F495651

General Info

Members Datasets Scaffolds Average Seq Length
1772 484 1772 259

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10130183|Ga0157374_101301832
Length 297
Sequence LSGLLAHVYTESGPGETDPPTVLVRNAQSIYDRRSRVVMMPHIEVADVSLTYDTPSGQVPGVDGVSIDIEASEFLCIVGPSGCGKSTLLNIIAGFLSPTAGEIRIGGKVVTGHGLDRGVVFQDFAQLFPWRTALGNVTFGLEMKGIGKAEREEIALRQLRLVKLEKFVQSYPHHLSGGMQQRVAIARALAYNPSVLLMDEPFAALDALTRDDMQRLLADVWRETRKTVIYVTHNVAEAVYLADRVVVMTPHPGRVKIELPIPLALPRYPLSVDVLKYQKSLLQHLGQQAVAAVDAKS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
147 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
148 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
149 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
166 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
167 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
168 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
247 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
250 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
254 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
255 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
258 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
259 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
260 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
261 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
262 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
263 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
264 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
265 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
266 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
269 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
270 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
271 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
272 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
273 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
274 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
275 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
276 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
277 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
278 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
279 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
280 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
281 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
282 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
283 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
285 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
286 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
287 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
288 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
289 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
290 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
291 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
292 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
293 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
294 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
295 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
296 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
297 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
298 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
299 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
300 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
301 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
302 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
303 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
304 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
305 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
306 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
309 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
310 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
313 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
314 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
315 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
316 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
317 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
318 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
319 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
320 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
321 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
322 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
323 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
324 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
325 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
326 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
327 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
328 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
329 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
330 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
331 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
332 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
333 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
334 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
335 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
336 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
337 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
338 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
339 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
340 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
341 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
342 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
343 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
344 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
345 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
346 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
347 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
348 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
349 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
350 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
351 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
352 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
353 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
354 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
357 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
358 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
359 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
360 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
361 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
362 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
363 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
364 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
365 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
366 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
367 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
368 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
369 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
370 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
371 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
372 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
373 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
374 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
377 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
378 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
379 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
380 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
381 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
382 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
383 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
384 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
385 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
386 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
387 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
388 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
389 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
390 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
394 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
397 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
398 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
399 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
400 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
401 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
402 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
403 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
404 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
405 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
406 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
407 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
408 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
409 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
410 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
411 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
412 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
413 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
414 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
415 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
416 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
417 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
418 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
419 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
435 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
436 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
439 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
440 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
441 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
442 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
443 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
444 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
445 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
446 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
447 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
448 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
449 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
452 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
453 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
454 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
455 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
456 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
457 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
458 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
459 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
460 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
461 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
462 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
463 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
464 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
465 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
466 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
467 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
468 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
469 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
470 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
471 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
472 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
473 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
474 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
475 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
476 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
477 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
478 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
479 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
480 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
481 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
482 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
483 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
484 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.94
Metatranscriptomes 0.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0
Rhizoplane 7.84
Rhizosphere 89
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772980 2209111006 Bacteria 12584
2 ARcpr5oldR_c000026 3300000041 Bacteria 30226
3 ARSoilYngRDRAFT_c00029 3300000042 Bacteria 22121
4 ARcpr5yngRDRAFT_c000044 3300000043 Bacteria 19945
5 ARSoilOldRDRAFT_c000037 3300000044 Bacteria 30277
6 ARCol0oldRDRAFT_c01671 3300000045 Bacteria 1310
7 ARCol0yngRDRAFT_1000020 3300000652 Bacteria 30273
8 JGI24746J21847_1005093 3300001977 Bacteria 2057
9 JGI24747J21853_1006822 3300001978 Bacteria 1088
10 JGI24740J21852_10036806 3300001979 Bacteria 1516
11 JGI24739J22299_10004550 3300001989 Bacteria 5302
12 JGI24739J22299_10008850 3300001989 Bacteria 3753
13 JGI24737J22298_10001930 3300001990 Bacteria 7416
14 JGI24743J22301_10003452 3300001991 Bacteria 2502
15 JGI24750J21931_1000586 3300002070 Bacteria 5547
16 JGI24745J21846_1000864 3300002073 Bacteria 2808
17 JGI24749J21850_1001223 3300002076 Bacteria 3648
18 JGI24744J21845_10000745 3300002077 Bacteria 6048
19 JGI24035J26624_1001145 3300002126 Bacteria 2512
20 JGI24742J22300_10000139 3300002244 Bacteria 10736
21 JGI24751J29686_10015704 3300002459 Bacteria 1561
22 JGI25406J46586_10009736 3300003203 Bacteria 4295
23 JGI25153J46596_10002462 3300003215 Bacteria 10656
24 JGI25405J52794_10004616 3300003911 Bacteria 2461
25 Ga0065716_1001673 3300005277 Bacteria 4322
26 Ga0065712_10071735 3300005290 Bacteria 5090
27 Ga0065712_10077193 3300005290 Bacteria 3510
28 Ga0065715_10038352 3300005293 Bacteria 1274
29 Ga0065715_10092917 3300005293 Bacteria 4880
30 Ga0065715_10113387 3300005293 Bacteria 2491
31 Ga0070658_10021114 3300005327 Bacteria 5216
32 Ga0070658_10048153 3300005327 Bacteria 3450
33 Ga0070658_10191350 3300005327 Bacteria 1724
34 Ga0070676_10001078 3300005328 Bacteria 13598
35 Ga0070676_10079340 3300005328 Bacteria 1988
36 Ga0070676_10107334 3300005328 Bacteria 1733
37 Ga0070676_10188872 3300005328 Bacteria 1344
38 Ga0070683_100007390 3300005329 Bacteria 9282
39 Ga0070683_100138777 3300005329 Bacteria 2303
40 Ga0070683_100228105 3300005329 Bacteria 1770
41 Ga0070683_100400610 3300005329 Bacteria 1309
42 Ga0070690_100076879 3300005330 Bacteria 2178
43 Ga0070690_100104406 3300005330 Bacteria 1882
44 Ga0070690_100193295 3300005330 Bacteria 1412
45 Ga0070690_100303803 3300005330 Bacteria 1145
46 Ga0070670_100037546 3300005331 Bacteria 4168
47 Ga0070670_100215578 3300005331 Bacteria 1670
48 Ga0068869_100051408 3300005334 Bacteria 2990
49 Ga0068869_100176034 3300005334 Bacteria 1674
50 Ga0068869_100193995 3300005334 Bacteria 1598
51 Ga0070666_10162832 3300005335 Bacteria 1559
52 Ga0070680_100004715 3300005336 Bacteria 10260
53 Ga0070680_100021923 3300005336 Bacteria 5080
54 Ga0070680_100026870 3300005336 Bacteria 4605
55 Ga0070680_100094650 3300005336 Bacteria 2476
56 Ga0070682_100001091 3300005337 Bacteria 15614
57 Ga0070682_100048274 3300005337 Bacteria 2650
58 Ga0070682_100108168 3300005337 Bacteria 1848
59 Ga0068868_100037790 3300005338 Bacteria 3744
60 Ga0068868_100305139 3300005338 Bacteria 1353
61 Ga0070660_100001398 3300005339 Bacteria 16443
62 Ga0070660_100058854 3300005339 Bacteria 2979
63 Ga0070660_100189907 3300005339 Bacteria 1664
64 Ga0070660_100219760 3300005339 Bacteria 1544
65 Ga0070660_100244998 3300005339 Bacteria 1460
66 Ga0070660_100249932 3300005339 Bacteria 1446
67 Ga0070660_100409626 3300005339 Bacteria 1122
68 Ga0070660_100418893 3300005339 Bacteria 1109
69 Ga0070689_100008504 3300005340 Bacteria 7234
70 Ga0070689_100017677 3300005340 Bacteria 5243
71 Ga0070689_100063151 3300005340 Bacteria 2882
72 Ga0070689_100086925 3300005340 Bacteria 2459
73 Ga0070689_100138970 3300005340 Bacteria 1952
74 Ga0070689_100316812 3300005340 Bacteria 1301
75 Ga0070689_100488322 3300005340 Bacteria 1053
76 Ga0070691_10000769 3300005341 Bacteria 12720
77 Ga0070691_10205457 3300005341 Bacteria 1037
78 Ga0070687_100177502 3300005343 Bacteria 1273
79 Ga0070687_100206503 3300005343 Bacteria 1194
80 Ga0070687_100209803 3300005343 Bacteria 1186
81 Ga0070661_100001076 3300005344 Bacteria 19335
82 Ga0070661_100061169 3300005344 Bacteria 2764
83 Ga0070661_100061862 3300005344 Bacteria 2748
84 Ga0070661_100187879 3300005344 Bacteria 1575
85 Ga0070692_10015532 3300005345 Bacteria 3603
86 Ga0070692_10210532 3300005345 Bacteria 1144
87 Ga0070668_100012317 3300005347 Bacteria 6370
88 Ga0070668_100330193 3300005347 Bacteria 1286
89 Ga0070668_100415475 3300005347 Bacteria 1151
90 Ga0070669_100005888 3300005353 Bacteria 8845
91 Ga0070669_100045834 3300005353 Bacteria 3187
92 Ga0070669_100129722 3300005353 Bacteria 1933
93 Ga0070669_100141434 3300005353 Bacteria 1855
94 Ga0070669_100161681 3300005353 Bacteria 1740
95 Ga0070675_100000727 3300005354 Bacteria 22927
96 Ga0070675_100189878 3300005354 Bacteria 1780
97 Ga0070671_100000438 3300005355 Bacteria 28920
98 Ga0070671_100017456 3300005355 Bacteria 5813
99 Ga0070671_100018195 3300005355 Bacteria 5704
100 Ga0070671_100146871 3300005355 Bacteria 1990
101 Ga0070674_100001976 3300005356 Bacteria 11215
102 Ga0070674_100023669 3300005356 Bacteria 3978
103 Ga0070674_100076955 3300005356 Bacteria 2374
104 Ga0070673_100001186 3300005364 Bacteria 14992
105 Ga0070673_100064845 3300005364 Bacteria 2911
106 Ga0070673_100086664 3300005364 Bacteria 2551
107 Ga0070673_100231226 3300005364 Bacteria 1604
108 Ga0070688_100022325 3300005365 Bacteria 3706
109 Ga0070688_100064296 3300005365 Bacteria 2328
110 Ga0070688_100082189 3300005365 Bacteria 2087
111 Ga0070688_100116948 3300005365 Bacteria 1781
112 Ga0070688_100170191 3300005365 Bacteria 1503
113 Ga0070659_100005874 3300005366 Bacteria 8843
114 Ga0070659_100058285 3300005366 Bacteria 3048
