062196 3300005435 Bacteria 3208
94 Ga0070714_100108329 3300005435 Bacteria 2456
95 Ga0070714_100190311 3300005435 Bacteria 1872
96 Ga0070714_100234528 3300005435 Bacteria 1691
97 Ga0070714_100259453 3300005435 Unclassified 1609
98 Ga0070714_100808327 3300005435 Bacteria 908
99 Ga0070713_100012818 3300005436 Bacteria 6164
100 Ga0070713_100025980 3300005436 Bacteria 4589
101 Ga0070713_100091162 3300005436 Bacteria 2622
102 Ga0070713_100099214 3300005436 Bacteria 2519
103 Ga0070713_100160590 3300005436 Bacteria 2006
104 Ga0070713_100261316 3300005436 Bacteria 1582
105 Ga0070713_100367076 3300005436 Bacteria 1338
106 Ga0070713_100554481 3300005436 Bacteria 1088
107 Ga0070713_100903245 3300005436 Bacteria 850
108 Ga0070713_101271457 3300005436 Unclassified 713
109 Ga0070710_10001306 3300005437 Bacteria 11777
110 Ga0070710_10007464 3300005437 Bacteria 5295
111 Ga0070710_10250259 3300005437 Bacteria 1139
112 Ga0070710_10389972 3300005437 Bacteria 931
113 Ga0070710_10715643 3300005437 Bacteria 708
114 Ga0070710_10903341 3300005437 Unclassified 638
115 Ga0070710_10909301 3300005437 Bacteria 636
116 Ga0070701_10591086 3300005438 Bacteria 734
117 Ga0070701_10669392 3300005438 Bacteria 695
118 Ga0070701_10819569 3300005438 Bacteria 636
119 Ga0070711_100013670 3300005439 Bacteria 5100
120 Ga0070711_100016837 3300005439 Bacteria 4646
121 Ga0070711_100020555 3300005439 Bacteria 4256
122 Ga0070711_100079548 3300005439 Bacteria 2332
123 Ga0070711_100721311 3300005439 Bacteria 841
124 Ga0070711_100741224 3300005439 Bacteria 830
125 Ga0070711_101264160 3300005439 Bacteria 640
126 Ga0070705_100063810 3300005440 Bacteria 2198
127 Ga0070705_100171300 3300005440 Bacteria 1461
128 Ga0070705_100324585 3300005440 Bacteria 1113
129 Ga0070705_100550422 3300005440 Unclassified 884
130 Ga0070705_100885761 3300005440 Unclassified 717
131 Ga0070705_101578107 3300005440 Bacteria 552
132 Ga0070700_100006069 3300005441 Bacteria 6432
133 Ga0070700_100449788 3300005441 Bacteria 980
134 Ga0070700_100901886 3300005441 Bacteria 720
135 Ga0070700_101226974 3300005441 Bacteria 627
136 Ga0070694_100006994 3300005444 Bacteria 6860
137 Ga0070694_100238868 3300005444 Unclassified 1370
138 Ga0070694_100951663 3300005444 Unclassified 711
139 Ga0070694_101958939 3300005444 Unclassified 501
140 Ga0070708_100120073 3300005445 Bacteria 2424
141 Ga0070708_100146282 3300005445 Bacteria 2195
142 Ga0070708_100180628 3300005445 Unclassified 1972
143 Ga0070708_100229094 3300005445 Bacteria 1743
144 Ga0070708_100333774 3300005445 Bacteria 1429
145 Ga0070708_100371625 3300005445 Bacteria 1348
146 Ga0070708_100560246 3300005445 Bacteria 1078
147 Ga0070708_101172842 3300005445 Bacteria 719
148 Ga0070708_101348185 3300005445 Bacteria 666
149 Ga0070708_101987053 3300005445 Unclassified 538
150 Ga0070663_100051962 3300005455 Bacteria 2921
151 Ga0070678_100158820 3300005456 Bacteria 1829
152 Ga0070678_100212788 3300005456 Bacteria 1603
153 Ga0070678_100251223 3300005456 Bacteria 1483
154 Ga0070678_100660657 3300005456 Bacteria 938
155 Ga0070678_101385879 3300005456 Bacteria 656
156 Ga0070678_101782474 3300005456 Bacteria 580
157 Ga0070662_100450671 3300005457 Bacteria 1068
158 Ga0070662_101003088 3300005457 Bacteria 715
159 Ga0070681_10049123 3300005458 Bacteria 4215
160 Ga0070681_10058032 3300005458 Bacteria 3851
161 Ga0070681_10156680 3300005458 Bacteria 2202
162 Ga0070681_10359146 3300005458 Bacteria 1367
163 Ga0070681_11044004 3300005458 Unclassified 737
164 Ga0070681_11894441 3300005458 Bacteria 524
165 Ga0068867_100087002 3300005459 Unclassified 2365
166 Ga0068867_100200655 3300005459 Unclassified 1597
167 Ga0070685_10059828 3300005466 Unclassified 2225
168 Ga0070706_100005941 3300005467 Bacteria 11541
169 Ga0070706_100016460 3300005467 Bacteria 6833
170 Ga0070706_100017080 3300005467 Bacteria 6704
171 Ga0070706_100107671 3300005467 Unclassified 2593
172 Ga0070706_100153993 3300005467 Bacteria 2146
173 Ga0070706_100508344 3300005467 Bacteria 1121
174 Ga0070706_100550886 3300005467 Bacteria 1073
175 Ga0070706_101523629 3300005467 Bacteria 611
176 Ga0070706_101597429 3300005467 Unclassified 595
177 Ga0070706_101774773 3300005467 Bacteria 561
178 Ga0070707_100001116 3300005468 Bacteria 26505
179 Ga0070707_100002726 3300005468 Bacteria 16796
180 Ga0070707_100004597 3300005468 Bacteria 12914
181 Ga0070707_100065690 3300005468 Bacteria 3486
182 Ga0070707_100126263 3300005468 Bacteria 2486
183 Ga0070707_100653591 3300005468 Unclassified 1014
184 Ga0070707_100813928 3300005468 Unclassified 898
185 Ga0070707_101051699 3300005468 Bacteria 780
186 Ga0070707_101475020 3300005468 Bacteria 647
187 Ga0070707_101628331 3300005468 Bacteria 613
188 Ga0070707_101811471 3300005468 Bacteria 578
189 Ga0070698_100001818 3300005471 Bacteria 23727
190 Ga0070698_100068930 3300005471 Bacteria 3553
191 Ga0070698_100070866 3300005471 Bacteria 3497
192 Ga0070698_100081594 3300005471 Bacteria 3228
193 Ga0070698_100224119 3300005471 Bacteria 1813
194 Ga0070698_100264670 3300005471 Archaea 1651
195 Ga0070698_100547204 3300005471 Bacteria 1097
196 Ga0070698_100970761 3300005471 Bacteria 796
197 Ga0070698_101420625 3300005471 Unclassified 645
198 Ga0070699_100008589 3300005518 Bacteria 8852
199 Ga0070699_100021417 3300005518 Bacteria 5575
200 Ga0070699_100077528 3300005518 Bacteria 2893
201 Ga0070699_100447006 3300005518 Bacteria 1171
202 Ga0070699_100596007 3300005518 Bacteria 1007
203 Ga0070699_100603673 3300005518 Bacteria 1001
204 Ga0070699_101757676 3300005518 Bacteria 568
205 Ga0070679_100016558 3300005530 Bacteria 7117
206 Ga0070679_100058865 3300005530 Bacteria 3829
207 Ga0070679_100098276 3300005530 Bacteria 2915
208 Ga0070679_100393218 3300005530 Bacteria 1332
209 Ga0070679_100691282 3300005530 Bacteria 963
210 Ga0070679_100765106 3300005530 Bacteria 909
211 Ga0070679_100814414 3300005530 Bacteria 877
212 Ga0070679_101234373 3300005530 Bacteria 693
213 Ga0070684_100030393 3300005535 Bacteria 4589
214 Ga0070684_100038632 3300005535 Bacteria 4102
215 Ga0070684_100174055 3300005535 Bacteria 1956
216 Ga0070684_100288905 3300005535 Bacteria 1503
217 Ga0070684_100589108 3300005535 Bacteria 1034
218 Ga0070684_101119842 3300005535 Unclassified 740
219 Ga0070697_100209001 3300005536 Bacteria 1661
220 Ga0070697_100342388 3300005536 Bacteria 1290
221 Ga0068853_100156719 3300005539 Unclassified 2052
222 Ga0068853_101055956 3300005539 Bacteria 783
223 Ga0070672_100137555 3300005543 Unclassified 2012
224 Ga0070672_100364294 3300005543 Bacteria 1234
225 Ga0070672_102015564 3300005543 Bacteria 520
226 Ga0070686_100001847 3300005544 Bacteria 11811
227 Ga0070695_100000005 3300005545 Bacteria 97484
228 Ga0070695_100024161 3300005545 Bacteria 3741
229 Ga0070695_100422896 3300005545 Bacteria 1015
230 Ga0070695_100551843 3300005545 Bacteria 898
231 Ga0070695_100799124 3300005545 Unclassified 756
232 Ga0070696_100149142 3300005546 Unclassified 1715
233 Ga0070696_100161223 3300005546 Bacteria 1652
234 Ga0070696_100532324 3300005546 Bacteria 939
235 Ga0070696_100553588 3300005546 Bacteria 922
236 Ga0070696_100924306 3300005546 Unclassified 725
237 Ga0070696_101216703 3300005546 Bacteria 637
238 Ga0070693_100010553 3300005547 Bacteria 4632
239 Ga0070693_100279221 3300005547 Bacteria 1118
240 Ga0070693_100320990 3300005547 Bacteria 1051
241 Ga0070693_100610165 3300005547 Bacteria 789
242 Ga0070665_100026234 3300005548 Bacteria 5868
243 Ga0070665_100198118 3300005548 Bacteria 2009
244 Ga0070665_101134344 3300005548 Bacteria 793
245 Ga0070704_100017479 3300005549 Bacteria 4561
246 Ga0070704_100118053 3300005549 Bacteria 2032
247 Ga0070704_100166190 3300005549 Bacteria 1750
248 Ga0070704_100566368 3300005549 Bacteria 994
249 Ga0070704_101892852 3300005549 Bacteria 553
250 Ga0068855_100076265 3300005563 Bacteria 3891
251 Ga0068855_100809736 3300005563 Bacteria 995
252 Ga0068855_100905259 3300005563 Bacteria 932
253 Ga0068855_101185266 3300005563 Bacteria 795
254 Ga0068855_101455072 3300005563 Bacteria 705
255 Ga0068855_101616811 3300005563 Bacteria 663
256 Ga0070664_100626125 3300005564 Bacteria 999
257 Ga0070664_101116768 3300005564 Bacteria 743
258 Ga0070664_102072552 3300005564 Unclassified 540
259 Ga0068857_100307574 3300005577 Bacteria 1462
260 Ga0068857_101946336 3300005577 Unclassified 576
261 Ga0068854_100392018 3300005578 Bacteria 1147
262 Ga0068854_101473511 3300005578 Bacteria 617
263 Ga0068856_100034234 3300005614 Bacteria 4976
264 Ga0068856_100069684 3300005614 Bacteria 3477
265 Ga0068856_100082822 3300005614 Bacteria 3184
266 Ga0068856_100191552 3300005614 Bacteria 2058
267 Ga0068856_100248954 3300005614 Bacteria 1792
268 Ga0068856_100341259 3300005614 Bacteria 1516
269 Ga0068856_100401206 3300005614 Bacteria 1391
270 Ga0068856_100477401 3300005614 Bacteria 1268
271 Ga0068856_100569816 3300005614 Bacteria 1153
272 Ga0068856_100755407 3300005614 Bacteria 992
273 Ga0068856_100854556 3300005614 Unclassified 929
274 Ga0068856_100930482 3300005614 Bacteria 888
275 Ga0068856_102294030 3300005614 Bacteria 548
276 Ga0068856_102407227 3300005614 Bacteria 534
277 Ga0070702_100028675 3300005615 Bacteria 3018
278 Ga0070702_100409223 3300005615 Bacteria 973
279 Ga0070702_100565110 3300005615 Bacteria 847
280 Ga0068852_100877005 3300005616 Bacteria 914
281 Ga0068852_101453369 3300005616 Bacteria 708
282 Ga0068859_100108825 3300005617 Unclassified 2833
283 Ga0068864_100479883 3300005618 Bacteria 1193
284 Ga0068864_100708168 3300005618 Bacteria 984
285 Ga0068866_10033457 3300005718 Bacteria 2494
286 Ga0068866_10177917 3300005718 Bacteria 1254
287 Ga0068861_100063568 3300005719 Bacteria 2837
288 Ga0068861_101518106 3300005719 Bacteria 658
289 Ga0068851_10189284 3300005834 Bacteria 1143
290 Ga0068870_10208524 3300005840 Bacteria 1189
291 Ga0068863_100239616 3300005841 Bacteria 1751
292 Ga0068863_100259997 3300005841 Bacteria 1678
293 Ga0068863_102584730 3300005841 Unclassified 517
294 Ga0068858_100895036 3300005842 Bacteria 868
295 Ga0068860_100051850 3300005843 Bacteria 3903
296 Ga0068860_100746623 3300005843 Bacteria 990
297 Ga0068862_100982905 3300005844 Bacteria 834
298 Ga0068862_101420508 3300005844 Bacteria 698
299 Ga0081455_10020437 3300005937 Bacteria 6234
300 Ga0081455_10020619 3300005937 Bacteria 6200
301 Ga0081455_10108857 3300005937 Bacteria 2206
302 Ga0081455_10213301 3300005937 Unclassified 1437
303 Ga0081455_10356485 3300005937 Viruses 1030
304 Ga0081538_10029358 3300005981 Bacteria 3758
305 Ga0081538_10066336 3300005981 Unclassified 2024
306 Ga0081538_10161978 3300005981 Bacteria 992
307 Ga0081538_10212734 3300005981 Bacteria 777
308 Ga0081540_1004661 3300005983 Bacteria 10374
309 Ga0081540_1048522 3300005983 Bacteria 2126
310 Ga0081540_1265075 3300005983 Unclassified 596
311 Ga0081539_10014095 3300005985 Bacteria 5945
312 Ga0081539_10071976 3300005985 Bacteria 1850
313 Ga0070717_10008509 3300006028 Bacteria 7663
314 Ga0070717_10009572 3300006028 Bacteria 7288
315 Ga0070717_10128713 3300006028 Bacteria 2175
316 Ga0070717_10148806 3300006028 Bacteria 2025
317 Ga0070717_10170441 3300006028 Bacteria 1893
318 Ga0070717_10385383 3300006028 Bacteria 1257
319 Ga0070717_10493056 3300006028 Bacteria 1107
320 Ga0070717_10541002 3300006028 Unclassified 1054
321 Ga0070717_10755438 3300006028 Unclassified 884
322 Ga0075365_10021013 3300006038 Bacteria 4062
323 Ga0075365_10061283 3300006038 Bacteria 2512
324 Ga0075368_10037491 3300006042 Bacteria 1896
325 Ga0075364_10061285 3300006051 Bacteria 2467
326 Ga0075364_10615757 3300006051 Bacteria 742
327 Ga0075432_10030528 3300006058 Bacteria 1862
328 Ga0075432_10105773 3300006058 Unclassified 1044
329 Ga0075432_10202231 3300006058 Bacteria 786
330 Ga0070715_10000411 3300006163 Bacteria 10899
331 Ga0070715_10071420 3300006163 Bacteria 1552
332 Ga0070716_100003224 3300006173 Bacteria 7656
333 Ga0070716_100004028 3300006173 Bacteria 6976
334 Ga0070716_100117441 3300006173 Unclassified 1659
335 Ga0070716_100356144 3300006173 Bacteria 1038
336 Ga0070716_100362605 3300006173 Bacteria 1030
337 Ga0070716_100403046 3300006173 Bacteria 984
338 Ga0070716_100955972 3300006173 Bacteria 674
339 Ga0070716_101330834 3300006173 Unclassified 582
340 Ga0070716_101331103 3300006173 Bacteria 582
341 Ga0070716_101629147 3300006173 Bacteria 531
342 Ga0070712_100036499 3300006175 Bacteria 3345
343 Ga0070712_100044870 3300006175 Bacteria 3049
344 Ga0070712_100062735 3300006175 Bacteria 2629
345 Ga0070712_100138374 3300006175 Bacteria 1855
346 Ga0070712_100290695 3300006175 Bacteria 1319
347 Ga0070712_100301792 3300006175 Bacteria 1296
348 Ga0070712_101003101 3300006175 Unclassified 722
349 Ga0070712_101071532 3300006175 Unclassified 699
350 Ga0075362_10010441 3300006177 Bacteria 3626
351 Ga0097621_100027775 3300006237 Bacteria 4453
352 Ga0097621_100069381 3300006237 Bacteria 2910
353 Ga0097621_100350317 3300006237 Bacteria 1313
354 Ga0097621_102080695 3300006237 Bacteria 543
355 Ga0068871_100015524 3300006358 Bacteria 5703
356 Ga0068871_100037623 3300006358 Bacteria 3860
357 Ga0068871_100176749 3300006358 Bacteria 1833
358 Ga0068871_100727559 3300006358 Unclassified 911
359 Ga0068871_100951470 3300006358 Bacteria 798
360 Ga0075428_100738413 3300006844 Bacteria 1048
361 Ga0075428_100937113 3300006844 Bacteria 918
362 Ga0075428_101032923 3300006844 Bacteria 869
363 Ga0075428_101137444 3300006844 Unclassified 824
364 Ga0075428_102114165 3300006844 Bacteria 582
365 Ga0075428_102492511 3300006844 Bacteria 530
366 Ga0075430_100082886 3300006846 Bacteria 2687
367 Ga0075431_100046434 3300006847 Bacteria 4478
368 Ga0075431_100129178 3300006847 Bacteria 2607
369 Ga0075431_100198360 3300006847 Bacteria 2054
370 Ga0075431_100881721 3300006847 Bacteria 865
371 Ga0075431_101389175 3300006847 Unclassified 662
372 Ga0075431_102065393 3300006847 Unclassified 525
373 Ga0075433_10010520 3300006852 Bacteria 7431
374 Ga0075433_10083582 3300006852 Bacteria 2818
375 Ga0075433_10313819 3300006852 Bacteria 1387
376 Ga0075433_10940014 3300006852 Bacteria 754
377 Ga0075433_10967560 3300006852 Bacteria 742
378 Ga0075434_100062436 3300006871 Bacteria 3708
379 Ga0075434_100083511 3300006871 Bacteria 3191
380 Ga0075434_100114729 3300006871 Bacteria 2707
381 Ga0075434_100263741 3300006871 Bacteria 1742
382 Ga0075434_101326636 3300006871 Bacteria 730
383 Ga0075434_101335367 3300006871 Bacteria 728
384 Ga0075434_101879194 3300006871 Unclassified 605
385 Ga0075434_101957542 3300006871 Bacteria 592
386 Ga0075434_102540257 3300006871 Bacteria 513
387 Ga0075429_100462076 3300006880 Bacteria 1112
388 Ga0075429_100731047 3300006880 Bacteria 867
389 Ga0075429_101467374 3300006880 Bacteria 594
390 Ga0075429_101778150 3300006880 Bacteria 535
391 Ga0068865_100002569 3300006881 Bacteria 10774
392 Ga0068865_100211781 3300006881 Bacteria 1511
393 Ga0068865_100486787 3300006881 Bacteria 1026
394 Ga0068865_102183233 3300006881 Bacteria 504
395 Ga0075436_100005290 3300006914 Bacteria 8878
396 Ga0075436_100014092 3300006914 Bacteria 5472
397 Ga0075436_100115804 3300006914 Bacteria 1873
398 Ga0075436_100408801 3300006914 Bacteria 984
399 Ga0075436_100767237 3300006914 Unclassified 717
400 Ga0075436_101090722 3300006914 Bacteria 601
401 Ga0097620_100108824 3300006931 Unclassified 2833
402 Ga0075435_100029772 3300007076 Bacteria 4287
403 Ga0075435_100059064 3300007076 Bacteria 3108
404 Ga0075435_100123865 3300007076 Bacteria 2159
405 Ga0075435_100462203 3300007076 Bacteria 1095
406 Ga0075435_100616040 3300007076 Unclassified 942
407 Ga0075435_100675940 3300007076 Unclassified 897
408 Ga0075435_100706151 3300007076 Unclassified 877
409 Ga0075435_101049143 3300007076 Bacteria 712
410 Ga0075435_101582264 3300007076 Unclassified 575
411 Ga0099794_10345463 3300007265 Bacteria 774
412 Ga0099795_10153195 3300007788 Bacteria 946
413 Ga0105251_10465950 3300009011 Bacteria 587
414 Ga0105240_10026970 3300009093 Bacteria 7530
415 Ga0105240_10086355 3300009093 Bacteria 3842
416 Ga0105240_10466016 3300009093 Bacteria 1411