115 Ga0070659_100159515 3300005366 Bacteria 1844
116 Ga0070667_100005963 3300005367 Bacteria 10128
117 Ga0070667_100150888 3300005367 Bacteria 2041
118 Ga0070667_100329662 3300005367 Bacteria 1379
119 Ga0070703_10002528 3300005406 Bacteria 5263
120 Ga0070703_10014584 3300005406 Bacteria 2240
121 Ga0070703_10027328 3300005406 Bacteria 1700
122 Ga0070709_10015469 3300005434 Bacteria 4342
123 Ga0070709_10089303 3300005434 Bacteria 2029
124 Ga0070709_10199392 3300005434 Bacteria 1416
125 Ga0070709_10223114 3300005434 Bacteria 1345
126 Ga0070714_100085977 3300005435 Bacteria 2748
127 Ga0070714_100111046 3300005435 Bacteria 2427
128 Ga0070714_100258646 3300005435 Bacteria 1611
129 Ga0070714_100623688 3300005435 Bacteria 1037
130 Ga0070713_100005553 3300005436 Bacteria 8640
131 Ga0070713_100015791 3300005436 Bacteria 5658
132 Ga0070713_100028859 3300005436 Bacteria 4385
133 Ga0070713_100108048 3300005436 Bacteria 2421
134 Ga0070713_100296394 3300005436 Bacteria 1488
135 Ga0070710_10010566 3300005437 Bacteria 4538
136 Ga0070710_10082207 3300005437 Bacteria 1883
137 Ga0070701_10000339 3300005438 Bacteria 15527
138 Ga0070701_10238564 3300005438 Bacteria 1092
139 Ga0070711_100027442 3300005439 Bacteria 3738
140 Ga0070711_100073831 3300005439 Bacteria 2411
141 Ga0070711_100090812 3300005439 Bacteria 2200
142 Ga0070711_100146211 3300005439 Bacteria 1778
143 Ga0070711_100163297 3300005439 Bacteria 1690
144 Ga0070711_100384579 3300005439 Bacteria 1136
145 Ga0070705_100000010 3300005440 Bacteria 102079
146 Ga0070705_100005352 3300005440 Bacteria 6249
147 Ga0070700_100000783 3300005441 Bacteria 15666
148 Ga0070700_100076044 3300005441 Bacteria 2155
149 Ga0070700_100203189 3300005441 Bacteria 1393
150 Ga0070700_100337910 3300005441 Bacteria 1112
151 Ga0070700_100417352 3300005441 Bacteria 1013
152 Ga0070694_100006633 3300005444 Bacteria 7034
153 Ga0070694_100155140 3300005444 Bacteria 1675
154 Ga0070694_100183756 3300005444 Bacteria 1548
155 Ga0070708_100179279 3300005445 Bacteria 1980
156 Ga0070708_100249728 3300005445 Bacteria 1666
157 Ga0070663_100017471 3300005455 Bacteria 4682
158 Ga0070663_100025858 3300005455 Bacteria 3968
159 Ga0070663_100028384 3300005455 Bacteria 3810
160 Ga0070663_100033005 3300005455 Bacteria 3573
161 Ga0070678_100011564 3300005456 Bacteria 5451
162 Ga0070678_100054346 3300005456 Bacteria 2917
163 Ga0070678_100160180 3300005456 Bacteria 1822
164 Ga0070678_100401004 3300005456 Bacteria 1191
165 Ga0070662_100017941 3300005457 Bacteria 4778
166 Ga0070662_100093667 3300005457 Bacteria 2260
167 Ga0070662_100103866 3300005457 Bacteria 2155
168 Ga0070662_100176643 3300005457 Bacteria 1681
169 Ga0070662_100253104 3300005457 Bacteria 1417
170 Ga0070681_10013836 3300005458 Bacteria 8031
171 Ga0070681_10051242 3300005458 Bacteria 4117
172 Ga0070681_10070525 3300005458 Bacteria 3460
173 Ga0070681_10089994 3300005458 Bacteria 3020
174 Ga0070681_10133426 3300005458 Bacteria 2414
175 Ga0070681_10457310 3300005458 Bacteria 1189
176 Ga0070681_10502254 3300005458 Bacteria 1126
177 Ga0068867_100047346 3300005459 Bacteria 3160
178 Ga0068867_100277257 3300005459 Bacteria 1374
179 Ga0068867_100504535 3300005459 Bacteria 1040
180 Ga0068867_100552296 3300005459 Bacteria 998
181 Ga0070685_10005962 3300005466 Bacteria 6203
182 Ga0070685_10022940 3300005466 Bacteria 3410
183 Ga0070685_10023443 3300005466 Bacteria 3380
184 Ga0070685_10164789 3300005466 Bacteria 1416
185 Ga0070707_100232584 3300005468 Bacteria 1794
186 Ga0070699_100001314 3300005518 Bacteria 22902
187 Ga0070699_100010423 3300005518 Bacteria 8044
188 Ga0070699_100318041 3300005518 Bacteria 1398
189 Ga0070679_100021002 3300005530 Bacteria 6371
190 Ga0070679_100034318 3300005530 Bacteria 5027
191 Ga0070679_100056408 3300005530 Bacteria 3914
192 Ga0070679_100127315 3300005530 Bacteria 2528
193 Ga0070679_100212152 3300005530 Bacteria 1900
194 Ga0070679_100222677 3300005530 Bacteria 1847
195 Ga0070679_100348569 3300005530 Bacteria 1429
196 Ga0070679_100457082 3300005530 Bacteria 1221
197 Ga0070684_100142264 3300005535 Bacteria 2169
198 Ga0070684_100326179 3300005535 Bacteria 1411
199 Ga0070684_100345226 3300005535 Bacteria 1369
200 Ga0070697_100039300 3300005536 Bacteria 3825
201 Ga0070697_100236973 3300005536 Bacteria 1558
202 Ga0068853_100004375 3300005539 Bacteria 10933
203 Ga0070672_100011149 3300005543 Bacteria 6259
204 Ga0070672_100022463 3300005543 Bacteria 4635
205 Ga0070686_100006762 3300005544 Bacteria 6383
206 Ga0070686_100262531 3300005544 Bacteria 1266
207 Ga0070695_100001719 3300005545 Bacteria 12317
208 Ga0070695_100030227 3300005545 Bacteria 3371
209 Ga0070696_100002812 3300005546 Bacteria 11557
210 Ga0070696_100029222 3300005546 Bacteria 3766
211 Ga0070696_100045814 3300005546 Bacteria 3031
212 Ga0070696_100246747 3300005546 Bacteria 1349
213 Ga0070693_100000577 3300005547 Bacteria 16215
214 Ga0070693_100010134 3300005547 Bacteria 4709
215 Ga0070693_100023786 3300005547 Bacteria 3279
216 Ga0070693_100131349 3300005547 Bacteria 1566
217 Ga0070665_100076321 3300005548 Bacteria 3358
218 Ga0070665_100199540 3300005548 Bacteria 2001
219 Ga0070665_100231865 3300005548 Bacteria 1846
220 Ga0070704_100013846 3300005549 Bacteria 5022
221 Ga0070704_100028556 3300005549 Bacteria 3713
222 Ga0070704_100126371 3300005549 Bacteria 1974
223 Ga0068855_100014148 3300005563 Bacteria 9611
224 Ga0068855_100031300 3300005563 Bacteria 6354
225 Ga0068855_100409055 3300005563 Bacteria 1486
226 Ga0068855_100462066 3300005563 Bacteria 1384
227 Ga0070664_100002073 3300005564 Bacteria 16008
228 Ga0070664_100070153 3300005564 Bacteria 3000
229 Ga0070664_100076795 3300005564 Bacteria 2871
230 Ga0070664_100145042 3300005564 Bacteria 2093
231 Ga0070664_100167671 3300005564 Bacteria 1946
232 Ga0070664_100175888 3300005564 Bacteria 1900
233 Ga0070664_100268699 3300005564 Bacteria 1536
234 Ga0070664_100341265 3300005564 Bacteria 1361
235 Ga0070664_100374759 3300005564 Bacteria 1298
236 Ga0068857_100008536 3300005577 Bacteria 8859
237 Ga0068857_100011549 3300005577 Bacteria 7685
238 Ga0068857_100622489 3300005577 Bacteria 1021
239 Ga0068854_100001074 3300005578 Bacteria 16449
240 Ga0068854_100074407 3300005578 Bacteria 2492
241 Ga0068854_100581300 3300005578 Bacteria 954
242 Ga0068856_100026335 3300005614 Bacteria 5671
243 Ga0068856_100039625 3300005614 Bacteria 4625
244 Ga0068856_100475444 3300005614 Bacteria 1270
245 Ga0068856_100485250 3300005614 Bacteria 1257
246 Ga0068856_100554185 3300005614 Bacteria 1171
247 Ga0070702_100005245 3300005615 Bacteria 6011
248 Ga0070702_100023173 3300005615 Bacteria 3295
249 Ga0070702_100184462 3300005615 Bacteria 1368
250 Ga0070702_100258096 3300005615 Bacteria 1185
251 Ga0070702_100269451 3300005615 Bacteria 1164
252 Ga0068852_100001086 3300005616 Bacteria 17979
253 Ga0068852_100054483 3300005616 Bacteria 3447
254 Ga0068852_100284846 3300005616 Bacteria 1594
255 Ga0068852_100436738 3300005616 Bacteria 1293
256 Ga0068859_100023234 3300005617 Bacteria 6221
257 Ga0068859_100087792 3300005617 Bacteria 3159
258 Ga0068859_100104533 3300005617 Bacteria 2891
259 Ga0068859_100108837 3300005617 Bacteria 2832
260 Ga0068859_100161472 3300005617 Bacteria 2320
261 Ga0068859_100242104 3300005617 Bacteria 1893
262 Ga0068859_100825794 3300005617 Bacteria 1013
263 Ga0068864_100021486 3300005618 Bacteria 5408
264 Ga0068864_100025772 3300005618 Bacteria 4956
265 Ga0068864_100053465 3300005618 Bacteria 3484
266 Ga0068864_100070454 3300005618 Bacteria 3042
267 Ga0068864_100197788 3300005618 Bacteria 1845
268 Ga0068866_10000403 3300005718 Bacteria 20138
269 Ga0068866_10083848 3300005718 Bacteria 1718
270 Ga0068866_10089937 3300005718 Bacteria 1669
271 Ga0068866_10152188 3300005718 Bacteria 1341
272 Ga0068861_100001047 3300005719 Bacteria 16998
273 Ga0068861_100112392 3300005719 Bacteria 2184
274 Ga0068870_10000860 3300005840 Bacteria 11868
275 Ga0068870_10087983 3300005840 Bacteria 1730
276 Ga0068863_100003728 3300005841 Bacteria 15069
277 Ga0068863_100184737 3300005841 Bacteria 2002
278 Ga0068863_100248601 3300005841 Bacteria 1717
279 Ga0068858_100032605 3300005842 Bacteria 4837
280 Ga0068858_100051742 3300005842 Bacteria 3800
281 Ga0068858_100098651 3300005842 Bacteria 2723
282 Ga0068858_100201782 3300005842 Bacteria 1881
283 Ga0068858_100391148 3300005842 Bacteria 1335
284 Ga0068858_100398192 3300005842 Bacteria 1323
285 Ga0068860_100013440 3300005843 Bacteria 8028
286 Ga0068860_100023327 3300005843 Bacteria 5980
287 Ga0068860_100223447 3300005843 Bacteria 1829
288 Ga0068862_100003043 3300005844 Bacteria 14604
289 Ga0068862_100024080 3300005844 Bacteria 5105
290 Ga0068862_100216773 3300005844 Bacteria 1731
291 Ga0068862_100223767 3300005844 Bacteria 1704
292 Ga0068862_100242962 3300005844 Bacteria 1638
293 Ga0081455_10000012 3300005937 Bacteria 201668
294 Ga0081455_10003284 3300005937 Bacteria 18715
295 Ga0081455_10007017 3300005937 Bacteria 11967
296 Ga0081455_10007967 3300005937 Bacteria 11076
297 Ga0081455_10016936 3300005937 Bacteria 7006
298 Ga0081455_10054157 3300005937 Bacteria 3421
299 Ga0081455_10186527 3300005937 Bacteria 1566
300 Ga0081538_10017736 3300005981 Bacteria 5386
301 Ga0081538_10018338 3300005981 Bacteria 5260
302 Ga0081538_10068602 3300005981 Bacteria 1970
303 Ga0081540_1000185 3300005983 Bacteria 64858
304 Ga0081540_1002413 3300005983 Bacteria 15223
305 Ga0081540_1005241 3300005983 Bacteria 9701
306 Ga0081540_1011112 3300005983 Bacteria 6044
307 Ga0081539_10008542 3300005985 Bacteria 8868
308 Ga0070717_10007114 3300006028 Bacteria 8292
309 Ga0070717_10010759 3300006028 Bacteria 6925
310 Ga0070717_10635447 3300006028 Bacteria 969
311 Ga0075365_10040270 3300006038 Bacteria 3047
312 Ga0075365_10054308 3300006038 Bacteria 2656
313 Ga0075365_10118964 3300006038 Bacteria 1821
314 Ga0075365_10133288 3300006038 Bacteria 1720
315 Ga0075365_10256126 3300006038 Bacteria 1230
316 Ga0075368_10034063 3300006042 Bacteria 1983
317 Ga0075368_10125050 3300006042 Bacteria 1067
318 Ga0075363_100033082 3300006048 Bacteria 2690
319 Ga0075364_10008816 3300006051 Bacteria 6037
320 Ga0075364_10057317 3300006051 Bacteria 2551
321 Ga0075432_10001490 3300006058 Bacteria 7644
322 Ga0075432_10043086 3300006058 Bacteria 1581
323 Ga0070715_10015144 3300006163 Bacteria 2870
324 Ga0070716_100047381 3300006173 Bacteria 2424
325 Ga0070712_100001328 3300006175 Bacteria 14997
326 Ga0070712_100025089 3300006175 Bacteria 3958
327 Ga0070712_100227496 3300006175 Bacteria 1479
328 Ga0070712_100449611 3300006175 Bacteria 1072
329 Ga0075362_10014874 3300006177 Bacteria 3153
330 Ga0075362_10171211 3300006177 Bacteria 1049
331 Ga0075367_10039470 3300006178 Bacteria 2753
332 Ga0075367_10124156 3300006178 Bacteria 1592
333 Ga0075367_10186253 3300006178 Bacteria 1295
334 Ga0075367_10408182 3300006178 Bacteria 859
335 Ga0075369_10016633 3300006186 Bacteria 2971
336 Ga0075427_10001112 3300006194 Bacteria 3382
337 Ga0075366_10001687 3300006195 Bacteria 11092
338 Ga0097621_100000421 3300006237 Bacteria 29460
339 Ga0097621_100008029 3300006237 Bacteria 7577
340 Ga0075370_10163989 3300006353 Bacteria 1305
341 Ga0068871_100000515 3300006358 Bacteria 26586
342 Ga0068871_100012948 3300006358 Bacteria 6177
343 Ga0075428_100007282 3300006844 Bacteria 12256
344 Ga0075428_100013216 3300006844 Bacteria 9185
345 Ga0075428_100068287 3300006844 Bacteria 3888
346 Ga0075428_100069359 3300006844 Bacteria 3854
347 Ga0075428_100099013 3300006844 Bacteria 3179
348 Ga0075428_100124513 3300006844 Bacteria 2805
349 Ga0075428_100124758 3300006844 Bacteria 2803
350 Ga0075428_100245919 3300006844 Bacteria 1929
351 Ga0075428_100598426 3300006844 Bacteria 1178
352 Ga0075430_100000223 3300006846 Bacteria 39224
353 Ga0075430_100021979 3300006846 Bacteria 5422
354 Ga0075430_100028858 3300006846 Bacteria 4711
355 Ga0075430_100285844 3300006846 Bacteria 1364
356 Ga0075431_100001810 3300006847 Bacteria 20184
357 Ga0075431_100002413 3300006847 Bacteria 17988
358 Ga0075431_100072177 3300006847 Bacteria 3562
359 Ga0075431_100143787 3300006847 Bacteria 2458
360 Ga0075431_100505165 3300006847 Bacteria 1200
361 Ga0075433_10002034 3300006852 Bacteria 15272
362 Ga0075433_10006137 3300006852 Bacteria 9468
363 Ga0075433_10008633 3300006852 Bacteria 8131
364 Ga0075433_10036232 3300006852 Bacteria 4248
365 Ga0075433_10062911 3300006852 Bacteria 3250
366 Ga0075433_10270158 3300006852 Bacteria 1507
367 Ga0075434_100000007 3300006871 Bacteria 95975
368 Ga0075434_100000693 3300006871 Bacteria 26314
369 Ga0075434_100001159 3300006871 Bacteria 21806
370 Ga0075434_100005025 3300006871 Bacteria 12006
371 Ga0075434_100020496 3300006871 Bacteria 6414
372 Ga0075434_100038594 3300006871 Bacteria 4730
373 Ga0075434_100082088 3300006871 Bacteria 3221
374 Ga0075434_100096480 3300006871 Bacteria 2961
375 Ga0075434_100152317 3300006871 Bacteria 2332
376 Ga0075434_100577216 3300006871 Bacteria 1144
377 Ga0075429_100004783 3300006880 Bacteria 11659
378 Ga0075429_100006663 3300006880 Bacteria 10011
379 Ga0075429_100021886 3300006880 Bacteria 5542
380 Ga0075429_100026387 3300006880 Bacteria 5044
381 Ga0075429_100119201 3300006880 Bacteria 2306
382 Ga0075429_100271459 3300006880 Bacteria 1485
383 Ga0075429_100353876 3300006880 Bacteria 1286
384 Ga0068865_100002115 3300006881 Bacteria 11728
385 Ga0075436_100002192 3300006914 Bacteria 13473
386 Ga0075436_100014836 3300006914 Bacteria 5340
387 Ga0075436_100037473 3300006914 Bacteria 3348
388 Ga0075436_100052910 3300006914 Bacteria 2803
389 Ga0075436_100116949 3300006914 Bacteria 1864
390 Ga0075436_100155144 3300006914 Bacteria 1612
391 Ga0097620_100023234 3300006931 Bacteria 6221
392 Ga0097620_100087787 3300006931 Bacteria 3159
393 Ga0097620_100104537 3300006931 Bacteria 2891
394 Ga0097620_100108838 3300006931 Bacteria 2832
395 Ga0097620_100161476 3300006931 Bacteria 2320
396 Ga0097620_100242115 3300006931 Bacteria 1893
397 Ga0097620_100825766 3300006931 Bacteria 1013
398 Ga0075435_100000432 3300007076 Bacteria 25629
399 Ga0075435_100025823 3300007076 Bacteria 4577
400 Ga0075435_100039209 3300007076 Bacteria 3780
401 Ga0075435_100049630 3300007076 Bacteria 3375
402 Ga0075435_100149194 3300007076 Bacteria 1965
403 Ga0075435_100698182 3300007076 Bacteria 882
404 Ga0099794_10018222 3300007265 Bacteria 3145
405 Ga0105251_10040087 3300009011 Bacteria 2284
406 Ga0105240_10037315 3300009093 Bacteria 6246
407 Ga0105240_10146994 3300009093 Bacteria 2811
408 Ga0111539_10004448 3300009094 Bacteria 18316
409 Ga0111539_10005607 3300009094 Bacteria 16233
410 Ga0111539_10013539 3300009094 Bacteria 10195
411 Ga0111539_10017591 3300009094 Bacteria 8846
412 Ga0111539_10019998 3300009094 Bacteria 8247
413 Ga0111539_10022696 3300009094 Bacteria 7708
414 Ga0111539_10108411 3300009094 Bacteria 3259
415 Ga0111539_10146086 3300009094 Bacteria 2769
416 Ga0111539_10197563 3300009094 Bacteria 2346
417 Ga0111539_10358184 3300009094 Bacteria 1698
418 Ga0111539_10409294 3300009094 Bacteria 1580
419 Ga0111539_10642777 3300009094 Bacteria 1235
420 Ga0111539_11070617 3300009094 Bacteria 937
421 Ga0105245_10069147 3300009098 Bacteria 3202
422 Ga0105245_10183449 3300009098 Bacteria 2001
423 Ga0105245_10536001 3300009098 Bacteria 1191
424 Ga0105247_10011296 3300009101 Bacteria 5386
425 Ga0105247_10012837 3300009101 Bacteria 5028
426 Ga0105247_10135646 3300009101 Bacteria 1608
427 Ga0114129_10000742 3300009147 Bacteria 41451
428 Ga0114129_10008001 3300009147 Bacteria 15058
429 Ga0114129_10059035 3300009147 Bacteria 5364
430 Ga0114129_10065278 3300009147 Bacteria 5080
431 Ga0114129_10072693 3300009147 Bacteria 4794
432 Ga0114129_10097190 3300009147 Bacteria 4076
433 Ga0114129_10105879 3300009147 Bacteria 3886
434 Ga0114129_10148174 3300009147 Bacteria 3213
435 Ga0114129_10240682 3300009147 Bacteria 2433
436 Ga0114129_10260479 3300009147 Bacteria 2325
437 Ga0105243_10002574 3300009148 Bacteria 15152
438 Ga0105243_10011951 3300009148 Bacteria 6563
439 Ga0105243_10209355 3300009148 Bacteria 1716
440 Ga0105243_10319277 3300009148 Bacteria 1414
441 Ga0105243_10774371 3300009148 Bacteria 943
442 Ga0105241_10110703 3300009174 Bacteria 2197
443 Ga0105241_10111008 3300009174 Bacteria 2194
444 Ga0105241_10235651 3300009174 Bacteria 1545
445 Ga0105242_10056433 3300009176 Bacteria 3214
446 Ga0105242_10282850 3300009176 Bacteria 1507
447 Ga0105248_10000821 3300009177 Bacteria 34849
448 Ga0105248_10076409 3300009177 Bacteria 3764
449 Ga0105248_10084997 3300009177 Bacteria 3561
450 Ga0105248_10121013 3300009177 Bacteria 2953
451 Ga0105248_10196174 3300009177 Bacteria 2275
452 Ga0105248_10204882 3300009177 Bacteria 2223
453 Ga0105248_10451642 3300009177 Bacteria 1448
454 Ga0105237_10128596 3300009545 Bacteria 2527
455 Ga0105237_10262560 3300009545 Bacteria 1729
456 Ga0105238_10009936 3300009551 Bacteria 9542
457 Ga0105238_10011216 3300009551 Bacteria 9016
458 Ga0105238_10535685 3300009551 Bacteria 1174
459 Ga0105238_10732457 3300009551 Bacteria 1002
460 Ga0105249_10015879 3300009553 Bacteria 6674
461 Ga0105249_10017602 3300009553 Bacteria 6345
462 Ga0105249_10084737 3300009553 Bacteria 2952
463 Ga0105249_10319768 3300009553 Bacteria 1563
464 Ga0099796_10005153 3300010159 Bacteria 3238
465 Ga0105239_10004537 3300010375 Bacteria 16545
466 Ga0105239_10196874 3300010375 Bacteria 2257
467 Ga0105239_10405567 3300010375 Bacteria 1543
468 Ga0105239_10698425 3300010375 Bacteria 1160
469 Ga0105246_10001092 3300011119 Bacteria 15711
470 Ga0105246_10097849 3300011119 Bacteria 2130
471 Ga0105246_10147153 3300011119 Bacteria 1779
472 Ga0157335_1001913 3300012492 Bacteria 1197
473 Ga0157345_1001831 3300012498 Bacteria 1489
474 Ga0157316_1006538 3300012510 Bacteria 960
475 Ga0157338_1014273 3300012515 Bacteria 854
476 Ga0157373_10188691 3300013100 Bacteria 1452
477 Ga0157373_10239296 3300013100 Bacteria 1283
478 Ga0157373_10448647 3300013100 Bacteria 928
479 Ga0157371_10007315 3300013102 Bacteria 8965
480 Ga0157371_10248820 3300013102 Bacteria 1279
481 Ga0157370_10158470 3300013104 Bacteria 2106
482 Ga0157370_10180697 3300013104 Bacteria 1960
483 Ga0157369_10312214 3300013105 Bacteria 1635
484 Ga0157369_10870663 3300013105 Bacteria 924