417 Ga0105240_10714686 3300009093 Bacteria 1092
418 Ga0105240_11235172 3300009093 Bacteria 790
419 Ga0105240_11912422 3300009093 Bacteria 617
420 Ga0111539_10026259 3300009094 Bacteria 7124
421 Ga0111539_10311132 3300009094 Bacteria 1833
422 Ga0111539_10422037 3300009094 Bacteria 1553
423 Ga0105245_10006470 3300009098 Bacteria 10302
424 Ga0105245_10016352 3300009098 Bacteria 6469
425 Ga0105245_10032981 3300009098 Bacteria 4586
426 Ga0105245_10093167 3300009098 Bacteria 2775
427 Ga0105245_10217624 3300009098 Bacteria 1841
428 Ga0105245_10647743 3300009098 Unclassified 1086
429 Ga0105245_10920262 3300009098 Bacteria 917
430 Ga0105245_11112558 3300009098 Bacteria 836
431 Ga0105245_11173832 3300009098 Bacteria 815
432 Ga0105247_10039193 3300009101 Bacteria 2894
433 Ga0105247_10041124 3300009101 Unclassified 2828
434 Ga0105247_10455354 3300009101 Bacteria 923
435 Ga0105247_10628807 3300009101 Bacteria 799
436 Ga0114129_10014214 3300009147 Bacteria 11342
437 Ga0114129_10028533 3300009147 Bacteria 7907
438 Ga0114129_10176020 3300009147 Bacteria 2914
439 Ga0114129_10333560 3300009147 Bacteria 2013
440 Ga0114129_10443997 3300009147 Bacteria 1703
441 Ga0114129_11481715 3300009147 Unclassified 834
442 Ga0114129_12161052 3300009147 Bacteria 670
443 Ga0114129_12273645 3300009147 Bacteria 651
444 Ga0114129_12636026 3300009147 Bacteria 599
445 Ga0105243_10006582 3300009148 Bacteria 8978
446 Ga0105243_10176379 3300009148 Bacteria 1855
447 Ga0105243_10472913 3300009148 Bacteria 1181
448 Ga0105243_10920157 3300009148 Bacteria 871
449 Ga0105243_11232722 3300009148 Bacteria 763
450 Ga0105243_11766009 3300009148 Bacteria 649
451 Ga0105241_10010431 3300009174 Bacteria 6818
452 Ga0105241_10225695 3300009174 Bacteria 1577
453 Ga0105241_11189493 3300009174 Unclassified 722
454 Ga0105242_10189764 3300009176 Bacteria 1819
455 Ga0105242_10232541 3300009176 Bacteria 1653
456 Ga0105242_10611090 3300009176 Bacteria 1054
457 Ga0105242_11904192 3300009176 Bacteria 635
458 Ga0105242_12037709 3300009176 Unclassified 617
459 Ga0105242_12283825 3300009176 Bacteria 587
460 Ga0105248_10049097 3300009177 Bacteria 4734
461 Ga0105248_10305897 3300009177 Bacteria 1790
462 Ga0105248_10322552 3300009177 Bacteria 1740
463 Ga0105248_10970970 3300009177 Bacteria 960
464 Ga0105248_11825226 3300009177 Unclassified 690
465 Ga0105248_11914902 3300009177 Unclassified 673
466 Ga0105248_12234074 3300009177 Bacteria 623
467 Ga0105248_12822677 3300009177 Bacteria 554
468 Ga0105237_10016127 3300009545 Bacteria 7770
469 Ga0105237_10082158 3300009545 Bacteria 3213
470 Ga0105237_11400414 3300009545 Unclassified 706
471 Ga0105237_11677159 3300009545 Unclassified 643
472 Ga0105238_10270449 3300009551 Bacteria 1680
473 Ga0105249_10530734 3300009553 Bacteria 1225
474 Ga0105249_11370788 3300009553 Bacteria 779
475 Ga0105249_11793470 3300009553 Bacteria 686
476 Ga0099796_10246869 3300010159 Unclassified 740
477 Ga0105239_10047664 3300010375 Bacteria 4696
478 Ga0105239_10082773 3300010375 Bacteria 3534
479 Ga0105239_10896385 3300010375 Bacteria 1018
480 Ga0105239_10973953 3300010375 Unclassified 975
481 Ga0105239_11374835 3300010375 Bacteria 815
482 Ga0105239_13455417 3300010375 Unclassified 514
483 Ga0105246_10015657 3300011119 Bacteria 4792
484 Ga0105246_10154906 3300011119 Unclassified 1739
485 Ga0105246_10155850 3300011119 Bacteria 1734
486 Ga0105246_10421196 3300011119 Bacteria 1114
487 Ga0105246_10447504 3300011119 Bacteria 1085
488 Ga0105246_11429931 3300011119 Bacteria 646
489 Ga0105246_11560348 3300011119 Bacteria 622
490 Ga0157336_1020165 3300012477 Unclassified 597
491 Ga0157318_1024722 3300012482 Bacteria 558
492 Ga0157321_1030441 3300012487 Bacteria 548
493 Ga0157335_1004864 3300012492 Unclassified 920
494 Ga0157319_1008123 3300012497 Bacteria 796
495 Ga0157347_1011762 3300012502 Bacteria 934
496 Ga0157339_1019802 3300012505 Bacteria 705
497 Ga0157342_1022454 3300012507 Bacteria 743
498 Ga0157315_1027696 3300012508 Unclassified 644
499 Ga0157326_1040471 3300012513 Bacteria 652
500 Ga0157373_10274124 3300013100 Unclassified 1195
501 Ga0157373_10361112 3300013100 Bacteria 1037
502 Ga0157373_10885394 3300013100 Bacteria 662
503 Ga0157371_10044697 3300013102 Bacteria 3153
504 Ga0157371_10343760 3300013102 Bacteria 1085
505 Ga0157371_10377891 3300013102 Unclassified 1034
506 Ga0157370_10189800 3300013104 Bacteria 1908
507 Ga0157370_10325820 3300013104 Bacteria 1417
508 Ga0157370_10872670 3300013104 Bacteria 817
509 Ga0157370_11020394 3300013104 Unclassified 749
510 Ga0157370_11229979 3300013104 Bacteria 675
511 Ga0157370_11394070 3300013104 Bacteria 631
512 Ga0157369_10080357 3300013105 Bacteria 3491
513 Ga0157369_10120813 3300013105 Bacteria 2780
514 Ga0157369_10138075 3300013105 Bacteria 2580
515 Ga0157369_10269526 3300013105 Bacteria 1774
516 Ga0157369_10726452 3300013105 Bacteria 1022
517 Ga0157369_11010926 3300013105 Bacteria 851
518 Ga0157369_11128225 3300013105 Unclassified 801
519 Ga0157369_12651350 3300013105 Unclassified 506
520 Ga0157374_10020635 3300013296 Bacteria 5851
521 Ga0157374_10095491 3300013296 Unclassified 2843
522 Ga0157374_10173495 3300013296 Bacteria 2104
523 Ga0157374_10268809 3300013296 Bacteria 1681
524 Ga0157374_11308648 3300013296 Bacteria 747
525 Ga0157378_10086458 3300013297 Bacteria 2842
526 Ga0157378_11253976 3300013297 Bacteria 782
527 Ga0157378_11257669 3300013297 Bacteria 780
528 Ga0157378_11848308 3300013297 Bacteria 653
529 Ga0157378_11947405 3300013297 Bacteria 637
530 Ga0163162_10051975 3300013306 Bacteria 4114
531 Ga0163162_10322659 3300013306 Bacteria 1677
532 Ga0163162_10876998 3300013306 Bacteria 1011
533 Ga0163162_11863027 3300013306 Bacteria 688
534 Ga0157372_10160028 3300013307 Bacteria 2602
535 Ga0157372_10196442 3300013307 Bacteria 2337
536 Ga0157372_10276342 3300013307 Unclassified 1953
537 Ga0157372_10413923 3300013307 Bacteria 1571
538 Ga0157372_10502340 3300013307 Bacteria 1414
539 Ga0157372_10944775 3300013307 Bacteria 999
540 Ga0157372_11030418 3300013307 Bacteria 953
541 Ga0157372_11511173 3300013307 Bacteria 774
542 Ga0157375_10006851 3300013308 Bacteria 9931
543 Ga0157375_10009400 3300013308 Bacteria 8582
544 Ga0157375_10374897 3300013308 Bacteria 1589
545 Ga0157375_11214135 3300013308 Bacteria 885
546 Ga0157375_13660397 3300013308 Unclassified 511
547 Ga0163163_10687593 3300014325 Bacteria 1087
548 Ga0163163_12793379 3300014325 Bacteria 545
549 Ga0157380_10059961 3300014326 Bacteria 3039
550 Ga0157380_10342071 3300014326 Bacteria 1396
551 Ga0157380_11218644 3300014326 Bacteria 797
552 Ga0157380_11419542 3300014326 Unclassified 745
553 Ga0182008_10006258 3300014497 Bacteria 6685
554 Ga0182008_10062492 3300014497 Bacteria 1835
555 Ga0182008_10084390 3300014497 Bacteria 1564
556 Ga0182008_10471947 3300014497 Bacteria 685
557 Ga0182008_10544273 3300014497 Bacteria 644
558 Ga0182008_10813649 3300014497 Bacteria 543
559 Ga0157377_10004537 3300014745 Bacteria 6412
560 Ga0157377_10079857 3300014745 Bacteria 1909
561 Ga0157377_10550329 3300014745 Bacteria 815
562 Ga0157379_10130378 3300014968 Bacteria 2263
563 Ga0157379_10963677 3300014968 Bacteria 812
564 Ga0157379_11507908 3300014968 Bacteria 654
565 Ga0157379_11532306 3300014968 Bacteria 649
566 Ga0157376_10012855 3300014969 Bacteria 6227
567 Ga0157376_10149906 3300014969 Bacteria 2102
568 Ga0157376_10195967 3300014969 Bacteria 1856
569 Ga0157376_10421366 3300014969 Bacteria 1296
570 Ga0157376_10841849 3300014969 Bacteria 932
571 Ga0157376_12005172 3300014969 Bacteria 616
572 Ga0157376_12624430 3300014969 Bacteria 544
573 Ga0182006_1002844 3300015261 Bacteria 9220
574 Ga0182006_1038260 3300015261 Bacteria 1897
575 Ga0182006_1119563 3300015261 Bacteria 916
576 Ga0182007_10055135 3300015262 Unclassified 1307
577 Ga0182007_10300293 3300015262 Bacteria 589
578 Ga0182005_1135682 3300015265 Bacteria 708
579 Ga0182005_1183412 3300015265 Archaea 622
580 Ga0163161_10333234 3300017792 Bacteria 1202
581 Ga0163161_10528693 3300017792 Unclassified 964
582 Ga0163161_10989445 3300017792 Bacteria 717
583 Ga0197907_10415719 3300020069 Unclassified 502
584 Ga0197907_10599385 3300020069 Bacteria 932
585 Ga0197907_10712153 3300020069 Bacteria 628
586 Ga0197907_10912859 3300020069 Bacteria 715
587 Ga0197907_10976367 3300020069 Bacteria 1132
588 Ga0197907_11296060 3300020069 Bacteria 847
589 Ga0206356_10713961 3300020070 Unclassified 502
590 Ga0206356_10765291 3300020070 Unclassified 625
591 Ga0206356_11023176 3300020070 Bacteria 1856
592 Ga0206355_1068348 3300020076 Bacteria 732
593 Ga0206355_1148949 3300020076 Bacteria 668
594 Ga0206355_1158685 3300020076 Unclassified 530
595 Ga0206355_1187411 3300020076 Bacteria 567
596 Ga0206351_10128392 3300020077 Unclassified 823
597 Ga0206351_10481373 3300020077 Bacteria 774
598 Ga0206352_11289281 3300020078 Bacteria 609
599 Ga0206350_11155711 3300020080 Bacteria 1011
600 Ga0206350_11268713 3300020080 Unclassified 529
601 Ga0206350_11419901 3300020080 Bacteria 500
602 Ga0206354_10205280 3300020081 Unclassified 1457
603 Ga0206354_10380699 3300020081 Bacteria 1514
604 Ga0206354_10993587 3300020081 Bacteria 699
605 Ga0206354_11373038 3300020081 Bacteria 757
606 Ga0206354_11465929 3300020081 Bacteria 573
607 Ga0206354_11603311 3300020081 Unclassified 1007
608 Ga0206353_10651477 3300020082 Unclassified 1087
609 Ga0206353_11608935 3300020082 Bacteria 3585
610 Ga0206353_11750180 3300020082 Bacteria 902
611 Ga0206353_11814207 3300020082 Bacteria 1819
612 Ga0154015_1105780 3300020610 Bacteria 508
613 Ga0213874_10085357 3300021377 Bacteria 1029
614 Ga0224712_10061397 3300022467 Bacteria 1499
615 Ga0224712_10093615 3300022467 Bacteria 1263
616 Ga0224712_10223881 3300022467 Bacteria 862
617 Ga0224712_10532951 3300022467 Bacteria 569
618 Ga0224712_10533197 3300022467 Bacteria 569
619 Ga0207653_10075233 3300025885 Bacteria 1160
620 Ga0207682_10102324 3300025893 Bacteria 1253
621 Ga0207682_10421608 3300025893 Bacteria 631
622 Ga0207692_10010787 3300025898 Bacteria 3866
623 Ga0207692_10019501 3300025898 Bacteria 3066
624 Ga0207692_10094073 3300025898 Bacteria 1631
625 Ga0207692_10240974 3300025898 Bacteria 1080
626 Ga0207692_10262257 3300025898 Bacteria 1039
627 Ga0207692_10285656 3300025898 Bacteria 1000
628 Ga0207692_10327388 3300025898 Bacteria 939
629 Ga0207692_10343219 3300025898 Bacteria 919
630 Ga0207692_10838051 3300025898 Unclassified 603
631 Ga0207642_10023373 3300025899 Bacteria 2468
632 Ga0207642_10334657 3300025899 Bacteria 888
633 Ga0207710_10085677 3300025900 Bacteria 1468
634 Ga0207710_10180769 3300025900 Bacteria 1035
635 Ga0207710_10188880 3300025900 Bacteria 1014
636 Ga0207688_10084658 3300025901 Bacteria 1815
637 Ga0207688_10349015 3300025901 Bacteria 911
638 Ga0207688_10524598 3300025901 Bacteria 743
639 Ga0207688_10596282 3300025901 Bacteria 696
640 Ga0207680_10469580 3300025903 Bacteria 894
641 Ga0207647_10098484 3300025904 Bacteria 1738
642 Ga0207647_10652721 3300025904 Unclassified 577
643 Ga0207685_10200136 3300025905 Bacteria 938
644 Ga0207699_10004728 3300025906 Bacteria 6506
645 Ga0207699_10012388 3300025906 Bacteria 4338
646 Ga0207699_10074686 3300025906 Bacteria 2083
647 Ga0207699_10168694 3300025906 Bacteria 1463
648 Ga0207699_10207042 3300025906 Bacteria 1332
649 Ga0207699_10462396 3300025906 Bacteria 912
650 Ga0207645_10261918 3300025907 Bacteria 1146
651 Ga0207645_10637199 3300025907 Bacteria 724
652 Ga0207643_10063461 3300025908 Bacteria 2112
653 Ga0207705_10542226 3300025909 Bacteria 904
654 Ga0207705_10562132 3300025909 Unclassified 887
655 Ga0207705_10929291 3300025909 Bacteria 673
656 Ga0207705_11429295 3300025909 Bacteria 525
657 Ga0207684_10008813 3300025910 Bacteria 8956
658 Ga0207684_10030845 3300025910 Bacteria 4562
659 Ga0207684_10143351 3300025910 Bacteria 2054
660 Ga0207684_10342575 3300025910 Bacteria 1287
661 Ga0207684_10605041 3300025910 Bacteria 936
662 Ga0207684_11129376 3300025910 Bacteria 651
663 Ga0207654_10083163 3300025911 Bacteria 1932
664 Ga0207654_10236968 3300025911 Bacteria 1218
665 Ga0207707_10018185 3300025912 Bacteria 6125
666 Ga0207707_10092180 3300025912 Bacteria 2648
667 Ga0207707_10138889 3300025912 Bacteria 2125
668 Ga0207707_10478112 3300025912 Bacteria 1064
669 Ga0207707_10488359 3300025912 Bacteria 1051
670 Ga0207707_11600806 3300025912 Bacteria 513
671 Ga0207695_10173737 3300025913 Bacteria 2078
672 Ga0207695_10181618 3300025913 Bacteria 2025
673 Ga0207695_10470553 3300025913 Bacteria 1139
674 Ga0207695_10807905 3300025913 Bacteria 818
675 Ga0207695_11088388 3300025913 Unclassified 679
676 Ga0207695_11409856 3300025913 Unclassified 577
677 Ga0207671_10031915 3300025914 Bacteria 3923
678 Ga0207671_10265899 3300025914 Bacteria 1350
679 Ga0207693_10000807 3300025915 Bacteria 28042
680 Ga0207693_10000924 3300025915 Bacteria 26395
681 Ga0207693_10002104 3300025915 Bacteria 17374
682 Ga0207693_10041055 3300025915 Bacteria 3644
683 Ga0207693_10117679 3300025915 Bacteria 2087
684 Ga0207693_10165785 3300025915 Bacteria 1739
685 Ga0207693_10703607 3300025915 Unclassified 782
686 Ga0207693_10863242 3300025915 Unclassified 695
687 Ga0207663_10009751 3300025916 Bacteria 5082
688 Ga0207663_10015616 3300025916 Bacteria 4193
689 Ga0207663_10030655 3300025916 Bacteria 3174
690 Ga0207663_10085866 3300025916 Bacteria 2073
691 Ga0207663_10120700 3300025916 Bacteria 1795
692 Ga0207663_11264317 3300025916 Unclassified 594
693 Ga0207660_10458774 3300025917 Bacteria 1031
694 Ga0207660_10480598 3300025917 Bacteria 1007
695 Ga0207660_10675849 3300025917 Bacteria 842
696 Ga0207660_10713297 3300025917 Bacteria 818
697 Ga0207660_10759840 3300025917 Bacteria 791
698 Ga0207662_10090539 3300025918 Bacteria 1881
699 Ga0207662_10408574 3300025918 Bacteria 922
700 Ga0207657_10000486 3300025919 Bacteria 41915
701 Ga0207657_10103420 3300025919 Bacteria 2361
702 Ga0207657_10236712 3300025919 Bacteria 1459
703 Ga0207657_10402986 3300025919 Bacteria 1076
704 Ga0207657_10518444 3300025919 Bacteria 933
705 Ga0207649_10539432 3300025920 Bacteria 891
706 Ga0207649_10914043 3300025920 Unclassified 688
707 Ga0207649_11614115 3300025920 Unclassified 513
708 Ga0207652_10027118 3300025921 Bacteria 4773
709 Ga0207652_10105223 3300025921 Bacteria 2497
710 Ga0207652_10730436 3300025921 Bacteria 882
711 Ga0207652_10766881 3300025921 Bacteria 858
712 Ga0207646_10001597 3300025922 Bacteria 27663
713 Ga0207646_10005168 3300025922 Bacteria 13814
714 Ga0207646_10007573 3300025922 Bacteria 11004
715 Ga0207646_10110622 3300025922 Bacteria 2465
716 Ga0207646_10200810 3300025922 Unclassified 1801
717 Ga0207646_10373300 3300025922 Bacteria 1289
718 Ga0207646_10480098 3300025922 Unclassified 1121
719 Ga0207646_10535826 3300025922 Bacteria 1053
720 Ga0207646_11219829 3300025922 Bacteria 659
721 Ga0207646_11309568 3300025922 Bacteria 632
722 Ga0207646_11661720 3300025922 Unclassified 549
723 Ga0207646_11881329 3300025922 Unclassified 510
724 Ga0207681_10079267 3300025923 Bacteria 2314
725 Ga0207694_10134949 3300025924 Bacteria 1981
726 Ga0207650_11268989 3300025925 Bacteria 627
727 Ga0207659_10065504 3300025926 Bacteria 2633
728 Ga0207659_10140631 3300025926 Bacteria 1873
729 Ga0207687_10055681 3300025927 Bacteria 2772
730 Ga0207687_10134605 3300025927 Unclassified 1868
731 Ga0207687_10245456 3300025927 Bacteria 1421
732 Ga0207687_10289592 3300025927 Bacteria 1316
733 Ga0207687_10635357 3300025927 Bacteria 902
734 Ga0207700_10000001 3300025928 Bacteria 1122509
735 Ga0207700_10020161 3300025928 Bacteria 4521
736 Ga0207700_10067077 3300025928 Bacteria 2745
737 Ga0207700_10071397 3300025928 Bacteria 2673
738 Ga0207700_10187646 3300025928 Bacteria 1735
739 Ga0207700_10381320 3300025928 Bacteria 1233
740 Ga0207700_10538567 3300025928 Unclassified 1035
741 Ga0207700_11567284 3300025928 Bacteria 583
742 Ga0207664_10009662 3300025929 Bacteria 6780
743 Ga0207664_10039265 3300025929 Bacteria 3675
744 Ga0207664_10053974 3300025929 Bacteria 3183
745 Ga0207664_10067139 3300025929 Bacteria 2877
746 Ga0207664_10111665 3300025929 Bacteria 2274
747 Ga0207664_10128895 3300025929 Bacteria 2127
748 Ga0207664_10138713 3300025929 Bacteria 2054
749 Ga0207664_10282510 3300025929 Bacteria 1457
750 Ga0207664_10347889 3300025929 Bacteria 1312
751 Ga0207664_10384019 3300025929 Bacteria 1247
752 Ga0207664_11170519 3300025929 Unclassified 686
753 Ga0207664_11193741 3300025929 Bacteria 679
754 Ga0207644_10062612 3300025931 Bacteria 2699
755 Ga0207644_10066090 3300025931 Bacteria 2632
756 Ga0207644_10303177 3300025931 Bacteria 1288
757 Ga0207644_10587920 3300025931 Unclassified 924
758 Ga0207690_10107160 3300025932 Bacteria 2006
759 Ga0207690_10456443 3300025932 Bacteria 1028
760 Ga0207690_10811228 3300025932 Bacteria 774
761 Ga0207706_10314683 3300025933 Bacteria 1363
762 Ga0207686_10066786 3300025934 Bacteria 2298
763 Ga0207686_10076457 3300025934 Bacteria 2171
764 Ga0207686_10679632 3300025934 Bacteria 817
765 Ga0207686_10680495 3300025934 Bacteria 816
766 Ga0207686_10683756 3300025934 Bacteria 814
767 Ga0207709_10268584 3300025935 Bacteria 1254
768 Ga0207709_10279248 3300025935 Bacteria 1233
769 Ga0207709_10394335 3300025935 Bacteria 1057
770 Ga0207709_10763306 3300025935 Bacteria 778
771 Ga0207670_10051744 3300025936 Bacteria 2759
772 Ga0207670_11107102 3300025936 Bacteria 669
773 Ga0207669_10925531 3300025937 Bacteria 729
774 Ga0207669_11908502 3300025937 Bacteria 508
775 Ga0207704_10006080 3300025938 Bacteria 5596
776 Ga0207704_10153130 3300025938 Bacteria 1630
777 Ga0207704_10163892 3300025938 Bacteria 1585
778 Ga0207665_10000058 3300025939 Bacteria 72882
779 Ga0207665_10001956 3300025939 Bacteria 13858
780 Ga0207665_10010709 3300025939 Bacteria 6023
781 Ga0207665_10116071 3300025939 Bacteria 1886
782 Ga0207665_10485646 3300025939 Bacteria 952
783 Ga0207665_10499185 3300025939 Bacteria 940
784 Ga0207665_10550787 3300025939 Bacteria 896
785 Ga0207665_10870171 3300025939 Bacteria 714
786 Ga0207665_11102259 3300025939 Bacteria 633
787 Ga0207691_10093311 3300025940 Bacteria 2696
788 Ga0207691_10376604 3300025940 Unclassified 1212
789 Ga0207691_11230497 3300025940 Bacteria 620
790 Ga0207711_10023157 3300025941 Bacteria 5198
791 Ga0207711_10154130 3300025941 Unclassified 2075
792 Ga0207711_10223640 3300025941 Bacteria 1722
793 Ga0207711_10494608 3300025941 Bacteria 1140
794 Ga0207711_10527299 3300025941 Bacteria 1101
795 Ga0207711_10910387 3300025941 Bacteria 818
796 Ga0207689_10052839 3300025942 Bacteria 3347
797 Ga0207689_10474564 3300025942 Bacteria 1047
798 Ga0207689_11324315 3300025942 Bacteria 605
799 Ga0207661_10066647 3300025944 Bacteria 2925
800 Ga0207661_10179085 3300025944 Bacteria 1850
801 Ga0207661_10374989 3300025944 Bacteria 1287
802 Ga0207661_10506112 3300025944 Bacteria 1104
803 Ga0207661_11030941 3300025944 Bacteria 758
804 Ga0207661_12121611 3300025944 Unclassified 508
805 Ga0207679_10879573 3300025945 Bacteria 819
806 Ga0207679_11371973 3300025945 Bacteria 649
807 Ga0207679_12084956 3300025945 Unclassified 515
808 Ga0207667_10721663 3300025949 Bacteria 998
809 Ga0207667_11060276 3300025949 Unclassified 795
810 Ga0207667_11545816 3300025949 Bacteria 633
811 Ga0207667_11848469 3300025949 Bacteria 567
812 Ga0207651_10278459 3300025960 Bacteria 1381
813 Ga0207651_10376333 3300025960 Bacteria 1202
814 Ga0207712_10226975 3300025961 Bacteria 1497
815 Ga0207668_10127346 3300025972 Bacteria 1939
816 Ga0207640_10840104 3300025981 Bacteria 798
817 Ga0207640_10867086 3300025981 Unclassified 786
818 Ga0207658_12106996 3300025986 Bacteria 512
819 Ga0207677_10099472 3300026023 Bacteria 2136
820 Ga0207677_10146512 3300026023 Bacteria 1815
821 Ga0207677_11165409 3300026023 Bacteria 704
822 Ga0207677_11412994 3300026023 Bacteria 641
823 Ga0207703_10147797 3300026035 Bacteria 2046
824 Ga0207639_10165616 3300026041 Bacteria 1867
825 Ga0207678_10020158 3300026067 Bacteria 5856
826 Ga0207678_11748936 3300026067 Bacteria 545
827 Ga0207708_10029459 3300026075 Bacteria 4162
828 Ga0207708_10142622 3300026075 Bacteria 1881
829 Ga0207708_10310172 3300026075 Bacteria 1285
830 Ga0207708_10478009 3300026075 Bacteria 1041
831 Ga0207708_10783262 3300026075 Bacteria 820
832 Ga0207708_11274288 3300026075 Bacteria 644
833 Ga0207708_11893952 3300026075 Bacteria 523
834 Ga0207702_10005430 3300026078 Bacteria 11159
835 Ga0207702_10133803 3300026078 Bacteria 2234
836 Ga0207702_10175527 3300026078 Bacteria 1969
837 Ga0207702_10251346 3300026078 Bacteria 1660
838 Ga0207702_10337847 3300026078 Bacteria 1438
839 Ga0207702_10346138 3300026078 Bacteria 1421
840 Ga0207702_10365103 3300026078 Bacteria 1385
841 Ga0207702_10774701 3300026078 Bacteria 948
842 Ga0207702_10805454 3300026078 Bacteria 929
843 Ga0207702_11349379 3300026078 Bacteria 707
844 Ga0207702_11788227 3300026078 Bacteria 607
845 Ga0207702_12452752 3300026078 Unclassified 508
846 Ga0207641_10349890 3300026088 Bacteria 1408
847 Ga0207641_10741395 3300026088 Bacteria 969
848 Ga0207648_10001479 3300026089 Bacteria 25851
849 Ga0207648_10414264 3300026089 Bacteria 1223
850 Ga0207676_10829413 3300026095 Bacteria 903
851 Ga0207674_10459809 3300026116 Bacteria 1230
852 Ga0207674_11432069 3300026116 Unclassified 660
853 Ga0207675_100045622 3300026118 Bacteria 4095
854 Ga0207675_100648569 3300026118 Bacteria 1062
855 Ga0207683_10000336 3300026121 Bacteria 42739
856 Ga0207683_10000966 3300026121 Bacteria 26320
857 Ga0207683_10293865 3300026121 Bacteria 1486
858 Ga0207683_10440091 3300026121 Bacteria 1201
859 Ga0207683_10451140 3300026121 Bacteria 1186
860 Ga0207683_11170572 3300026121 Bacteria 713
861 Ga0209966_1053207 3300027695 Bacteria 864
862 Ga0209813_10171589 3300027866 Bacteria 788
863 Ga0209974_10460877 3300027876 Bacteria 505
864 Ga0207428_10006507 3300027907 Bacteria 10782
865 Ga0207428_10029205 3300027907 Bacteria 4573
866 Ga0207428_10195808 3300027907 Bacteria 1522
867 Ga0207428_10258429 3300027907 Bacteria 1297
868 Ga0207428_10635776 3300027907 Bacteria 767
869 Ga0207428_10825408 3300027907 Unclassified 658
870 Ga0268266_10379883 3300028379 Bacteria 1332
871 Ga0268266_10836009 3300028379 Bacteria 890
872 Ga0268266_11005121 3300028379 Bacteria 807
873 Ga0268265_10376761 3300028380 Bacteria 1304
874 Ga0268265_11977020 3300028380 Bacteria 590
875 Ga0268264_10052067 3300028381 Bacteria 3413
876 Ga0265337_1067003 3300028556 Unclassified 989
877 Ga0265326_10120259 3300028558 Unclassified 747
878 Ga0265326_10144018 3300028558 Bacteria 680
879 Ga0265319_1016012 3300028563 Bacteria 2883
880 Ga0265319_1156879 3300028563 Bacteria 704
881 Ga0265334_10014972 3300028573 Bacteria 3227
882 Ga0265318_10369950 3300028577 Unclassified 523
883 Ga0265323_10173361 3300028653 Bacteria 685
884 Ga0265322_10216270 3300028654 Unclassified 549
885 Ga0265336_10001679 3300028666 Bacteria 9775
886 Ga0265336_10029316 3300028666 Unclassified 1717
887 Ga0265338_10003865 3300028800 Bacteria 20766
888 Ga0265338_10004114 3300028800 Bacteria 19928
889 Ga0265338_10097542 3300028800 Bacteria 2407
890 Ga0265324_10148462 3300029957 Unclassified 796
891 Ga0265330_10005447 3300031235 Bacteria 6349
892 Ga0265339_10003346 3300031249 Bacteria 11226
893 Ga0265327_10046422 3300031251 Unclassified 2299
894 Ga0307408_100276341 3300031548 Unclassified 1397
895 Ga0265313_10009625 3300031595 Bacteria 6250
896 Ga0265314_10371032 3300031711 Unclassified 781
897 Ga0265342_10022365 3300031712 Bacteria 4020
898 Ga0307413_10447126 3300031824 Bacteria 1025
899 Ga0307406_10734701 3300031901 Bacteria 827
900 Ga0307407_10030113 3300031903 Bacteria 2925
901 Ga0307412_10363106 3300031911 Bacteria 1167
902 Ga0307412_10644355 3300031911 Bacteria 903
903 Ga0307412_11662510 3300031911 Bacteria 584
904 Ga0307409_100051516 3300031995 Bacteria 3151
905 Ga0307409_100176643 3300031995 Bacteria 1886
906 Ga0307409_100230698 3300031995 Bacteria 1678
907 Ga0307409_100503556 3300031995 Bacteria 1180
908 Ga0307409_100662188 3300031995 Bacteria 1039
909 Ga0307409_100926126 3300031995 Bacteria 886
910 Ga0307409_101396935 3300031995 Unclassified 726
911 Ga0307409_102511669 3300031995 Bacteria 544
912 Ga0307409_102966286 3300031995 Bacteria 501
913 Ga0307416_100450949 3300032002 Bacteria 1339
914 Ga0307416_100550001 3300032002 Bacteria 1227
915 Ga0307416_100629888 3300032002 Bacteria 1155
916 Ga0307416_101078898 3300032002 Bacteria 907
917 Ga0307414_11081184 3300032004 Bacteria 740
918 Ga0307414_11743633 3300032004 Unclassified 581
919 Ga0307414_11926713 3300032004 Bacteria 552
920 Ga0307415_100194861 3300032126 Bacteria 1602
921 Ga0307415_100291982 3300032126 Bacteria 1346
922 Ga0307415_100930597 3300032126 Bacteria 803
923 Ga0316583_10258442 3300032133 Unclassified 603
924 Ga0373948_0148597 3300034817 Bacteria 584
925 Ga0373959_0054848 3300034820 Bacteria 869
926 Ga0373959_0065496 3300034820 Unclassified 812
927 Ga0373938_0196926 3300034957 Bacteria 557
928 Ga0373928_0248298 3300035084 Bacteria 529
929 Ga0373929_0038574 3300035085 Bacteria 1052
930 Ga0373929_0077209 3300035085 Bacteria 806
931 Ga0373934_0172223 3300035086 Bacteria 889
932 Ga0373934_0483998 3300035086 Bacteria 520
933 Ga0373940_0030290 3300035088 Bacteria 1439
934 Ga0373940_0055002 3300035088 Bacteria 1126
935 Ga0373940_0259277 3300035088 Unclassified 588
936 Ga0373949_0086305 3300035090 Unclassified 843
937 Ga0373949_0101023 3300035090 Bacteria 790
938 Ga0373951_0282638 3300035091 Bacteria 507
939 Ga0373932_0015407 3300035112 Bacteria 1938
940 Ga0373936_0479861 3300035113 Bacteria 577
941 Ga0373939_0269160 3300035114 Bacteria 669
942 Ga0373941_0043704 3300035115 Bacteria 1396
943 Ga0373941_0074037 3300035115 Bacteria 1137
944 Ga0373941_0353631 3300035115 Bacteria 598
945 Ga0373941_0354939 3300035115 Bacteria 597
946 Ga0373953_0196457 3300035117 Bacteria 872
947 Ga0373953_0479189 3300035117 Bacteria 551
948 Ga0373957_0212255 3300035120 Unclassified 809
949 Ga0373960_0195177 3300035121 Unclassified 713
950 Ga0373960_0240966 3300035121 Bacteria 654
951 Ga0373943_0139427 3300035170 Bacteria 1305
952 Ga0373943_0141453 3300035170 Bacteria 1297
953 Ga0373943_0521122 3300035170 Unclassified 696
954 Ga0373946_0154898 3300035171 Bacteria 1072
955 Ga0373955_0093261 3300035172 Bacteria 1719
956 Ga0373942_0034443 3300035207 Bacteria 1355
957 Ga0373942_0045711 3300035207 Bacteria 1211
958 Ga0373961_0034707 3300035241 Bacteria 1427
959 Ga0373961_0325153 3300035241 Bacteria 574
960 Ga0373962_0073173 3300035242 Bacteria 1028
961 Ga0373924_0098360 3300035410 Bacteria 1257
962 Ga0373931_0019574 3300035691 Bacteria 3381
963 Ga0373931_0033045 3300035691 Bacteria 2679
964 Ga0373931_0144160 3300035691 Bacteria 1383
965 Ga0373931_0345405 3300035691 Unclassified 930
966 Ga0373931_0380598 3300035691 Bacteria 890
967 Ga0373931_0422794 3300035691 Bacteria 847
968 Ga0373931_0455315 3300035691 Bacteria 819
969 Ga0373935_0052968 3300035692 Bacteria 2581
970 Ga0373935_0837623 3300035692 Bacteria 680
971 Ga0373933_0309184 3300035724 Unclassified 1024
972 Ga0373933_0588774 3300035724 Bacteria 730
973 Ga0373947_0190601 3300035725 Bacteria 1338
974 Ga0373947_0548662 3300035725 Bacteria 787
975 Ga0373937_0002464 3300036401 Bacteria 15386
976 Ga0373937_0233521 3300036401 Unclassified 1732
977 Ga0373937_0271071 3300036401 Unclassified 1602
978 Ga0373925_0136982 3300037068 Bacteria 1914
979 Ga0373925_0204883 3300037068 Bacteria 1570
980 Ga0373925_0346253 3300037068 Bacteria 1206
981 Ga0395899_0031469 3300037312 Bacteria 3987
982 Ga0395899_0034136 3300037312 Bacteria 3819
983 Ga0395899_0043891 3300037312 Bacteria 3332
984 Ga0395899_0057550 3300037312 Bacteria 2870
985 Ga0395899_0065359 3300037312 Bacteria 2673
986 Ga0395899_0087833 3300037312 Bacteria 2256
987 Ga0395899_0143943 3300037312 Unclassified 1694
988 Ga0395899_0237483 3300037312 Bacteria 1256
989 Ga0395899_0259443 3300037312 Unclassified 1189
990 Ga0395899_0288125 3300037312 Unclassified 1115
991 Ga0395899_0352059 3300037312 Bacteria 985
992 Ga0395899_0495672 3300037312 Unclassified 793
993 Ga0395899_0554141 3300037312 Bacteria 738
994 Ga0395899_0575662 3300037312 Unclassified 720
995 Ga0395899_0929114 3300037312 Bacteria 529
996 Ga0395900_0002317 3300037418 Bacteria 21119
997 Ga0395900_0003596 3300037418 Bacteria 16662
998 Ga0395900_0005500 3300037418 Bacteria 13258
999 Ga0395900_0006561 3300037418 Bacteria 12123
1000 Ga0395900_0007355 3300037418 Bacteria 11384
1001 Ga0395900_0030414 3300037418 Bacteria 5546
1002 Ga0395900_0092124 3300037418 Bacteria 3114
1003 Ga0395900_0138465 3300037418 Bacteria 2493
1004 Ga0395900_0161221 3300037418 Unclassified 2287
1005 Ga0395900_0163977 3300037418 Bacteria 2266
1006 Ga0395900_0186802 3300037418 Bacteria 2103
1007 Ga0395900_0225896 3300037418 Bacteria 1885
1008 Ga0395900_0318042 3300037418 Bacteria 1537
1009 Ga0395900_0419059 3300037418 Bacteria 1300
1010 Ga0395900_0526589 3300037418 Unclassified 1129
1011 Ga0395900_0810967 3300037418 Bacteria 863
1012 Ga0395900_0976638 3300037418 Bacteria 768
1013 Ga0395900_1347952 3300037418 Bacteria 627
1014 Ga0395900_1513732 3300037418 Bacteria 583
1015 Ga0395898_0002928 3300037466 Bacteria 19413
1016 Ga0395898_0005497 3300037466 Bacteria 13684
1017 Ga0395898_0007699 3300037466 Bacteria 11437
1018 Ga0395898_0011504 3300037466 Bacteria 9189
1019 Ga0395898_0017360 3300037466 Bacteria 7351
1020 Ga0395898_0017648 3300037466 Bacteria 7285
1021 Ga0395898_0044942 3300037466 Bacteria 4342
1022 Ga0395898_0072989 3300037466 Bacteria 3314
1023 Ga0395898_0076407 3300037466 Bacteria 3234
1024 Ga0395898_0077931 3300037466 Bacteria 3199
1025 Ga0395898_0131358 3300037466 Bacteria 2398
1026 Ga0395898_0142627 3300037466 Bacteria 2293
1027 Ga0395898_0267353 3300037466 Bacteria 1631
1028 Ga0395898_0327083 3300037466 Unclassified 1462
1029 Ga0395898_0350929 3300037466 Bacteria 1407
1030 Ga0395898_0379529 3300037466 Bacteria 1348
1031 Ga0395898_0757608 3300037466 Unclassified 912
1032 Ga0395898_1409451 3300037466 Unclassified 624
1033 Ga0395898_1948504 3300037466 Bacteria 507
1034 Ga0395905_0000698 3300037471 Bacteria 44490
1035 Ga0395905_0002827 3300037471 Bacteria 19021
1036 Ga0395905_0004158 3300037471 Bacteria 15144
1037 Ga0395905_0005462 3300037471 Bacteria 12965
1038 Ga0395905_0010671 3300037471 Bacteria 8910
1039 Ga0395905_0023407 3300037471 Bacteria 5837
1040 Ga0395905_0029867 3300037471 Bacteria 5138
1041 Ga0395905_0079110 3300037471 Bacteria 3081
1042 Ga0395905_0089827 3300037471 Bacteria 2879
1043 Ga0395905_0111130 3300037471 Bacteria 2573
1044 Ga0395905_0336919 3300037471 Bacteria 1399
1045 Ga0395905_1018305 3300037471 Bacteria 731
1046 Ga0395901_0001102 3300038443 Bacteria 28752
1047 Ga0395901_0002126 3300038443 Bacteria 20297
1048 Ga0395901_0002813 3300038443 Bacteria 17572
1049 Ga0395901_0007390 3300038443 Bacteria 11084
1050 Ga0395901_0012117 3300038443 Bacteria 8747
1051 Ga0395901_0019191 3300038443 Bacteria 6989
1052 Ga0395901_0042603 3300038443 Bacteria 4707
1053 Ga0395901_0043416 3300038443 Bacteria 4663
1054 Ga0395901_0087341 3300038443 Bacteria 3261
1055 Ga0395901_0088539 3300038443 Bacteria 3238
1056 Ga0395901_0099635 3300038443 Bacteria 3047
1057 Ga0395901_0150684 3300038443 Bacteria 2444
1058 Ga0395901_0191471 3300038443 Bacteria 2145
1059 Ga0395901_0248811 3300038443 Bacteria 1852
1060 Ga0395901_0317611 3300038443 Bacteria 1612
1061 Ga0395901_0338879 3300038443 Bacteria 1553
1062 Ga0395901_0367396 3300038443 Bacteria 1482
1063 Ga0395901_0389792 3300038443 Unclassified 1432
1064 Ga0395901_0447404 3300038443 Unclassified 1322
1065 Ga0395901_0634942 3300038443 Bacteria 1073
1066 Ga0395901_1098888 3300038443 Bacteria 766
1067 Ga0395901_1153524 3300038443 Bacteria 743
1068 Ga0395901_1258516 3300038443 Unclassified 703
1069 Ga0395901_1744204 3300038443 Bacteria 573
1070 Ga0395901_2080438 3300038443 Unclassified 513
1071 Ga0436363_0575511 3300039450 Bacteria 1441
1072 Ga0439438_092942 3300041405 Bacteria 734
1073 Ga0439461_0002163 3300041410 Bacteria 3114
1074 Ga0439461_0030378 3300041410 Bacteria 1123
1075 Ga0439466_0156092 3300041411 Bacteria 698