485 Ga0157374_10002049 3300013296 Bacteria 16945
486 Ga0157374_10032857 3300013296 Bacteria 4729
487 Ga0157374_10130183 3300013296 Bacteria 2435
488 Ga0157374_10527076 3300013296 Bacteria 1188
489 Ga0157378_10007541 3300013297 Bacteria 9498
490 Ga0157378_10213406 3300013297 Bacteria 1831
491 Ga0157378_10229704 3300013297 Bacteria 1768
492 Ga0157378_10312686 3300013297 Bacteria 1524
493 Ga0157378_10325547 3300013297 Bacteria 1494
494 Ga0157378_10573049 3300013297 Bacteria 1137
495 Ga0163162_10005029 3300013306 Bacteria 12738
496 Ga0163162_10077208 3300013306 Bacteria 3394
497 Ga0163162_10077995 3300013306 Bacteria 3377
498 Ga0163162_10218623 3300013306 Bacteria 2035
499 Ga0157372_10012748 3300013307 Bacteria 8955
500 Ga0157372_10343424 3300013307 Bacteria 1739
501 Ga0157372_11036284 3300013307 Bacteria 950
502 Ga0157375_10005227 3300013308 Bacteria 11266
503 Ga0157375_10019784 3300013308 Bacteria 6134
504 Ga0157375_10180264 3300013308 Bacteria 2263
505 Ga0157375_10191934 3300013308 Bacteria 2197
506 Ga0157375_10207198 3300013308 Bacteria 2117
507 Ga0157375_10538422 3300013308 Bacteria 1330
508 Ga0163163_10005574 3300014325 Bacteria 10905
509 Ga0163163_10084887 3300014325 Bacteria 3174
510 Ga0157380_10001279 3300014326 Bacteria 16357
511 Ga0157380_10167974 3300014326 Bacteria 1914
512 Ga0157380_10726026 3300014326 Bacteria 1002
513 Ga0157377_10000312 3300014745 Bacteria 22340
514 Ga0157377_10284684 3300014745 Bacteria 1085
515 Ga0157379_10001989 3300014968 Bacteria 16918
516 Ga0157379_10029559 3300014968 Bacteria 4872
517 Ga0157379_10063884 3300014968 Bacteria 3291
518 Ga0157379_10387290 3300014968 Bacteria 1283
519 Ga0157376_10001372 3300014969 Bacteria 16037
520 Ga0157376_10019925 3300014969 Bacteria 5179
521 Ga0157376_10054749 3300014969 Bacteria 3327
522 Ga0157376_10440512 3300014969 Bacteria 1269
523 Ga0163161_10003480 3300017792 Bacteria 11037
524 Ga0213872_10111987 3300021361 Bacteria 1212
525 Ga0224572_1013150 3300024225 Bacteria 1577
526 Ga0228598_1016476 3300024227 Bacteria 1459
527 Ga0207666_1000038 3300025271 Bacteria 26508
528 Ga0207666_1000670 3300025271 Bacteria 4106
529 Ga0209758_1000079 3300025297 Bacteria 262874
530 Ga0207697_10000373 3300025315 Bacteria 25127
531 Ga0207656_10080070 3300025321 Bacteria 1466
532 Ga0207653_10000559 3300025885 Bacteria 13532
533 Ga0207653_10005254 3300025885 Bacteria 4046
534 Ga0207653_10009753 3300025885 Bacteria 2993
535 Ga0207682_10000071 3300025893 Bacteria 44843
536 Ga0207692_10010499 3300025898 Bacteria 3906
537 Ga0207692_10051167 3300025898 Bacteria 2093
538 Ga0207692_10076273 3300025898 Bacteria 1780
539 Ga0207692_10080845 3300025898 Bacteria 1738
540 Ga0207642_10004072 3300025899 Bacteria 4683
541 Ga0207710_10007122 3300025900 Bacteria 4745
542 Ga0207710_10018719 3300025900 Bacteria 2947
543 Ga0207710_10125777 3300025900 Bacteria 1228
544 Ga0207688_10000237 3300025901 Bacteria 25119
545 Ga0207688_10002075 3300025901 Bacteria 10771
546 Ga0207688_10062115 3300025901 Bacteria 2106
547 Ga0207680_10016997 3300025903 Bacteria 3834
548 Ga0207680_10037949 3300025903 Bacteria 2785
549 Ga0207647_10009005 3300025904 Bacteria 7113
550 Ga0207647_10064700 3300025904 Bacteria 2222
551 Ga0207647_10080366 3300025904 Bacteria 1955
552 Ga0207685_10043200 3300025905 Bacteria 1697
553 Ga0207699_10073451 3300025906 Bacteria 2098
554 Ga0207699_10126789 3300025906 Bacteria 1659
555 Ga0207645_10000779 3300025907 Bacteria 26604
556 Ga0207645_10027896 3300025907 Bacteria 3645
557 Ga0207645_10036138 3300025907 Bacteria 3172
558 Ga0207645_10093669 3300025907 Bacteria 1933
559 Ga0207643_10000276 3300025908 Bacteria 35671
560 Ga0207643_10002314 3300025908 Bacteria 10366
561 Ga0207643_10032530 3300025908 Bacteria 2914
562 Ga0207705_10077767 3300025909 Bacteria 2414
563 Ga0207705_10103433 3300025909 Bacteria 2098
564 Ga0207705_10223975 3300025909 Bacteria 1429
565 Ga0207684_10119069 3300025910 Bacteria 2263
566 Ga0207654_10014702 3300025911 Bacteria 4048
567 Ga0207654_10093334 3300025911 Bacteria 1840
568 Ga0207654_10361226 3300025911 Bacteria 1002
569 Ga0207707_10000454 3300025912 Bacteria 42654
570 Ga0207707_10069691 3300025912 Bacteria 3065
571 Ga0207707_10070862 3300025912 Bacteria 3037
572 Ga0207707_10080459 3300025912 Bacteria 2845
573 Ga0207707_10207864 3300025912 Bacteria 1706
574 Ga0207707_10236855 3300025912 Bacteria 1588
575 Ga0207707_10361291 3300025912 Bacteria 1250
576 Ga0207695_10213968 3300025913 Bacteria 1837
577 Ga0207671_10016484 3300025914 Bacteria 5741
578 Ga0207671_10037376 3300025914 Bacteria 3601
579 Ga0207671_10211283 3300025914 Bacteria 1518
580 Ga0207693_10005073 3300025915 Bacteria 11046
581 Ga0207693_10007312 3300025915 Bacteria 9084
582 Ga0207693_10010113 3300025915 Bacteria 7663
583 Ga0207693_10010718 3300025915 Bacteria 7439
584 Ga0207693_10021275 3300025915 Bacteria 5154
585 Ga0207693_10031132 3300025915 Bacteria 4215
586 Ga0207693_10073450 3300025915 Bacteria 2677
587 Ga0207693_10097721 3300025915 Bacteria 2302
588 Ga0207663_10072881 3300025916 Bacteria 2221
589 Ga0207663_10118857 3300025916 Bacteria 1806
590 Ga0207663_10141582 3300025916 Bacteria 1676
591 Ga0207663_10166343 3300025916 Bacteria 1562
592 Ga0207663_10183783 3300025916 Bacteria 1495
593 Ga0207663_10247050 3300025916 Bacteria 1311
594 Ga0207660_10000087 3300025917 Bacteria 49552
595 Ga0207660_10018065 3300025917 Bacteria 4696
596 Ga0207660_10035293 3300025917 Bacteria 3471
597 Ga0207660_10065427 3300025917 Bacteria 2627
598 Ga0207660_10107168 3300025917 Bacteria 2096
599 Ga0207660_10398957 3300025917 Bacteria 1107
600 Ga0207662_10000659 3300025918 Bacteria 15653
601 Ga0207662_10009020 3300025918 Bacteria 5479
602 Ga0207662_10022432 3300025918 Bacteria 3620
603 Ga0207662_10108986 3300025918 Bacteria 1725
604 Ga0207662_10244695 3300025918 Bacteria 1175
605 Ga0207657_10003101 3300025919 Bacteria 17768
606 Ga0207657_10005173 3300025919 Bacteria 13682
607 Ga0207657_10035321 3300025919 Bacteria 4483
608 Ga0207657_10090738 3300025919 Bacteria 2550
609 Ga0207657_10189285 3300025919 Bacteria 1661
610 Ga0207657_10440634 3300025919 Bacteria 1023
611 Ga0207649_10000662 3300025920 Bacteria 22982
612 Ga0207649_10039165 3300025920 Bacteria 2872
613 Ga0207652_10001908 3300025921 Bacteria 18069
614 Ga0207652_10008147 3300025921 Bacteria 8415
615 Ga0207652_10023549 3300025921 Bacteria 5101
616 Ga0207652_10111416 3300025921 Bacteria 2427
617 Ga0207652_10133337 3300025921 Bacteria 2217
618 Ga0207652_10257875 3300025921 Bacteria 1573
619 Ga0207652_10323990 3300025921 Bacteria 1391
620 Ga0207652_10385849 3300025921 Bacteria 1264
621 Ga0207652_10576436 3300025921 Bacteria 1010
622 Ga0207681_10001262 3300025923 Bacteria 16334
623 Ga0207681_10151297 3300025923 Bacteria 1739
624 Ga0207681_10253399 3300025923 Bacteria 1375
625 Ga0207694_10017984 3300025924 Bacteria 5342
626 Ga0207694_10044775 3300025924 Bacteria 3417
627 Ga0207694_10182297 3300025924 Bacteria 1703
628 Ga0207694_10435899 3300025924 Bacteria 1093
629 Ga0207650_10005107 3300025925 Bacteria 8956
630 Ga0207650_10015020 3300025925 Bacteria 5386
631 Ga0207650_10097382 3300025925 Bacteria 2258
632 Ga0207650_10178535 3300025925 Bacteria 1691
633 Ga0207659_10000143 3300025926 Bacteria 42200
634 Ga0207659_10026549 3300025926 Bacteria 3909
635 Ga0207659_10145896 3300025926 Bacteria 1842
636 Ga0207687_10000865 3300025927 Bacteria 20461
637 Ga0207687_10030379 3300025927 Bacteria 3643
638 Ga0207687_10052245 3300025927 Bacteria 2852
639 Ga0207687_10122905 3300025927 Bacteria 1944
640 Ga0207687_10246166 3300025927 Bacteria 1419
641 Ga0207700_10000323 3300025928 Bacteria 28133
642 Ga0207700_10276966 3300025928 Bacteria 1442
643 Ga0207700_10293094 3300025928 Bacteria 1403
644 Ga0207664_10075293 3300025929 Bacteria 2729
645 Ga0207664_10092332 3300025929 Bacteria 2484
646 Ga0207664_10104335 3300025929 Bacteria 2347
647 Ga0207664_10337725 3300025929 Bacteria 1332
648 Ga0207664_10388968 3300025929 Bacteria 1239
649 Ga0207664_10403389 3300025929 Bacteria 1216
650 Ga0207644_10000532 3300025931 Bacteria 24677
651 Ga0207644_10042290 3300025931 Bacteria 3228
652 Ga0207644_10243525 3300025931 Bacteria 1432
653 Ga0207644_10378619 3300025931 Bacteria 1154
654 Ga0207690_10000409 3300025932 Bacteria 28156
655 Ga0207690_10127841 3300025932 Bacteria 1855
656 Ga0207690_10269905 3300025932 Bacteria 1321
657 Ga0207706_10001338 3300025933 Bacteria 24639
658 Ga0207706_10006705 3300025933 Bacteria 10645
659 Ga0207706_10058641 3300025933 Bacteria 3390
660 Ga0207706_10138699 3300025933 Bacteria 2139
661 Ga0207706_10300810 3300025933 Bacteria 1398
662 Ga0207686_10000500 3300025934 Bacteria 25713
663 Ga0207686_10042200 3300025934 Bacteria 2786
664 Ga0207686_10097295 3300025934 Bacteria 1958
665 Ga0207686_10141181 3300025934 Bacteria 1665
666 Ga0207686_10322567 3300025934 Bacteria 1154
667 Ga0207709_10001266 3300025935 Bacteria 18089
668 Ga0207709_10037338 3300025935 Bacteria 2886
669 Ga0207709_10062539 3300025935 Bacteria 2330
670 Ga0207709_10131293 3300025935 Bacteria 1708
671 Ga0207670_10007354 3300025936 Bacteria 6140
672 Ga0207670_10016040 3300025936 Bacteria 4493
673 Ga0207670_10207631 3300025936 Bacteria 1492
674 Ga0207670_10229327 3300025936 Bacteria 1425
675 Ga0207670_10249011 3300025936 Bacteria 1372
676 Ga0207669_10001125 3300025937 Bacteria 11423
677 Ga0207669_10015259 3300025937 Bacteria 3870
678 Ga0207669_10397944 3300025937 Bacteria 1078
679 Ga0207669_10539886 3300025937 Bacteria 939
680 Ga0207704_10000613 3300025938 Bacteria 15794
681 Ga0207704_10075416 3300025938 Bacteria 2156
682 Ga0207704_10266244 3300025938 Bacteria 1295
683 Ga0207665_10001192 3300025939 Bacteria 17511
684 Ga0207665_10003934 3300025939 Bacteria 9947
685 Ga0207665_10052253 3300025939 Bacteria 2753
686 Ga0207665_10133806 3300025939 Bacteria 1762
687 Ga0207665_10327524 3300025939 Bacteria 1151
688 Ga0207691_10002493 3300025940 Bacteria 18001
689 Ga0207691_10003339 3300025940 Bacteria 15624
690 Ga0207691_10024434 3300025940 Bacteria 5683
691 Ga0207691_10130622 3300025940 Bacteria 2219
692 Ga0207691_10193211 3300025940 Bacteria 1775
693 Ga0207711_10003987 3300025941 Bacteria 12681
694 Ga0207711_10029326 3300025941 Bacteria 4640
695 Ga0207711_10032877 3300025941 Bacteria 4387
696 Ga0207711_10041693 3300025941 Bacteria 3909
697 Ga0207711_10050370 3300025941 Bacteria 3565
698 Ga0207711_10162221 3300025941 Bacteria 2024
699 Ga0207711_10469127 3300025941 Bacteria 1172
700 Ga0207689_10000440 3300025942 Bacteria 38932
701 Ga0207689_10021598 3300025942 Bacteria 5412
702 Ga0207689_10064489 3300025942 Bacteria 3014
703 Ga0207689_10065413 3300025942 Bacteria 2990
704 Ga0207689_10248080 3300025942 Bacteria 1472
705 Ga0207689_10445733 3300025942 Bacteria 1082
706 Ga0207661_10059018 3300025944 Bacteria 3090
707 Ga0207661_10061762 3300025944 Bacteria 3028
708 Ga0207661_10320955 3300025944 Bacteria 1392
709 Ga0207679_10000131 3300025945 Bacteria 61363
710 Ga0207679_10016049 3300025945 Bacteria 4965
711 Ga0207679_10203794 3300025945 Bacteria 1654
712 Ga0207667_10088810 3300025949 Bacteria 3196
713 Ga0207667_10092846 3300025949 Bacteria 3117
714 Ga0207667_10724036 3300025949 Bacteria 996
715 Ga0207651_10000335 3300025960 Bacteria 19911
716 Ga0207651_10298458 3300025960 Bacteria 1339
717 Ga0207712_10002448 3300025961 Bacteria 11985
718 Ga0207712_10004065 3300025961 Bacteria 9233
719 Ga0207712_10030909 3300025961 Bacteria 3604
720 Ga0207712_10048380 3300025961 Bacteria 2958
721 Ga0207712_10305140 3300025961 Bacteria 1308
722 Ga0207712_10395616 3300025961 Bacteria 1160
723 Ga0207668_10000065 3300025972 Bacteria 86273
724 Ga0207668_10100099 3300025972 Bacteria 2152
725 Ga0207640_10000339 3300025981 Bacteria 31004
726 Ga0207640_10031052 3300025981 Bacteria 3297
727 Ga0207640_10086417 3300025981 Bacteria 2159
728 Ga0207658_10004428 3300025986 Bacteria 9771
729 Ga0207658_10034444 3300025986 Bacteria 3620
730 Ga0207677_10003580 3300026023 Bacteria 8226
731 Ga0207677_10458159 3300026023 Bacteria 1094
732 Ga0207703_10001885 3300026035 Bacteria 18620
733 Ga0207703_10056702 3300026035 Bacteria 3192
734 Ga0207703_10124556 3300026035 Bacteria 2217
735 Ga0207703_10141154 3300026035 Bacteria 2091
736 Ga0207703_10413126 3300026035 Bacteria 1254
737 Ga0207703_10423763 3300026035 Bacteria 1239
738 Ga0207639_10041384 3300026041 Bacteria 3447
739 Ga0207639_10209690 3300026041 Bacteria 1676
740 Ga0207639_10436969 3300026041 Bacteria 1186
741 Ga0207678_10000944 3300026067 Bacteria 26538
742 Ga0207678_10006342 3300026067 Bacteria 10500
743 Ga0207678_10019284 3300026067 Bacteria 5990
744 Ga0207678_10036592 3300026067 Bacteria 4273
745 Ga0207678_10056937 3300026067 Bacteria 3364
746 Ga0207678_10058587 3300026067 Bacteria 3314
747 Ga0207678_10086398 3300026067 Bacteria 2681
748 Ga0207678_10160477 3300026067 Bacteria 1920
749 Ga0207708_10002019 3300026075 Bacteria 14954
750 Ga0207708_10002166 3300026075 Bacteria 14494
751 Ga0207708_10041728 3300026075 Bacteria 3497
752 Ga0207708_10067796 3300026075 Bacteria 2730
753 Ga0207708_10206842 3300026075 Bacteria 1568
754 Ga0207708_10237196 3300026075 Bacteria 1466
755 Ga0207708_10419328 3300026075 Bacteria 1110
756 Ga0207702_10028991 3300026078 Bacteria 4603
757 Ga0207702_10056555 3300026078 Bacteria 3331
758 Ga0207641_10005810 3300026088 Bacteria 10470
759 Ga0207641_10085777 3300026088 Bacteria 2744
760 Ga0207641_10167384 3300026088 Bacteria 2003
761 Ga0207641_10179572 3300026088 Bacteria 1938
762 Ga0207641_10545589 3300026088 Bacteria 1130
763 Ga0207648_10004730 3300026089 Bacteria 13904
764 Ga0207648_10039268 3300026089 Bacteria 4163
765 Ga0207648_10049631 3300026089 Bacteria 3672
766 Ga0207676_10008134 3300026095 Bacteria 7455
767 Ga0207676_10100203 3300026095 Bacteria 2399
768 Ga0207676_10139552 3300026095 Bacteria 2073
769 Ga0207676_10151364 3300026095 Bacteria 1998
770 Ga0207676_10331087 3300026095 Bacteria 1401
771 Ga0207674_10003323 3300026116 Bacteria 19775
772 Ga0207674_10005364 3300026116 Bacteria 15249
773 Ga0207674_10100292 3300026116 Bacteria 2877
774 Ga0207674_10488334 3300026116 Bacteria 1190
775 Ga0207675_100000815 3300026118 Bacteria 31016
776 Ga0207675_100053907 3300026118 Bacteria 3752
777 Ga0207675_100291146 3300026118 Bacteria 1588
778 Ga0207675_100442262 3300026118 Bacteria 1287
779 Ga0207675_100476579 3300026118 Bacteria 1240
780 Ga0207683_10000001 3300026121 Bacteria 352047
781 Ga0207683_10027788 3300026121 Bacteria 4889
782 Ga0207683_10081084 3300026121 Bacteria 2879
783 Ga0207683_10132061 3300026121 Bacteria 2246
784 Ga0207683_10138555 3300026121 Bacteria 2191
785 Ga0207698_10051342 3300026142 Bacteria 3152
786 Ga0207698_10144287 3300026142 Bacteria 2056
787 Ga0207698_10192321 3300026142 Bacteria 1819
788 Ga0209967_1000489 3300027364 Bacteria 5203
789 Ga0209981_1000830 3300027378 Bacteria 3900
790 Ga0209995_1003461 3300027471 Bacteria 2515
791 Ga0209999_1003822 3300027543 Bacteria 2705
792 Ga0210002_1033724 3300027617 Bacteria 857
793 Ga0209983_1030948 3300027665 Bacteria 1141
794 Ga0209588_1021817 3300027671 Bacteria 2013
795 Ga0209966_1000743 3300027695 Bacteria 6783
796 Ga0209998_10001042 3300027717 Bacteria 6950
797 Ga0209998_10002206 3300027717 Bacteria 4515
798 Ga0209813_10082809 3300027866 Bacteria 1064
799 Ga0209974_10065047 3300027876 Bacteria 1238
800 Ga0207428_10000172 3300027907 Bacteria 90200
801 Ga0207428_10000255 3300027907 Bacteria 72962
802 Ga0207428_10003313 3300027907 Bacteria 15665
803 Ga0207428_10013736 3300027907 Bacteria 7059
804 Ga0207428_10016308 3300027907 Bacteria 6392
805 Ga0207428_10058144 3300027907 Bacteria 3069
806 Ga0207428_10138752 3300027907 Bacteria 1857
807 Ga0207428_10178586 3300027907 Bacteria 1605
808 Ga0265357_1002134 3300028023 Bacteria 1577
809 Ga0268266_10020037 3300028379 Bacteria 5701
810 Ga0268266_10175367 3300028379 Bacteria 1948
811 Ga0268265_10009461 3300028380 Bacteria 6580
812 Ga0268265_10029653 3300028380 Bacteria 3930
813 Ga0268264_10001153 3300028381 Bacteria 25764
814 Ga0268264_10006938 3300028381 Bacteria 9501
815 Ga0268264_10330445 3300028381 Bacteria 1444
816 Ga0268264_10350221 3300028381 Bacteria 1405
817 Ga0268264_10353932 3300028381 Bacteria 1399
818 Ga0268264_10366967 3300028381 Bacteria 1375
819 Ga0265334_10075822 3300028573 Bacteria 1246
820 Ga0265338_10038131 3300028800 Bacteria 4558
821 Ga0265338_10038132 3300028800 Bacteria 4558
822 Ga0265760_10069529 3300031090 Bacteria 1078
823 Ga0265332_10085378 3300031238 Bacteria 1338
824 Ga0265325_10000320 3300031241 Bacteria 33866
825 Ga0265325_10000901 3300031241 Bacteria 21471
826 Ga0265325_10001624 3300031241 Bacteria 15665
827 Ga0265325_10013945 3300031241 Bacteria 4559
828 Ga0265325_10018886 3300031241 Bacteria 3819
829 Ga0265325_10022061 3300031241 Bacteria 3490
830 Ga0265325_10105494 3300031241 Bacteria 1375
831 Ga0265340_10053019 3300031247 Bacteria 1960
832 Ga0265340_10099607 3300031247 Bacteria 1351
833 Ga0265340_10216465 3300031247 Bacteria 859
834 Ga0265339_10000091 3300031249 Bacteria 75937
835 Ga0265339_10000387 3300031249 Bacteria 34871
836 Ga0265339_10082085 3300031249 Bacteria 1702
837 Ga0265316_10222699 3300031344 Bacteria 1391
838 Ga0265316_10345461 3300031344 Bacteria 1078
839 Ga0307513_10169054 3300031456 Bacteria 2066
840 Ga0265313_10000850 3300031595 Bacteria 30762
841 Ga0265313_10001068 3300031595 Bacteria 26548
842 Ga0265313_10004004 3300031595 Bacteria 11532
843 Ga0265313_10006723 3300031595 Bacteria 8045
844 Ga0265313_10127706 3300031595 Bacteria 1104
845 Ga0265313_10174770 3300031595 Bacteria 905
846 Ga0265314_10007897 3300031711 Bacteria 9182
847 Ga0265314_10024428 3300031711 Bacteria 4582
848 Ga0265342_10000196 3300031712 Bacteria 67364
849 Ga0265342_10024497 3300031712 Bacteria 3809
850 Ga0265342_10051287 3300031712 Bacteria 2462
851 Ga0307413_10105998 3300031824 Bacteria 1870
852 Ga0307406_10733410 3300031901 Bacteria 828
853 Ga0307411_10044801 3300032005 Bacteria 2841
854 Ga0373930_0000014 3300034816 Bacteria 17170
855 Ga0373948_0000493 3300034817 Bacteria 4922
856 Ga0373948_0000950 3300034817 Bacteria 3883
857 Ga0373950_0000145 3300034818 Bacteria 11351