1076 Ga0439465_0094353 3300041413 Bacteria 1027
1077 Ga0451789_0931210 3300041443 Archaea 871
1078 Ga0451800_0626990 3300041459 Unclassified 615
1079 Ga0451800_1510129 3300041459 Unclassified 809
1080 Ga0451807_1287325 3300041486 Bacteria 669
1081 Ga0451833_0099372 3300041491 Bacteria 531
1082 Ga0451839_0645495 3300041496 Unclassified 554
1083 Ga0451847_0684522 3300041503 Bacteria 565
1084 Ga0451849_0924877 3300041505 Bacteria 535
1085 Ga0451853_1843922 3300041512 Bacteria 1281
1086 Ga0451853_1871389 3300041512 Bacteria 586
1087 Ga0439431_0138357 3300041997 Bacteria 687
1088 Ga0439433_0101055 3300041999 Unclassified 716
1089 Ga0439437_003758 3300042000 Unclassified 1641
1090 Ga0439441_011079 3300042001 Bacteria 1525
1091 Ga0439448_0020940 3300042005 Bacteria 2027
1092 Ga0439448_0023535 3300042005 Bacteria 1922
1093 Ga0439448_0332760 3300042005 Bacteria 541
1094 Ga0439450_036950 3300042008 Bacteria 1120
1095 Ga0439455_0025882 3300042012 Bacteria 1429
1096 Ga0439455_0030751 3300042012 Unclassified 1334
1097 Ga0439463_026392 3300042016 Archaea 1459
1098 Ga0450915_010080 3300042119 Bacteria 655
1099 Ga0450917_003609 3300042120 Bacteria 1122
1100 Ga0450923_036325 3300042125 Bacteria 1022
1101 Ga0450888_003542 3300042126 Bacteria 1588
1102 Ga0450892_025811 3300042130 Unclassified 598
1103 Ga0450900_079428 3300042136 Bacteria 526
1104 Ga0450910_037728 3300042147 Bacteria 774
1105 Ga0439446_0001843 3300042156 Bacteria 4965
1106 Ga0439458_0001865 3300042157 Bacteria 5233
1107 Ga0439434_0011303 3300042435 Bacteria 2638
1108 Ga0439434_0273306 3300042435 Bacteria 581
1109 Ga0439444_0020048 3300042437 Bacteria 1173
1110 Ga0439459_0088222 3300042438 Bacteria 742
1111 Ga0439459_0147883 3300042438 Bacteria 612
1112 Ga0439460_0050102 3300042461 Bacteria 1250
1113 Ga0439460_0226440 3300042461 Bacteria 642
1114 Ga0450916_023532 3300042530 Bacteria 860
1115 Ga0450918_027058 3300042531 Unclassified 1008
1116 Ga0439440_0203594 3300042993 Bacteria 588
1117 Ga0439440_0295012 3300042993 Unclassified 504
1118 Ga0466969_0000416 3300044656 Bacteria 23320
1119 Ga0466969_0183031 3300044656 Bacteria 959
1120 Ga0466972_0021651 3300044658 Bacteria 3204
1121 Ga0466972_0118110 3300044658 Bacteria 1251
1122 Ga0466972_0605835 3300044658 Bacteria 518
1123 Ga0466965_0012753 3300044683 Bacteria 3958
1124 Ga0466965_0066969 3300044683 Bacteria 1802
1125 Ga0466965_0316550 3300044683 Bacteria 849
1126 Ga0466966_0586673 3300044684 Unclassified 671
1127 Ga0466961_0000463 3300044693 Bacteria 25666
1128 Ga0466961_0002397 3300044693 Bacteria 11644
1129 Ga0466961_0018213 3300044693 Bacteria 4515
1130 Ga0466961_0057813 3300044693 Bacteria 2468
1131 Ga0466961_0137595 3300044693 Bacteria 1530
1132 Ga0466961_0170653 3300044693 Bacteria 1353
1133 Ga0466963_0000055 3300044694 Bacteria 37968
1134 Ga0466963_0004827 3300044694 Bacteria 7860
1135 Ga0466963_0012434 3300044694 Bacteria 5210
1136 Ga0466963_0015842 3300044694 Bacteria 4679
1137 Ga0466963_0022743 3300044694 Bacteria 3973
1138 Ga0466963_0023942 3300044694 Bacteria 3883
1139 Ga0466963_0033848 3300044694 Bacteria 3321
1140 Ga0466963_0050054 3300044694 Bacteria 2765
1141 Ga0466963_0064761 3300044694 Bacteria 2449
1142 Ga0466963_0072063 3300044694 Bacteria 2326
1143 Ga0466963_0100496 3300044694 Bacteria 1979
1144 Ga0466963_0226574 3300044694 Unclassified 1309
1145 Ga0466963_0252889 3300044694 Unclassified 1236
1146 Ga0466963_0296732 3300044694 Unclassified 1136
1147 Ga0466963_0431087 3300044694 Bacteria 930
1148 Ga0466963_1132171 3300044694 Unclassified 550
1149 Ga0466964_0009411 3300044706 Bacteria 3678
1150 Ga0466964_0011536 3300044706 Bacteria 3340
1151 Ga0466964_0018416 3300044706 Bacteria 2680
1152 Ga0466964_0021550 3300044706 Bacteria 2493
1153 Ga0466964_0043695 3300044706 Unclassified 1818
1154 Ga0466964_0044614 3300044706 Bacteria 1801
1155 Ga0466964_0051059 3300044706 Bacteria 1697
1156 Ga0466964_0056924 3300044706 Bacteria 1617
1157 Ga0466964_0074116 3300044706 Bacteria 1446
1158 Ga0466964_0151865 3300044706 Bacteria 1074
1159 Ga0466964_0166246 3300044706 Bacteria 1035
1160 Ga0466964_0210594 3300044706 Bacteria 939
1161 Ga0466964_0444768 3300044706 Unclassified 686
1162 Ga0453684_0702652 3300044712 Bacteria 1099
1163 Ga0466971_0006844 3300044719 Bacteria 4959
1164 Ga0466971_0014728 3300044719 Bacteria 3442
1165 Ga0466971_0042499 3300044719 Bacteria 2042
1166 Ga0466971_0149105 3300044719 Bacteria 1091
1167 Ga0466971_0235099 3300044719 Bacteria 871
1168 Ga0466971_0259620 3300044719 Unclassified 829
1169 Ga0466971_0303512 3300044719 Unclassified 767
1170 Ga0466971_0409493 3300044719 Bacteria 662
1171 Ga0466968_0000852 3300044735 Bacteria 10683
1172 Ga0466968_0003464 3300044735 Bacteria 5841
1173 Ga0466968_0019156 3300044735 Bacteria 2753
1174 Ga0466968_0070119 3300044735 Bacteria 1524
1175 Ga0466968_0161887 3300044735 Bacteria 1033
1176 Ga0466968_0590580 3300044735 Bacteria 560
1177 Ga0466970_0027540 3300044765 Bacteria 2982
1178 Ga0466970_0038297 3300044765 Bacteria 2543
1179 Ga0466970_0227888 3300044765 Bacteria 1041
1180 Ga0466970_0298449 3300044765 Bacteria 908
1181 Ga0466970_0575684 3300044765 Bacteria 652
1182 Ga0466957_0005164 3300044842 Bacteria 7299
1183 Ga0466957_0006754 3300044842 Bacteria 6481
1184 Ga0466957_0030978 3300044842 Bacteria 3195
1185 Ga0466957_0073228 3300044842 Bacteria 2123
1186 Ga0466957_0233465 3300044842 Bacteria 1218
1187 Ga0466957_0729073 3300044842 Bacteria 701
1188 Ga0466960_0028038 3300044901 Bacteria 2575
1189 Ga0466960_0094462 3300044901 Bacteria 1530
1190 Ga0466960_0168260 3300044901 Bacteria 1182
1191 Ga0466960_0201029 3300044901 Bacteria 1089
1192 Ga0466960_0208085 3300044901 Bacteria 1071
1193 Ga0466960_0276693 3300044901 Bacteria 940
1194 Ga0466960_0895369 3300044901 Unclassified 541
1195 Ga0466960_0942844 3300044901 Bacteria 528
1196 Ga0466959_0007192 3300045049 Bacteria 7796
1197 Ga0466959_0012300 3300045049 Bacteria 6178
1198 Ga0466959_0093916 3300045049 Bacteria 2152
1199 Ga0466959_0135018 3300045049 Bacteria 1747
1200 Ga0466959_0411749 3300045049 Bacteria 918
1201 Ga0466959_0468675 3300045049 Bacteria 853
1202 Ga0466959_1012098 3300045049 Bacteria 553
1203 Ga0451576_0140420 3300045051 Bacteria 2519
1204 Ga0451576_0759758 3300045051 Bacteria 1018
1205 Ga0451576_1217744 3300045051 Bacteria 786
1206 Ga0466958_0003853 3300045836 Bacteria 7846
1207 Ga0466958_0009051 3300045836 Bacteria 5530
1208 Ga0466958_0011141 3300045836 Bacteria 5058
1209 Ga0466958_0037204 3300045836 Bacteria 2915
1210 Ga0466958_0125048 3300045836 Bacteria 1612
1211 Ga0466958_0149446 3300045836 Unclassified 1473
1212 Ga0466958_0272504 3300045836 Bacteria 1084
1213 Ga0466958_0314234 3300045836 Bacteria 1006
1214 Ga0466958_0343730 3300045836 Unclassified 960
1215 Ga0466958_0492483 3300045836 Unclassified 795
1216 Ga0466967_0001501 3300045976 Bacteria 13628
1217 Ga0466967_0010040 3300045976 Bacteria 7073
1218 Ga0466967_0012011 3300045976 Bacteria 6600
1219 Ga0466967_0013350 3300045976 Bacteria 6342
1220 Ga0466967_0014574 3300045976 Bacteria 6130
1221 Ga0466967_0015086 3300045976 Bacteria 6045
1222 Ga0466967_0026921 3300045976 Bacteria 4773
1223 Ga0466967_0046495 3300045976 Bacteria 3779
1224 Ga0466967_0081187 3300045976 Bacteria 2928
1225 Ga0466967_0141208 3300045976 Bacteria 2243
1226 Ga0466967_0143713 3300045976 Bacteria 2224
1227 Ga0466967_0154470 3300045976 Bacteria 2148
1228 Ga0466967_0155326 3300045976 Bacteria 2142
1229 Ga0466967_0190169 3300045976 Unclassified 1939
1230 Ga0466967_0195071 3300045976 Bacteria 1915
1231 Ga0466967_0203512 3300045976 Bacteria 1875
1232 Ga0466967_0473293 3300045976 Unclassified 1226
1233 Ga0466967_0474254 3300045976 Bacteria 1225
1234 Ga0466967_0557080 3300045976 Bacteria 1128
1235 Ga0466967_0678245 3300045976 Bacteria 1020
1236 Ga0466967_0742320 3300045976 Bacteria 973
1237 Ga0466967_1416322 3300045976 Archaea 692
1238 Ga0466967_1427188 3300045976 Bacteria 689
1239 Ga0495627_192704 3300046453 Bacteria 563
1240 Ga0495592_0000082 3300046454 Bacteria 83312
1241 Ga0495592_0044892 3300046454 Bacteria 3300
1242 Ga0495592_0134802 3300046454 Bacteria 1723
1243 Ga0495592_0296900 3300046454 Bacteria 1051
1244 Ga0495592_0388926 3300046454 Bacteria 886
1245 Ga0495603_0012630 3300046455 Bacteria 5108
1246 Ga0495603_0023587 3300046455 Bacteria 3721
1247 Ga0495603_0047153 3300046455 Bacteria 2567
1248 Ga0495603_0452266 3300046455 Unclassified 735
1249 Ga0495629_0150626 3300046459 Unclassified 1617
1250 Ga0495629_0217503 3300046459 Bacteria 1318
1251 Ga0495641_0033810 3300046461 Bacteria 2423
1252 Ga0495641_0035320 3300046461 Unclassified 2358
1253 Ga0495641_0040645 3300046461 Bacteria 2162
1254 Ga0495641_0106426 3300046461 Bacteria 1251
1255 Ga0495641_0119238 3300046461 Bacteria 1177
1256 Ga0495641_0164231 3300046461 Bacteria 993
1257 Ga0495651_0000080 3300046462 Bacteria 70453
1258 Ga0495653_0001358 3300046463 Bacteria 19003
1259 Ga0495653_0136939 3300046463 Bacteria 1726
1260 Ga0495653_0248072 3300046463 Bacteria 1183
1261 Ga0495580_0473412 3300046472 Unclassified 838
1262 Ga0495580_0547410 3300046472 Bacteria 769
1263 Ga0495582_0063737 3300046473 Bacteria 2036
1264 Ga0495582_0075739 3300046473 Bacteria 1864
1265 Ga0495582_0075882 3300046473 Bacteria 1862
1266 Ga0495582_0097235 3300046473 Bacteria 1646
1267 Ga0495582_0141954 3300046473 Bacteria 1361
1268 Ga0495582_0406229 3300046473 Bacteria 785
1269 Ga0495582_0409955 3300046473 Bacteria 782
1270 Ga0495605_0071165 3300046474 Unclassified 1643
1271 Ga0495605_0194995 3300046474 Bacteria 885
1272 Ga0495605_0415478 3300046474 Bacteria 558
1273 Ga0495639_0198301 3300046475 Bacteria 982
1274 Ga0495662_0032448 3300046476 Bacteria 2522
1275 Ga0495662_0081926 3300046476 Bacteria 1570
1276 Ga0495662_0183815 3300046476 Bacteria 1030
1277 Ga0495664_0201599 3300046477 Bacteria 1205
1278 Ga0495664_0297874 3300046477 Bacteria 974
1279 Ga0495584_0006888 3300046491 Bacteria 5939
1280 Ga0495584_0137112 3300046491 Bacteria 1242
1281 Ga0495584_0188904 3300046491 Unclassified 1047
1282 Ga0495584_0510498 3300046491 Unclassified 612
1283 Ga0495584_0608259 3300046491 Bacteria 557
1284 Ga0495585_0026440 3300046492 Bacteria 3314
1285 Ga0495585_0173844 3300046492 Unclassified 1111
1286 Ga0495585_0207059 3300046492 Bacteria 996
1287 Ga0495594_0080117 3300046499 Bacteria 1823
1288 Ga0495594_0309286 3300046499 Unclassified 900
1289 Ga0495594_0541916 3300046499 Unclassified 660
1290 Ga0495596_0068080 3300046500 Bacteria 1384
1291 Ga0495596_0074307 3300046500 Unclassified 1320
1292 Ga0495596_0090321 3300046500 Bacteria 1189
1293 Ga0495596_0206579 3300046500 Bacteria 763
1294 Ga0495596_0225540 3300046500 Unclassified 728
1295 Ga0495607_0017149 3300046501 Bacteria 4659
1296 Ga0495607_0383903 3300046501 Bacteria 642
1297 Ga0495608_0000669 3300046511 Bacteria 23647
1298 Ga0495608_0062795 3300046511 Bacteria 2439
1299 Ga0495608_0332216 3300046511 Bacteria 937
1300 Ga0495608_0339871 3300046511 Unclassified 925
1301 Ga0495608_0382795 3300046511 Bacteria 862
1302 Ga0495616_0155699 3300046513 Bacteria 1031
1303 Ga0495618_0055679 3300046514 Bacteria 2504
1304 Ga0495618_0293440 3300046514 Bacteria 1011
1305 Ga0495618_0924765 3300046514 Unclassified 502
1306 Ga0495620_0200860 3300046515 Bacteria 767
1307 Ga0495628_0000292 3300046516 Bacteria 45065
1308 Ga0495628_0181774 3300046516 Unclassified 1590
1309 Ga0495628_0939071 3300046516 Bacteria 598
1310 Ga0495630_0022995 3300046517 Bacteria 4605
1311 Ga0495630_0052669 3300046517 Bacteria 3047
1312 Ga0495630_0222274 3300046517 Bacteria 1442
1313 Ga0495630_0326377 3300046517 Unclassified 1173
1314 Ga0495630_0449794 3300046517 Bacteria 987
1315 Ga0495630_0932770 3300046517 Bacteria 661
1316 Ga0495631_0120537 3300046518 Bacteria 1128
1317 Ga0495631_0217528 3300046518 Bacteria 816
1318 Ga0495637_0209108 3300046520 Bacteria 714
1319 Ga0495637_0225667 3300046520 Bacteria 680
1320 Ga0495637_0346992 3300046520 Unclassified 521
1321 Ga0495644_0020660 3300046523 Bacteria 2512
1322 Ga0495644_0074931 3300046523 Bacteria 1274
1323 Ga0495644_0139131 3300046523 Bacteria 927
1324 Ga0495663_0021460 3300046525 Bacteria 1860
1325 Ga0495663_0043246 3300046525 Bacteria 1375
1326 Ga0495663_0382055 3300046525 Unclassified 516
1327 Ga0495666_0139807 3300046526 Bacteria 1129
1328 Ga0495652_0000847 3300046529 Bacteria 35270
1329 Ga0495652_0097098 3300046529 Bacteria 2397
1330 Ga0495652_0310659 3300046529 Bacteria 1142
1331 Ga0495665_0171582 3300046531 Unclassified 1129
1332 Ga0495665_0541543 3300046531 Bacteria 585
1333 Ga0495640_0016924 3300046533 Bacteria 5444
1334 Ga0495640_0100761 3300046533 Bacteria 1896
1335 Ga0495640_0488913 3300046533 Unclassified 750
1336 Ga0495586_0057390 3300046535 Bacteria 2112
1337 Ga0495587_0000060 3300046536 Bacteria 93780
1338 Ga0495587_0087898 3300046536 Bacteria 1798
1339 Ga0495609_0041212 3300046538 Bacteria 2076
1340 Ga0495609_0098830 3300046538 Bacteria 1265
1341 Ga0495609_0177073 3300046538 Bacteria 899
1342 Ga0495609_0276571 3300046538 Bacteria 687
1343 Ga0495645_0000038 3300046543 Bacteria 96124
1344 Ga0495645_0079531 3300046543 Bacteria 2354
1345 Ga0495622_0149429 3300046557 Unclassified 1058
1346 Ga0495667_0073429 3300046559 Bacteria 2228
1347 Ga0495667_0202357 3300046559 Bacteria 1271
1348 Ga0495667_0226025 3300046559 Unclassified 1194
1349 Ga0495656_0007613 3300046615 Bacteria 3835
1350 Ga0495656_0048507 3300046615 Bacteria 1805
1351 Ga0495656_0089683 3300046615 Bacteria 1404
1352 Ga0495656_0324951 3300046615 Unclassified 793
1353 Ga0495656_0694494 3300046615 Bacteria 547
1354 Ga0495634_0027105 3300046642 Bacteria 3990
1355 Ga0495634_0186140 3300046642 Bacteria 1297
1356 Ga0495634_0370747 3300046642 Unclassified 854
1357 Ga0495611_0056994 3300046648 Bacteria 1770
1358 Ga0495635_0960076 3300046663 Unclassified 545
1359 Ga0495659_0016528 3300046664 Bacteria 2435
1360 Ga0495659_0210461 3300046664 Bacteria 800
1361 Ga0495659_0498739 3300046664 Bacteria 533
1362 Ga0495661_0153986 3300046665 Bacteria 1240
1363 Ga0495661_0251189 3300046665 Bacteria 903
1364 Ga0495588_0320285 3300046674 Bacteria 815
1365 Ga0495588_0765290 3300046674 Bacteria 505
1366 Ga0495657_0072449 3300046675 Bacteria 2247
1367 Ga0495657_0870746 3300046675 Unclassified 513
1368 Ga0495599_0000402 3300046678 Bacteria 24769
1369 Ga0495599_0109298 3300046678 Bacteria 1722
1370 Ga0495599_0748211 3300046678 Bacteria 561
1371 Ga0495623_0000442 3300046679 Bacteria 27277
1372 Ga0495623_0115030 3300046679 Unclassified 1626
1373 Ga0495623_0618460 3300046679 Unclassified 561
1374 Ga0495646_0001935 3300046680 Bacteria 12469
1375 Ga0495646_0034453 3300046680 Bacteria 3144
1376 Ga0495647_0081820 3300046681 Unclassified 1310
1377 Ga0495647_0368004 3300046681 Bacteria 656
1378 Ga0495647_0404826 3300046681 Bacteria 627
1379 Ga0495658_0091213 3300046683 Bacteria 1804
1380 Ga0495658_0331320 3300046683 Bacteria 966
1381 Ga0495658_1114994 3300046683 Unclassified 503
1382 Ga0495669_0080687 3300046684 Bacteria 1493
1383 Ga0495669_0273532 3300046684 Bacteria 812
1384 Ga0495613_0095654 3300046689 Bacteria 2148
1385 Ga0495613_0184169 3300046689 Bacteria 1478
1386 Ga0495613_0299055 3300046689 Unclassified 1114
1387 Ga0495624_0016447 3300046690 Bacteria 4979
1388 Ga0495624_0073326 3300046690 Bacteria 2128
1389 Ga0495624_0081739 3300046690 Bacteria 2001
1390 Ga0495624_0084327 3300046690 Bacteria 1964
1391 Ga0495624_0332030 3300046690 Unclassified 915
1392 Ga0495670_0587640 3300046691 Bacteria 606
1393 Ga0495670_0664294 3300046691 Bacteria 568
1394 Ga0495670_0739145 3300046691 Bacteria 537
1395 Ga0495649_0537186 3300046694 Unclassified 580
1396 Ga0495589_0118734 3300046794 Bacteria 1274
1397 Ga0495589_0147174 3300046794 Bacteria 1126
1398 Ga0495600_0194009 3300046809 Bacteria 1305
1399 Ga0495581_0739244 3300047315 Bacteria 566
1400 Ga0495604_0000043 3300047317 Bacteria 116335
1401 Ga0495604_0124988 3300047317 Bacteria 1856
1402 Ga0495604_0518901 3300047317 Bacteria 771
1403 Ga0495604_0896618 3300047317 Bacteria 554
1404 Ga0495636_0031764 3300047318 Bacteria 2166
1405 Ga0495636_0186929 3300047318 Bacteria 942
1406 Ga0495674_0044574 3300047319 Bacteria 3943
1407 Ga0495674_0126352 3300047319 Bacteria 2157
1408 Ga0495674_0868492 3300047319 Unclassified 698
1409 Ga0495674_1134840 3300047319 Unclassified 593
1410 Ga0495676_0019485 3300047321 Bacteria 5966
1411 Ga0495676_0040517 3300047321 Bacteria 3843
1412 Ga0495676_0095220 3300047321 Bacteria 2216
1413 Ga0495676_0123134 3300047321 Unclassified 1883
1414 Ga0495676_0330612 3300047321 Bacteria 1022
1415 Ga0495676_0477333 3300047321 Bacteria 820
1416 Ga0495676_0744133 3300047321 Unclassified 633
1417 Ga0495680_0006459 3300047322 Bacteria 10885
1418 Ga0495680_0171499 3300047322 Bacteria 1571
1419 Ga0495680_0352631 3300047322 Unclassified 1024
1420 Ga0495680_0487984 3300047322 Bacteria 838
1421 Ga0495680_0604546 3300047322 Unclassified 733
1422 Ga0495680_0622766 3300047322 Bacteria 720
1423 Ga0495680_0877799 3300047322 Bacteria 581
1424 Ga0495680_0972480 3300047322 Unclassified 544
1425 Ga0495675_0000827 3300047444 Bacteria 19000
1426 Ga0495675_0143261 3300047444 Unclassified 1480
1427 Ga0495675_0825353 3300047444 Bacteria 512
1428 Ga0495677_0067675 3300047445 Bacteria 1329
1429 Ga0495677_0111106 3300047445 Bacteria 1042
1430 Ga0495684_0094459 3300047471 Bacteria 2264
1431 Ga0495684_0137542 3300047471 Bacteria 1833
1432 Ga0495684_0154760 3300047471 Unclassified 1713
1433 Ga0495684_0820352 3300047471 Bacteria 606
1434 Ga0495593_0093855 3300047673 Unclassified 1544
1435 Ga0495602_0000536 3300048088 Bacteria 35263
1436 Ga0495602_0153916 3300048088 Bacteria 1803
1437 Ga0495602_0579235 3300048088 Unclassified 774
1438 Ga0495614_0184469 3300048089 Unclassified 939
1439 Ga0495614_0543121 3300048089 Bacteria 555
1440 Ga0495614_0664212 3300048089 Bacteria 503
1441 Ga0495626_0114301 3300048091 Bacteria 1166
1442 Ga0496100_0027778 3300048903 Bacteria 3482
1443 Ga0496100_0087791 3300048903 Bacteria 2115
1444 Ga0496100_0091814 3300048903 Bacteria 2073
1445 Ga0496100_0119505 3300048903 Bacteria 1841
1446 Ga0496100_0564080 3300048903 Bacteria 882
1447 Ga0496100_0774148 3300048903 Bacteria 751
1448 Ga0496100_0841435 3300048903 Unclassified 719
1449 Ga0496100_1147873 3300048903 Bacteria 612
1450 Ga0496100_1276301 3300048903 Bacteria 579
1451 Ga0496101_0001928 3300048904 Bacteria 12558
1452 Ga0496101_0019452 3300048904 Bacteria 4636
1453 Ga0496101_0044578 3300048904 Bacteria 3174
1454 Ga0496101_0082788 3300048904 Bacteria 2374
1455 Ga0496101_0118264 3300048904 Bacteria 2001
1456 Ga0496101_0148669 3300048904 Bacteria 1790
1457 Ga0496101_0218654 3300048904 Bacteria 1478
1458 Ga0496101_0252591 3300048904 Bacteria 1374
1459 Ga0496101_0407155 3300048904 Bacteria 1071
1460 Ga0496101_0972216 3300048904 Bacteria 668
1461 Ga0496102_0021784 3300048905 Bacteria 5671
1462 Ga0496102_0028158 3300048905 Bacteria 5019
1463 Ga0496102_0031232 3300048905 Bacteria 4776
1464 Ga0496102_0118855 3300048905 Bacteria 2467
1465 Ga0496102_0197463 3300048905 Bacteria 1896
1466 Ga0496102_0403585 3300048905 Bacteria 1285
1467 Ga0496102_0403760 3300048905 Bacteria 1284
1468 Ga0496102_0806104 3300048905 Bacteria 861
1469 Ga0496102_0837813 3300048905 Bacteria 842
1470 Ga0496102_1116413 3300048905 Bacteria 708
1471 Ga0496102_1171634 3300048905 Unclassified 688
1472 Ga0496102_1566673 3300048905 Unclassified 577
1473 Ga0496103_0003123 3300048906 Bacteria 10187
1474 Ga0496103_0003893 3300048906 Bacteria 9084
1475 Ga0496103_0004055 3300048906 Bacteria 8904
1476 Ga0496103_0011785 3300048906 Bacteria 5186
1477 Ga0496103_0038013 3300048906 Bacteria 2952
1478 Ga0496103_0091563 3300048906 Bacteria 1919
1479 Ga0496103_0211979 3300048906 Bacteria 1245
1480 Ga0496103_0245340 3300048906 Bacteria 1152
1481 Ga0496104_0000566 3300048907 Bacteria 31603
1482 Ga0496104_0001456 3300048907 Bacteria 20455
1483 Ga0496104_0013980 3300048907 Bacteria 7241
1484 Ga0496104_0018210 3300048907 Bacteria 6406
1485 Ga0496104_0045934 3300048907 Bacteria 4109
1486 Ga0496104_0116458 3300048907 Bacteria 2565
1487 Ga0496104_0136337 3300048907 Bacteria 2358
1488 Ga0496104_0185869 3300048907 Bacteria 1989
1489 Ga0496104_0353239 3300048907 Bacteria 1383
1490 Ga0496104_1025443 3300048907 Bacteria 729
1491 Ga0496104_1279916 3300048907 Bacteria 636
1492 Ga0496105_0001017 3300048908 Bacteria 19386
1493 Ga0496105_0002560 3300048908 Bacteria 13204
1494 Ga0496105_0022998 3300048908 Bacteria 5053
1495 Ga0496105_0029105 3300048908 Bacteria 4520
1496 Ga0496105_0085833 3300048908 Bacteria 2601
1497 Ga0496105_0116043 3300048908 Bacteria 2208
1498 Ga0496105_0123614 3300048908 Bacteria 2133
1499 Ga0496105_0257711 3300048908 Bacteria 1411
1500 Ga0496105_0316639 3300048908 Bacteria 1251
1501 Ga0496105_0375538 3300048908 Bacteria 1132
1502 Ga0496105_1330285 3300048908 Unclassified 523
1503 Ga0496106_0001733 3300048909 Bacteria 16292
1504 Ga0496106_0026652 3300048909 Bacteria 4304
1505 Ga0496106_0030904 3300048909 Bacteria 3992
1506 Ga0496106_0049470 3300048909 Bacteria 3167
1507 Ga0496106_0138258 3300048909 Bacteria 1915
1508 Ga0496106_0204403 3300048909 Bacteria 1572
1509 Ga0496106_0209315 3300048909 Bacteria 1553
1510 Ga0496106_0229480 3300048909 Bacteria 1482
1511 Ga0496106_0309242 3300048909 Bacteria 1268
1512 Ga0496106_0333298 3300048909 Unclassified 1218
1513 Ga0496106_0333553 3300048909 Unclassified 1218
1514 Ga0496106_1536508 3300048909 Bacteria 511
1515 Ga0496107_0002910 3300048910 Bacteria 11318
1516 Ga0496107_0048698 3300048910 Bacteria 3054
1517 Ga0496107_0074565 3300048910 Bacteria 2469
1518 Ga0496107_0090486 3300048910 Bacteria 2235
1519 Ga0496107_0101698 3300048910 Bacteria 2107
1520 Ga0496107_0345269 3300048910 Bacteria 1107
1521 Ga0496107_0378205 3300048910 Bacteria 1053
1522 Ga0496107_0430976 3300048910 Bacteria 980
1523 Ga0496107_1214011 3300048910 Unclassified 542
1524 Ga0496107_1256002 3300048910 Unclassified 531
1525 Ga0496108_0000906 3300048911 Bacteria 23091
1526 Ga0496108_0021413 3300048911 Bacteria 5314
1527 Ga0496108_0040487 3300048911 Bacteria 3884
1528 Ga0496108_0101435 3300048911 Bacteria 2455
1529 Ga0496108_0136966 3300048911 Bacteria 2107
1530 Ga0496108_0224676 3300048911 Unclassified 1632
1531 Ga0496108_0278016 3300048911 Bacteria 1458
1532 Ga0496108_0284340 3300048911 Bacteria 1440
1533 Ga0496108_0650150 3300048911 Bacteria 916
1534 Ga0496109_0005563 3300048912 Bacteria 10549
1535 Ga0496109_0010078 3300048912 Bacteria 8064
1536 Ga0496109_0115763 3300048912 Bacteria 2494
1537 Ga0496109_0134057 3300048912 Bacteria 2313
1538 Ga0496109_0147897 3300048912 Bacteria 2198
1539 Ga0496109_0166610 3300048912 Bacteria 2066
1540 Ga0496109_0188421 3300048912 Bacteria 1938
1541 Ga0496109_0226420 3300048912 Bacteria 1759
1542 Ga0496109_0230128 3300048912 Bacteria 1744
1543 Ga0496109_0270418 3300048912 Bacteria 1601
1544 Ga0496109_0388509 3300048912 Bacteria 1318
1545 Ga0496109_0433311 3300048912 Bacteria 1242
1546 Ga0496109_0935892 3300048912 Bacteria 804
1547 Ga0496109_1604541 3300048912 Unclassified 585
1548 Ga0496109_1665387 3300048912 Bacteria 572
1549 Ga0496110_0000951 3300048913 Bacteria 20276
1550 Ga0496110_0000997 3300048913 Bacteria 19893
1551 Ga0496110_0007809 3300048913 Bacteria 8573
1552 Ga0496110_0016084 3300048913 Bacteria 6238
1553 Ga0496110_0019409 3300048913 Bacteria 5719
1554 Ga0496110_0028156 3300048913 Bacteria 4823
1555 Ga0496110_0112830 3300048913 Bacteria 2444
1556 Ga0496110_0162280 3300048913 Bacteria 2026
1557 Ga0496110_0172469 3300048913 Bacteria 1963
1558 Ga0496110_0206655 3300048913 Unclassified 1785
1559 Ga0496110_0262342 3300048913 Unclassified 1572
1560 Ga0496110_0266325 3300048913 Bacteria 1560
1561 Ga0496110_0353477 3300048913 Bacteria 1339
1562 Ga0496110_0747526 3300048913 Bacteria 881
1563 Ga0496110_1085697 3300048913 Bacteria 708
1564 Ga0496110_1219960 3300048913 Bacteria 661
1565 Ga0496111_0000512 3300048914 Bacteria 20026
1566 Ga0496111_0002184 3300048914 Bacteria 11720
1567 Ga0496111_0005450 3300048914 Bacteria 8153
1568 Ga0496111_0005744 3300048914 Bacteria 8004
1569 Ga0496111_0069745 3300048914 Bacteria 2556
1570 Ga0496111_0071179 3300048914 Bacteria 2531
1571 Ga0496111_0184054 3300048914 Bacteria 1553
1572 Ga0496111_0213360 3300048914 Bacteria 1434
1573 Ga0496111_0349097 3300048914 Bacteria 1095
1574 Ga0496111_0667003 3300048914 Unclassified 758
1575 Ga0496111_0771088 3300048914 Unclassified 697
1576 Ga0496111_1041846 3300048914 Unclassified 585
1577 Ga0496112_0004731 3300048915 Bacteria 11598
1578 Ga0496112_0009224 3300048915 Bacteria 8869
1579 Ga0496112_0027466 3300048915 Bacteria 5487
1580 Ga0496112_0090427 3300048915 Bacteria 3030
1581 Ga0496112_0247526 3300048915 Bacteria 1734
1582 Ga0496112_0327220 3300048915 Bacteria 1476
1583 Ga0496112_0458615 3300048915 Bacteria 1212
1584 Ga0496112_0609221 3300048915 Bacteria 1023
1585 Ga0496112_0689329 3300048915 Unclassified 950
1586 Ga0496112_1896331 3300048915 Bacteria 507
1587 Ga0496113_0010891 3300048916 Bacteria 6034
1588 Ga0496113_0046582 3300048916 Bacteria 3219
1589 Ga0496113_0068476 3300048916 Bacteria 2694
1590 Ga0496113_0138314 3300048916 Bacteria 1915
1591 Ga0496113_0167297 3300048916 Bacteria 1740
1592 Ga0496113_0178578 3300048916 Bacteria 1683
1593 Ga0496113_0230956 3300048916 Unclassified 1475
1594 Ga0496113_0351649 3300048916 Unclassified 1182
1595 Ga0496113_0353400 3300048916 Bacteria 1179
1596 Ga0496113_0615307 3300048916 Bacteria 869
1597 Ga0496113_0672453 3300048916 Bacteria 827
1598 Ga0496113_0796285 3300048916 Bacteria 751
1599 Ga0496114_0002097 3300048917 Bacteria 15151
1600 Ga0496114_0017867 3300048917 Bacteria 5732
1601 Ga0496114_0036750 3300048917 Bacteria 4049
1602 Ga0496114_0074651 3300048917 Bacteria 2855
1603 Ga0496114_0140476 3300048917 Bacteria 2091
1604 Ga0496114_0189445 3300048917 Bacteria 1799
1605 Ga0496114_0296012 3300048917 Bacteria 1428
1606 Ga0496114_0344674 3300048917 Bacteria 1317
1607 Ga0496114_0353092 3300048917 Bacteria 1300
1608 Ga0496114_1026679 3300048917 Bacteria 708
1609 Ga0496115_0044549 3300048918 Bacteria 3539
1610 Ga0496115_0055048 3300048918 Bacteria 3195
1611 Ga0496115_0113403 3300048918 Bacteria 2227
1612 Ga0496115_0261104 3300048918 Bacteria 1424
1613 Ga0496115_0413339 3300048918 Bacteria 1093
1614 Ga0501298_146661 3300049521 Bacteria 574
1615 Ga0501031_0069984 3300049568 Bacteria 2285
1616 Ga0501031_0446109 3300049568 Bacteria 836
1617 Ga0501031_1043944 3300049568 Bacteria 522
1618 Ga0501032_0148468 3300049569 Bacteria 1542
1619 Ga0501032_1051003 3300049569 Unclassified 511
1620 Ga0501033_0163192 3300049570 Bacteria 1603
1621 Ga0501036_0036730 3300049572 Bacteria 4146
1622 Ga0501037_0211779 3300049573 Bacteria 1366
1623 Ga0501038_0058270 3300049574 Bacteria 3312
1624 Ga0501039_0038129 3300049575 Bacteria 3712
1625 Ga0501039_0764607 3300049575 Bacteria 754
1626 Ga0501040_0015402 3300049576 Bacteria 5056
1627 Ga0501040_0182121 3300049576 Bacteria 1489
1628 Ga0501041_0007471 3300049577 Bacteria 6416
1629 Ga0501041_0111005 3300049577 Bacteria 1701
1630 Ga0501041_0374915 3300049577 Bacteria 900
1631 Ga0501041_0783530 3300049577 Unclassified 611
1632 Ga0501042_0070432 3300049578 Bacteria 2501
1633 Ga0501042_0314460 3300049578 Bacteria 1131
1634 Ga0501042_1331879 3300049578 Bacteria 524
1635 Ga0501046_0083004 3300049580 Bacteria 2474
1636 Ga0501046_0240151 3300049580 Bacteria 1336
1637 Ga0501048_0014730 3300049582 Bacteria 5786
1638 Ga0501048_1103511 3300049582 Bacteria 571
1639 Ga0501048_1233917 3300049582 Bacteria 538
1640 Ga0501067_0018931 3300049583 Bacteria 3809
1641 Ga0501067_0223514 3300049583 Bacteria 1048
1642 Ga0501067_0237108 3300049583 Bacteria 1015
1643 Ga0501067_0573987 3300049583 Bacteria 632
1644 Ga0501067_0649454 3300049583 Bacteria 592
1645 Ga0501068_0137175 3300049584 Bacteria 1532
1646 Ga0501069_0073814 3300049585 Unclassified 1913
1647 Ga0501069_0099093 3300049585 Bacteria 1653
1648 Ga0501069_0296145 3300049585 Bacteria 948
1649 Ga0501070_0228267 3300049586 Bacteria 1526
1650 Ga0501070_0666027 3300049586 Unclassified 825
1651 Ga0501071_0004656 3300049587 Bacteria 8714
1652 Ga0501071_0217034 3300049587 Bacteria 1439
1653 Ga0501071_0617298 3300049587 Bacteria 834
1654 Ga0501072_0003264 3300049588 Bacteria 12190
1655 Ga0501073_0401459 3300049589 Unclassified 947
1656 Ga0501073_0916399 3300049589 Bacteria 603
1657 Ga0501074_0080528 3300049590 Bacteria 2336
1658 Ga0501074_0461938 3300049590 Bacteria 900
1659 Ga0501075_0018170 3300049591 Bacteria 5085
1660 Ga0501075_0135269 3300049591 Bacteria 1878
1661 Ga0501075_1256954 3300049591 Bacteria 561
1662 Ga0501076_0001105 3300049592 Bacteria 17776
1663 Ga0501076_0700221 3300049592 Bacteria 836
1664 Ga0501077_0042502 3300049593 Bacteria 2890
1665 Ga0501202_215196 3300049652 Bacteria 530
1666 Ga0501233_184621 3300049668 Bacteria 599
1667 Ga0501225_0251116 3300049705 Bacteria 582
1668 Ga0501079_0037266 3300049741 Bacteria 3747
1669 Ga0501079_0134259 3300049741 Bacteria 1926
1670 Ga0501079_0527929 3300049741 Bacteria 928
1671 Ga0501080_0071893 3300049742 Bacteria 3218
1672 Ga0501081_0058177 3300049743 Bacteria 2674
1673 Ga0501081_0215914 3300049743 Bacteria 1394
1674 Ga0501081_0359080 3300049743 Bacteria 1074
1675 Ga0501083_0321516 3300049744 Bacteria 1006
1676 Ga0501083_1142710 3300049744 Bacteria 507
1677 Ga0501035_0252438 3300049822 Bacteria 1497
1678 Ga0501035_0567365 3300049822 Bacteria 928
1679 Ga0501044_0287075 3300049823 Bacteria 1578
1680 Ga0501045_0005351 3300049824 Bacteria 8893
1681 Ga0501045_1314436 3300049824 Bacteria 526
1682 Ga0501045_1330375 3300049824 Bacteria 522
1683 nmdc:mga03683_49432_c1 3300050489 Bacteria 1751
1684 nmdc:mga00v17_11157_c1 3300050491 Bacteria 4932
1685 nmdc:mga00v17_727885_c1 3300050491 Bacteria 635
1686 nmdc:mga0yw44_32896_c1 3300050492 Bacteria 3025
1687 nmdc:mga0yw44_615987_c1 3300050492 Unclassified 738
1688 nmdc:mga04h51_296052_c1 3300050495 Bacteria 658
1689 nmdc:mga05p37_13294_c1 3300050507 Bacteria 9857
1690 nmdc:mga05p37_167787_c1 3300050507 Bacteria 2678
1691 nmdc:mga05p37_1895896_c1 3300050507 Bacteria 570
1692 nmdc:mga05p37_2114232_c1 3300050507 Unclassified 527
1693 nmdc:mga05p37_244057_c1 3300050507 Bacteria 2158
1694 nmdc:mga05p37_314764_c1 3300050507 Bacteria 1854
1695 nmdc:mga05p37_68166_c1 3300050507 Bacteria 4376
1696 nmdc:mga05p37_706369_c1 3300050507 Bacteria 1119
1697 nmdc:mga09592_151081_c1 3300050508 Bacteria 2004
1698 nmdc:mga09592_619081_c1 3300050508 Bacteria 926
1699 nmdc:mga09592_874890_c1 3300050508 Unclassified 756
1700 nmdc:mga0qj67_108618_c1 3300050509 Bacteria 2239
1701 nmdc:mga06r32_10690_c1 3300050510 Bacteria 8271
1702 nmdc:mga06r32_1301213_c1 3300050510 Bacteria 671
1703 nmdc:mga06r32_1883578_c1 3300050510 Unclassified 533
1704 nmdc:mga06r32_43491_c1 3300050510 Bacteria 4274
1705 nmdc:mga06r32_639830_c1 3300050510 Bacteria 1032
1706 nmdc:mga06r32_825230_c1 3300050510 Bacteria 887
1707 nmdc:mga08y16_1564151_c1 3300050511 Bacteria 618
1708 nmdc:mga08y16_18761_c1 3300050511 Bacteria 7288
1709 nmdc:mga08y16_196041_c1 3300050511 Bacteria 2093
1710 nmdc:mga08y16_491918_c1 3300050511 Bacteria 1247
1711 nmdc:mga08y16_79427_c1 3300050511 Bacteria 3419
1712 nmdc:mga0n895_1116647_c1 3300050512 Bacteria 765
1713 nmdc:mga0n895_135876_c1 3300050512 Bacteria 2485
1714 nmdc:mga0n895_1588271_c1 3300050512 Bacteria 619
1715 nmdc:mga0n895_160159_c1 3300050512 Bacteria 2282
1716 nmdc:mga0n895_1637059_c1 3300050512 Unclassified 607
1717 nmdc:mga0n895_182761_c1 3300050512 Bacteria 2128
1718 nmdc:mga0n895_19407_c1 3300050512 Bacteria 6319
1719 nmdc:mga0n895_2162655_c1 3300050512 Bacteria 512
1720 nmdc:mga0n895_34144_c1 3300050512 Bacteria 4895
1721 nmdc:mga0n895_7715_c1 3300050512 Bacteria 9261
1722 nmdc:mga0rr50_1205443_c1 3300050513 Bacteria 643
1723 nmdc:mga0rr50_1395326_c1 3300050513 Unclassified 593
1724 nmdc:mga0rr50_294586_c1 3300050513 Bacteria 1356
1725 nmdc:mga0rr50_44331_c1 3300050513 Bacteria 3262
1726 nmdc:mga0rr50_49718_c1 3300050513 Bacteria 3105