858 Ga0373950_0007552 3300034818 Bacteria 1691
859 Ga0373958_0000064 3300034819 Bacteria 10619
860 Ga0373958_0012499 3300034819 Bacteria 1453
861 Ga0373958_0015415 3300034819 Bacteria 1350
862 Ga0373958_0017715 3300034819 Bacteria 1284
863 Ga0373959_0005735 3300034820 Bacteria 2041
864 Ga0373959_0053195 3300034820 Bacteria 879
865 Ga0373938_0001531 3300034957 Bacteria 3712
866 Ga0373938_0014379 3300034957 Bacteria 1518
867 Ga0373938_0037550 3300034957 Bacteria 1064
868 Ga0373938_0049817 3300034957 Bacteria 954
869 Ga0373926_0017053 3300035083 Bacteria 2489
870 Ga0373926_0049141 3300035083 Bacteria 1518
871 Ga0373926_0084674 3300035083 Bacteria 1175
872 Ga0373928_0001389 3300035084 Bacteria 4719
873 Ga0373928_0007010 3300035084 Bacteria 2172
874 Ga0373929_0000101 3300035085 Bacteria 14304
875 Ga0373929_0002108 3300035085 Bacteria 3695
876 Ga0373929_0053362 3300035085 Bacteria 929
877 Ga0373934_0010944 3300035086 Bacteria 3411
878 Ga0373940_0003765 3300035088 Bacteria 3134
879 Ga0373940_0041509 3300035088 Bacteria 1265
880 Ga0373940_0076050 3300035088 Bacteria 985
881 Ga0373944_0007357 3300035089 Bacteria 2948
882 Ga0373944_0011177 3300035089 Bacteria 2456
883 Ga0373944_0013599 3300035089 Bacteria 2261
884 Ga0373944_0035961 3300035089 Bacteria 1511
885 Ga0373944_0045478 3300035089 Bacteria 1370
886 Ga0373944_0120512 3300035089 Bacteria 903
887 Ga0373949_0000293 3300035090 Bacteria 18099
888 Ga0373949_0000952 3300035090 Bacteria 8980
889 Ga0373951_0000154 3300035091 Bacteria 25002
890 Ga0373951_0014795 3300035091 Bacteria 1755
891 Ga0373952_0000030 3300035092 Bacteria 16323
892 Ga0373952_0000920 3300035092 Bacteria 5345
893 Ga0373952_0023481 3300035092 Bacteria 1318
894 Ga0373952_0050550 3300035092 Bacteria 990
895 Ga0373923_0010802 3300035111 Bacteria 3333
896 Ga0373932_0001243 3300035112 Bacteria 7237
897 Ga0373932_0049425 3300035112 Bacteria 1243
898 Ga0373936_0009974 3300035113 Bacteria 3585
899 Ga0373936_0017372 3300035113 Bacteria 2769
900 Ga0373936_0019684 3300035113 Bacteria 2616
901 Ga0373936_0029855 3300035113 Bacteria 2148
902 Ga0373936_0204465 3300035113 Bacteria 872
903 Ga0373939_0000791 3300035114 Bacteria 7801
904 Ga0373939_0003691 3300035114 Bacteria 3605
905 Ga0373939_0004617 3300035114 Bacteria 3262
906 Ga0373939_0021740 3300035114 Bacteria 1760
907 Ga0373939_0024887 3300035114 Bacteria 1672
908 Ga0373941_0000050 3300035115 Bacteria 17747
909 Ga0373941_0085807 3300035115 Bacteria 1071
910 Ga0373945_0001214 3300035116 Bacteria 7848
911 Ga0373945_0005087 3300035116 Bacteria 4193
912 Ga0373945_0010311 3300035116 Bacteria 3075
913 Ga0373945_0010949 3300035116 Bacteria 2992
914 Ga0373945_0023434 3300035116 Bacteria 2132
915 Ga0373945_0030077 3300035116 Bacteria 1912
916 Ga0373953_0001444 3300035117 Bacteria 6890
917 Ga0373953_0013693 3300035117 Bacteria 2901
918 Ga0373954_0001943 3300035118 Bacteria 8567
919 Ga0373954_0008746 3300035118 Bacteria 4451
920 Ga0373954_0021614 3300035118 Bacteria 2914
921 Ga0373954_0023220 3300035118 Bacteria 2818
922 Ga0373954_0025068 3300035118 Bacteria 2724
923 Ga0373954_0137932 3300035118 Bacteria 1189
924 Ga0373956_0024897 3300035119 Bacteria 2583
925 Ga0373956_0044007 3300035119 Bacteria 1989
926 Ga0373957_0003309 3300035120 Bacteria 4749
927 Ga0373957_0005066 3300035120 Bacteria 4066
928 Ga0373957_0024044 3300035120 Bacteria 2184
929 Ga0373960_0003068 3300035121 Bacteria 3771
930 Ga0373960_0028479 3300035121 Bacteria 1542
931 Ga0373943_0000132 3300035170 Bacteria 28317
932 Ga0373943_0001792 3300035170 Bacteria 9710
933 Ga0373943_0006259 3300035170 Bacteria 5347
934 Ga0373943_0010229 3300035170 Bacteria 4207
935 Ga0373943_0014659 3300035170 Bacteria 3553
936 Ga0373943_0115598 3300035170 Bacteria 1420
937 Ga0373946_0000496 3300035171 Bacteria 13068
938 Ga0373946_0000760 3300035171 Bacteria 10975
939 Ga0373946_0001192 3300035171 Bacteria 9005
940 Ga0373946_0005660 3300035171 Bacteria 4514
941 Ga0373946_0007440 3300035171 Bacteria 4005
942 Ga0373946_0111178 3300035171 Bacteria 1240
943 Ga0373946_0159408 3300035171 Bacteria 1058
944 Ga0373955_0000779 3300035172 Bacteria 13651
945 Ga0373955_0005131 3300035172 Bacteria 5853
946 Ga0373955_0057467 3300035172 Bacteria 2137
947 Ga0373955_0067556 3300035172 Bacteria 1990
948 Ga0373955_0084642 3300035172 Bacteria 1798
949 Ga0373955_0127120 3300035172 Bacteria 1486
950 Ga0373955_0146766 3300035172 Bacteria 1386
951 Ga0373955_0270947 3300035172 Bacteria 1020
952 Ga0373942_0000073 3300035207 Bacteria 21344
953 Ga0373942_0025665 3300035207 Bacteria 1520
954 Ga0373942_0026622 3300035207 Bacteria 1498
955 Ga0373942_0061063 3300035207 Bacteria 1081
956 Ga0373942_0103677 3300035207 Bacteria 872
957 Ga0373961_0000480 3300035241 Bacteria 15603
958 Ga0373961_0009096 3300035241 Bacteria 2425
959 Ga0373961_0081398 3300035241 Bacteria 1019
960 Ga0373962_0001214 3300035242 Bacteria 6025
961 Ga0373962_0001920 3300035242 Bacteria 4950
962 Ga0373962_0011212 3300035242 Bacteria 2244
963 Ga0373962_0023763 3300035242 Bacteria 1634
964 Ga0373962_0033854 3300035242 Bacteria 1412
965 Ga0373924_0039884 3300035410 Bacteria 1920
966 Ga0373924_0118510 3300035410 Bacteria 1147
967 Ga0373931_0000537 3300035691 Bacteria 15543
968 Ga0373931_0004302 3300035691 Bacteria 6489
969 Ga0373931_0006018 3300035691 Bacteria 5644
970 Ga0373931_0010273 3300035691 Bacteria 4498
971 Ga0373931_0023545 3300035691 Bacteria 3111
972 Ga0373931_0036666 3300035691 Bacteria 2557
973 Ga0373931_0108251 3300035691 Bacteria 1573
974 Ga0373931_0119575 3300035691 Bacteria 1504
975 Ga0373931_0129610 3300035691 Bacteria 1450
976 Ga0373935_0000053 3300035692 Bacteria 46838
977 Ga0373935_0001261 3300035692 Bacteria 13962
978 Ga0373935_0003568 3300035692 Bacteria 9069
979 Ga0373935_0006902 3300035692 Bacteria 6778
980 Ga0373935_0021565 3300035692 Bacteria 3945
981 Ga0373935_0046856 3300035692 Bacteria 2732
982 Ga0373935_0069841 3300035692 Bacteria 2263
983 Ga0373935_0130097 3300035692 Bacteria 1690
984 Ga0373935_0187924 3300035692 Bacteria 1421
985 Ga0373935_0574631 3300035692 Bacteria 823
986 Ga0373927_0011111 3300035695 Bacteria 5997
987 Ga0373927_0035423 3300035695 Bacteria 3245
988 Ga0373927_0095761 3300035695 Bacteria 1929
989 Ga0373927_0116233 3300035695 Bacteria 1744
990 Ga0373927_0120334 3300035695 Bacteria 1713
991 Ga0373933_0001426 3300035724 Bacteria 14019
992 Ga0373933_0002786 3300035724 Bacteria 9757
993 Ga0373933_0021557 3300035724 Bacteria 3661
994 Ga0373933_0022272 3300035724 Bacteria 3606
995 Ga0373933_0051395 3300035724 Bacteria 2463
996 Ga0373947_0000239 3300035725 Bacteria 30999
997 Ga0373947_0000259 3300035725 Bacteria 29909
998 Ga0373947_0001656 3300035725 Bacteria 13631
999 Ga0373947_0008738 3300035725 Bacteria 5824
1000 Ga0373947_0009288 3300035725 Bacteria 5649
1001 Ga0373947_0013217 3300035725 Bacteria 4732
1002 Ga0373947_0054577 3300035725 Bacteria 2411
1003 Ga0373947_0065243 3300035725 Bacteria 2220
1004 Ga0373947_0080997 3300035725 Bacteria 2009
1005 Ga0373947_0169381 3300035725 Bacteria 1416
1006 Ga0373937_0000030 3300036401 Bacteria 122176
1007 Ga0373937_0000907 3300036401 Bacteria 25212
1008 Ga0373937_0001504 3300036401 Bacteria 19577
1009 Ga0373937_0003255 3300036401 Bacteria 13620
1010 Ga0373937_0029085 3300036401 Bacteria 5003
1011 Ga0373937_0036814 3300036401 Bacteria 4458
1012 Ga0373937_0355286 3300036401 Bacteria 1388
1013 Ga0373925_0000002 3300037068 Bacteria 368879
1014 Ga0373925_0000706 3300037068 Bacteria 31254
1015 Ga0373925_0019842 3300037068 Bacteria 4890
1016 Ga0373925_0024207 3300037068 Bacteria 4432
1017 Ga0373925_0036229 3300037068 Bacteria 3641
1018 Ga0373925_0038812 3300037068 Bacteria 3522
1019 Ga0373925_0057058 3300037068 Bacteria 2925
1020 Ga0373925_0073022 3300037068 Bacteria 2596
1021 Ga0373925_0178500 3300037068 Bacteria 1679
1022 Ga0373925_0193557 3300037068 Bacteria 1614
1023 Ga0373925_0644593 3300037068 Bacteria 873
1024 Ga0395899_0052594 3300037312 Bacteria 3018
1025 Ga0395900_0009186 3300037418 Bacteria 10132
1026 Ga0395900_0022366 3300037418 Bacteria 6466
1027 Ga0395900_0108898 3300037418 Bacteria 2846
1028 Ga0395898_0003941 3300037466 Bacteria 16375
1029 Ga0395898_0024197 3300037466 Bacteria 6126
1030 Ga0395898_0310833 3300037466 Bacteria 1503
1031 Ga0395901_0014006 3300038443 Bacteria 8161
1032 Ga0395901_0075175 3300038443 Bacteria 3524
1033 Ga0395901_0161489 3300038443 Bacteria 2353
1034 Ga0395901_0321676 3300038443 Bacteria 1600
1035 Ga0242420_033121 3300038996 Bacteria 965
1036 Ga0436365_0109845 3300039437 Bacteria 1319
1037 Ga0436365_0497354 3300039437 Bacteria 8033
1038 Ga0436365_1614912 3300039437 Bacteria 4311
1039 Ga0436363_0961840 3300039450 Bacteria 808
1040 Ga0439453_0002489 3300041408 Bacteria 2549
1041 Ga0439461_0003514 3300041410 Bacteria 2581
1042 Ga0451835_0493760 3300041492 Bacteria 1024
1043 Ga0439441_022166 3300042001 Bacteria 1178
1044 Ga0439443_000477 3300042003 Bacteria 3560
1045 Ga0439462_0023808 3300042015 Bacteria 1606
1046 Ga0439446_0001019 3300042156 Bacteria 6142
1047 Ga0439446_0035914 3300042156 Bacteria 1447
1048 Ga0439434_0002451 3300042435 Bacteria 5395
1049 Ga0439435_0000002 3300042436 Bacteria 34816
1050 Ga0439435_0000646 3300042436 Bacteria 5729
1051 Ga0439435_0028486 3300042436 Bacteria 1502
1052 Ga0439464_0034111 3300042439 Bacteria 1434
1053 Ga0451577_0147580 3300042876 Bacteria 2115
1054 Ga0466966_0016428 3300044684 Bacteria 4891
1055 Ga0466966_0135867 3300044684 Bacteria 1504
1056 Ga0466963_0013664 3300044694 Bacteria 4992
1057 Ga0466963_0044109 3300044694 Bacteria 2935
1058 Ga0466963_0190873 3300044694 Bacteria 1431
1059 Ga0466963_0431546 3300044694 Bacteria 929
1060 Ga0453684_0283538 3300044712 Bacteria 1888
1061 Ga0453684_0669787 3300044712 Bacteria 1130
1062 Ga0466971_0008622 3300044719 Bacteria 4448
1063 Ga0466971_0156124 3300044719 Bacteria 1067
1064 Ga0466957_0034003 3300044842 Bacteria 3058
1065 Ga0466957_0121630 3300044842 Bacteria 1664
1066 Ga0466957_0373921 3300044842 Bacteria 971
1067 Ga0466959_0168004 3300045049 Bacteria 1539
1068 Ga0451576_0017130 3300045051 Bacteria 7970
1069 Ga0451576_0117936 3300045051 Bacteria 2763
1070 Ga0466958_0171884 3300045836 Bacteria 1372
1071 Ga0466958_0304967 3300045836 Bacteria 1022
1072 Ga0466967_0000135 3300045976 Bacteria 28276
1073 Ga0466967_0006741 3300045976 Bacteria 8174
1074 Ga0466967_0416209 3300045976 Bacteria 1309
1075 Ga0495617_038698 3300046452 Bacteria 1595
1076 Ga0495592_0000046 3300046454 Bacteria 117345
1077 Ga0495592_0001393 3300046454 Bacteria 16741
1078 Ga0495592_0002484 3300046454 Bacteria 13030
1079 Ga0495592_0071960 3300046454 Bacteria 2516
1080 Ga0495592_0078729 3300046454 Bacteria 2387
1081 Ga0495603_0001804 3300046455 Bacteria 12638
1082 Ga0495603_0002249 3300046455 Bacteria 11338
1083 Ga0495603_0008354 3300046455 Bacteria 6257
1084 Ga0495603_0014184 3300046455 Bacteria 4821
1085 Ga0495603_0090177 3300046455 Bacteria 1793
1086 Ga0495603_0155645 3300046455 Bacteria 1326
1087 Ga0495629_0000594 3300046459 Bacteria 29414
1088 Ga0495629_0001140 3300046459 Bacteria 20980
1089 Ga0495629_0002311 3300046459 Bacteria 14684
1090 Ga0495629_0019080 3300046459 Bacteria 4903
1091 Ga0495629_0088951 3300046459 Bacteria 2154
1092 Ga0495629_0233255 3300046459 Bacteria 1268
1093 Ga0495638_0003988 3300046460 Bacteria 11355
1094 Ga0495638_0039767 3300046460 Bacteria 2984
1095 Ga0495638_0244708 3300046460 Bacteria 991
1096 Ga0495638_0300939 3300046460 Bacteria 864
1097 Ga0495641_0007754 3300046461 Bacteria 6650
1098 Ga0495641_0011331 3300046461 Bacteria 5090
1099 Ga0495641_0017820 3300046461 Bacteria 3686
1100 Ga0495651_0000822 3300046462 Bacteria 24113
1101 Ga0495651_0004816 3300046462 Bacteria 10326
1102 Ga0495651_0047233 3300046462 Bacteria 3330
1103 Ga0495653_0000006 3300046463 Bacteria 363285
1104 Ga0495653_0004798 3300046463 Bacteria 10964
1105 Ga0495653_0024139 3300046463 Bacteria 4904
1106 Ga0495653_0037925 3300046463 Bacteria 3784
1107 Ga0495653_0290993 3300046463 Bacteria 1068
1108 Ga0495580_0017640 3300046472 Bacteria 5332
1109 Ga0495580_0034551 3300046472 Bacteria 3640
1110 Ga0495580_0057444 3300046472 Bacteria 2738
1111 Ga0495580_0074214 3300046472 Bacteria 2374
1112 Ga0495582_0000379 3300046473 Bacteria 24152
1113 Ga0495582_0010594 3300046473 Bacteria 5072
1114 Ga0495582_0028169 3300046473 Bacteria 3083
1115 Ga0495582_0161747 3300046473 Bacteria 1273
1116 Ga0495639_0004321 3300046475 Bacteria 6094
1117 Ga0495639_0038991 3300046475 Bacteria 2135
1118 Ga0495639_0046773 3300046475 Bacteria 1959
1119 Ga0495639_0067099 3300046475 Bacteria 1652
1120 Ga0495662_0000084 3300046476 Bacteria 33781
1121 Ga0495662_0002481 3300046476 Bacteria 9294
1122 Ga0495662_0027194 3300046476 Bacteria 2763
1123 Ga0495662_0051846 3300046476 Bacteria 1980
1124 Ga0495662_0237944 3300046476 Bacteria 897
1125 Ga0495664_0000002 3300046477 Bacteria 625183
1126 Ga0495664_0000112 3300046477 Bacteria 40522
1127 Ga0495664_0007745 3300046477 Bacteria 5977
1128 Ga0495664_0043029 3300046477 Bacteria 2676
1129 Ga0495664_0050575 3300046477 Bacteria 2467
1130 Ga0495584_0033756 3300046491 Bacteria 2590
1131 Ga0495584_0048021 3300046491 Bacteria 2153
1132 Ga0495585_0001932 3300046492 Bacteria 15492
1133 Ga0495585_0196692 3300046492 Bacteria 1029
1134 Ga0495594_0002726 3300046499 Bacteria 9162
1135 Ga0495594_0009110 3300046499 Bacteria 5124
1136 Ga0495594_0011284 3300046499 Bacteria 4642
1137 Ga0495594_0247839 3300046499 Bacteria 1015
1138 Ga0495607_0095599 3300046501 Bacteria 1601
1139 Ga0495608_0000006 3300046511 Bacteria 324334
1140 Ga0495608_0012927 3300046511 Bacteria 5794
1141 Ga0495608_0017846 3300046511 Bacteria 4905
1142 Ga0495608_0082397 3300046511 Bacteria 2089
1143 Ga0495618_0000034 3300046514 Bacteria 104335
1144 Ga0495618_0001016 3300046514 Bacteria 19217
1145 Ga0495618_0001547 3300046514 Bacteria 15443
1146 Ga0495618_0156557 3300046514 Bacteria 1454
1147 Ga0495620_0073308 3300046515 Bacteria 1396
1148 Ga0495628_0000002 3300046516 Bacteria 589399
1149 Ga0495628_0003624 3300046516 Bacteria 13800
1150 Ga0495628_0027943 3300046516 Bacteria 4586
1151 Ga0495628_0032270 3300046516 Bacteria 4229
1152 Ga0495628_0101756 3300046516 Bacteria 2217
1153 Ga0495630_0000662 3300046517 Bacteria 24856
1154 Ga0495630_0005622 3300046517 Bacteria 8855
1155 Ga0495630_0015890 3300046517 Bacteria 5501
1156 Ga0495630_0027968 3300046517 Bacteria 4189
1157 Ga0495630_0042264 3300046517 Bacteria 3404
1158 Ga0495637_0020521 3300046520 Bacteria 3041
1159 Ga0495643_0130553 3300046522 Bacteria 1262
1160 Ga0495644_0003085 3300046523 Bacteria 6594
1161 Ga0495666_0001508 3300046526 Bacteria 11395
1162 Ga0495666_0012392 3300046526 Bacteria 4250
1163 Ga0495666_0034119 3300046526 Bacteria 2483
1164 Ga0495666_0045397 3300046526 Bacteria 2120
1165 Ga0495652_0000004 3300046529 Bacteria 588877
1166 Ga0495652_0013904 3300046529 Bacteria 7238
1167 Ga0495652_0019057 3300046529 Bacteria 6112
1168 Ga0495652_0078363 3300046529 Bacteria 2736
1169 Ga0495665_0003909 3300046531 Bacteria 8063
1170 Ga0495665_0014689 3300046531 Bacteria 4221
1171 Ga0495665_0084846 3300046531 Bacteria 1664
1172 Ga0495665_0115799 3300046531 Bacteria 1404
1173 Ga0495665_0123334 3300046531 Bacteria 1357
1174 Ga0495665_0123478 3300046531 Bacteria 1356
1175 Ga0495640_0000007 3300046533 Bacteria 265481
1176 Ga0495640_0006199 3300046533 Bacteria 9472
1177 Ga0495640_0008881 3300046533 Bacteria 7849
1178 Ga0495640_0010455 3300046533 Bacteria 7168
1179 Ga0495640_0050524 3300046533 Bacteria 2864
1180 Ga0495640_0113463 3300046533 Bacteria 1768
1181 Ga0495586_0032879 3300046535 Bacteria 2782
1182 Ga0495586_0097810 3300046535 Bacteria 1626
1183 Ga0495586_0177186 3300046535 Bacteria 1205
1184 Ga0495587_0000031 3300046536 Bacteria 126721
1185 Ga0495587_0002979 3300046536 Bacteria 11321
1186 Ga0495587_0016339 3300046536 Bacteria 4618
1187 Ga0495587_0179519 3300046536 Bacteria 1201
1188 Ga0495598_0004396 3300046537 Bacteria 3048
1189 Ga0495598_0050085 3300046537 Bacteria 1254
1190 Ga0495609_0065459 3300046538 Bacteria 1602
1191 Ga0495609_0132914 3300046538 Bacteria 1065
1192 Ga0495645_0000003 3300046543 Bacteria 570133
1193 Ga0495645_0005275 3300046543 Bacteria 8852
1194 Ga0495645_0010875 3300046543 Bacteria 6391
1195 Ga0495645_0011025 3300046543 Bacteria 6352
1196 Ga0495645_0125919 3300046543 Bacteria 1800
1197 Ga0495645_0128951 3300046543 Bacteria 1775
1198 Ga0495622_0013050 3300046557 Bacteria 3855
1199 Ga0495622_0049494 3300046557 Bacteria 1951
1200 Ga0495633_0071043 3300046558 Bacteria 1624
1201 Ga0495667_0000002 3300046559 Bacteria 437535
1202 Ga0495667_0000202 3300046559 Bacteria 40046
1203 Ga0495667_0000365 3300046559 Bacteria 28797
1204 Ga0495667_0111739 3300046559 Bacteria 1765
1205 Ga0495667_0188265 3300046559 Bacteria 1323
1206 Ga0495667_0273622 3300046559 Bacteria 1073
1207 Ga0495656_0000360 3300046615 Bacteria 15300
1208 Ga0495634_0000533 3300046642 Bacteria 37336
1209 Ga0495634_0003620 3300046642 Bacteria 12342
1210 Ga0495634_0008544 3300046642 Bacteria 7612
1211 Ga0495634_0021460 3300046642 Bacteria 4564
1212 Ga0495611_0157480 3300046648 Bacteria 1061
1213 Ga0495635_0000022 3300046663 Bacteria 160907
1214 Ga0495635_0000981 3300046663 Bacteria 18808
1215 Ga0495635_0004867 3300046663 Bacteria 9345
1216 Ga0495635_0013894 3300046663 Bacteria 5633
1217 Ga0495635_0081639 3300046663 Bacteria 2212
1218 Ga0495659_0098745 3300046664 Bacteria 1129
1219 Ga0495659_0117966 3300046664 Bacteria 1042
1220 Ga0495661_0010683 3300046665 Bacteria 6254
1221 Ga0495588_0019668 3300046674 Bacteria 3310
1222 Ga0495588_0075208 3300046674 Bacteria 1759
1223 Ga0495588_0090074 3300046674 Bacteria 1606
1224 Ga0495588_0092431 3300046674 Bacteria 1585
1225 Ga0495657_0000276 3300046675 Bacteria 46295
1226 Ga0495657_0031463 3300046675 Bacteria 3709
1227 Ga0495657_0045253 3300046675 Bacteria 2988
1228 Ga0495599_0000001 3300046678 Bacteria 537563
1229 Ga0495599_0002835 3300046678 Bacteria 10095
1230 Ga0495599_0046540 3300046678 Bacteria 2720
1231 Ga0495623_0000094 3300046679 Bacteria 53328
1232 Ga0495623_0001448 3300046679 Bacteria 16089
1233 Ga0495623_0204206 3300046679 Bacteria 1134