1727 nmdc:mga0rr50_519956_c1 3300050513 Bacteria 1012
1728 nmdc:mga0rr50_81771_c1 3300050513 Bacteria 2494
1729 nmdc:mga0rr50_993710_c1 3300050513 Unclassified 715
1730 nmdc:mga08x19_18831_c1 3300050514 Bacteria 4232
1731 nmdc:mga08x19_29425_c1 3300050514 Bacteria 3445
1732 nmdc:mga08x19_43212_c1 3300050514 Bacteria 2875
1733 nmdc:mga08x19_449879_c1 3300050514 Bacteria 906
1734 nmdc:mga08x19_486783_c1 3300050514 Bacteria 870
1735 nmdc:mga08x19_718350_c1 3300050514 Bacteria 709
1736 nmdc:mga08x19_783501_c1 3300050514 Unclassified 677
1737 nmdc:mga08x19_951266_c1 3300050514 Bacteria 610
1738 nmdc:mga0a205_122897_c1 3300050515 Bacteria 2495
1739 nmdc:mga0a205_1436974_c1 3300050515 Bacteria 538
1740 nmdc:mga0a205_188932_c1 3300050515 Bacteria 1953
1741 nmdc:mga0a205_266846_c1 3300050515 Bacteria 1589
1742 nmdc:mga0a205_31020_c1 3300050515 Bacteria 5120
1743 nmdc:mga0a205_798610_c1 3300050515 Bacteria 791
1744 nmdc:mga0a205_90380_c1 3300050515 Bacteria 2959
1745 Ga0495601_0000178 3300053077 Bacteria 33686
1746 Ga0495601_0363711 3300053077 Bacteria 940
1747 Ga0495601_0429289 3300053077 Unclassified 855
1748 Ga0495601_0492742 3300053077 Unclassified 791
1749 Ga0495601_0774783 3300053077 Bacteria 610
1750 Ga0495601_0777679 3300053077 Unclassified 608
1751 Ga0495601_0828522 3300053077 Bacteria 586
1752 Ga0495612_0017228 3300053078 Bacteria 2894
1753 Ga0495612_0124556 3300053078 Bacteria 1110
1754 Ga0495595_0083745 3300053084 Unclassified 1523
1755 Ga0495595_0156310 3300053084 Bacteria 1124
1756 Ga0495595_0308993 3300053084 Unclassified 796
1757 Ga0495619_0004567 3300053085 Bacteria 8847
1758 Ga0495619_0049368 3300053085 Bacteria 2775
1759 Ga0495619_0515847 3300053085 Bacteria 821
1760 Ga0501084_0009069 3300054114 Bacteria 8230
1761 Ga0501084_0182568 3300054114 Bacteria 1771
1762 Ga0501084_0438645 3300054114 Unclassified 1104
1763 Ga0501084_0685089 3300054114 Bacteria 865
1764 Ga0501084_1245950 3300054114 Bacteria 624
1765 Ga0590071_026629 3300059421 Bacteria 1372
1766 Ga0590075_005904 3300059424 Bacteria 2896
1767 Ga0590075_026904 3300059424 Bacteria 1449
1768 Ga0587080_178597 3300059503 Bacteria 508
1769 Ga0587083_0027321 3300059505 Bacteria 1109
1770 Ga0587083_0223707 3300059505 Bacteria 549
1771 Ga0587085_041965 3300059506 Bacteria 801
1772 Ga0587086_092311 3300059507 Bacteria 548
1773 Ga0587069_156302 3300059642 Unclassified 510
1774 Ga0587075_152295 3300059644 Unclassified 501
1775 Ga0587079_201834 3300059647 Unclassified 543
1776 Ga0587114_105860 3300059655 Unclassified 554
1777 Ga0587111_0148806 3300060346 Bacteria 627
1778 Ga0501082_0190537 3300060353 Bacteria 1784
1779 Ga0501082_1078213 3300060353 Bacteria 702
1780 Ga0466962_0003839 3300061719 Bacteria 7180
1781 Ga0466962_0009515 3300061719 Bacteria 4660
1782 Ga0466962_0041609 3300061719 Bacteria 2198
1783 Ga0466962_0045217 3300061719 Bacteria 2105
1784 Ga0466962_0276730 3300061719 Unclassified 828
1785 Ga0530510_0007146 3300061734 Bacteria 7770
1786 Ga0530510_0035687 3300061734 Bacteria 3584
1787 Ga0530510_0226665 3300061734 Bacteria 1390
1788 Ga0530510_0238099 3300061734 Bacteria 1355
1789 Ga0530510_0405050 3300061734 Bacteria 1029
1790 Ga0530510_0921447 3300061734 Bacteria 668
1791 Ga0070700_100401125
1792 JGI24746J21847_1048614
1793 JGI24747J21853_1016955
1794 JGI24737J22298_10178942
1795 JGI24743J22301_10129190
1796 JGI24749J21850_1029563
1797 JGI24744J21845_10003592
1798 JGI24742J22300_10036530
1799 JGI24742J22300_10038740
1800 rootL2_10091144
1801 JGI25407J50210_10162221
1802 JGI25404J52841_10036040
1803 Ga0058860_10026662
1804 Ga0070658_10083898
1805 Ga0070658_10505778
1806 Ga0070676_10275815
1807 Ga0070683_100067793
1808 Ga0070690_100028453
1809 Ga0070670_101468243
1810 Ga0070677_10102324
1811 Ga0070677_10465098
1812 Ga0068869_100279703
1813 Ga0068869_100986668
1814 Ga0068869_101240832
1815 Ga0070666_10080620
1816 Ga0070680_100012321
1817 Ga0070680_100067747
1818 Ga0070680_100433055
1819 Ga0070680_100623767
1820 Ga0070680_100860718
1821 Ga0070680_101286639
1822 Ga0070682_100016493
1823 Ga0070682_100054134
1824 Ga0070682_100083590
1825 Ga0070682_100176053
1826 Ga0070682_101425419
1827 Ga0068868_100067114
1828 Ga0068868_100168372
1829 Ga0068868_100438390
1830 Ga0070660_100022594
1831 Ga0070660_100209107
1832 Ga0070660_100557123
1833 Ga0070660_100641984
1834 Ga0070660_100808125
1835 Ga0070660_101316321
1836 Ga0070689_100032361
1837 Ga0070689_100510160
1838 Ga0070691_10086670
1839 Ga0070687_101064337
1840 Ga0070687_101216447
1841 Ga0070661_100063325
1842 Ga0070661_100615782
1843 Ga0070661_100906759
1844 Ga0070661_101471510
1845 Ga0070692_10038074
1846 Ga0070668_100225980
1847 Ga0070669_100578565
1848 Ga0070669_100648897
1849 Ga0070669_101391106
1850 Ga0070675_100032562
1851 Ga0070675_100269191
1852 Ga0070675_100286508
1853 Ga0070671_100033028
1854 Ga0070671_100033063
1855 Ga0070671_100095902
1856 Ga0070671_101671482
1857 Ga0070674_100005001
1858 Ga0070674_100461248
1859 Ga0070673_100195570
1860 Ga0070673_100388952
1861 Ga0070673_100831512
1862 Ga0070673_100834817
1863 Ga0070673_101454465
1864 Ga0070688_100083124
1865 Ga0070688_101702608
1866 Ga0070659_100034381
1867 Ga0070659_100975608
1868 Ga0070659_101226432
1869 Ga0070667_101143302
1870 Ga0070703_10012916
1871 Ga0070703_10231426
1872 Ga0070703_10415645
1873 Ga0070709_10005698
1874 Ga0070709_10052234
1875 Ga0070709_10140929
1876 Ga0070709_10511238
1877 Ga0070709_10582036
1878 Ga0070714_100001612
1879 Ga0070714_100006822
1880 Ga0070714_100014480
1881 Ga0070714_100034986
1882 Ga0070714_100039441
1883 Ga0070714_100062196
1884 Ga0070714_100108329
1885 Ga0070714_100190311
1886 Ga0070714_100234528
1887 Ga0070714_100259453
1888 Ga0070714_100808327
1889 Ga0070713_100012818
1890 Ga0070713_100025980
1891 Ga0070713_100091162
1892 Ga0070713_100099214
1893 Ga0070713_100160590
1894 Ga0070713_100261316
1895 Ga0070713_100367076
1896 Ga0070713_100554481
1897 Ga0070713_100903245
1898 Ga0070713_101271457
1899 Ga0070710_10001306
1900 Ga0070710_10007464
1901 Ga0070710_10250259
1902 Ga0070710_10389972
1903 Ga0070710_10715643
1904 Ga0070710_10903341
1905 Ga0070710_10909301
1906 Ga0070701_10591086
1907 Ga0070701_10669392
1908 Ga0070701_10819569
1909 Ga0070711_100013670
1910 Ga0070711_100016837
1911 Ga0070711_100020555
1912 Ga0070711_100079548
1913 Ga0070711_100721311
1914 Ga0070711_100741224
1915 Ga0070711_101264160
1916 Ga0070705_100063810
1917 Ga0070705_100171300
1918 Ga0070705_100324585
1919 Ga0070705_100550422
1920 Ga0070705_100885761
1921 Ga0070705_101578107
1922 Ga0070700_100006069
1923 Ga0070700_100449788
1924 Ga0070700_100901886
1925 Ga0070700_101226974
1926 Ga0070694_100006994
1927 Ga0070694_100238868
1928 Ga0070694_100951663
1929 Ga0070694_101958939
1930 Ga0070708_100120073
1931 Ga0070708_100146282
1932 Ga0070708_100180628
1933 Ga0070708_100229094
1934 Ga0070708_100333774
1935 Ga0070708_100371625
1936 Ga0070708_100560246
1937 Ga0070708_101172842
1938 Ga0070708_101348185
1939 Ga0070708_101987053
1940 Ga0070663_100051962
1941 Ga0070678_100158820
1942 Ga0070678_100212788
1943 Ga0070678_100251223
1944 Ga0070678_100660657
1945 Ga0070678_101385879
1946 Ga0070678_101782474
1947 Ga0070662_100450671
1948 Ga0070662_101003088
1949 Ga0070681_10049123
1950 Ga0070681_10058032
1951 Ga0070681_10156680
1952 Ga0070681_10359146
1953 Ga0070681_11044004
1954 Ga0070681_11894441
1955 Ga0068867_100087002
1956 Ga0068867_100200655
1957 Ga0070685_10059828
1958 Ga0070706_100005941
1959 Ga0070706_100016460
1960 Ga0070706_100017080
1961 Ga0070706_100107671
1962 Ga0070706_100153993
1963 Ga0070706_100508344
1964 Ga0070706_100550886
1965 Ga0070706_101523629
1966 Ga0070706_101597429
1967 Ga0070706_101774773
1968 Ga0070707_100001116
1969 Ga0070707_100002726
1970 Ga0070707_100004597
1971 Ga0070707_100065690
1972 Ga0070707_100126263
1973 Ga0070707_100653591
1974 Ga0070707_100813928
1975 Ga0070707_101051699
1976 Ga0070707_101475020
1977 Ga0070707_101628331
1978 Ga0070707_101811471
1979 Ga0070698_100001818
1980 Ga0070698_100068930
1981 Ga0070698_100070866
1982 Ga0070698_100081594
1983 Ga0070698_100224119
1984 Ga0070698_100264670
1985 Ga0070698_100547204
1986 Ga0070698_100970761
1987 Ga0070698_101420625
1988 Ga0070699_100008589
1989 Ga0070699_100021417
1990 Ga0070699_100077528
1991 Ga0070699_100447006
1992 Ga0070699_100596007
1993 Ga0070699_100603673
1994 Ga0070699_101757676
1995 Ga0070679_100016558
1996 Ga0070679_100058865
1997 Ga0070679_100098276
1998 Ga0070679_100393218
1999 Ga0070679_100691282
2000 Ga0070679_100765106
2001 Ga0070679_100814414
2002 Ga0070679_101234373
2003 Ga0070684_100030393
2004 Ga0070684_100038632
2005 Ga0070684_100174055
2006 Ga0070684_100288905
2007 Ga0070684_100589108
2008 Ga0070684_101119842
2009 Ga0070697_100209001
2010 Ga0070697_100342388
2011 Ga0068853_100156719
2012 Ga0068853_101055956
2013 Ga0070672_100137555
2014 Ga0070672_100364294
2015 Ga0070672_102015564
2016 Ga0070686_100001847
2017 Ga0070695_100000005
2018 Ga0070695_100024161
2019 Ga0070695_100422896
2020 Ga0070695_100551843
2021 Ga0070695_100799124
2022 Ga0070696_100149142
2023 Ga0070696_100161223
2024 Ga0070696_100532324
2025 Ga0070696_100553588
2026 Ga0070696_100924306
2027 Ga0070696_101216703
2028 Ga0070693_100010553
2029 Ga0070693_100279221
2030 Ga0070693_100320990
2031 Ga0070693_100610165
2032 Ga0070665_100026234
2033 Ga0070665_100198118
2034 Ga0070665_101134344
2035 Ga0070704_100017479
2036 Ga0070704_100118053
2037 Ga0070704_100166190
2038 Ga0070704_100566368
2039 Ga0070704_101892852
2040 Ga0068855_100076265
2041 Ga0068855_100809736
2042 Ga0068855_100905259
2043 Ga0068855_101185266
2044 Ga0068855_101455072
2045 Ga0068855_101616811
2046 Ga0070664_100626125
2047 Ga0070664_101116768
2048 Ga0070664_102072552
2049 Ga0068857_100307574
2050 Ga0068857_101946336
2051 Ga0068854_100392018
2052 Ga0068854_101473511
2053 Ga0068856_100034234
2054 Ga0068856_100069684
2055 Ga0068856_100082822
2056 Ga0068856_100191552
2057 Ga0068856_100248954
2058 Ga0068856_100341259
2059 Ga0068856_100401206
2060 Ga0068856_100477401
2061 Ga0068856_100569816
2062 Ga0068856_100755407
2063 Ga0068856_100854556
2064 Ga0068856_100930482
2065 Ga0068856_102294030
2066 Ga0068856_102407227
2067 Ga0070702_100028675
2068 Ga0070702_100409223
2069 Ga0070702_100565110
2070 Ga0068852_100877005
2071 Ga0068852_101453369
2072 Ga0068859_100108825
2073 Ga0068864_100479883
2074 Ga0068864_100708168
2075 Ga0068866_10033457
2076 Ga0068866_10177917
2077 Ga0068861_100063568
2078 Ga0068861_101518106
2079 Ga0068851_10189284
2080 Ga0068870_10208524
2081 Ga0068863_100239616
2082 Ga0068863_100259997
2083 Ga0068863_102584730
2084 Ga0068858_100895036
2085 Ga0068860_100051850
2086 Ga0068860_100746623
2087 Ga0068862_100982905
2088 Ga0068862_101420508
2089 Ga0081455_10020437
2090 Ga0081455_10020619
2091 Ga0081455_10108857
2092 Ga0081455_10213301
2093 Ga0081455_10356485
2094 Ga0081538_10029358
2095 Ga0081538_10066336
2096 Ga0081538_10161978
2097 Ga0081538_10212734
2098 Ga0081540_1004661
2099 Ga0081540_1048522
2100 Ga0081540_1265075
2101 Ga0081539_10014095
2102 Ga0081539_10071976
2103 Ga0070717_10008509
2104 Ga0070717_10009572
2105 Ga0070717_10128713
2106 Ga0070717_10148806
2107 Ga0070717_10170441
2108 Ga0070717_10385383
2109 Ga0070717_10493056
2110 Ga0070717_10541002
2111 Ga0070717_10755438
2112 Ga0075365_10021013
2113 Ga0075365_10061283
2114 Ga0075368_10037491
2115 Ga0075364_10061285
2116 Ga0075364_10615757
2117 Ga0075432_10030528
2118 Ga0075432_10105773
2119 Ga0075432_10202231
2120 Ga0070715_10000411
2121 Ga0070715_10071420
2122 Ga0070716_100003224
2123 Ga0070716_100004028
2124 Ga0070716_100117441
2125 Ga0070716_100356144
2126 Ga0070716_100362605
2127 Ga0070716_100403046
2128 Ga0070716_100955972
2129 Ga0070716_101330834
2130 Ga0070716_101331103
2131 Ga0070716_101629147
2132 Ga0070712_100036499
2133 Ga0070712_100044870
2134 Ga0070712_100062735
2135 Ga0070712_100138374
2136 Ga0070712_100290695
2137 Ga0070712_100301792
2138 Ga0070712_101003101
2139 Ga0070712_101071532
2140 Ga0075362_10010441
2141 Ga0097621_100027775
2142 Ga0097621_100069381
2143 Ga0097621_100350317
2144 Ga0097621_102080695
2145 Ga0068871_100015524
2146 Ga0068871_100037623
2147 Ga0068871_100176749
2148 Ga0068871_100727559
2149 Ga0068871_100951470
2150 Ga0075428_100738413
2151 Ga0075428_100937113
2152 Ga0075428_101032923
2153 Ga0075428_101137444
2154 Ga0075428_102114165
2155 Ga0075428_102492511
2156 Ga0075430_100082886
2157 Ga0075431_100046434
2158 Ga0075431_100129178
2159 Ga0075431_100198360
2160 Ga0075431_100881721
2161 Ga0075431_101389175
2162 Ga0075431_102065393
2163 Ga0075433_10010520
2164 Ga0075433_10083582
2165 Ga0075433_10313819
2166 Ga0075433_10940014
2167 Ga0075433_10967560
2168 Ga0075434_100062436
2169 Ga0075434_100083511
2170 Ga0075434_100114729
2171 Ga0075434_100263741
2172 Ga0075434_101326636
2173 Ga0075434_101335367
2174 Ga0075434_101879194
2175 Ga0075434_101957542
2176 Ga0075434_102540257
2177 Ga0075429_100462076
2178 Ga0075429_100731047
2179 Ga0075429_101467374
2180 Ga0075429_101778150
2181 Ga0068865_100002569
2182 Ga0068865_100211781
2183 Ga0068865_100486787
2184 Ga0068865_102183233
2185 Ga0075436_100005290
2186 Ga0075436_100014092
2187 Ga0075436_100115804
2188 Ga0075436_100408801
2189 Ga0075436_100767237
2190 Ga0075436_101090722
2191 Ga0097620_100108824
2192 Ga0075435_100029772
2193 Ga0075435_100059064
2194 Ga0075435_100123865
2195 Ga0075435_100462203
2196 Ga0075435_100616040
2197 Ga0075435_100675940
2198 Ga0075435_100706151
2199 Ga0075435_101049143
2200 Ga0075435_101582264
2201 Ga0099794_10345463
2202 Ga0099795_10153195
2203 Ga0105251_10465950
2204 Ga0105240_10026970
2205 Ga0105240_10086355
2206 Ga0105240_10466016
2207 Ga0105240_10714686
2208 Ga0105240_11235172
2209 Ga0105240_11912422
2210 Ga0111539_10026259
2211 Ga0111539_10311132
2212 Ga0111539_10422037
2213 Ga0105245_10006470
2214 Ga0105245_10016352
2215 Ga0105245_10032981
2216 Ga0105245_10093167
2217 Ga0105245_10217624
2218 Ga0105245_10647743
2219 Ga0105245_10920262
2220 Ga0105245_11112558
2221 Ga0105245_11173832
2222 Ga0105247_10039193
2223 Ga0105247_10041124
2224 Ga0105247_10455354
2225 Ga0105247_10628807
2226 Ga0114129_10014214
2227 Ga0114129_10028533
2228 Ga0114129_10176020
2229 Ga0114129_10333560
2230 Ga0114129_10443997
2231 Ga0114129_11481715
2232 Ga0114129_12161052
2233 Ga0114129_12273645
2234 Ga0114129_12636026
2235 Ga0105243_10006582
2236 Ga0105243_10176379
2237 Ga0105243_10472913
2238 Ga0105243_10920157
2239 Ga0105243_11232722
2240 Ga0105243_11766009
2241 Ga0105241_10010431
2242 Ga0105241_10225695
2243 Ga0105241_11189493
2244 Ga0105242_10189764
2245 Ga0105242_10232541
2246 Ga0105242_10611090
2247 Ga0105242_11904192
2248 Ga0105242_12037709
2249 Ga0105242_12283825
2250 Ga0105248_10049097
2251 Ga0105248_10305897
2252 Ga0105248_10322552
2253 Ga0105248_10970970
2254 Ga0105248_11825226
2255 Ga0105248_11914902
2256 Ga0105248_12234074
2257 Ga0105248_12822677
2258 Ga0105237_10016127
2259 Ga0105237_10082158
2260 Ga0105237_11400414
2261 Ga0105237_11677159
2262 Ga0105238_10270449
2263 Ga0105249_10530734
2264 Ga0105249_11370788
2265 Ga0105249_11793470
2266 Ga0099796_10246869
2267 Ga0105239_10047664
2268 Ga0105239_10082773
2269 Ga0105239_10896385
2270 Ga0105239_10973953
2271 Ga0105239_11374835
2272 Ga0105239_13455417
2273 Ga0105246_10015657
2274 Ga0105246_10154906
2275 Ga0105246_10155850
2276 Ga0105246_10421196
2277 Ga0105246_10447504
2278 Ga0105246_11429931
2279 Ga0105246_11560348
2280 Ga0157336_1020165
2281 Ga0157318_1024722
2282 Ga0157321_1030441
2283 Ga0157335_1004864
2284 Ga0157319_1008123
2285 Ga0157347_1011762
2286 Ga0157339_1019802
2287 Ga0157342_1022454
2288 Ga0157315_1027696
2289 Ga0157326_1040471
2290 Ga0157373_10274124
2291 Ga0157373_10361112
2292 Ga0157373_10885394
2293 Ga0157371_10044697
2294 Ga0157371_10343760
2295 Ga0157371_10377891
2296 Ga0157370_10189800
2297 Ga0157370_10325820
2298 Ga0157370_10872670
2299 Ga0157370_11020394
2300 Ga0157370_11229979
2301 Ga0157370_11394070
2302 Ga0157369_10080357
2303 Ga0157369_10120813