1234 Ga0495646_0000007 3300046680 Bacteria 236764
1235 Ga0495646_0002316 3300046680 Bacteria 11659
1236 Ga0495646_0061367 3300046680 Bacteria 2239
1237 Ga0495647_0000122 3300046681 Bacteria 19930
1238 Ga0495647_0000393 3300046681 Bacteria 12484
1239 Ga0495647_0001922 3300046681 Bacteria 6479
1240 Ga0495647_0052367 3300046681 Bacteria 1589
1241 Ga0495658_0000210 3300046683 Bacteria 33648
1242 Ga0495658_0005298 3300046683 Bacteria 6345
1243 Ga0495658_0009937 3300046683 Bacteria 4747
1244 Ga0495658_0014265 3300046683 Bacteria 4057
1245 Ga0495658_0026729 3300046683 Bacteria 3096
1246 Ga0495658_0041879 3300046683 Bacteria 2554
1247 Ga0495658_0148403 3300046683 Bacteria 1439
1248 Ga0495658_0295200 3300046683 Bacteria 1024
1249 Ga0495669_0028471 3300046684 Bacteria 2448
1250 Ga0495669_0040626 3300046684 Bacteria 2064
1251 Ga0495613_0018397 3300046689 Bacteria 5211
1252 Ga0495613_0056650 3300046689 Bacteria 2878
1253 Ga0495613_0083862 3300046689 Bacteria 2314
1254 Ga0495613_0182607 3300046689 Bacteria 1485
1255 Ga0495613_0288357 3300046689 Bacteria 1138
1256 Ga0495624_0000222 3300046690 Bacteria 44293
1257 Ga0495624_0001294 3300046690 Bacteria 19719
1258 Ga0495624_0020416 3300046690 Bacteria 4410
1259 Ga0495624_0034304 3300046690 Bacteria 3283
1260 Ga0495624_0063300 3300046690 Bacteria 2312
1261 Ga0495624_0091603 3300046690 Bacteria 1875
1262 Ga0495624_0096687 3300046690 Bacteria 1819
1263 Ga0495624_0184177 3300046690 Bacteria 1272
1264 Ga0495670_0001624 3300046691 Bacteria 11000
1265 Ga0495600_0000033 3300046809 Bacteria 83590
1266 Ga0495600_0000506 3300046809 Bacteria 20198
1267 Ga0495600_0002658 3300046809 Bacteria 10329
1268 Ga0495600_0030323 3300046809 Bacteria 3503
1269 Ga0495581_0005193 3300047315 Bacteria 7534
1270 Ga0495581_0005649 3300047315 Bacteria 7252
1271 Ga0495581_0020808 3300047315 Bacteria 3806
1272 Ga0495581_0205382 3300047315 Bacteria 1152
1273 Ga0495604_0000005 3300047317 Bacteria 424516
1274 Ga0495604_0001089 3300047317 Bacteria 22540
1275 Ga0495604_0002751 3300047317 Bacteria 14105
1276 Ga0495604_0007025 3300047317 Bacteria 8925
1277 Ga0495604_0082269 3300047317 Bacteria 2408
1278 Ga0495674_0000003 3300047319 Bacteria 562126
1279 Ga0495674_0001490 3300047319 Bacteria 22945
1280 Ga0495674_0001513 3300047319 Bacteria 22779
1281 Ga0495674_0014630 3300047319 Bacteria 7343
1282 Ga0495674_0406574 3300047319 Bacteria 1098
1283 Ga0495672_0127450 3300047320 Bacteria 1344
1284 Ga0495672_0211159 3300047320 Bacteria 964
1285 Ga0495676_0000289 3300047321 Bacteria 40718
1286 Ga0495676_0021676 3300047321 Bacteria 5605
1287 Ga0495676_0079695 3300047321 Bacteria 2489
1288 Ga0495676_0096501 3300047321 Bacteria 2197
1289 Ga0495676_0130099 3300047321 Bacteria 1818
1290 Ga0495676_0171305 3300047321 Bacteria 1528
1291 Ga0495680_0000091 3300047322 Bacteria 81622
1292 Ga0495680_0001414 3300047322 Bacteria 25878
1293 Ga0495680_0012301 3300047322 Bacteria 7541
1294 Ga0495680_0018026 3300047322 Bacteria 6007
1295 Ga0495680_0037109 3300047322 Bacteria 3906
1296 Ga0495680_0072323 3300047322 Bacteria 2623
1297 Ga0495675_0000064 3300047444 Bacteria 74132
1298 Ga0495675_0063292 3300047444 Bacteria 2341
1299 Ga0495679_046890 3300047446 Bacteria 1313
1300 Ga0495684_0000035 3300047471 Bacteria 107768
1301 Ga0495684_0000075 3300047471 Bacteria 67922
1302 Ga0495684_0000264 3300047471 Bacteria 41677
1303 Ga0495684_0001309 3300047471 Bacteria 20014
1304 Ga0495684_0041943 3300047471 Bacteria 3506
1305 Ga0495684_0073421 3300047471 Bacteria 2599
1306 Ga0495684_0128149 3300047471 Bacteria 1908
1307 Ga0495684_0383201 3300047471 Bacteria 991
1308 Ga0495686_0172416 3300047472 Bacteria 1258
1309 Ga0495593_0000228 3300047673 Bacteria 30037
1310 Ga0495593_0001106 3300047673 Bacteria 15737
1311 Ga0495593_0014059 3300047673 Bacteria 4556
1312 Ga0495593_0020031 3300047673 Bacteria 3746
1313 Ga0495602_0000029 3300048088 Bacteria 142344
1314 Ga0495602_0002033 3300048088 Bacteria 20344
1315 Ga0495602_0018847 3300048088 Bacteria 6872
1316 Ga0495602_0460889 3300048088 Bacteria 895
1317 Ga0495614_0017130 3300048089 Bacteria 3149
1318 Ga0495614_0024948 3300048089 Bacteria 2580
1319 Ga0495614_0118009 3300048089 Bacteria 1168
1320 Ga0496100_0000404 3300048903 Bacteria 20908
1321 Ga0496100_0000823 3300048903 Bacteria 14892
1322 Ga0496100_0006720 3300048903 Bacteria 6298
1323 Ga0496100_0017884 3300048903 Bacteria 4194
1324 Ga0496100_0032334 3300048903 Bacteria 3262
1325 Ga0496100_0265535 3300048903 Bacteria 1274
1326 Ga0496100_0305060 3300048903 Bacteria 1192
1327 Ga0496100_0322698 3300048903 Bacteria 1160
1328 Ga0496101_0000423 3300048904 Bacteria 27228
1329 Ga0496101_0013330 3300048904 Bacteria 5504
1330 Ga0496101_0051874 3300048904 Bacteria 2956
1331 Ga0496101_0090963 3300048904 Bacteria 2270
1332 Ga0496102_0003323 3300048905 Bacteria 13636
1333 Ga0496102_0017907 3300048905 Bacteria 6213
1334 Ga0496102_0050819 3300048905 Bacteria 3775
1335 Ga0496102_0137970 3300048905 Bacteria 2285
1336 Ga0496102_0216909 3300048905 Bacteria 1803
1337 Ga0496102_0362586 3300048905 Bacteria 1364
1338 Ga0496102_0443883 3300048905 Bacteria 1217
1339 Ga0496102_0726698 3300048905 Bacteria 916
1340 Ga0496103_0000967 3300048906 Bacteria 20341
1341 Ga0496103_0009318 3300048906 Bacteria 5817
1342 Ga0496103_0023575 3300048906 Bacteria 3712
1343 Ga0496103_0085283 3300048906 Bacteria 1990
1344 Ga0496104_0000711 3300048907 Bacteria 28620
1345 Ga0496104_0000925 3300048907 Bacteria 25187
1346 Ga0496104_0005217 3300048907 Bacteria 11362
1347 Ga0496104_0005466 3300048907 Bacteria 11129
1348 Ga0496104_0014835 3300048907 Bacteria 7042
1349 Ga0496104_0018532 3300048907 Bacteria 6351
1350 Ga0496104_0018853 3300048907 Bacteria 6302
1351 Ga0496104_0036022 3300048907 Bacteria 4622
1352 Ga0496104_0037286 3300048907 Bacteria 4546
1353 Ga0496104_0101035 3300048907 Bacteria 2761
1354 Ga0496104_0144331 3300048907 Bacteria 2286
1355 Ga0496104_0166636 3300048907 Bacteria 2113
1356 Ga0496104_0181717 3300048907 Bacteria 2014
1357 Ga0496104_0307758 3300048907 Bacteria 1497
1358 Ga0496104_0319118 3300048907 Bacteria 1466
1359 Ga0496105_0004562 3300048908 Bacteria 10431
1360 Ga0496105_0010049 3300048908 Bacteria 7427
1361 Ga0496105_0025218 3300048908 Bacteria 4837
1362 Ga0496105_0055857 3300048908 Bacteria 3260
1363 Ga0496105_0079464 3300048908 Bacteria 2708
1364 Ga0496105_0081682 3300048908 Bacteria 2669
1365 Ga0496105_0110294 3300048908 Bacteria 2271
1366 Ga0496105_0172070 3300048908 Bacteria 1775
1367 Ga0496105_0197097 3300048908 Bacteria 1645
1368 Ga0496105_0213306 3300048908 Bacteria 1573
1369 Ga0496105_0536570 3300048908 Bacteria 915
1370 Ga0496106_0002446 3300048909 Bacteria 13839
1371 Ga0496106_0003669 3300048909 Bacteria 11448
1372 Ga0496106_0005520 3300048909 Bacteria 9359
1373 Ga0496106_0009344 3300048909 Bacteria 7247
1374 Ga0496106_0015174 3300048909 Bacteria 5701
1375 Ga0496106_0017560 3300048909 Bacteria 5294
1376 Ga0496106_0046079 3300048909 Bacteria 3277
1377 Ga0496106_0138098 3300048909 Bacteria 1916
1378 Ga0496106_0204770 3300048909 Bacteria 1571
1379 Ga0496106_0278662 3300048909 Bacteria 1339
1380 Ga0496106_0346450 3300048909 Bacteria 1193
1381 Ga0496107_0000500 3300048910 Bacteria 21655
1382 Ga0496107_0021517 3300048910 Bacteria 4558
1383 Ga0496107_0036271 3300048910 Bacteria 3536
1384 Ga0496107_0046339 3300048910 Bacteria 3129
1385 Ga0496107_0130304 3300048910 Bacteria 1856
1386 Ga0496107_0194999 3300048910 Bacteria 1505
1387 Ga0496107_0222895 3300048910 Bacteria 1403
1388 Ga0496107_0265173 3300048910 Bacteria 1278
1389 Ga0496108_0032769 3300048911 Bacteria 4315
1390 Ga0496108_0039555 3300048911 Bacteria 3930
1391 Ga0496108_0048346 3300048911 Bacteria 3556
1392 Ga0496108_0086431 3300048911 Bacteria 2662
1393 Ga0496108_0137032 3300048911 Bacteria 2107
1394 Ga0496108_0227952 3300048911 Bacteria 1619
1395 Ga0496109_0000340 3300048912 Bacteria 43565
1396 Ga0496109_0000359 3300048912 Bacteria 42297
1397 Ga0496109_0000976 3300048912 Bacteria 23658
1398 Ga0496109_0005940 3300048912 Bacteria 10246
1399 Ga0496109_0015600 3300048912 Bacteria 6625
1400 Ga0496109_0017045 3300048912 Bacteria 6358
1401 Ga0496109_0060588 3300048912 Bacteria 3458
1402 Ga0496109_0142769 3300048912 Bacteria 2239
1403 Ga0496109_0191932 3300048912 Bacteria 1920
1404 Ga0496109_0367970 3300048912 Bacteria 1358
1405 Ga0496109_0411173 3300048912 Bacteria 1278
1406 Ga0496110_0002357 3300048913 Bacteria 14148
1407 Ga0496110_0003362 3300048913 Bacteria 12213
1408 Ga0496110_0014914 3300048913 Bacteria 6458
1409 Ga0496110_0020674 3300048913 Bacteria 5559
1410 Ga0496110_0022973 3300048913 Bacteria 5301
1411 Ga0496110_0027384 3300048913 Bacteria 4886
1412 Ga0496110_0034978 3300048913 Bacteria 4355
1413 Ga0496110_0054089 3300048913 Bacteria 3531
1414 Ga0496110_0061174 3300048913 Bacteria 3323
1415 Ga0496110_0122134 3300048913 Bacteria 2347
1416 Ga0496110_0269120 3300048913 Bacteria 1551
1417 Ga0496110_0444018 3300048913 Bacteria 1182
1418 Ga0496111_0013977 3300048914 Bacteria 5475
1419 Ga0496111_0021239 3300048914 Bacteria 4530
1420 Ga0496111_0023917 3300048914 Bacteria 4294
1421 Ga0496111_0030852 3300048914 Bacteria 3814
1422 Ga0496111_0040590 3300048914 Bacteria 3338
1423 Ga0496111_0069085 3300048914 Bacteria 2569
1424 Ga0496111_0156658 3300048914 Bacteria 1690
1425 Ga0496111_0171207 3300048914 Bacteria 1613
1426 Ga0496112_0021049 3300048915 Bacteria 6194
1427 Ga0496112_0044120 3300048915 Bacteria 4367
1428 Ga0496112_0051703 3300048915 Bacteria 4030
1429 Ga0496112_0061635 3300048915 Bacteria 3698
1430 Ga0496112_0078758 3300048915 Bacteria 3259
1431 Ga0496112_0302782 3300048915 Bacteria 1544
1432 Ga0496113_0001950 3300048916 Bacteria 11812
1433 Ga0496113_0002665 3300048916 Bacteria 10463
1434 Ga0496113_0008785 3300048916 Bacteria 6598
1435 Ga0496113_0008826 3300048916 Bacteria 6585
1436 Ga0496113_0129705 3300048916 Bacteria 1977
1437 Ga0496113_0199278 3300048916 Bacteria 1591
1438 Ga0496113_0348048 3300048916 Bacteria 1188
1439 Ga0496114_0046871 3300048917 Bacteria 3592
1440 Ga0496114_0111990 3300048917 Bacteria 2339
1441 Ga0496114_0137536 3300048917 Bacteria 2113
1442 Ga0496114_0242600 3300048917 Bacteria 1585
1443 Ga0496114_0284430 3300048917 Bacteria 1458
1444 Ga0496114_0380195 3300048917 Bacteria 1250
1445 Ga0496114_0428142 3300048917 Bacteria 1172
1446 Ga0496115_0009549 3300048918 Bacteria 7206
1447 Ga0496115_0019987 3300048918 Bacteria 5160
1448 Ga0496115_0073699 3300048918 Bacteria 2771
1449 Ga0496115_0080355 3300048918 Bacteria 2654
1450 Ga0496115_0088771 3300048918 Bacteria 2525
1451 Ga0496115_0096761 3300048918 Bacteria 2417
1452 Ga0496115_0101996 3300048918 Bacteria 2353
1453 Ga0496115_0127875 3300048918 Bacteria 2093
1454 Ga0496115_0173197 3300048918 Bacteria 1784
1455 Ga0496115_0263324 3300048918 Bacteria 1417
1456 Ga0496115_0271117 3300048918 Bacteria 1394
1457 Ga0496115_0333853 3300048918 Bacteria 1238
1458 Ga0496115_0366312 3300048918 Bacteria 1173
1459 Ga0501031_0055503 3300049568 Bacteria 2581
1460 Ga0501031_0079391 3300049568 Bacteria 2138
1461 Ga0501032_0148159 3300049569 Bacteria 1544
1462 Ga0501033_0044445 3300049570 Bacteria 3307
1463 Ga0501033_0075440 3300049570 Bacteria 2474
1464 Ga0501033_0215081 3300049570 Bacteria 1370
1465 Ga0501034_0001160 3300049571 Bacteria 36511
1466 Ga0501034_0006692 3300049571 Bacteria 12361
1467 Ga0501034_0029366 3300049571 Bacteria 5588
1468 Ga0501034_0198853 3300049571 Bacteria 1963
1469 Ga0501036_0018021 3300049572 Bacteria 5912
1470 Ga0501036_0043532 3300049572 Bacteria 3802
1471 Ga0501036_0090209 3300049572 Bacteria 2589
1472 Ga0501036_0282535 3300049572 Bacteria 1389
1473 Ga0501036_0309725 3300049572 Bacteria 1320
1474 Ga0501036_0350203 3300049572 Bacteria 1233
1475 Ga0501037_0026526 3300049573 Bacteria 4282
1476 Ga0501037_0071272 3300049573 Bacteria 2528
1477 Ga0501037_0220440 3300049573 Bacteria 1335
1478 Ga0501038_0000775 3300049574 Bacteria 28264
1479 Ga0501038_0076041 3300049574 Bacteria 2837
1480 Ga0501038_0173956 3300049574 Bacteria 1741
1481 Ga0501038_0255938 3300049574 Bacteria 1385
1482 Ga0501038_0598462 3300049574 Bacteria 834
1483 Ga0501039_0099388 3300049575 Bacteria 2270
1484 Ga0501039_0232807 3300049575 Bacteria 1448
1485 Ga0501040_0009567 3300049576 Bacteria 6324
1486 Ga0501040_0012594 3300049576 Bacteria 5545
1487 Ga0501040_0018457 3300049576 Bacteria 4631
1488 Ga0501040_0318735 3300049576 Bacteria 1112
1489 Ga0501040_0390174 3300049576 Bacteria 999
1490 Ga0501040_0452266 3300049576 Bacteria 924
1491 Ga0501041_0017024 3300049577 Bacteria 4325
1492 Ga0501041_0027793 3300049577 Bacteria 3410
1493 Ga0501041_0107756 3300049577 Bacteria 1728
1494 Ga0501041_0125194 3300049577 Bacteria 1599
1495 Ga0501041_0213223 3300049577 Bacteria 1211
1496 Ga0501042_0059716 3300049578 Bacteria 2723
1497 Ga0501042_0196918 3300049578 Bacteria 1453
1498 Ga0501042_0202099 3300049578 Bacteria 1433
1499 Ga0501042_0228284 3300049578 Bacteria 1343
1500 Ga0501042_0281813 3300049578 Bacteria 1200
1501 Ga0501043_0050356 3300049579 Bacteria 3274
1502 Ga0501043_0087879 3300049579 Bacteria 2442
1503 Ga0501043_0193664 3300049579 Bacteria 1580
1504 Ga0501046_0039215 3300049580 Bacteria 3795
1505 Ga0501046_0043437 3300049580 Bacteria 3578
1506 Ga0501046_0044144 3300049580 Bacteria 3545
1507 Ga0501046_0216539 3300049580 Bacteria 1420
1508 Ga0501046_0252265 3300049580 Bacteria 1298
1509 Ga0501046_0324833 3300049580 Bacteria 1121
1510 Ga0501047_0006347 3300049581 Bacteria 11116
1511 Ga0501047_0009067 3300049581 Bacteria 9395
1512 Ga0501047_0018859 3300049581 Bacteria 6617
1513 Ga0501047_0612500 3300049581 Bacteria 910
1514 Ga0501048_0016432 3300049582 Bacteria 5454
1515 Ga0501048_0105395 3300049582 Bacteria 1990
1516 Ga0501048_0195551 3300049582 Bacteria 1434
1517 Ga0501048_0371157 3300049582 Bacteria 1021
1518 Ga0501048_0405454 3300049582 Bacteria 975
1519 Ga0501067_0044703 3300049583 Bacteria 2460
1520 Ga0501067_0117104 3300049583 Bacteria 1482
1521 Ga0501067_0202144 3300049583 Bacteria 1107
1522 Ga0501068_0070612 3300049584 Bacteria 2130
1523 Ga0501068_0264327 3300049584 Bacteria 1098
1524 Ga0501069_0046105 3300049585 Bacteria 2417
1525 Ga0501070_0003185 3300049586 Bacteria 14271
1526 Ga0501070_0004846 3300049586 Bacteria 11495
1527 Ga0501070_0027193 3300049586 Bacteria 4799
1528 Ga0501070_0056684 3300049586 Bacteria 3248
1529 Ga0501070_0097024 3300049586 Bacteria 2438
1530 Ga0501070_0113855 3300049586 Bacteria 2235
1531 Ga0501070_0172111 3300049586 Bacteria 1783
1532 Ga0501070_0471341 3300049586 Bacteria 1011
1533 Ga0501070_0580399 3300049586 Bacteria 895
1534 Ga0501071_0050634 3300049587 Bacteria 2992
1535 Ga0501071_0095714 3300049587 Bacteria 2185
1536 Ga0501071_0216273 3300049587 Bacteria 1442
1537 Ga0501071_0424840 3300049587 Bacteria 1016
1538 Ga0501072_0030502 3300049588 Bacteria 4218
1539 Ga0501072_0067915 3300049588 Bacteria 2813
1540 Ga0501072_0071741 3300049588 Bacteria 2737
1541 Ga0501072_0099576 3300049588 Bacteria 2311
1542 Ga0501072_0106645 3300049588 Bacteria 2228
1543 Ga0501072_0356005 3300049588 Bacteria 1162
1544 Ga0501072_0420071 3300049588 Bacteria 1060
1545 Ga0501073_0029987 3300049589 Bacteria 3885
1546 Ga0501073_0057334 3300049589 Bacteria 2723
1547 Ga0501073_0192902 3300049589 Bacteria 1410
1548 Ga0501073_0261578 3300049589 Bacteria 1194
1549 Ga0501073_0281551 3300049589 Bacteria 1147
1550 Ga0501073_0546123 3300049589 Bacteria 801
1551 Ga0501074_0060566 3300049590 Bacteria 2727
1552 Ga0501074_0073296 3300049590 Bacteria 2460
1553 Ga0501074_0180182 3300049590 Bacteria 1507
1554 Ga0501074_0575730 3300049590 Bacteria 797
1555 Ga0501075_0004734 3300049591 Bacteria 9250
1556 Ga0501075_0005155 3300049591 Bacteria 8937
1557 Ga0501075_0098564 3300049591 Bacteria 2219
1558 Ga0501075_0124053 3300049591 Bacteria 1966
1559 Ga0501075_0125334 3300049591 Bacteria 1955
1560 Ga0501075_0161886 3300049591 Bacteria 1707
1561 Ga0501076_0001405 3300049592 Bacteria 16125
1562 Ga0501076_0216486 3300049592 Bacteria 1566
1563 Ga0501076_0420225 3300049592 Bacteria 1100
1564 Ga0501077_0007341 3300049593 Bacteria 6798
1565 Ga0501077_0034622 3300049593 Bacteria 3214
1566 Ga0501077_0105319 3300049593 Bacteria 1788
1567 Ga0501077_0183791 3300049593 Bacteria 1328
1568 Ga0501077_0282036 3300049593 Bacteria 1058
1569 Ga0501077_0378527 3300049593 Bacteria 904
1570 Ga0501079_0003233 3300049741 Bacteria 11932
1571 Ga0501079_0040616 3300049741 Bacteria 3589
1572 Ga0501079_0118163 3300049741 Bacteria 2061
1573 Ga0501079_0173252 3300049741 Bacteria 1682
1574 Ga0501079_0498850 3300049741 Bacteria 957
1575 Ga0501080_0021206 3300049742 Bacteria 6013
1576 Ga0501080_0028713 3300049742 Bacteria 5178
1577 Ga0501080_0064534 3300049742 Bacteria 3405
1578 Ga0501080_0083911 3300049742 Bacteria 2960
1579 Ga0501080_0096741 3300049742 Bacteria 2741
1580 Ga0501080_0140519 3300049742 Bacteria 2233
1581 Ga0501080_0259554 3300049742 Bacteria 1583
1582 Ga0501080_0260592 3300049742 Bacteria 1580
1583 Ga0501080_0284670 3300049742 Bacteria 1502
1584 Ga0501080_0504713 3300049742 Bacteria 1081
1585 Ga0501081_0001767 3300049743 Bacteria 13415
1586 Ga0501081_0010499 3300049743 Bacteria 6045
1587 Ga0501081_0010888 3300049743 Bacteria 5945
1588 Ga0501081_0038168 3300049743 Bacteria 3280
1589 Ga0501081_0055859 3300049743 Bacteria 2728
1590 Ga0501081_0400901 3300049743 Bacteria 1015
1591 Ga0501083_0057931 3300049744 Bacteria 2593
1592 Ga0501083_0104465 3300049744 Bacteria 1866
1593 Ga0501083_0240612 3300049744 Bacteria 1178
1594 Ga0501035_0000127 3300049822 Bacteria 92397
1595 Ga0501035_0005073 3300049822 Bacteria 12482
1596 Ga0501035_0022579 3300049822 Bacteria 5779
1597 Ga0501035_0025523 3300049822 Bacteria 5416
1598 Ga0501035_0068477 3300049822 Bacteria 3147
1599 Ga0501035_0294443 3300049822 Bacteria 1369
1600 Ga0501044_0001312 3300049823 Bacteria 29308
1601 Ga0501044_0008177 3300049823 Bacteria 11483
1602 Ga0501044_0023098 3300049823 Bacteria 6621
1603 Ga0501044_0030205 3300049823 Bacteria 5712
1604 Ga0501044_0088157 3300049823 Bacteria 3133
1605 Ga0501044_0117406 3300049823 Bacteria 2664
1606 Ga0501044_0147701 3300049823 Bacteria 2335
1607 Ga0501044_0163053 3300049823 Bacteria 2204
1608 Ga0501044_0281404 3300049823 Bacteria 1597
1609 Ga0501044_0309288 3300049823 Bacteria 1507
1610 Ga0501045_0018155 3300049824 Bacteria 4999
1611 Ga0501045_0026472 3300049824 Bacteria 4172
1612 Ga0501045_0089530 3300049824 Bacteria 2273
1613 nmdc:mga03683_4783_c1 3300050489 Bacteria 4521
1614 nmdc:mga00v17_196983_c1 3300050491 Bacteria 1302
1615 nmdc:mga00v17_4490_c1 3300050491 Bacteria 7264
1616 nmdc:mga0yw44_114460_c1 3300050492 Bacteria 1274
1617 nmdc:mga0yw44_23841_c1 3300050492 Bacteria 3453
1618 nmdc:mga0yw44_89401_c1 3300050492 Bacteria 1943
1619 nmdc:mga0k408_2408_c1 3300050493 Bacteria 9952
1620 nmdc:mga06z11_124102_c1 3300050494 Bacteria 1443
1621 nmdc:mga06z11_137595_c1 3300050494 Bacteria 1377
1622 nmdc:mga06z11_23201_c1 3300050494 Bacteria 2911
1623 nmdc:mga06z11_343661_c1 3300050494 Bacteria 892
1624 nmdc:mga06z11_70741_c1 3300050494 Bacteria 1845
1625 nmdc:mga04h51_83923_c1 3300050495 Bacteria 1135
1626 nmdc:mga05p37_108365_c1 3300050507 Bacteria 3417
1627 nmdc:mga05p37_148901_c1 3300050507 Bacteria 2865
1628 nmdc:mga05p37_1808_c2 3300050507 Bacteria 13333
1629 nmdc:mga05p37_450398_c1 3300050507 Bacteria 1490
1630 nmdc:mga05p37_45950_c1 3300050507 Bacteria 5370
1631 nmdc:mga05p37_508_c2 3300050507 Bacteria 7955
1632 nmdc:mga05p37_75031_c1 3300050507 Bacteria 4163
1633 nmdc:mga05p37_90850_c1 3300050507 Bacteria 3763
1634 nmdc:mga09592_141748_c1 3300050508 Bacteria 2072
1635 nmdc:mga09592_30039_c1 3300050508 Bacteria 4523
1636 nmdc:mga09592_469785_c1 3300050508 Bacteria 1084
1637 nmdc:mga09592_5057_c1 3300050508 Bacteria 10702
1638 nmdc:mga09592_92656_c1 3300050508 Bacteria 2583
1639 nmdc:mga0qj67_115940_c1 3300050509 Bacteria 2165
1640 nmdc:mga0qj67_119224_c1 3300050509 Bacteria 2134
1641 nmdc:mga0qj67_130809_c1 3300050509 Bacteria 2033
1642 nmdc:mga0qj67_15510_c1 3300050509 Bacteria 5769
1643 nmdc:mga0qj67_169352_c1 3300050509 Bacteria 1773
1644 nmdc:mga0qj67_52_c1 3300050509 Bacteria 84067
1645 nmdc:mga0qj67_72452_c1 3300050509 Bacteria 2751
1646 nmdc:mga06r32_105218_c1 3300050510 Bacteria 2772
1647 nmdc:mga06r32_146979_c1 3300050510 Bacteria 2334
1648 nmdc:mga06r32_1960_c1 3300050510 Bacteria 18367
1649 nmdc:mga06r32_230180_c1 3300050510 Bacteria 1841
1650 nmdc:mga06r32_236166_c1 3300050510 Bacteria 1816
1651 nmdc:mga06r32_33897_c1 3300050510 Bacteria 4812
1652 nmdc:mga06r32_3441_c1 3300050510 Bacteria 14162
1653 nmdc:mga06r32_34449_c1 3300050510 Bacteria 4774
1654 nmdc:mga06r32_489666_c1 3300050510 Bacteria 1207
1655 nmdc:mga06r32_53801_c1 3300050510 Bacteria 3858
1656 nmdc:mga08y16_14675_c1 3300050511 Bacteria 8238
1657 nmdc:mga08y16_2332_c1 3300050511 Bacteria 19466
1658 nmdc:mga08y16_283486_c1 3300050511 Bacteria 1708
1659 nmdc:mga08y16_290441_c1 3300050511 Bacteria 1686
1660 nmdc:mga08y16_30278_c1 3300050511 Bacteria 5698
1661 nmdc:mga08y16_3146_c1 3300050511 Bacteria 17090
1662 nmdc:mga08y16_3939_c1 3300050511 Bacteria 15466
1663 nmdc:mga08y16_63381_c1 3300050511 Bacteria 3860
1664 nmdc:mga08y16_75718_c1 3300050511 Bacteria 3508
1665 nmdc:mga08y16_8982_c1 3300050511 Bacteria 10497
1666 nmdc:mga08y16_9215_c1 3300050511 Bacteria 10357
1667 nmdc:mga0n895_145_c1 3300050512 Bacteria 43408
1668 nmdc:mga0n895_159698_c1 3300050512 Bacteria 2285
1669 nmdc:mga0n895_193711_c1 3300050512 Bacteria 2064
1670 nmdc:mga0n895_336958_c1 3300050512 Bacteria 1528
1671 nmdc:mga0n895_37534_c1 3300050512 Bacteria 4688
1672 nmdc:mga0n895_414424_c1 3300050512 Bacteria 1362
1673 nmdc:mga0n895_4696_c1 3300050512 Bacteria 11271
1674 nmdc:mga0n895_475845_c1 3300050512 Bacteria 1260
1675 nmdc:mga0n895_620401_c1 3300050512 Bacteria 1082
1676 nmdc:mga0n895_69426_c1 3300050512 Bacteria 3491
1677 nmdc:mga0n895_697_c1 3300050512 Bacteria 23592
1678 nmdc:mga0n895_79449_c1 3300050512 Bacteria 3267
1679 nmdc:mga0rr50_115821_c1 3300050513 Bacteria 2127
1680 nmdc:mga0rr50_161239_c1 3300050513 Bacteria 1820
1681 nmdc:mga0rr50_1966_c1 3300050513 Bacteria 11411
1682 nmdc:mga0rr50_25674_c1 3300050513 Bacteria 4099
1683 nmdc:mga0rr50_2684_c1 3300050513 Bacteria 10078
1684 nmdc:mga0rr50_26927_c1 3300050513 Bacteria 4020
1685 nmdc:mga0rr50_42859_c1 3300050513 Bacteria 3308
1686 nmdc:mga0rr50_48815_c1 3300050513 Bacteria 3131
1687 nmdc:mga0rr50_59705_c1 3300050513 Bacteria 2865
1688 nmdc:mga0rr50_617932_c1 3300050513 Bacteria 924
1689 nmdc:mga08x19_1133_c1 3300050514 Bacteria 16621
1690 nmdc:mga08x19_116183_c1 3300050514 Bacteria 1789
1691 nmdc:mga08x19_24255_c1 3300050514 Bacteria 3768
1692 nmdc:mga08x19_274819_c1 3300050514 Bacteria 1166
1693 nmdc:mga08x19_291574_c1 3300050514 Bacteria 1132
1694 nmdc:mga08x19_33203_c1 3300050514 Bacteria 3256
1695 nmdc:mga08x19_33421_c1 3300050514 Bacteria 3246
1696 nmdc:mga08x19_386216_c1 3300050514 Bacteria 981
1697 nmdc:mga08x19_3872_c1 3300050514 Bacteria 8905
1698 nmdc:mga0a205_127802_c1 3300050515 Bacteria 1639
1699 nmdc:mga0a205_17080_c2 3300050515 Bacteria 3784
1700 nmdc:mga0a205_18201_c1 3300050515 Bacteria 6599
1701 nmdc:mga0a205_1921_c1 3300050515 Bacteria 18059
1702 nmdc:mga0a205_2724_c1 3300050515 Bacteria 15622
1703 nmdc:mga0a205_297338_c1 3300050515 Bacteria 1488
1704 nmdc:mga0a205_435226_c1 3300050515 Bacteria 1173
1705 nmdc:mga0a205_44400_c1 3300050515 Bacteria 4284
1706 Ga0495601_0000008 3300053077 Bacteria 362152
1707 Ga0495601_0001042 3300053077 Bacteria 15154
1708 Ga0495601_0001925 3300053077 Bacteria 11619
1709 Ga0495601_0004619 3300053077 Bacteria 7965
1710 Ga0495601_0029283 3300053077 Bacteria 3414
1711 Ga0495601_0044685 3300053077 Bacteria 2784
1712 Ga0495601_0094550 3300053077 Bacteria 1926
1713 Ga0495601_0096670 3300053077 Bacteria 1905
1714 Ga0495601_0113370 3300053077 Bacteria 1757
1715 Ga0495601_0460018 3300053077 Bacteria 822
1716 Ga0495612_0000026 3300053078 Bacteria 111627
1717 Ga0495612_0000308 3300053078 Bacteria 19880
1718 Ga0495612_0000858 3300053078 Bacteria 12361
1719 Ga0495612_0012643 3300053078 Bacteria 3403
1720 Ga0495612_0032977 3300053078 Bacteria 2094
1721 Ga0495612_0140718 3300053078 Bacteria 1046
1722 Ga0495595_0000024 3300053084 Bacteria 108008
1723 Ga0495595_0000879 3300053084 Bacteria 11535
1724 Ga0495595_0006336 3300053084 Bacteria 4819
1725 Ga0495595_0010002 3300053084 Bacteria 3933
1726 Ga0495595_0011017 3300053084 Bacteria 3773
1727 Ga0495595_0014880 3300053084 Bacteria 3308
1728 Ga0495595_0031159 3300053084 Bacteria 2395
1729 Ga0495619_0000002 3300053085 Bacteria 530226
1730 Ga0495619_0000229 3300053085 Bacteria 40785
1731 Ga0495619_0001598 3300053085 Bacteria 14888
1732 Ga0495619_0002881 3300053085 Bacteria 11182
1733 Ga0495619_0005795 3300053085 Bacteria 7828
1734 Ga0495619_0013992 3300053085 Bacteria 5062
1735 Ga0495619_0018217 3300053085 Bacteria 4453
1736 Ga0500643_009516 3300053087 Bacteria 3706
1737 Ga0500651_0022942 3300053093 Bacteria 3904
1738 Ga0500651_0180041 3300053093 Bacteria 1256
1739 Ga0500566_0094479 3300053094 Bacteria 1648
1740 Ga0500641_0020457 3300053096 Bacteria 2513
1741 Ga0500562_056036 3300053108 Bacteria 1057
1742 Ga0500562_057978 3300053108 Bacteria 1039
1743 Ga0500595_000010 3300053119 Bacteria 275806
1744 Ga0500595_014685 3300053119 Bacteria 2964
1745 Ga0500595_048037 3300053119 Bacteria 1334
1746 Ga0500616_0000001 3300053153 Bacteria 1986011
1747 Ga0500616_0061428 3300053153 Bacteria 1945
1748 Ga0500616_0062798 3300053153 Bacteria 1917
1749 Ga0500616_0065607 3300053153 Bacteria 1866
1750 Ga0500645_000015 3300053730 Bacteria 150140
1751 Ga0501084_0057017 3300054114 Bacteria 3269
1752 Ga0501084_0068704 3300054114 Bacteria 2966
1753 Ga0501084_0077346 3300054114 Bacteria 2790
1754 Ga0501084_0147838 3300054114 Bacteria 1979
1755 Ga0501084_0150596 3300054114 Bacteria 1961
1756 Ga0501084_0370135 3300054114 Bacteria 1211
1757 Ga0501084_0450370 3300054114 Bacteria 1088
1758 Ga0590071_011869 3300059421 Bacteria 2040
1759 Ga0590075_021489 3300059424 Bacteria 1611
1760 Ga0590077_005770 3300059426 Bacteria 2536
1761 Ga0501082_0000013 3300060353 Bacteria 119623
1762 Ga0501082_0013431 3300060353 Bacteria 7039
1763 Ga0501082_0015413 3300060353 Bacteria 6579
1764 Ga0501082_0052731 3300060353 Bacteria 3506
1765 Ga0501082_0060268 3300060353 Bacteria 3268
1766 Ga0501082_0112665 3300060353 Bacteria 2355
1767 Ga0501082_0398927 3300060353 Bacteria 1200
1768 Ga0530510_0000596 3300061734 Bacteria 23255
1769 Ga0530510_0092868 3300061734 Bacteria 2203
1770 Ga0530510_0111429 3300061734 Bacteria 2004
1771 Ga0530510_0220076 3300061734 Bacteria 1411
1772 Ga0530510_0419855 3300061734 Bacteria 1009

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10282850 Ga0105242_102828501 242
2 3300049587 Ga0501071_0424840 Ga0501071_0424840_228_971 242
3 3300044842 Ga0466957_0121630 Ga0466957_0121630_464_1198 244
4 3300005330 Ga0070690_100193295 Ga0070690_1001932952 245
5 3300005563 Ga0068855_100409055 Ga0068855_1004090552 245
6 3300005617 Ga0068859_100104533 Ga0068859_1001045332 245
7 3300005618 Ga0068864_100053465 Ga0068864_1000534653 245
8 3300005841 Ga0068863_100184737 Ga0068863_1001847372 245
9 3300006852 Ga0075433_10006137 Ga0075433_100061376 245
10 3300006871 Ga0075434_100001159 Ga0075434_10000115916 245
11 3300006914 Ga0075436_100002192 Ga0075436_1000021926 245
12 3300006931 Ga0097620_100104537 Ga0097620_1001045373 245
13 3300007076 Ga0075435_100000432 Ga0075435_10000043226 245
14 3300009094 Ga0111539_10019998 Ga0111539_100199983 245
15 3300014745 Ga0157377_10284684 Ga0157377_102846842 245
16 3300026088 Ga0207641_10167384 Ga0207641_101673842 245
17 3300027907 Ga0207428_10138752 Ga0207428_101387523 245
18 3300028381 Ga0268264_10366967 Ga0268264_103669672 245
19 3300049578 Ga0501042_0281813 Ga0501042_0281813_217_960 245
20 3300050511 nmdc:mga08y16_9215_c1 nmdc:mga08y16_9215_c1_5402_6142 245
21 3300050512 nmdc:mga0n895_4696_c1 nmdc:mga0n895_4696_c1_7590_8330 245
22 3300050513 nmdc:mga0rr50_1966_c1 nmdc:mga0rr50_1966_c1_7730_8470 245
23 3300050514 nmdc:mga08x19_1133_c1 nmdc:mga08x19_1133_c1_7691_8431 245
24 3300050515 nmdc:mga0a205_1921_c1 nmdc:mga0a205_1921_c1_10288_11028 245
25 3300005334 Ga0068869_100051408 Ga0068869_1000514084 246
26 3300005444 Ga0070694_100183756 Ga0070694_1001837562 246
27 3300005546 Ga0070696_100029222 Ga0070696_1000292222 246
28 3300025942 Ga0207689_10065413 Ga0207689_100654134 246
29 3300042876 Ga0451577_0147580 Ga0451577_0147580_104_847 246
30 3300044712 Ga0453684_0669787 Ga0453684_0669787_133_876 246
31 3300045051 Ga0451576_0017130 Ga0451576_0017130_5198_5941 246
32 3300025898 Ga0207692_10080845 Ga0207692_100808452 247
33 3300025912 Ga0207707_10207864 Ga0207707_102078642 247
34 3300005347 Ga0070668_100415475 Ga0070668_1004154752 248
35 3300005406 Ga0070703_10002528 Ga0070703_100025284 248
36 3300005438 Ga0070701_10238564 Ga0070701_102385641 248
37 3300005439 Ga0070711_100146211 Ga0070711_1001462112 248
38 3300005440 Ga0070705_100000010 Ga0070705_10000001046 248
39 3300005444 Ga0070694_100155140 Ga0070694_1001551402 248
40 3300005445 Ga0070708_100179279 Ga0070708_1001792792 248
41 3300005455 Ga0070663_100028384 Ga0070663_1000283842 248
42 3300005457 Ga0070662_100253104 Ga0070662_1002531042 248
43 3300005518 Ga0070699_100001314 Ga0070699_1000013146 248
44 3300005536 Ga0070697_100039300 Ga0070697_1000393003 248
45 3300005545 Ga0070695_100001719 Ga0070695_1000017197 248
46 3300005546 Ga0070696_100002812 Ga0070696_1000028127 248
47 3300005547 Ga0070693_100023786 Ga0070693_1000237862 248
48 3300005549 Ga0070704_100013846 Ga0070704_1000138464 248
49 3300005564 Ga0070664_100374759 Ga0070664_1003747592 248
50 3300005577 Ga0068857_100011549 Ga0068857_1000115493 248
51 3300005843 Ga0068860_100013440 Ga0068860_1000134405 248
52 3300005844 Ga0068862_100003043 Ga0068862_10000304310 248
53 3300006175 Ga0070712_100001328 Ga0070712_10000132815 248
54 3300006844 Ga0075428_100069359 Ga0075428_1000693595 248
55 3300006844 Ga0075428_100124758 Ga0075428_1001247581 248
56 3300006847 Ga0075431_100002413 Ga0075431_1000024132 248
57 3300006847 Ga0075431_100143787 Ga0075431_1001437872 248
58 3300006852 Ga0075433_10270158 Ga0075433_102701582 248
59 3300006871 Ga0075434_100000007 Ga0075434_10000000794 248
60 3300006880 Ga0075429_100271459 Ga0075429_1002714592 248
61 3300006880 Ga0075429_100353876 Ga0075429_1003538762 248
62 3300006914 Ga0075436_100014836 Ga0075436_1000148362 248
63 3300006914 Ga0075436_100037473 Ga0075436_1000374734 248
64 3300007076 Ga0075435_100025823 Ga0075435_1000258234 248
65 3300009094 Ga0111539_11070617 Ga0111539_110706171 248
66 3300009553 Ga0105249_10017602 Ga0105249_100176024 248
67 3300010375 Ga0105239_10698425 Ga0105239_106984252 248
68 3300014326 Ga0157380_10726026 Ga0157380_107260261 248
69 3300025885 Ga0207653_10000559 Ga0207653_100005593 248
70 3300025915 Ga0207693_10007312 Ga0207693_100073128 248
71 3300025916 Ga0207663_10118857 Ga0207663_101188572 248
72 3300025917 Ga0207660_10035293 Ga0207660_100352932 248
73 3300025933 Ga0207706_10300810 Ga0207706_103008102 248
74 3300025942 Ga0207689_10021598 Ga0207689_100215984 248
75 3300025961 Ga0207712_10004065 Ga0207712_100040654 248
76 3300026067 Ga0207678_10019284 Ga0207678_100192844 248
77 3300026075 Ga0207708_10002166 Ga0207708_100021667 248
78 3300026116 Ga0207674_10003323 Ga0207674_100033235 248
79 3300027364 Ga0209967_1000489 Ga0209967_10004894 248
80 3300027378 Ga0209981_1000830 Ga0209981_10008304 248
81 3300027471 Ga0209995_1003461 Ga0209995_10034613 248
82 3300027543 Ga0209999_1003822 Ga0209999_10038222 248
83 3300027665 Ga0209983_1030948 Ga0209983_10309481 248
84 3300027907 Ga0207428_10178586 Ga0207428_101785862 248
85 3300028380 Ga0268265_10009461 Ga0268265_100094614 248
86 3300028381 Ga0268264_10006938 Ga0268264_100069385 248
87 3300034820 Ga0373959_0053195 Ga0373959_0053195_56_811 248
88 3300041410 Ga0439461_0003514 Ga0439461_0003514_1335_2090 248
89 3300042015 Ga0439462_0023808 Ga0439462_0023808_324_1079 248
90 3300042156 Ga0439446_0001019 Ga0439446_0001019_2837_3592 248
91 3300042435 Ga0439434_0002451 Ga0439434_0002451_213_968 248
92 3300042436 Ga0439435_0000002 Ga0439435_0000002_15030_15785 248
93 3300047320 Ga0495672_0127450 Ga0495672_0127450_278_1024 248
94 3300048903 Ga0496100_0322698 Ga0496100_0322698_304_1050 248
95 3300048906 Ga0496103_0085283 Ga0496103_0085283_1085_1831 248
96 3300048908 Ga0496105_0536570 Ga0496105_0536570_30_776 248
97 3300048909 Ga0496106_0003669 Ga0496106_0003669_9706_10452 248
98 3300048910 Ga0496107_0046339 Ga0496107_0046339_973_1719 248
99 3300048918 Ga0496115_0127875 Ga0496115_0127875_167_913 248
100 3300049568 Ga0501031_0055503 Ga0501031_0055503_1647_2402 248
101 3300049570 Ga0501033_0215081 Ga0501033_0215081_86_832 248
102 3300049572 Ga0501036_0018021 Ga0501036_0018021_3902_4654 248
103 3300049572 Ga0501036_0309725 Ga0501036_0309725_388_1143 248
104 3300049575 Ga0501039_0232807 Ga0501039_0232807_677_1423 248
105 3300049576 Ga0501040_0012594 Ga0501040_0012594_2396_3148 248
106 3300049576 Ga0501040_0018457 Ga0501040_0018457_174_929 248
107 3300049576 Ga0501040_0452266 Ga0501040_0452266_139_885 248
108 3300049577 Ga0501041_0017024 Ga0501041_0017024_2111_2863 248
109 3300049578 Ga0501042_0228284 Ga0501042_0228284_420_1166 248
110 3300049580 Ga0501046_0039215 Ga0501046_0039215_1819_2565 248
111 3300049580 Ga0501046_0252265 Ga0501046_0252265_369_1124 248
112 3300049581 Ga0501047_0612500 Ga0501047_0612500_51_797 248
113 3300049583 Ga0501067_0117104 Ga0501067_0117104_409_1155 248
114 3300049588 Ga0501072_0030502 Ga0501072_0030502_313_1068 248
115 3300049590 Ga0501074_0073296 Ga0501074_0073296_377_1123 248
116 3300049591 Ga0501075_0004734 Ga0501075_0004734_6406_7158 248
117 3300049592 Ga0501076_0001405 Ga0501076_0001405_9177_9929 248
118 3300049593 Ga0501077_0007341 Ga0501077_0007341_4841_5593 248
119 3300049593 Ga0501077_0282036 Ga0501077_0282036_184_939 248
120 3300049741 Ga0501079_0003233 Ga0501079_0003233_8672_9424 248
121 3300049742 Ga0501080_0021206 Ga0501080_0021206_4191_4943 248
122 3300049743 Ga0501081_0001767 Ga0501081_0001767_8281_9033 248
123 3300049743 Ga0501081_0010888 Ga0501081_0010888_2871_3617 248
124 3300049743 Ga0501081_0055859 Ga0501081_0055859_238_993 248
125 3300049743 Ga0501081_0400901 Ga0501081_0400901_146_892 248
126 3300049824 Ga0501045_0018155 Ga0501045_0018155_1293_2045 248
127 3300049824 Ga0501045_0089530 Ga0501045_0089530_516_1271 248
128 3300050507 nmdc:mga05p37_450398_c1 nmdc:mga05p37_450398_c1_708_1478 248
129 3300050509 nmdc:mga0qj67_115940_c1 nmdc:mga0qj67_115940_c1_544_1290 248
130 3300050509 nmdc:mga0qj67_130809_c1 nmdc:mga0qj67_130809_c1_458_1204 248
131 3300050509 nmdc:mga0qj67_72452_c1 nmdc:mga0qj67_72452_c1_275_1021 248
132 3300050510 nmdc:mga06r32_146979_c1 nmdc:mga06r32_146979_c1_1483_2229 248
133 3300050510 nmdc:mga06r32_236166_c1 nmdc:mga06r32_236166_c1_527_1273 248
134 3300050510 nmdc:mga06r32_33897_c1 nmdc:mga06r32_33897_c1_313_1059 248
135 3300050511 nmdc:mga08y16_30278_c1 nmdc:mga08y16_30278_c1_4195_4941 248
136 3300050512 nmdc:mga0n895_145_c1 nmdc:mga0n895_145_c1_12001_12756 248
137 3300050513 nmdc:mga0rr50_2684_c1 nmdc:mga0rr50_2684_c1_8399_9154 248
138 3300050514 nmdc:mga08x19_33421_c1 nmdc:mga08x19_33421_c1_470_1225 248
139 3300050515 nmdc:mga0a205_127802_c1 nmdc:mga0a205_127802_c1_251_1006 248
140 3300054114 Ga0501084_0068704 Ga0501084_0068704_1981_2736 248
141 3300054114 Ga0501084_0147838 Ga0501084_0147838_1097_1849 248
142 3300054114 Ga0501084_0450370 Ga0501084_0450370_161_907 248
143 3300059421 Ga0590071_011869 Ga0590071_011869_950_1705 248
144 3300059424 Ga0590075_021489 Ga0590075_021489_270_1025 248
145 3300059426 Ga0590077_005770 Ga0590077_005770_657_1412 248
146 3300060353 Ga0501082_0015413 Ga0501082_0015413_614_1360 248
147 3300060353 Ga0501082_0052731 Ga0501082_0052731_304_1050 248
148 3300061734 Ga0530510_0000596 Ga0530510_0000596_9203_9955 248
149 3300061734 Ga0530510_0092868 Ga0530510_0092868_600_1346 248
150 3300006914 Ga0075436_100052910 Ga0075436_1000529102 249
151 3300013308 Ga0157375_10538422 Ga0157375_105384222 249
152 3300042156 Ga0439446_0035914 Ga0439446_0035914_584_1333 249
153 3300049572 Ga0501036_0090209 Ga0501036_0090209_1369_2127 249