2304 Ga0157369_10138075
2305 Ga0157369_10269526
2306 Ga0157369_10726452
2307 Ga0157369_11010926
2308 Ga0157369_11128225
2309 Ga0157369_12651350
2310 Ga0157374_10020635
2311 Ga0157374_10095491
2312 Ga0157374_10173495
2313 Ga0157374_10268809
2314 Ga0157374_11308648
2315 Ga0157378_10086458
2316 Ga0157378_11253976
2317 Ga0157378_11257669
2318 Ga0157378_11848308
2319 Ga0157378_11947405
2320 Ga0163162_10051975
2321 Ga0163162_10322659
2322 Ga0163162_10876998
2323 Ga0163162_11863027
2324 Ga0157372_10160028
2325 Ga0157372_10196442
2326 Ga0157372_10276342
2327 Ga0157372_10413923
2328 Ga0157372_10502340
2329 Ga0157372_10944775
2330 Ga0157372_11030418
2331 Ga0157372_11511173
2332 Ga0157375_10006851
2333 Ga0157375_10009400
2334 Ga0157375_10374897
2335 Ga0157375_11214135
2336 Ga0157375_13660397
2337 Ga0163163_10687593
2338 Ga0163163_12793379
2339 Ga0157380_10059961
2340 Ga0157380_10342071
2341 Ga0157380_11218644
2342 Ga0157380_11419542
2343 Ga0182008_10006258
2344 Ga0182008_10062492
2345 Ga0182008_10084390
2346 Ga0182008_10471947
2347 Ga0182008_10544273
2348 Ga0182008_10813649
2349 Ga0157377_10004537
2350 Ga0157377_10079857
2351 Ga0157377_10550329
2352 Ga0157379_10130378
2353 Ga0157379_10963677
2354 Ga0157379_11507908
2355 Ga0157379_11532306
2356 Ga0157376_10012855
2357 Ga0157376_10149906
2358 Ga0157376_10195967
2359 Ga0157376_10421366
2360 Ga0157376_10841849
2361 Ga0157376_12005172
2362 Ga0157376_12624430
2363 Ga0182006_1002844
2364 Ga0182006_1038260
2365 Ga0182006_1119563
2366 Ga0182007_10055135
2367 Ga0182007_10300293
2368 Ga0182005_1135682
2369 Ga0182005_1183412
2370 Ga0163161_10333234
2371 Ga0163161_10528693
2372 Ga0163161_10989445
2373 Ga0197907_10415719
2374 Ga0197907_10599385
2375 Ga0197907_10712153
2376 Ga0197907_10912859
2377 Ga0197907_10976367
2378 Ga0197907_11296060
2379 Ga0206356_10713961
2380 Ga0206356_10765291
2381 Ga0206356_11023176
2382 Ga0206355_1068348
2383 Ga0206355_1148949
2384 Ga0206355_1158685
2385 Ga0206355_1187411
2386 Ga0206351_10128392
2387 Ga0206351_10481373
2388 Ga0206352_11289281
2389 Ga0206350_11155711
2390 Ga0206350_11268713
2391 Ga0206350_11419901
2392 Ga0206354_10205280
2393 Ga0206354_10380699
2394 Ga0206354_10993587
2395 Ga0206354_11373038
2396 Ga0206354_11465929
2397 Ga0206354_11603311
2398 Ga0206353_10651477
2399 Ga0206353_11608935
2400 Ga0206353_11750180
2401 Ga0206353_11814207
2402 Ga0154015_1105780
2403 Ga0213874_10085357
2404 Ga0224712_10061397
2405 Ga0224712_10093615
2406 Ga0224712_10223881
2407 Ga0224712_10532951
2408 Ga0224712_10533197
2409 Ga0207653_10075233
2410 Ga0207682_10102324
2411 Ga0207682_10421608
2412 Ga0207692_10010787
2413 Ga0207692_10019501
2414 Ga0207692_10094073
2415 Ga0207692_10240974
2416 Ga0207692_10262257
2417 Ga0207692_10285656
2418 Ga0207692_10327388
2419 Ga0207692_10343219
2420 Ga0207692_10838051
2421 Ga0207642_10023373
2422 Ga0207642_10334657
2423 Ga0207710_10085677
2424 Ga0207710_10180769
2425 Ga0207710_10188880
2426 Ga0207688_10084658
2427 Ga0207688_10349015
2428 Ga0207688_10524598
2429 Ga0207688_10596282
2430 Ga0207680_10469580
2431 Ga0207647_10098484
2432 Ga0207647_10652721
2433 Ga0207685_10200136
2434 Ga0207699_10004728
2435 Ga0207699_10012388
2436 Ga0207699_10074686
2437 Ga0207699_10168694
2438 Ga0207699_10207042
2439 Ga0207699_10462396
2440 Ga0207645_10261918
2441 Ga0207645_10637199
2442 Ga0207643_10063461
2443 Ga0207705_10542226
2444 Ga0207705_10562132
2445 Ga0207705_10929291
2446 Ga0207705_11429295
2447 Ga0207684_10008813
2448 Ga0207684_10030845
2449 Ga0207684_10143351
2450 Ga0207684_10342575
2451 Ga0207684_10605041
2452 Ga0207684_11129376
2453 Ga0207654_10083163
2454 Ga0207654_10236968
2455 Ga0207707_10018185
2456 Ga0207707_10092180
2457 Ga0207707_10138889
2458 Ga0207707_10478112
2459 Ga0207707_10488359
2460 Ga0207707_11600806
2461 Ga0207695_10173737
2462 Ga0207695_10181618
2463 Ga0207695_10470553
2464 Ga0207695_10807905
2465 Ga0207695_11088388
2466 Ga0207695_11409856
2467 Ga0207671_10031915
2468 Ga0207671_10265899
2469 Ga0207693_10000807
2470 Ga0207693_10000924
2471 Ga0207693_10002104
2472 Ga0207693_10041055
2473 Ga0207693_10117679
2474 Ga0207693_10165785
2475 Ga0207693_10703607
2476 Ga0207693_10863242
2477 Ga0207663_10009751
2478 Ga0207663_10015616
2479 Ga0207663_10030655
2480 Ga0207663_10085866
2481 Ga0207663_10120700
2482 Ga0207663_11264317
2483 Ga0207660_10458774
2484 Ga0207660_10480598
2485 Ga0207660_10675849
2486 Ga0207660_10713297
2487 Ga0207660_10759840
2488 Ga0207662_10090539
2489 Ga0207662_10408574
2490 Ga0207657_10000486
2491 Ga0207657_10103420
2492 Ga0207657_10236712
2493 Ga0207657_10402986
2494 Ga0207657_10518444
2495 Ga0207649_10539432
2496 Ga0207649_10914043
2497 Ga0207649_11614115
2498 Ga0207652_10027118
2499 Ga0207652_10105223
2500 Ga0207652_10730436
2501 Ga0207652_10766881
2502 Ga0207646_10001597
2503 Ga0207646_10005168
2504 Ga0207646_10007573
2505 Ga0207646_10110622
2506 Ga0207646_10200810
2507 Ga0207646_10373300
2508 Ga0207646_10480098
2509 Ga0207646_10535826
2510 Ga0207646_11219829
2511 Ga0207646_11309568
2512 Ga0207646_11661720
2513 Ga0207646_11881329
2514 Ga0207681_10079267
2515 Ga0207694_10134949
2516 Ga0207650_11268989
2517 Ga0207659_10065504
2518 Ga0207659_10140631
2519 Ga0207687_10055681
2520 Ga0207687_10134605
2521 Ga0207687_10245456
2522 Ga0207687_10289592
2523 Ga0207687_10635357
2524 Ga0207700_10000001
2525 Ga0207700_10020161
2526 Ga0207700_10067077
2527 Ga0207700_10071397
2528 Ga0207700_10187646
2529 Ga0207700_10381320
2530 Ga0207700_10538567
2531 Ga0207700_11567284
2532 Ga0207664_10009662
2533 Ga0207664_10039265
2534 Ga0207664_10053974
2535 Ga0207664_10067139
2536 Ga0207664_10111665
2537 Ga0207664_10128895
2538 Ga0207664_10138713
2539 Ga0207664_10282510
2540 Ga0207664_10347889
2541 Ga0207664_10384019
2542 Ga0207664_11170519
2543 Ga0207664_11193741
2544 Ga0207644_10062612
2545 Ga0207644_10066090
2546 Ga0207644_10303177
2547 Ga0207644_10587920
2548 Ga0207690_10107160
2549 Ga0207690_10456443
2550 Ga0207690_10811228
2551 Ga0207706_10314683
2552 Ga0207686_10066786
2553 Ga0207686_10076457
2554 Ga0207686_10679632
2555 Ga0207686_10680495
2556 Ga0207686_10683756
2557 Ga0207709_10268584
2558 Ga0207709_10279248
2559 Ga0207709_10394335
2560 Ga0207709_10763306
2561 Ga0207670_10051744
2562 Ga0207670_11107102
2563 Ga0207669_10925531
2564 Ga0207669_11908502
2565 Ga0207704_10006080
2566 Ga0207704_10153130
2567 Ga0207704_10163892
2568 Ga0207665_10000058
2569 Ga0207665_10001956
2570 Ga0207665_10010709
2571 Ga0207665_10116071
2572 Ga0207665_10485646
2573 Ga0207665_10499185
2574 Ga0207665_10550787
2575 Ga0207665_10870171
2576 Ga0207665_11102259
2577 Ga0207691_10093311
2578 Ga0207691_10376604
2579 Ga0207691_11230497
2580 Ga0207711_10023157
2581 Ga0207711_10154130
2582 Ga0207711_10223640
2583 Ga0207711_10494608
2584 Ga0207711_10527299
2585 Ga0207711_10910387
2586 Ga0207689_10052839
2587 Ga0207689_10474564
2588 Ga0207689_11324315
2589 Ga0207661_10066647
2590 Ga0207661_10179085
2591 Ga0207661_10374989
2592 Ga0207661_10506112
2593 Ga0207661_11030941
2594 Ga0207661_12121611
2595 Ga0207679_10879573
2596 Ga0207679_11371973
2597 Ga0207679_12084956
2598 Ga0207667_10721663
2599 Ga0207667_11060276
2600 Ga0207667_11545816
2601 Ga0207667_11848469
2602 Ga0207651_10278459
2603 Ga0207651_10376333
2604 Ga0207712_10226975
2605 Ga0207668_10127346
2606 Ga0207640_10840104
2607 Ga0207640_10867086
2608 Ga0207658_12106996
2609 Ga0207677_10099472
2610 Ga0207677_10146512
2611 Ga0207677_11165409
2612 Ga0207677_11412994
2613 Ga0207703_10147797
2614 Ga0207639_10165616
2615 Ga0207678_10020158
2616 Ga0207678_11748936
2617 Ga0207708_10029459
2618 Ga0207708_10142622
2619 Ga0207708_10310172
2620 Ga0207708_10478009
2621 Ga0207708_10783262
2622 Ga0207708_11274288
2623 Ga0207708_11893952
2624 Ga0207702_10005430
2625 Ga0207702_10133803
2626 Ga0207702_10175527
2627 Ga0207702_10251346
2628 Ga0207702_10337847
2629 Ga0207702_10346138
2630 Ga0207702_10365103
2631 Ga0207702_10774701
2632 Ga0207702_10805454
2633 Ga0207702_11349379
2634 Ga0207702_11788227
2635 Ga0207702_12452752
2636 Ga0207641_10349890
2637 Ga0207641_10741395
2638 Ga0207648_10001479
2639 Ga0207648_10414264
2640 Ga0207676_10829413
2641 Ga0207674_10459809
2642 Ga0207674_11432069
2643 Ga0207675_100045622
2644 Ga0207675_100648569
2645 Ga0207683_10000336
2646 Ga0207683_10000966
2647 Ga0207683_10293865
2648 Ga0207683_10440091
2649 Ga0207683_10451140
2650 Ga0207683_11170572
2651 Ga0209966_1053207
2652 Ga0209813_10171589
2653 Ga0209974_10460877
2654 Ga0207428_10006507
2655 Ga0207428_10029205
2656 Ga0207428_10195808
2657 Ga0207428_10258429
2658 Ga0207428_10635776
2659 Ga0207428_10825408
2660 Ga0268266_10379883
2661 Ga0268266_10836009
2662 Ga0268266_11005121
2663 Ga0268265_10376761
2664 Ga0268265_11977020
2665 Ga0268264_10052067
2666 Ga0265337_1067003
2667 Ga0265326_10120259
2668 Ga0265326_10144018
2669 Ga0265319_1016012
2670 Ga0265319_1156879
2671 Ga0265334_10014972
2672 Ga0265318_10369950
2673 Ga0265323_10173361
2674 Ga0265322_10216270
2675 Ga0265336_10001679
2676 Ga0265336_10029316
2677 Ga0265338_10003865
2678 Ga0265338_10004114
2679 Ga0265338_10097542
2680 Ga0265324_10148462
2681 Ga0265330_10005447
2682 Ga0265339_10003346
2683 Ga0265327_10046422
2684 Ga0307408_100276341
2685 Ga0265313_10009625
2686 Ga0265314_10371032
2687 Ga0265342_10022365
2688 Ga0307413_10447126
2689 Ga0307406_10734701
2690 Ga0307407_10030113
2691 Ga0307412_10363106
2692 Ga0307412_10644355
2693 Ga0307412_11662510
2694 Ga0307409_100051516
2695 Ga0307409_100176643
2696 Ga0307409_100230698
2697 Ga0307409_100503556
2698 Ga0307409_100662188
2699 Ga0307409_100926126
2700 Ga0307409_101396935
2701 Ga0307409_102511669
2702 Ga0307409_102966286
2703 Ga0307416_100450949
2704 Ga0307416_100550001
2705 Ga0307416_100629888
2706 Ga0307416_101078898
2707 Ga0307414_11081184
2708 Ga0307414_11743633
2709 Ga0307414_11926713
2710 Ga0307415_100194861
2711 Ga0307415_100291982
2712 Ga0307415_100930597
2713 Ga0316583_10258442
2714 Ga0373948_0148597
2715 Ga0373959_0054848
2716 Ga0373959_0065496
2717 Ga0373938_0196926
2718 Ga0373928_0248298
2719 Ga0373929_0038574
2720 Ga0373929_0077209
2721 Ga0373934_0172223
2722 Ga0373934_0483998
2723 Ga0373940_0030290
2724 Ga0373940_0055002
2725 Ga0373940_0259277
2726 Ga0373949_0086305
2727 Ga0373949_0101023
2728 Ga0373951_0282638
2729 Ga0373932_0015407
2730 Ga0373936_0479861
2731 Ga0373939_0269160
2732 Ga0373941_0043704
2733 Ga0373941_0074037
2734 Ga0373941_0353631
2735 Ga0373941_0354939
2736 Ga0373953_0196457
2737 Ga0373953_0479189
2738 Ga0373957_0212255
2739 Ga0373960_0195177
2740 Ga0373960_0240966
2741 Ga0373943_0139427
2742 Ga0373943_0141453
2743 Ga0373943_0521122
2744 Ga0373946_0154898
2745 Ga0373955_0093261
2746 Ga0373942_0034443
2747 Ga0373942_0045711
2748 Ga0373961_0034707
2749 Ga0373961_0325153
2750 Ga0373962_0073173
2751 Ga0373924_0098360
2752 Ga0373931_0019574
2753 Ga0373931_0033045
2754 Ga0373931_0144160
2755 Ga0373931_0345405
2756 Ga0373931_0380598
2757 Ga0373931_0422794
2758 Ga0373931_0455315
2759 Ga0373935_0052968
2760 Ga0373935_0837623
2761 Ga0373933_0309184
2762 Ga0373933_0588774
2763 Ga0373947_0190601
2764 Ga0373947_0548662
2765 Ga0373937_0002464
2766 Ga0373937_0233521
2767 Ga0373937_0271071
2768 Ga0373925_0136982
2769 Ga0373925_0204883
2770 Ga0373925_0346253
2771 Ga0395899_0031469
2772 Ga0395899_0034136
2773 Ga0395899_0043891
2774 Ga0395899_0057550
2775 Ga0395899_0065359
2776 Ga0395899_0087833
2777 Ga0395899_0143943
2778 Ga0395899_0237483
2779 Ga0395899_0259443
2780 Ga0395899_0288125
2781 Ga0395899_0352059
2782 Ga0395899_0495672
2783 Ga0395899_0554141
2784 Ga0395899_0575662
2785 Ga0395899_0929114
2786 Ga0395900_0002317
2787 Ga0395900_0003596
2788 Ga0395900_0005500
2789 Ga0395900_0006561
2790 Ga0395900_0007355
2791 Ga0395900_0030414
2792 Ga0395900_0092124
2793 Ga0395900_0138465
2794 Ga0395900_0161221
2795 Ga0395900_0163977
2796 Ga0395900_0186802
2797 Ga0395900_0225896
2798 Ga0395900_0318042
2799 Ga0395900_0419059
2800 Ga0395900_0526589
2801 Ga0395900_0810967
2802 Ga0395900_0976638
2803 Ga0395900_1347952
2804 Ga0395900_1513732
2805 Ga0395898_0002928
2806 Ga0395898_0005497
2807 Ga0395898_0007699
2808 Ga0395898_0011504
2809 Ga0395898_0017360
2810 Ga0395898_0017648
2811 Ga0395898_0044942
2812 Ga0395898_0072989
2813 Ga0395898_0076407
2814 Ga0395898_0077931
2815 Ga0395898_0131358
2816 Ga0395898_0142627
2817 Ga0395898_0267353
2818 Ga0395898_0327083
2819 Ga0395898_0350929
2820 Ga0395898_0379529
2821 Ga0395898_0757608
2822 Ga0395898_1409451
2823 Ga0395898_1948504
2824 Ga0395905_0000698
2825 Ga0395905_0002827
2826 Ga0395905_0004158
2827 Ga0395905_0005462
2828 Ga0395905_0010671
2829 Ga0395905_0023407
2830 Ga0395905_0029867
2831 Ga0395905_0079110
2832 Ga0395905_0089827
2833 Ga0395905_0111130
2834 Ga0395905_0336919
2835 Ga0395905_1018305
2836 Ga0395901_0001102
2837 Ga0395901_0002126
2838 Ga0395901_0002813
2839 Ga0395901_0007390
2840 Ga0395901_0012117
2841 Ga0395901_0019191
2842 Ga0395901_0042603
2843 Ga0395901_0043416
2844 Ga0395901_0087341
2845 Ga0395901_0088539
2846 Ga0395901_0099635
2847 Ga0395901_0150684
2848 Ga0395901_0191471
2849 Ga0395901_0248811
2850 Ga0395901_0317611
2851 Ga0395901_0338879
2852 Ga0395901_0367396
2853 Ga0395901_0389792
2854 Ga0395901_0447404
2855 Ga0395901_0634942
2856 Ga0395901_1098888
2857 Ga0395901_1153524
2858 Ga0395901_1258516
2859 Ga0395901_1744204
2860 Ga0395901_2080438
2861 Ga0436363_0575511
2862 Ga0439438_092942
2863 Ga0439461_0002163
2864 Ga0439461_0030378
2865 Ga0439466_0156092
2866 Ga0439465_0094353
2867 Ga0451789_0931210
2868 Ga0451800_0626990
2869 Ga0451800_1510129
2870 Ga0451807_1287325
2871 Ga0451833_0099372
2872 Ga0451839_0645495
2873 Ga0451847_0684522
2874 Ga0451849_0924877
2875 Ga0451853_1843922
2876 Ga0451853_1871389
2877 Ga0439431_0138357
2878 Ga0439433_0101055
2879 Ga0439437_003758
2880 Ga0439441_011079
2881 Ga0439448_0020940
2882 Ga0439448_0023535
2883 Ga0439448_0332760
2884 Ga0439450_036950
2885 Ga0439455_0025882
2886 Ga0439455_0030751
2887 Ga0439463_026392
2888 Ga0450915_010080
2889 Ga0450917_003609
2890 Ga0450923_036325
2891 Ga0450888_003542
2892 Ga0450892_025811
2893 Ga0450900_079428
2894 Ga0450910_037728
2895 Ga0439446_0001843
2896 Ga0439458_0001865
2897 Ga0439434_0011303
2898 Ga0439434_0273306
2899 Ga0439444_0020048
2900 Ga0439459_0088222
2901 Ga0439459_0147883
2902 Ga0439460_0050102
2903 Ga0439460_0226440
2904 Ga0450916_023532
2905 Ga0450918_027058
2906 Ga0439440_0203594
2907 Ga0439440_0295012
2908 Ga0466969_0000416
2909 Ga0466969_0183031
2910 Ga0466972_0021651
2911 Ga0466972_0118110
2912 Ga0466972_0605835
2913 Ga0466965_0012753
2914 Ga0466965_0066969
2915 Ga0466965_0316550
2916 Ga0466966_0586673
2917 Ga0466961_0000463
2918 Ga0466961_0002397
2919 Ga0466961_0018213
2920 Ga0466961_0057813
2921 Ga0466961_0137595
2922 Ga0466961_0170653
2923 Ga0466963_0000055
2924 Ga0466963_0004827
2925 Ga0466963_0012434
2926 Ga0466963_0015842
2927 Ga0466963_0022743
2928 Ga0466963_0023942
2929 Ga0466963_0033848
2930 Ga0466963_0050054
2931 Ga0466963_0064761
2932 Ga0466963_0072063
2933 Ga0466963_0100496
2934 Ga0466963_0226574
2935 Ga0466963_0252889
2936 Ga0466963_0296732
2937 Ga0466963_0431087
2938 Ga0466963_1132171
2939 Ga0466964_0009411
2940 Ga0466964_0011536
2941 Ga0466964_0018416
2942 Ga0466964_0021550
2943 Ga0466964_0043695
2944 Ga0466964_0044614
2945 Ga0466964_0051059
2946 Ga0466964_0056924
2947 Ga0466964_0074116
2948 Ga0466964_0151865
2949 Ga0466964_0166246
2950 Ga0466964_0210594
2951 Ga0466964_0444768
2952 Ga0453684_0702652
2953 Ga0466971_0006844
2954 Ga0466971_0014728
2955 Ga0466971_0042499
2956 Ga0466971_0149105
2957 Ga0466971_0235099
2958 Ga0466971_0259620
2959 Ga0466971_0303512
2960 Ga0466971_0409493
2961 Ga0466968_0000852
2962 Ga0466968_0003464
2963 Ga0466968_0019156
2964 Ga0466968_0070119
2965 Ga0466968_0161887
2966 Ga0466968_0590580
2967 Ga0466970_0027540
2968 Ga0466970_0038297
2969 Ga0466970_0227888
2970 Ga0466970_0298449
2971 Ga0466970_0575684
2972 Ga0466957_0005164
2973 Ga0466957_0006754
2974 Ga0466957_0030978
2975 Ga0466957_0073228