154 3300049574 Ga0501038_0000775 Ga0501038_0000775_673_1431 249
155 3300049576 Ga0501040_0009567 Ga0501040_0009567_297_1055 249
156 3300049577 Ga0501041_0027793 Ga0501041_0027793_1724_2482 249
157 3300049579 Ga0501043_0050356 Ga0501043_0050356_1353_2111 249
158 3300049580 Ga0501046_0043437 Ga0501046_0043437_2752_3510 249
159 3300049582 Ga0501048_0195551 Ga0501048_0195551_654_1412 249
160 3300049587 Ga0501071_0095714 Ga0501071_0095714_251_1009 249
161 3300049588 Ga0501072_0106645 Ga0501072_0106645_749_1507 249
162 3300049589 Ga0501073_0192902 Ga0501073_0192902_391_1149 249
163 3300049591 Ga0501075_0005155 Ga0501075_0005155_460_1218 249
164 3300049741 Ga0501079_0040616 Ga0501079_0040616_2489_3247 249
165 3300049742 Ga0501080_0028713 Ga0501080_0028713_281_1039 249
166 3300049743 Ga0501081_0010499 Ga0501081_0010499_3450_4208 249
167 3300049822 Ga0501035_0005073 Ga0501035_0005073_965_1723 249
168 3300050513 nmdc:mga0rr50_161239_c1 nmdc:mga0rr50_161239_c1_1031_1780 249
169 3300050514 nmdc:mga08x19_3872_c1 nmdc:mga08x19_3872_c1_3220_3969 249
170 3300060353 Ga0501082_0060268 Ga0501082_0060268_2443_3201 249
171 3300061734 Ga0530510_0111429 Ga0530510_0111429_143_901 249
172 3300003203 JGI25406J46586_10009736 JGI25406J46586_100097362 250
173 3300005327 Ga0070658_10048153 Ga0070658_100481532 250
174 3300005328 Ga0070676_10188872 Ga0070676_101888722 250
175 3300005330 Ga0070690_100104406 Ga0070690_1001044061 250
176 3300005336 Ga0070680_100026870 Ga0070680_1000268702 250
177 3300005339 Ga0070660_100219760 Ga0070660_1002197602 250
178 3300005340 Ga0070689_100008504 Ga0070689_1000085042 250
179 3300005354 Ga0070675_100189878 Ga0070675_1001898781 250
180 3300005356 Ga0070674_100023669 Ga0070674_1000236692 250
181 3300005367 Ga0070667_100329662 Ga0070667_1003296621 250
182 3300005434 Ga0070709_10089303 Ga0070709_100893032 250
183 3300005435 Ga0070714_100258646 Ga0070714_1002586461 250
184 3300005441 Ga0070700_100076044 Ga0070700_1000760441 250
185 3300005456 Ga0070678_100401004 Ga0070678_1004010042 250
186 3300005458 Ga0070681_10013836 Ga0070681_100138366 250
187 3300005458 Ga0070681_10457310 Ga0070681_104573102 250
188 3300005459 Ga0068867_100047346 Ga0068867_1000473463 250
189 3300005518 Ga0070699_100010423 Ga0070699_1000104237 250
190 3300005530 Ga0070679_100034318 Ga0070679_1000343183 250
191 3300005530 Ga0070679_100222677 Ga0070679_1002226772 250
192 3300005544 Ga0070686_100262531 Ga0070686_1002625312 250
193 3300005548 Ga0070665_100231865 Ga0070665_1002318654 250
194 3300005563 Ga0068855_100462066 Ga0068855_1004620662 250
195 3300005578 Ga0068854_100581300 Ga0068854_1005813001 250
196 3300005617 Ga0068859_100161472 Ga0068859_1001614723 250
197 3300005842 Ga0068858_100398192 Ga0068858_1003981921 250
198 3300005937 Ga0081455_10007017 Ga0081455_1000701712 250
199 3300005985 Ga0081539_10008542 Ga0081539_100085425 250
200 3300006844 Ga0075428_100598426 Ga0075428_1005984261 250
201 3300006846 Ga0075430_100285844 Ga0075430_1002858441 250
202 3300006847 Ga0075431_100505165 Ga0075431_1005051652 250
203 3300006852 Ga0075433_10036232 Ga0075433_100362323 250
204 3300006871 Ga0075434_100020496 Ga0075434_1000204967 250
205 3300006871 Ga0075434_100096480 Ga0075434_1000964802 250
206 3300006871 Ga0075434_100577216 Ga0075434_1005772161 250
207 3300006880 Ga0075429_100119201 Ga0075429_1001192011 250
208 3300006931 Ga0097620_100161476 Ga0097620_1001614763 250
209 3300009094 Ga0111539_10022696 Ga0111539_100226968 250
210 3300009094 Ga0111539_10146086 Ga0111539_101460862 250
211 3300009147 Ga0114129_10059035 Ga0114129_100590353 250
212 3300009177 Ga0105248_10076409 Ga0105248_100764094 250
213 3300009551 Ga0105238_10535685 Ga0105238_105356852 250
214 3300010159 Ga0099796_10005153 Ga0099796_100051532 250
215 3300012510 Ga0157316_1006538 Ga0157316_10065381 250
216 3300013105 Ga0157369_10870663 Ga0157369_108706632 250
217 3300013306 Ga0163162_10218623 Ga0163162_102186231 250
218 3300014968 Ga0157379_10387290 Ga0157379_103872902 250
219 3300025905 Ga0207685_10043200 Ga0207685_100432002 250
220 3300025907 Ga0207645_10036138 Ga0207645_100361383 250
221 3300025909 Ga0207705_10103433 Ga0207705_101034332 250
222 3300025912 Ga0207707_10080459 Ga0207707_100804592 250
223 3300025917 Ga0207660_10018065 Ga0207660_100180654 250
224 3300025919 Ga0207657_10440634 Ga0207657_104406342 250
225 3300025921 Ga0207652_10023549 Ga0207652_100235494 250
226 3300025921 Ga0207652_10323990 Ga0207652_103239902 250
227 3300025929 Ga0207664_10075293 Ga0207664_100752932 250
228 3300025931 Ga0207644_10378619 Ga0207644_103786192 250
229 3300025934 Ga0207686_10097295 Ga0207686_100972952 250
230 3300025935 Ga0207709_10062539 Ga0207709_100625392 250
231 3300025936 Ga0207670_10016040 Ga0207670_100160402 250
232 3300025937 Ga0207669_10015259 Ga0207669_100152594 250
233 3300025939 Ga0207665_10052253 Ga0207665_100522532 250
234 3300025939 Ga0207665_10327524 Ga0207665_103275241 250
235 3300025940 Ga0207691_10193211 Ga0207691_101932112 250
236 3300025941 Ga0207711_10003987 Ga0207711_100039879 250
237 3300025949 Ga0207667_10724036 Ga0207667_107240362 250
238 3300025960 Ga0207651_10298458 Ga0207651_102984582 250
239 3300026067 Ga0207678_10086398 Ga0207678_100863982 250
240 3300026075 Ga0207708_10041728 Ga0207708_100417284 250
241 3300026075 Ga0207708_10206842 Ga0207708_102068422 250
242 3300026089 Ga0207648_10039268 Ga0207648_100392683 250
243 3300026121 Ga0207683_10027788 Ga0207683_100277882 250
244 3300026121 Ga0207683_10138555 Ga0207683_101385552 250
245 3300027907 Ga0207428_10058144 Ga0207428_100581444 250
246 3300031241 Ga0265325_10018886 Ga0265325_100188864 250
247 3300031247 Ga0265340_10053019 Ga0265340_100530192 250
248 3300034819 Ga0373958_0017715 Ga0373958_0017715_479_1240 250
249 3300035083 Ga0373926_0084674 Ga0373926_0084674_14_775 250
250 3300035085 Ga0373929_0053362 Ga0373929_0053362_46_804 250
251 3300035088 Ga0373940_0076050 Ga0373940_0076050_76_837 250
252 3300035089 Ga0373944_0035961 Ga0373944_0035961_175_930 250
253 3300035092 Ga0373952_0023481 Ga0373952_0023481_486_1244 250
254 3300035111 Ga0373923_0010802 Ga0373923_0010802_1716_2471 250
255 3300035113 Ga0373936_0009974 Ga0373936_0009974_2386_3141 250
256 3300035113 Ga0373936_0204465 Ga0373936_0204465_19_777 250
257 3300035114 Ga0373939_0004617 Ga0373939_0004617_935_1693 250
258 3300035116 Ga0373945_0023434 Ga0373945_0023434_719_1474 250
259 3300035117 Ga0373953_0001444 Ga0373953_0001444_1406_2161 250
260 3300035118 Ga0373954_0008746 Ga0373954_0008746_1745_2500 250
261 3300035120 Ga0373957_0005066 Ga0373957_0005066_1529_2284 250
262 3300035121 Ga0373960_0028479 Ga0373960_0028479_615_1373 250
263 3300035170 Ga0373943_0006259 Ga0373943_0006259_146_901 250
264 3300035171 Ga0373946_0001192 Ga0373946_0001192_800_1555 250
265 3300035171 Ga0373946_0159408 Ga0373946_0159408_31_792 250
266 3300035172 Ga0373955_0000779 Ga0373955_0000779_10288_11043 250
267 3300035207 Ga0373942_0103677 Ga0373942_0103677_82_840 250
268 3300035410 Ga0373924_0118510 Ga0373924_0118510_211_966 250
269 3300035691 Ga0373931_0023545 Ga0373931_0023545_859_1620 250
270 3300035691 Ga0373931_0036666 Ga0373931_0036666_1411_2169 250
271 3300035692 Ga0373935_0000053 Ga0373935_0000053_10825_11580 250
272 3300035692 Ga0373935_0021565 Ga0373935_0021565_714_1472 250
273 3300035695 Ga0373927_0035423 Ga0373927_0035423_635_1396 250
274 3300035724 Ga0373933_0001426 Ga0373933_0001426_8042_8797 250
275 3300035725 Ga0373947_0000259 Ga0373947_0000259_18965_19720 250
276 3300035725 Ga0373947_0013217 Ga0373947_0013217_3925_4686 250
277 3300035725 Ga0373947_0169381 Ga0373947_0169381_397_1155 250
278 3300036401 Ga0373937_0000030 Ga0373937_0000030_28086_28841 250
279 3300037068 Ga0373925_0000002 Ga0373925_0000002_37435_38190 250
280 3300037068 Ga0373925_0024207 Ga0373925_0024207_3282_4037 250
281 3300037068 Ga0373925_0036229 Ga0373925_0036229_354_1115 250
282 3300037068 Ga0373925_0193557 Ga0373925_0193557_118_876 250
283 3300039437 Ga0436365_0109845 Ga0436365_0109845_541_1299 250
284 3300039450 Ga0436363_0961840 Ga0436363_0961840_18_776 250
285 3300044842 Ga0466957_0373921 Ga0466957_0373921_25_780 250
286 3300045976 Ga0466967_0006741 Ga0466967_0006741_5916_6674 250
287 3300046454 Ga0495592_0000046 Ga0495592_0000046_73078_73833 250
288 3300046459 Ga0495629_0002311 Ga0495629_0002311_11649_12404 250
289 3300046462 Ga0495651_0000822 Ga0495651_0000822_13309_14064 250
290 3300046463 Ga0495653_0000006 Ga0495653_0000006_37481_38236 250
291 3300046473 Ga0495582_0028169 Ga0495582_0028169_958_1713 250
292 3300046473 Ga0495582_0161747 Ga0495582_0161747_242_1003 250
293 3300046476 Ga0495662_0002481 Ga0495662_0002481_520_1275 250
294 3300046477 Ga0495664_0000002 Ga0495664_0000002_73115_73870 250
295 3300046511 Ga0495608_0000006 Ga0495608_0000006_140676_141431 250
296 3300046514 Ga0495618_0000034 Ga0495618_0000034_90294_91049 250
297 3300046514 Ga0495618_0156557 Ga0495618_0156557_410_1168 250
298 3300046516 Ga0495628_0000002 Ga0495628_0000002_37398_38153 250
299 3300046517 Ga0495630_0000662 Ga0495630_0000662_13341_14096 250
300 3300046522 Ga0495643_0130553 Ga0495643_0130553_327_1082 250
301 3300046529 Ga0495652_0000004 Ga0495652_0000004_550628_551383 250
302 3300046531 Ga0495665_0123478 Ga0495665_0123478_392_1153 250
303 3300046533 Ga0495640_0000007 Ga0495640_0000007_88362_89117 250
304 3300046535 Ga0495586_0177186 Ga0495586_0177186_374_1129 250
305 3300046536 Ga0495587_0000031 Ga0495587_0000031_37500_38255 250
306 3300046543 Ga0495645_0000003 Ga0495645_0000003_18751_19506 250
307 3300046543 Ga0495645_0128951 Ga0495645_0128951_860_1624 250
308 3300046559 Ga0495667_0000002 Ga0495667_0000002_399468_400223 250
309 3300046642 Ga0495634_0000533 Ga0495634_0000533_229_984 250
310 3300046642 Ga0495634_0021460 Ga0495634_0021460_2479_3237 250
311 3300046663 Ga0495635_0000022 Ga0495635_0000022_7783_8538 250
312 3300046664 Ga0495659_0117966 Ga0495659_0117966_133_894 250
313 3300046675 Ga0495657_0000276 Ga0495657_0000276_10879_11634 250
314 3300046678 Ga0495599_0000001 Ga0495599_0000001_176178_176933 250
315 3300046679 Ga0495623_0000094 Ga0495623_0000094_18686_19441 250
316 3300046680 Ga0495646_0000007 Ga0495646_0000007_59872_60627 250
317 3300046683 Ga0495658_0041879 Ga0495658_0041879_98_859 250
318 3300046683 Ga0495658_0148403 Ga0495658_0148403_547_1302 250
319 3300046683 Ga0495658_0295200 Ga0495658_0295200_192_947 250
320 3300046689 Ga0495613_0182607 Ga0495613_0182607_704_1465 250
321 3300046690 Ga0495624_0020416 Ga0495624_0020416_3460_4215 250
322 3300046809 Ga0495600_0000033 Ga0495600_0000033_45432_46187 250
323 3300047317 Ga0495604_0000005 Ga0495604_0000005_63144_63899 250
324 3300047319 Ga0495674_0000003 Ga0495674_0000003_523871_524626 250
325 3300047322 Ga0495680_0000091 Ga0495680_0000091_62213_62968 250
326 3300047444 Ga0495675_0000064 Ga0495675_0000064_35980_36735 250
327 3300047471 Ga0495684_0000035 Ga0495684_0000035_18653_19408 250
328 3300047471 Ga0495684_0041943 Ga0495684_0041943_1458_2216 250
329 3300047673 Ga0495593_0001106 Ga0495593_0001106_11822_12577 250
330 3300048088 Ga0495602_0000029 Ga0495602_0000029_18643_19398 250
331 3300048089 Ga0495614_0118009 Ga0495614_0118009_94_855 250
332 3300048903 Ga0496100_0265535 Ga0496100_0265535_366_1121 250
333 3300048907 Ga0496104_0000711 Ga0496104_0000711_11064_11819 250
334 3300048907 Ga0496104_0000925 Ga0496104_0000925_8655_9410 250
335 3300048907 Ga0496104_0144331 Ga0496104_0144331_523_1281 250
336 3300048908 Ga0496105_0055857 Ga0496105_0055857_1059_1814 250
337 3300048908 Ga0496105_0110294 Ga0496105_0110294_1357_2115 250
338 3300048909 Ga0496106_0346450 Ga0496106_0346450_244_1005 250
339 3300048910 Ga0496107_0222895 Ga0496107_0222895_101_856 250
340 3300048910 Ga0496107_0265173 Ga0496107_0265173_50_811 250
341 3300048911 Ga0496108_0086431 Ga0496108_0086431_556_1314 250
342 3300048911 Ga0496108_0137032 Ga0496108_0137032_324_1079 250
343 3300048912 Ga0496109_0017045 Ga0496109_0017045_3614_4372 250
344 3300048912 Ga0496109_0142769 Ga0496109_0142769_99_857 250
345 3300048912 Ga0496109_0367970 Ga0496109_0367970_546_1304 250
346 3300048914 Ga0496111_0156658 Ga0496111_0156658_83_841 250
347 3300048915 Ga0496112_0061635 Ga0496112_0061635_1836_2594 250
348 3300048916 Ga0496113_0129705 Ga0496113_0129705_863_1621 250
349 3300048916 Ga0496113_0199278 Ga0496113_0199278_88_843 250
350 3300048917 Ga0496114_0380195 Ga0496114_0380195_475_1230 250
351 3300048918 Ga0496115_0009549 Ga0496115_0009549_923_1681 250
352 3300048918 Ga0496115_0088771 Ga0496115_0088771_31_789 250
353 3300048918 Ga0496115_0333853 Ga0496115_0333853_372_1127 250
354 3300048918 Ga0496115_0366312 Ga0496115_0366312_300_1070 250
355 3300049568 Ga0501031_0079391 Ga0501031_0079391_1328_2086 250
356 3300049570 Ga0501033_0044445 Ga0501033_0044445_213_968 250
357 3300049570 Ga0501033_0075440 Ga0501033_0075440_1367_2125 250
358 3300049572 Ga0501036_0043532 Ga0501036_0043532_2695_3453 250
359 3300049572 Ga0501036_0350203 Ga0501036_0350203_95_850 250
360 3300049573 Ga0501037_0026526 Ga0501037_0026526_2719_3477 250
361 3300049573 Ga0501037_0220440 Ga0501037_0220440_276_1031 250
362 3300049574 Ga0501038_0173956 Ga0501038_0173956_614_1372 250
363 3300049574 Ga0501038_0255938 Ga0501038_0255938_20_778 250
364 3300049574 Ga0501038_0598462 Ga0501038_0598462_39_794 250
365 3300049575 Ga0501039_0099388 Ga0501039_0099388_564_1322 250
366 3300049578 Ga0501042_0059716 Ga0501042_0059716_1276_2034 250
367 3300049579 Ga0501043_0087879 Ga0501043_0087879_1335_2093 250
368 3300049579 Ga0501043_0193664 Ga0501043_0193664_101_856 250
369 3300049580 Ga0501046_0044144 Ga0501046_0044144_1310_2068 250
370 3300049581 Ga0501047_0006347 Ga0501047_0006347_5289_6044 250
371 3300049582 Ga0501048_0016432 Ga0501048_0016432_3657_4415 250
372 3300049583 Ga0501067_0044703 Ga0501067_0044703_651_1457 250
373 3300049584 Ga0501068_0070612 Ga0501068_0070612_861_1619 250
374 3300049584 Ga0501068_0264327 Ga0501068_0264327_296_1057 250
375 3300049586 Ga0501070_0004846 Ga0501070_0004846_1476_2231 250
376 3300049587 Ga0501071_0050634 Ga0501071_0050634_1044_1850 250
377 3300049588 Ga0501072_0420071 Ga0501072_0420071_181_987 250
378 3300049589 Ga0501073_0057334 Ga0501073_0057334_1234_1992 250
379 3300049589 Ga0501073_0281551 Ga0501073_0281551_69_833 250
380 3300049590 Ga0501074_0060566 Ga0501074_0060566_628_1434 250
381 3300049591 Ga0501075_0161886 Ga0501075_0161886_869_1630 250
382 3300049741 Ga0501079_0173252 Ga0501079_0173252_71_829 250
383 3300049742 Ga0501080_0083911 Ga0501080_0083911_138_893 250
384 3300049742 Ga0501080_0259554 Ga0501080_0259554_473_1231 250
385 3300049744 Ga0501083_0104465 Ga0501083_0104465_77_883 250
386 3300049822 Ga0501035_0025523 Ga0501035_0025523_1367_2125 250
387 3300049822 Ga0501035_0068477 Ga0501035_0068477_1311_2066 250
388 3300049823 Ga0501044_0001312 Ga0501044_0001312_17105_17863 250
389 3300049823 Ga0501044_0008177 Ga0501044_0008177_8599_9354 250
390 3300049823 Ga0501044_0147701 Ga0501044_0147701_797_1558 250
391 3300049823 Ga0501044_0163053 Ga0501044_0163053_918_1673 250
392 3300049823 Ga0501044_0309288 Ga0501044_0309288_48_809 250
393 3300049824 Ga0501045_0026472 Ga0501045_0026472_1166_1972 250
394 3300050494 nmdc:mga06z11_70741_c1 nmdc:mga06z11_70741_c1_62_817 250
395 3300050507 nmdc:mga05p37_45950_c1 nmdc:mga05p37_45950_c1_2911_3714 250
396 3300050507 nmdc:mga05p37_75031_c1 nmdc:mga05p37_75031_c1_2769_3527 250
397 3300050508 nmdc:mga09592_469785_c1 nmdc:mga09592_469785_c1_182_985 250
398 3300050511 nmdc:mga08y16_290441_c1 nmdc:mga08y16_290441_c1_338_1096 250
399 3300050511 nmdc:mga08y16_63381_c1 nmdc:mga08y16_63381_c1_242_1003 250
400 3300050511 nmdc:mga08y16_8982_c1 nmdc:mga08y16_8982_c1_7832_8590 250
401 3300050512 nmdc:mga0n895_193711_c1 nmdc:mga0n895_193711_c1_782_1543 250
402 3300050512 nmdc:mga0n895_336958_c1 nmdc:mga0n895_336958_c1_452_1207 250
403 3300050512 nmdc:mga0n895_475845_c1 nmdc:mga0n895_475845_c1_432_1190 250
404 3300050513 nmdc:mga0rr50_115821_c1 nmdc:mga0rr50_115821_c1_600_1355 250
405 3300050514 nmdc:mga08x19_24255_c1 nmdc:mga08x19_24255_c1_726_1484 250
406 3300050514 nmdc:mga08x19_291574_c1 nmdc:mga08x19_291574_c1_124_879 250
407 3300050515 nmdc:mga0a205_17080_c2 nmdc:mga0a205_17080_c2_2515_3276 250
408 3300050515 nmdc:mga0a205_18201_c1 nmdc:mga0a205_18201_c1_1073_1831 250
409 3300053077 Ga0495601_0000008 Ga0495601_0000008_284487_285242 250
410 3300053077 Ga0495601_0096670 Ga0495601_0096670_27_779 250
411 3300053078 Ga0495612_0000026 Ga0495612_0000026_60717_61472 250
412 3300053078 Ga0495612_0140718 Ga0495612_0140718_195_947 250
413 3300053084 Ga0495595_0000024 Ga0495595_0000024_18760_19515 250
414 3300053085 Ga0495619_0000002 Ga0495619_0000002_37503_38258 250
415 3300053153 Ga0500616_0065607 Ga0500616_0065607_266_1021 250
416 3300054114 Ga0501084_0057017 Ga0501084_0057017_887_1693 250
417 3300060353 Ga0501082_0112665 Ga0501082_0112665_715_1473 250
418 3300005343 Ga0070687_100206503 Ga0070687_1002065032 251
419 3300005578 Ga0068854_100074407 Ga0068854_1000744073 251
420 3300005615 Ga0070702_100184462 Ga0070702_1001844622 251
421 3300005616 Ga0068852_100284846 Ga0068852_1002848462 251
422 3300005844 Ga0068862_100242962 Ga0068862_1002429622 251
423 3300005981 Ga0081538_10017736 Ga0081538_100177366 251
424 3300005981 Ga0081538_10018338 Ga0081538_100183386 251
425 3300005983 Ga0081540_1002413 Ga0081540_10024139 251
426 3300006038 Ga0075365_10040270 Ga0075365_100402703 251
427 3300006042 Ga0075368_10125050 Ga0075368_101250501 251
428 3300006048 Ga0075363_100033082 Ga0075363_1000330824 251
429 3300006051 Ga0075364_10008816 Ga0075364_100088167 251
430 3300006177 Ga0075362_10014874 Ga0075362_100148742 251
431 3300006178 Ga0075367_10124156 Ga0075367_101241562 251
432 3300006186 Ga0075369_10016633 Ga0075369_100166334 251
433 3300006195 Ga0075366_10001687 Ga0075366_100016877 251
434 3300006844 Ga0075428_100007282 Ga0075428_10000728210 251
435 3300006844 Ga0075428_100124513 Ga0075428_1001245133 251
436 3300006846 Ga0075430_100021979 Ga0075430_1000219796 251
437 3300006847 Ga0075431_100001810 Ga0075431_10000181016 251