2976 Ga0466957_0233465
2977 Ga0466957_0729073
2978 Ga0466960_0028038
2979 Ga0466960_0094462
2980 Ga0466960_0168260
2981 Ga0466960_0201029
2982 Ga0466960_0208085
2983 Ga0466960_0276693
2984 Ga0466960_0895369
2985 Ga0466960_0942844
2986 Ga0466959_0007192
2987 Ga0466959_0012300
2988 Ga0466959_0093916
2989 Ga0466959_0135018
2990 Ga0466959_0411749
2991 Ga0466959_0468675
2992 Ga0466959_1012098
2993 Ga0451576_0140420
2994 Ga0451576_0759758
2995 Ga0451576_1217744
2996 Ga0466958_0003853
2997 Ga0466958_0009051
2998 Ga0466958_0011141
2999 Ga0466958_0037204
3000 Ga0466958_0125048
3001 Ga0466958_0149446
3002 Ga0466958_0272504
3003 Ga0466958_0314234
3004 Ga0466958_0343730
3005 Ga0466958_0492483
3006 Ga0466967_0001501
3007 Ga0466967_0010040
3008 Ga0466967_0012011
3009 Ga0466967_0013350
3010 Ga0466967_0014574
3011 Ga0466967_0015086
3012 Ga0466967_0026921
3013 Ga0466967_0046495
3014 Ga0466967_0081187
3015 Ga0466967_0141208
3016 Ga0466967_0143713
3017 Ga0466967_0154470
3018 Ga0466967_0155326
3019 Ga0466967_0190169
3020 Ga0466967_0195071
3021 Ga0466967_0203512
3022 Ga0466967_0473293
3023 Ga0466967_0474254
3024 Ga0466967_0557080
3025 Ga0466967_0678245
3026 Ga0466967_0742320
3027 Ga0466967_1416322
3028 Ga0466967_1427188
3029 Ga0495627_192704
3030 Ga0495592_0000082
3031 Ga0495592_0044892
3032 Ga0495592_0134802
3033 Ga0495592_0296900
3034 Ga0495592_0388926
3035 Ga0495603_0012630
3036 Ga0495603_0023587
3037 Ga0495603_0047153
3038 Ga0495603_0452266
3039 Ga0495629_0150626
3040 Ga0495629_0217503
3041 Ga0495641_0033810
3042 Ga0495641_0035320
3043 Ga0495641_0040645
3044 Ga0495641_0106426
3045 Ga0495641_0119238
3046 Ga0495641_0164231
3047 Ga0495651_0000080
3048 Ga0495653_0001358
3049 Ga0495653_0136939
3050 Ga0495653_0248072
3051 Ga0495580_0473412
3052 Ga0495580_0547410
3053 Ga0495582_0063737
3054 Ga0495582_0075739
3055 Ga0495582_0075882
3056 Ga0495582_0097235
3057 Ga0495582_0141954
3058 Ga0495582_0406229
3059 Ga0495582_0409955
3060 Ga0495605_0071165
3061 Ga0495605_0194995
3062 Ga0495605_0415478
3063 Ga0495639_0198301
3064 Ga0495662_0032448
3065 Ga0495662_0081926
3066 Ga0495662_0183815
3067 Ga0495664_0201599
3068 Ga0495664_0297874
3069 Ga0495584_0006888
3070 Ga0495584_0137112
3071 Ga0495584_0188904
3072 Ga0495584_0510498
3073 Ga0495584_0608259
3074 Ga0495585_0026440
3075 Ga0495585_0173844
3076 Ga0495585_0207059
3077 Ga0495594_0080117
3078 Ga0495594_0309286
3079 Ga0495594_0541916
3080 Ga0495596_0068080
3081 Ga0495596_0074307
3082 Ga0495596_0090321
3083 Ga0495596_0206579
3084 Ga0495596_0225540
3085 Ga0495607_0017149
3086 Ga0495607_0383903
3087 Ga0495608_0000669
3088 Ga0495608_0062795
3089 Ga0495608_0332216
3090 Ga0495608_0339871
3091 Ga0495608_0382795
3092 Ga0495616_0155699
3093 Ga0495618_0055679
3094 Ga0495618_0293440
3095 Ga0495618_0924765
3096 Ga0495620_0200860
3097 Ga0495628_0000292
3098 Ga0495628_0181774
3099 Ga0495628_0939071
3100 Ga0495630_0022995
3101 Ga0495630_0052669
3102 Ga0495630_0222274
3103 Ga0495630_0326377
3104 Ga0495630_0449794
3105 Ga0495630_0932770
3106 Ga0495631_0120537
3107 Ga0495631_0217528
3108 Ga0495637_0209108
3109 Ga0495637_0225667
3110 Ga0495637_0346992
3111 Ga0495644_0020660
3112 Ga0495644_0074931
3113 Ga0495644_0139131
3114 Ga0495663_0021460
3115 Ga0495663_0043246
3116 Ga0495663_0382055
3117 Ga0495666_0139807
3118 Ga0495652_0000847
3119 Ga0495652_0097098
3120 Ga0495652_0310659
3121 Ga0495665_0171582
3122 Ga0495665_0541543
3123 Ga0495640_0016924
3124 Ga0495640_0100761
3125 Ga0495640_0488913
3126 Ga0495586_0057390
3127 Ga0495587_0000060
3128 Ga0495587_0087898
3129 Ga0495609_0041212
3130 Ga0495609_0098830
3131 Ga0495609_0177073
3132 Ga0495609_0276571
3133 Ga0495645_0000038
3134 Ga0495645_0079531
3135 Ga0495622_0149429
3136 Ga0495667_0073429
3137 Ga0495667_0202357
3138 Ga0495667_0226025
3139 Ga0495656_0007613
3140 Ga0495656_0048507
3141 Ga0495656_0089683
3142 Ga0495656_0324951
3143 Ga0495656_0694494
3144 Ga0495634_0027105
3145 Ga0495634_0186140
3146 Ga0495634_0370747
3147 Ga0495611_0056994
3148 Ga0495635_0960076
3149 Ga0495659_0016528
3150 Ga0495659_0210461
3151 Ga0495659_0498739
3152 Ga0495661_0153986
3153 Ga0495661_0251189
3154 Ga0495588_0320285
3155 Ga0495588_0765290
3156 Ga0495657_0072449
3157 Ga0495657_0870746
3158 Ga0495599_0000402
3159 Ga0495599_0109298
3160 Ga0495599_0748211
3161 Ga0495623_0000442
3162 Ga0495623_0115030
3163 Ga0495623_0618460
3164 Ga0495646_0001935
3165 Ga0495646_0034453
3166 Ga0495647_0081820
3167 Ga0495647_0368004
3168 Ga0495647_0404826
3169 Ga0495658_0091213
3170 Ga0495658_0331320
3171 Ga0495658_1114994
3172 Ga0495669_0080687
3173 Ga0495669_0273532
3174 Ga0495613_0095654
3175 Ga0495613_0184169
3176 Ga0495613_0299055
3177 Ga0495624_0016447
3178 Ga0495624_0073326
3179 Ga0495624_0081739
3180 Ga0495624_0084327
3181 Ga0495624_0332030
3182 Ga0495670_0587640
3183 Ga0495670_0664294
3184 Ga0495670_0739145
3185 Ga0495649_0537186
3186 Ga0495589_0118734
3187 Ga0495589_0147174
3188 Ga0495600_0194009
3189 Ga0495581_0739244
3190 Ga0495604_0000043
3191 Ga0495604_0124988
3192 Ga0495604_0518901
3193 Ga0495604_0896618
3194 Ga0495636_0031764
3195 Ga0495636_0186929
3196 Ga0495674_0044574
3197 Ga0495674_0126352
3198 Ga0495674_0868492
3199 Ga0495674_1134840
3200 Ga0495676_0019485
3201 Ga0495676_0040517
3202 Ga0495676_0095220
3203 Ga0495676_0123134
3204 Ga0495676_0330612
3205 Ga0495676_0477333
3206 Ga0495676_0744133
3207 Ga0495680_0006459
3208 Ga0495680_0171499
3209 Ga0495680_0352631
3210 Ga0495680_0487984
3211 Ga0495680_0604546
3212 Ga0495680_0622766
3213 Ga0495680_0877799
3214 Ga0495680_0972480
3215 Ga0495675_0000827
3216 Ga0495675_0143261
3217 Ga0495675_0825353
3218 Ga0495677_0067675
3219 Ga0495677_0111106
3220 Ga0495684_0094459
3221 Ga0495684_0137542
3222 Ga0495684_0154760
3223 Ga0495684_0820352
3224 Ga0495593_0093855
3225 Ga0495602_0000536
3226 Ga0495602_0153916
3227 Ga0495602_0579235
3228 Ga0495614_0184469
3229 Ga0495614_0543121
3230 Ga0495614_0664212
3231 Ga0495626_0114301
3232 Ga0496100_0027778
3233 Ga0496100_0087791
3234 Ga0496100_0091814
3235 Ga0496100_0119505
3236 Ga0496100_0564080
3237 Ga0496100_0774148
3238 Ga0496100_0841435
3239 Ga0496100_1147873
3240 Ga0496100_1276301
3241 Ga0496101_0001928
3242 Ga0496101_0019452
3243 Ga0496101_0044578
3244 Ga0496101_0082788
3245 Ga0496101_0118264
3246 Ga0496101_0148669
3247 Ga0496101_0218654
3248 Ga0496101_0252591
3249 Ga0496101_0407155
3250 Ga0496101_0972216
3251 Ga0496102_0021784
3252 Ga0496102_0028158
3253 Ga0496102_0031232
3254 Ga0496102_0118855
3255 Ga0496102_0197463
3256 Ga0496102_0403585
3257 Ga0496102_0403760
3258 Ga0496102_0806104
3259 Ga0496102_0837813
3260 Ga0496102_1116413
3261 Ga0496102_1171634
3262 Ga0496102_1566673
3263 Ga0496103_0003123
3264 Ga0496103_0003893
3265 Ga0496103_0004055
3266 Ga0496103_0011785
3267 Ga0496103_0038013
3268 Ga0496103_0091563
3269 Ga0496103_0211979
3270 Ga0496103_0245340
3271 Ga0496104_0000566
3272 Ga0496104_0001456
3273 Ga0496104_0013980
3274 Ga0496104_0018210
3275 Ga0496104_0045934
3276 Ga0496104_0116458
3277 Ga0496104_0136337
3278 Ga0496104_0185869
3279 Ga0496104_0353239
3280 Ga0496104_1025443
3281 Ga0496104_1279916
3282 Ga0496105_0001017
3283 Ga0496105_0002560
3284 Ga0496105_0022998
3285 Ga0496105_0029105
3286 Ga0496105_0085833
3287 Ga0496105_0116043
3288 Ga0496105_0123614
3289 Ga0496105_0257711
3290 Ga0496105_0316639
3291 Ga0496105_0375538
3292 Ga0496105_1330285
3293 Ga0496106_0001733
3294 Ga0496106_0026652
3295 Ga0496106_0030904
3296 Ga0496106_0049470
3297 Ga0496106_0138258
3298 Ga0496106_0204403
3299 Ga0496106_0209315
3300 Ga0496106_0229480
3301 Ga0496106_0309242
3302 Ga0496106_0333298
3303 Ga0496106_0333553
3304 Ga0496106_1536508
3305 Ga0496107_0002910
3306 Ga0496107_0048698
3307 Ga0496107_0074565
3308 Ga0496107_0090486
3309 Ga0496107_0101698
3310 Ga0496107_0345269
3311 Ga0496107_0378205
3312 Ga0496107_0430976
3313 Ga0496107_1214011
3314 Ga0496107_1256002
3315 Ga0496108_0000906
3316 Ga0496108_0021413
3317 Ga0496108_0040487
3318 Ga0496108_0101435
3319 Ga0496108_0136966
3320 Ga0496108_0224676
3321 Ga0496108_0278016
3322 Ga0496108_0284340
3323 Ga0496108_0650150
3324 Ga0496109_0005563
3325 Ga0496109_0010078
3326 Ga0496109_0115763
3327 Ga0496109_0134057
3328 Ga0496109_0147897
3329 Ga0496109_0166610
3330 Ga0496109_0188421
3331 Ga0496109_0226420
3332 Ga0496109_0230128
3333 Ga0496109_0270418
3334 Ga0496109_0388509
3335 Ga0496109_0433311
3336 Ga0496109_0935892
3337 Ga0496109_1604541
3338 Ga0496109_1665387
3339 Ga0496110_0000951
3340 Ga0496110_0000997
3341 Ga0496110_0007809
3342 Ga0496110_0016084
3343 Ga0496110_0019409
3344 Ga0496110_0028156
3345 Ga0496110_0112830
3346 Ga0496110_0162280
3347 Ga0496110_0172469
3348 Ga0496110_0206655
3349 Ga0496110_0262342
3350 Ga0496110_0266325
3351 Ga0496110_0353477
3352 Ga0496110_0747526
3353 Ga0496110_1085697
3354 Ga0496110_1219960
3355 Ga0496111_0000512
3356 Ga0496111_0002184
3357 Ga0496111_0005450
3358 Ga0496111_0005744
3359 Ga0496111_0069745
3360 Ga0496111_0071179
3361 Ga0496111_0184054
3362 Ga0496111_0213360
3363 Ga0496111_0349097
3364 Ga0496111_0667003
3365 Ga0496111_0771088
3366 Ga0496111_1041846
3367 Ga0496112_0004731
3368 Ga0496112_0009224
3369 Ga0496112_0027466
3370 Ga0496112_0090427
3371 Ga0496112_0247526
3372 Ga0496112_0327220
3373 Ga0496112_0458615
3374 Ga0496112_0609221
3375 Ga0496112_0689329
3376 Ga0496112_1896331
3377 Ga0496113_0010891
3378 Ga0496113_0046582
3379 Ga0496113_0068476
3380 Ga0496113_0138314
3381 Ga0496113_0167297
3382 Ga0496113_0178578
3383 Ga0496113_0230956
3384 Ga0496113_0351649
3385 Ga0496113_0353400
3386 Ga0496113_0615307
3387 Ga0496113_0672453
3388 Ga0496113_0796285
3389 Ga0496114_0002097
3390 Ga0496114_0017867
3391 Ga0496114_0036750
3392 Ga0496114_0074651
3393 Ga0496114_0140476
3394 Ga0496114_0189445
3395 Ga0496114_0296012
3396 Ga0496114_0344674
3397 Ga0496114_0353092
3398 Ga0496114_1026679
3399 Ga0496115_0044549
3400 Ga0496115_0055048
3401 Ga0496115_0113403
3402 Ga0496115_0261104
3403 Ga0496115_0413339
3404 Ga0501298_146661
3405 Ga0501031_0069984
3406 Ga0501031_0446109
3407 Ga0501031_1043944
3408 Ga0501032_0148468
3409 Ga0501032_1051003
3410 Ga0501033_0163192
3411 Ga0501036_0036730
3412 Ga0501037_0211779
3413 Ga0501038_0058270
3414 Ga0501039_0038129
3415 Ga0501039_0764607
3416 Ga0501040_0015402
3417 Ga0501040_0182121
3418 Ga0501041_0007471
3419 Ga0501041_0111005
3420 Ga0501041_0374915
3421 Ga0501041_0783530
3422 Ga0501042_0070432
3423 Ga0501042_0314460
3424 Ga0501042_1331879
3425 Ga0501046_0083004
3426 Ga0501046_0240151
3427 Ga0501048_0014730
3428 Ga0501048_1103511
3429 Ga0501048_1233917
3430 Ga0501067_0018931
3431 Ga0501067_0223514
3432 Ga0501067_0237108
3433 Ga0501067_0573987
3434 Ga0501067_0649454
3435 Ga0501068_0137175
3436 Ga0501069_0073814
3437 Ga0501069_0099093
3438 Ga0501069_0296145
3439 Ga0501070_0228267
3440 Ga0501070_0666027
3441 Ga0501071_0004656
3442 Ga0501071_0217034
3443 Ga0501071_0617298
3444 Ga0501072_0003264
3445 Ga0501073_0401459
3446 Ga0501073_0916399
3447 Ga0501074_0080528
3448 Ga0501074_0461938
3449 Ga0501075_0018170
3450 Ga0501075_0135269
3451 Ga0501075_1256954
3452 Ga0501076_0001105
3453 Ga0501076_0700221
3454 Ga0501077_0042502
3455 Ga0501202_215196
3456 Ga0501233_184621
3457 Ga0501225_0251116
3458 Ga0501079_0037266
3459 Ga0501079_0134259
3460 Ga0501079_0527929
3461 Ga0501080_0071893
3462 Ga0501081_0058177
3463 Ga0501081_0215914
3464 Ga0501081_0359080
3465 Ga0501083_0321516
3466 Ga0501083_1142710
3467 Ga0501035_0252438
3468 Ga0501035_0567365
3469 Ga0501044_0287075
3470 Ga0501045_0005351
3471 Ga0501045_1314436
3472 Ga0501045_1330375
3473 nmdc:mga03683_49432_c1
3474 nmdc:mga00v17_11157_c1
3475 nmdc:mga00v17_727885_c1
3476 nmdc:mga0yw44_32896_c1
3477 nmdc:mga0yw44_615987_c1
3478 nmdc:mga04h51_296052_c1
3479 nmdc:mga05p37_13294_c1
3480 nmdc:mga05p37_167787_c1
3481 nmdc:mga05p37_1895896_c1
3482 nmdc:mga05p37_2114232_c1
3483 nmdc:mga05p37_244057_c1
3484 nmdc:mga05p37_314764_c1
3485 nmdc:mga05p37_68166_c1
3486 nmdc:mga05p37_706369_c1
3487 nmdc:mga09592_151081_c1
3488 nmdc:mga09592_619081_c1
3489 nmdc:mga09592_874890_c1
3490 nmdc:mga0qj67_108618_c1
3491 nmdc:mga06r32_10690_c1
3492 nmdc:mga06r32_1301213_c1
3493 nmdc:mga06r32_1883578_c1
3494 nmdc:mga06r32_43491_c1
3495 nmdc:mga06r32_639830_c1
3496 nmdc:mga06r32_825230_c1
3497 nmdc:mga08y16_1564151_c1
3498 nmdc:mga08y16_18761_c1
3499 nmdc:mga08y16_196041_c1
3500 nmdc:mga08y16_491918_c1
3501 nmdc:mga08y16_79427_c1
3502 nmdc:mga0n895_1116647_c1
3503 nmdc:mga0n895_135876_c1
3504 nmdc:mga0n895_1588271_c1
3505 nmdc:mga0n895_160159_c1
3506 nmdc:mga0n895_1637059_c1
3507 nmdc:mga0n895_182761_c1
3508 nmdc:mga0n895_19407_c1
3509 nmdc:mga0n895_2162655_c1
3510 nmdc:mga0n895_34144_c1
3511 nmdc:mga0n895_7715_c1
3512 nmdc:mga0rr50_1205443_c1
3513 nmdc:mga0rr50_1395326_c1
3514 nmdc:mga0rr50_294586_c1
3515 nmdc:mga0rr50_44331_c1
3516 nmdc:mga0rr50_49718_c1
3517 nmdc:mga0rr50_519956_c1
3518 nmdc:mga0rr50_81771_c1
3519 nmdc:mga0rr50_993710_c1
3520 nmdc:mga08x19_18831_c1
3521 nmdc:mga08x19_29425_c1
3522 nmdc:mga08x19_43212_c1
3523 nmdc:mga08x19_449879_c1
3524 nmdc:mga08x19_486783_c1
3525 nmdc:mga08x19_718350_c1
3526 nmdc:mga08x19_783501_c1
3527 nmdc:mga08x19_951266_c1
3528 nmdc:mga0a205_122897_c1
3529 nmdc:mga0a205_1436974_c1
3530 nmdc:mga0a205_188932_c1
3531 nmdc:mga0a205_266846_c1
3532 nmdc:mga0a205_31020_c1
3533 nmdc:mga0a205_798610_c1
3534 nmdc:mga0a205_90380_c1
3535 Ga0495601_0000178
3536 Ga0495601_0363711
3537 Ga0495601_0429289
3538 Ga0495601_0492742
3539 Ga0495601_0774783
3540 Ga0495601_0777679
3541 Ga0495601_0828522
3542 Ga0495612_0017228
3543 Ga0495612_0124556
3544 Ga0495595_0083745
3545 Ga0495595_0156310
3546 Ga0495595_0308993
3547 Ga0495619_0004567
3548 Ga0495619_0049368
3549 Ga0495619_0515847
3550 Ga0501084_0009069
3551 Ga0501084_0182568
3552 Ga0501084_0438645
3553 Ga0501084_0685089
3554 Ga0501084_1245950
3555 Ga0590071_026629
3556 Ga0590075_005904
3557 Ga0590075_026904
3558 Ga0587080_178597
3559 Ga0587083_0027321
3560 Ga0587083_0223707
3561 Ga0587085_041965
3562 Ga0587086_092311
3563 Ga0587069_156302
3564 Ga0587075_152295
3565 Ga0587079_201834
3566 Ga0587114_105860
3567 Ga0587111_0148806
3568 Ga0501082_0190537
3569 Ga0501082_1078213
3570 Ga0466962_0003839
3571 Ga0466962_0009515
3572 Ga0466962_0041609
3573 Ga0466962_0045217
3574 Ga0466962_0276730
3575 Ga0530510_0007146
3576 Ga0530510_0035687
3577 Ga0530510_0226665
3578 Ga0530510_0238099
3579 Ga0530510_0405050
3580 Ga0530510_0921447

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i44-assembly4.cif.gz_H-3 structure of raca-dna complex; p21 form 0.8704 5 33
4j2n-assembly1.cif.gz_B crystal structure of mycobacteriophage pukovnik xis 0.8483 1 28
1j9i-assembly1.cif.gz_B structure of the dna binding domain of the gpnu1 subunit of lambda terminase 0.7706 4 51
4j2n-assembly1.cif.gz_A crystal structure of mycobacteriophage pukovnik xis 0.7605 1 45
6m62-assembly1.cif.gz_n cryo-em structure of eukaryotic pre-60s ribosome subunit from saccharomyces cerevisiae rpf2 delta 255-344 strain, c4 state. 0.7591 3 46
ID Description Score Start End Superfamily
af_A0A0R0HSY7_140_369_1.10.3260.10 Mainly Alpha;Orthogonal Bundle;DNA ligase i, domain 1;DNA ligase, ATP-dependent, N-terminal domain 0.8854 7 30 1.10.3260.10
5i44H00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8704 5 33 1.10.1660.10
af_Q21657_579_705_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8095 2 24 2.40.33.20
af_Q9V3F3_173_397_1.25.70.10 Mainly Alpha;Alpha Horseshoe;Transcription termination factor 3, mitochondrial;Transcription termination factor 3, mitochondrial 0.8072 7 27 1.25.70.10
af_I6YE30_32_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8027 5 34 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W0G9J5-F1-model_v4 DNA-binding protein 0.9973 1 50
AF-A0A7V9IY08-F1-model_v4 Translation initiation factor IF-2 N-terminal domain-containing protein 0.9633 1 51
AF-A0A7W0G9J5-F1-model_v4 DNA-binding protein 0.9592 1 50
AF-A0A7W1S1I8-F1-model_v4 deleted 0.949 1 51
AF-A0A7V8VJZ4-F1-model_v4 DNA-binding protein 0.949 1 51

Map