438 3300006880 Ga0075429_100004783 Ga0075429_10000478313 251
439 3300006880 Ga0075429_100021886 Ga0075429_1000218867 251
440 3300007076 Ga0075435_100149194 Ga0075435_1001491942 251
441 3300009094 Ga0111539_10013539 Ga0111539_100135398 251
442 3300009094 Ga0111539_10358184 Ga0111539_103581842 251
443 3300009147 Ga0114129_10000742 Ga0114129_1000074237 251
444 3300025926 Ga0207659_10145896 Ga0207659_101458962 251
445 3300025961 Ga0207712_10395616 Ga0207712_103956162 251
446 3300025981 Ga0207640_10031052 Ga0207640_100310522 251
447 3300026118 Ga0207675_100476579 Ga0207675_1004765791 251
448 3300026142 Ga0207698_10192321 Ga0207698_101923212 251
449 3300027907 Ga0207428_10013736 Ga0207428_100137367 251
450 3300027907 Ga0207428_10016308 Ga0207428_100163082 251
451 3300035116 Ga0373945_0010311 Ga0373945_0010311_1737_2498 251
452 3300035692 Ga0373935_0006902 Ga0373935_0006902_5017_5778 251
453 3300035695 Ga0373927_0095761 Ga0373927_0095761_1063_1824 251
454 3300035725 Ga0373947_0080997 Ga0373947_0080997_43_804 251
455 3300037068 Ga0373925_0038812 Ga0373925_0038812_894_1655 251
456 3300041408 Ga0439453_0002489 Ga0439453_0002489_243_1004 251
457 3300042003 Ga0439443_000477 Ga0439443_000477_576_1337 251
458 3300042436 Ga0439435_0000646 Ga0439435_0000646_1872_2633 251
459 3300046454 Ga0495592_0071960 Ga0495592_0071960_626_1387 251
460 3300046455 Ga0495603_0090177 Ga0495603_0090177_311_1072 251
461 3300046459 Ga0495629_0019080 Ga0495629_0019080_2961_3722 251
462 3300046463 Ga0495653_0037925 Ga0495653_0037925_1082_1843 251
463 3300046475 Ga0495639_0038991 Ga0495639_0038991_119_880 251
464 3300046477 Ga0495664_0000112 Ga0495664_0000112_33682_34443 251
465 3300046514 Ga0495618_0001016 Ga0495618_0001016_3881_4642 251
466 3300046517 Ga0495630_0015890 Ga0495630_0015890_287_1048 251
467 3300046533 Ga0495640_0008881 Ga0495640_0008881_3021_3782 251
468 3300046543 Ga0495645_0005275 Ga0495645_0005275_3668_4429 251
469 3300046642 Ga0495634_0003620 Ga0495634_0003620_10750_11511 251
470 3300046663 Ga0495635_0004867 Ga0495635_0004867_635_1396 251
471 3300046680 Ga0495646_0061367 Ga0495646_0061367_324_1085 251
472 3300046690 Ga0495624_0096687 Ga0495624_0096687_279_1040 251
473 3300047319 Ga0495674_0001513 Ga0495674_0001513_14204_14965 251
474 3300047320 Ga0495672_0211159 Ga0495672_0211159_104_865 251
475 3300047471 Ga0495684_0001309 Ga0495684_0001309_14267_15028 251
476 3300048907 Ga0496104_0005217 Ga0496104_0005217_4190_4951 251
477 3300048911 Ga0496108_0032769 Ga0496108_0032769_2998_3759 251
478 3300048912 Ga0496109_0005940 Ga0496109_0005940_3060_3821 251
479 3300048913 Ga0496110_0002357 Ga0496110_0002357_7592_8353 251
480 3300048914 Ga0496111_0023917 Ga0496111_0023917_2355_3116 251
481 3300048915 Ga0496112_0078758 Ga0496112_0078758_194_955 251
482 3300048916 Ga0496113_0002665 Ga0496113_0002665_569_1330 251
483 3300049572 Ga0501036_0282535 Ga0501036_0282535_53_820 251
484 3300049576 Ga0501040_0318735 Ga0501040_0318735_17_784 251
485 3300049576 Ga0501040_0390174 Ga0501040_0390174_156_917 251
486 3300049577 Ga0501041_0107756 Ga0501041_0107756_83_844 251
487 3300049577 Ga0501041_0125194 Ga0501041_0125194_666_1433 251
488 3300049577 Ga0501041_0213223 Ga0501041_0213223_204_965 251
489 3300049578 Ga0501042_0196918 Ga0501042_0196918_611_1378 251
490 3300049578 Ga0501042_0202099 Ga0501042_0202099_518_1279 251
491 3300049580 Ga0501046_0216539 Ga0501046_0216539_130_891 251
492 3300049580 Ga0501046_0324833 Ga0501046_0324833_324_1091 251
493 3300049582 Ga0501048_0105395 Ga0501048_0105395_250_1017 251
494 3300049582 Ga0501048_0371157 Ga0501048_0371157_120_881 251
495 3300049586 Ga0501070_0471341 Ga0501070_0471341_142_903 251
496 3300049588 Ga0501072_0071741 Ga0501072_0071741_1460_2227 251
497 3300049588 Ga0501072_0099576 Ga0501072_0099576_287_1042 251
498 3300049590 Ga0501074_0575730 Ga0501074_0575730_19_780 251
499 3300049591 Ga0501075_0098564 Ga0501075_0098564_1189_1950 251
500 3300049591 Ga0501075_0124053 Ga0501075_0124053_794_1561 251
501 3300049591 Ga0501075_0125334 Ga0501075_0125334_660_1421 251
502 3300049592 Ga0501076_0216486 Ga0501076_0216486_528_1289 251
503 3300049592 Ga0501076_0420225 Ga0501076_0420225_156_917 251
504 3300049593 Ga0501077_0105319 Ga0501077_0105319_806_1567 251
505 3300049593 Ga0501077_0183791 Ga0501077_0183791_180_941 251
506 3300049593 Ga0501077_0378527 Ga0501077_0378527_58_819 251
507 3300049741 Ga0501079_0118163 Ga0501079_0118163_576_1343 251
508 3300049741 Ga0501079_0498850 Ga0501079_0498850_76_852 251
509 3300049742 Ga0501080_0284670 Ga0501080_0284670_425_1192 251
510 3300050489 nmdc:mga03683_4783_c1 nmdc:mga03683_4783_c1_2714_3475 251
511 3300050491 nmdc:mga00v17_4490_c1 nmdc:mga00v17_4490_c1_2818_3579 251
512 3300050492 nmdc:mga0yw44_114460_c1 nmdc:mga0yw44_114460_c1_397_1158 251
513 3300050492 nmdc:mga0yw44_23841_c1 nmdc:mga0yw44_23841_c1_1605_2366 251
514 3300050493 nmdc:mga0k408_2408_c1 nmdc:mga0k408_2408_c1_352_1113 251
515 3300050507 nmdc:mga05p37_508_c2 nmdc:mga05p37_508_c2_4687_5448 251
516 3300050508 nmdc:mga09592_30039_c1 nmdc:mga09592_30039_c1_85_846 251
517 3300050508 nmdc:mga09592_92656_c1 nmdc:mga09592_92656_c1_515_1276 251
518 3300050509 nmdc:mga0qj67_15510_c1 nmdc:mga0qj67_15510_c1_4513_5274 251
519 3300050510 nmdc:mga06r32_1960_c1 nmdc:mga06r32_1960_c1_4339_5100 251
520 3300050510 nmdc:mga06r32_34449_c1 nmdc:mga06r32_34449_c1_624_1385 251
521 3300050510 nmdc:mga06r32_489666_c1 nmdc:mga06r32_489666_c1_178_939 251
522 3300050511 nmdc:mga08y16_14675_c1 nmdc:mga08y16_14675_c1_5998_6759 251
523 3300050511 nmdc:mga08y16_2332_c1 nmdc:mga08y16_2332_c1_4338_5099 251
524 3300050514 nmdc:mga08x19_116183_c1 nmdc:mga08x19_116183_c1_179_940 251
525 3300053077 Ga0495601_0004619 Ga0495601_0004619_3324_4085 251
526 3300053078 Ga0495612_0000308 Ga0495612_0000308_7850_8611 251
527 3300053085 Ga0495619_0001598 Ga0495619_0001598_13352_14113 251
528 3300053153 Ga0500616_0062798 Ga0500616_0062798_116_877 251
529 3300054114 Ga0501084_0370135 Ga0501084_0370135_340_1128 251
530 3300061734 Ga0530510_0220076 Ga0530510_0220076_121_909 251
531 3300061734 Ga0530510_0419855 Ga0530510_0419855_106_867 251
532 3300005329 Ga0070683_100400610 Ga0070683_1004006102 252
533 3300005353 Ga0070669_100045834 Ga0070669_1000458342 252
534 3300005458 Ga0070681_10502254 Ga0070681_105022541 252
535 3300005459 Ga0068867_100277257 Ga0068867_1002772572 252
536 3300005719 Ga0068861_100112392 Ga0068861_1001123922 252
537 3300006846 Ga0075430_100000223 Ga0075430_10000022334 252
538 3300006871 Ga0075434_100082088 Ga0075434_1000820883 252
539 3300007076 Ga0075435_100698182 Ga0075435_1006981821 252
540 3300009094 Ga0111539_10108411 Ga0111539_101084111 252
541 3300009545 Ga0105237_10262560 Ga0105237_102625602 252
542 3300009551 Ga0105238_10011216 Ga0105238_100112169 252
543 3300025898 Ga0207692_10076273 Ga0207692_100762732 252
544 3300025924 Ga0207694_10044775 Ga0207694_100447753 252
545 3300025944 Ga0207661_10320955 Ga0207661_103209552 252
546 3300034818 Ga0373950_0007552 Ga0373950_0007552_797_1561 252
547 3300034957 Ga0373938_0049817 Ga0373938_0049817_28_792 252
548 3300035088 Ga0373940_0041509 Ga0373940_0041509_313_1077 252
549 3300035115 Ga0373941_0085807 Ga0373941_0085807_252_1016 252
550 3300035242 Ga0373962_0033854 Ga0373962_0033854_416_1180 252
551 3300035691 Ga0373931_0004302 Ga0373931_0004302_2496_3260 252
552 3300035691 Ga0373931_0108251 Ga0373931_0108251_403_1167 252
553 3300042436 Ga0439435_0028486 Ga0439435_0028486_249_1013 252
554 3300048912 Ga0496109_0191932 Ga0496109_0191932_1115_1879 252
555 3300048913 Ga0496110_0022973 Ga0496110_0022973_3688_4452 252
556 3300048913 Ga0496110_0444018 Ga0496110_0444018_220_984 252
557 3300048914 Ga0496111_0013977 Ga0496111_0013977_4366_5130 252
558 3300048915 Ga0496112_0302782 Ga0496112_0302782_408_1172 252
559 3300048917 Ga0496114_0242600 Ga0496114_0242600_148_942 252
560 3300048918 Ga0496115_0271117 Ga0496115_0271117_282_1046 252
561 3300049569 Ga0501032_0148159 Ga0501032_0148159_605_1363 252
562 3300049571 Ga0501034_0001160 Ga0501034_0001160_907_1671 252
563 3300049571 Ga0501034_0029366 Ga0501034_0029366_2305_3063 252
564 3300049574 Ga0501038_0076041 Ga0501038_0076041_2059_2817 252
565 3300049581 Ga0501047_0018859 Ga0501047_0018859_3527_4285 252
566 3300049583 Ga0501067_0202144 Ga0501067_0202144_246_1010 252
567 3300049586 Ga0501070_0113855 Ga0501070_0113855_400_1164 252
568 3300049589 Ga0501073_0029987 Ga0501073_0029987_629_1387 252
569 3300049589 Ga0501073_0546123 Ga0501073_0546123_11_775 252
570 3300049744 Ga0501083_0057931 Ga0501083_0057931_842_1606 252
571 3300049744 Ga0501083_0240612 Ga0501083_0240612_228_992 252
572 3300049822 Ga0501035_0294443 Ga0501035_0294443_540_1298 252
573 3300049823 Ga0501044_0088157 Ga0501044_0088157_2326_3084 252
574 3300050509 nmdc:mga0qj67_52_c1 nmdc:mga0qj67_52_c1_81584_82345 252
575 3300050511 nmdc:mga08y16_75718_c1 nmdc:mga08y16_75718_c1_894_1658 252
576 3300050512 nmdc:mga0n895_414424_c1 nmdc:mga0n895_414424_c1_92_871 252
577 3300050512 nmdc:mga0n895_697_c1 nmdc:mga0n895_697_c1_20975_21739 252
578 3300050513 nmdc:mga0rr50_617932_c1 nmdc:mga0rr50_617932_c1_67_831 252
579 3300050515 nmdc:mga0a205_435226_c1 nmdc:mga0a205_435226_c1_256_1020 252
580 3300060353 Ga0501082_0013431 Ga0501082_0013431_3727_4485 252
581 3300060353 Ga0501082_0398927 Ga0501082_0398927_349_1113 252
582 3300003215 JGI25153J46596_10002462 JGI25153J46596_100024625 253
583 3300003911 JGI25405J52794_10004616 JGI25405J52794_100046161 253
584 3300005437 Ga0070710_10082207 Ga0070710_100822072 253
585 3300005937 Ga0081455_10016936 Ga0081455_100169363 253
586 3300006844 Ga0075428_100245919 Ga0075428_1002459192 253
587 3300009094 Ga0111539_10409294 Ga0111539_104092942 253
588 3300009147 Ga0114129_10148174 Ga0114129_101481743 253
589 3300009147 Ga0114129_10260479 Ga0114129_102604792 253
590 3300024225 Ga0224572_1013150 Ga0224572_10131502 253
591 3300024227 Ga0228598_1016476 Ga0228598_10164762 253
592 3300025297 Ga0209758_1000079 Ga0209758_1000079114 253
593 3300025928 Ga0207700_10293094 Ga0207700_102930942 253
594 3300028023 Ga0265357_1002134 Ga0265357_10021341 253
595 3300031090 Ga0265760_10069529 Ga0265760_100695292 253
596 3300031247 Ga0265340_10216465 Ga0265340_102164651 253
597 3300031344 Ga0265316_10345461 Ga0265316_103454612 253
598 3300031824 Ga0307413_10105998 Ga0307413_101059982 253
599 3300031901 Ga0307406_10733410 Ga0307406_107334101 253
600 3300032005 Ga0307411_10044801 Ga0307411_100448013 253
601 3300035089 Ga0373944_0007357 Ga0373944_0007357_285_1058 253
602 3300035113 Ga0373936_0029855 Ga0373936_0029855_1124_1897 253
603 3300035116 Ga0373945_0030077 Ga0373945_0030077_50_823 253
604 3300035118 Ga0373954_0137932 Ga0373954_0137932_297_1064 253
605 3300035170 Ga0373943_0000132 Ga0373943_0000132_21498_22271 253
606 3300035171 Ga0373946_0000760 Ga0373946_0000760_4350_5123 253
607 3300035171 Ga0373946_0111178 Ga0373946_0111178_145_978 253
608 3300035172 Ga0373955_0270947 Ga0373955_0270947_134_904 253
609 3300035207 Ga0373942_0061063 Ga0373942_0061063_224_1012 253
610 3300035692 Ga0373935_0003568 Ga0373935_0003568_4851_5624 253
611 3300035695 Ga0373927_0011111 Ga0373927_0011111_4929_5702 253
612 3300035725 Ga0373947_0000239 Ga0373947_0000239_10847_11620 253
613 3300037068 Ga0373925_0000706 Ga0373925_0000706_25886_26659 253
614 3300037068 Ga0373925_0073022 Ga0373925_0073022_288_1058 253
615 3300039437 Ga0436365_0497354 Ga0436365_0497354_1792_2559 253
616 3300039437 Ga0436365_1614912 Ga0436365_1614912_2353_3132 253
617 3300046459 Ga0495629_0233255 Ga0495629_0233255_460_1233 253
618 3300046472 Ga0495580_0017640 Ga0495580_0017640_1889_2662 253
619 3300046476 Ga0495662_0051846 Ga0495662_0051846_922_1695 253
620 3300046499 Ga0495594_0247839 Ga0495594_0247839_114_887 253
621 3300046517 Ga0495630_0027968 Ga0495630_0027968_2982_3755 253
622 3300046531 Ga0495665_0115799 Ga0495665_0115799_126_899 253
623 3300046664 Ga0495659_0098745 Ga0495659_0098745_248_1018 253
624 3300046689 Ga0495613_0056650 Ga0495613_0056650_874_1647 253
625 3300046690 Ga0495624_0001294 Ga0495624_0001294_9704_10477 253
626 3300047315 Ga0495581_0005649 Ga0495581_0005649_190_963 253
627 3300047321 Ga0495676_0171305 Ga0495676_0171305_29_802 253
628 3300047471 Ga0495684_0000264 Ga0495684_0000264_25686_26459 253
629 3300047673 Ga0495593_0020031 Ga0495593_0020031_260_1033 253
630 3300048088 Ga0495602_0460889 Ga0495602_0460889_108_878 253
631 3300048903 Ga0496100_0006720 Ga0496100_0006720_2034_2804 253
632 3300048903 Ga0496100_0032334 Ga0496100_0032334_744_1511 253
633 3300048904 Ga0496101_0090963 Ga0496101_0090963_1163_1933 253
634 3300048907 Ga0496104_0101035 Ga0496104_0101035_914_1684 253
635 3300048907 Ga0496104_0166636 Ga0496104_0166636_1203_1982 253
636 3300048908 Ga0496105_0172070 Ga0496105_0172070_661_1431 253
637 3300048908 Ga0496105_0213306 Ga0496105_0213306_632_1411 253
638 3300048917 Ga0496114_0284430 Ga0496114_0284430_537_1307 253
639 3300048918 Ga0496115_0080355 Ga0496115_0080355_550_1320 253
640 3300049582 Ga0501048_0405454 Ga0501048_0405454_65_862 253
641 3300050510 nmdc:mga06r32_53801_c1 nmdc:mga06r32_53801_c1_69_836 253
642 3300050511 nmdc:mga08y16_283486_c1 nmdc:mga08y16_283486_c1_238_1005 253
643 3300053077 Ga0495601_0113370 Ga0495601_0113370_44_814 253
644 3300053084 Ga0495595_0031159 Ga0495595_0031159_634_1401 253
645 3300005436 Ga0070713_100028859 Ga0070713_1000288593 254
646 3300005439 Ga0070711_100073831 Ga0070711_1000738312 254
647 3300005457 Ga0070662_100176643 Ga0070662_1001766431 254
648 3300005981 Ga0081538_10068602 Ga0081538_100686022 254
649 3300005983 Ga0081540_1005241 Ga0081540_10052416 254
650 3300006028 Ga0070717_10010759 Ga0070717_100107593 254
651 3300006051 Ga0075364_10057317 Ga0075364_100573172 254
652 3300006163 Ga0070715_10015144 Ga0070715_100151443 254
653 3300006173 Ga0070716_100047381 Ga0070716_1000473813 254
654 3300025898 Ga0207692_10051167 Ga0207692_100511672 254
655 3300025915 Ga0207693_10010113 Ga0207693_100101132 254
656 3300025916 Ga0207663_10183783 Ga0207663_101837832 254
657 3300025929 Ga0207664_10092332 Ga0207664_100923322 254
658 3300025939 Ga0207665_10003934 Ga0207665_100039347 254
659 3300044694 Ga0466963_0190873 Ga0466963_0190873_86_862 254
660 3300044842 Ga0466957_0034003 Ga0466957_0034003_1871_2647 254
661 3300045049 Ga0466959_0168004 Ga0466959_0168004_712_1488 254
662 3300045836 Ga0466958_0171884 Ga0466958_0171884_403_1179 254
663 3300048909 Ga0496106_0017560 Ga0496106_0017560_3668_4438 254
664 3300005328 Ga0070676_10107334 Ga0070676_101073342 255
665 3300005330 Ga0070690_100076879 Ga0070690_1000768792 255
666 3300005334 Ga0068869_100193995 Ga0068869_1001939952 255
667 3300005339 Ga0070660_100244998 Ga0070660_1002449981 255
668 3300005340 Ga0070689_100138970 Ga0070689_1001389702 255
669 3300005345 Ga0070692_10210532 Ga0070692_102105321 255
670 3300005353 Ga0070669_100141434 Ga0070669_1001414342 255
671 3300005364 Ga0070673_100086664 Ga0070673_1000866642 255
672 3300005441 Ga0070700_100417352 Ga0070700_1004173521 255
673 3300005466 Ga0070685_10164789 Ga0070685_101647891 255
674 3300005535 Ga0070684_100326179 Ga0070684_1003261791 255
675 3300005564 Ga0070664_100076795 Ga0070664_1000767952 255
676 3300005615 Ga0070702_100269451 Ga0070702_1002694511 255
677 3300005616 Ga0068852_100436738 Ga0068852_1004367381 255
678 3300005617 Ga0068859_100825794 Ga0068859_1008257941 255
679 3300005718 Ga0068866_10089937 Ga0068866_100899372 255
680 3300005844 Ga0068862_100216773 Ga0068862_1002167732 255
681 3300006028 Ga0070717_10635447 Ga0070717_106354471 255
682 3300006038 Ga0075365_10054308 Ga0075365_100543082 255
683 3300006038 Ga0075365_10133288 Ga0075365_101332883 255
684 3300006038 Ga0075365_10256126 Ga0075365_102561261 255
685 3300006042 Ga0075368_10034063 Ga0075368_100340631 255
686 3300006177 Ga0075362_10171211 Ga0075362_101712112 255
687 3300006178 Ga0075367_10408182 Ga0075367_104081821 255
688 3300006844 Ga0075428_100068287 Ga0075428_1000682873 255
689 3300006931 Ga0097620_100825766 Ga0097620_1008257661 255
690 3300009147 Ga0114129_10072693 Ga0114129_100726934 255
691 3300009553 Ga0105249_10319768 Ga0105249_103197682 255
692 3300013296 Ga0157374_10130183 Ga0157374_101301832 255
693 3300013297 Ga0157378_10229704 Ga0157378_102297042 255
694 3300014325 Ga0163163_10084887 Ga0163163_100848872 255
695 3300025901 Ga0207688_10002075 Ga0207688_100020752 255
696 3300025904 Ga0207647_10080366 Ga0207647_100803662 255
697 3300025907 Ga0207645_10027896 Ga0207645_100278963 255
698 3300025908 Ga0207643_10002314 Ga0207643_100023142 255
699 3300025918 Ga0207662_10022432 Ga0207662_100224324 255
700 3300025925 Ga0207650_10015020 Ga0207650_100150204 255
701 3300025933 Ga0207706_10138699 Ga0207706_101386993 255
702 3300025934 Ga0207686_10322567 Ga0207686_103225671 255
703 3300025940 Ga0207691_10002493 Ga0207691_100024935 255
704 3300025942 Ga0207689_10064489 Ga0207689_100644892 255
705 3300025961 Ga0207712_10305140 Ga0207712_103051402 255
706 3300025981 Ga0207640_10086417 Ga0207640_100864172 255
707 3300026035 Ga0207703_10413126 Ga0207703_104131261 255
708 3300026067 Ga0207678_10006342 Ga0207678_100063424 255
709 3300026075 Ga0207708_10067796 Ga0207708_100677962 255
710 3300026075 Ga0207708_10419328 Ga0207708_104193281 255
711 3300026088 Ga0207641_10545589 Ga0207641_105455892 255
712 3300026095 Ga0207676_10331087 Ga0207676_103310872 255
713 3300026118 Ga0207675_100053907 Ga0207675_1000539072 255
714 3300026121 Ga0207683_10132061 Ga0207683_101320612 255
715 3300027866 Ga0209813_10082809 Ga0209813_100828091 255
716 3300028800 Ga0265338_10038132 Ga0265338_100381324 255
717 3300031241 Ga0265325_10022061 Ga0265325_100220613 255
718 3300031249 Ga0265339_10000091 Ga0265339_100000912 255
719 3300031595 Ga0265313_10001068 Ga0265313_100010683 255
720 3300031712 Ga0265342_10051287 Ga0265342_100512872 255
721 3300035089 Ga0373944_0120512 Ga0373944_0120512_74_850 255
722 3300035170 Ga0373943_0014659 Ga0373943_0014659_1751_2521 255
723 3300035692 Ga0373935_0069841 Ga0373935_0069841_218_994 255
724 3300035692 Ga0373935_0574631 Ga0373935_0574631_23_799 255
725 3300035725 Ga0373947_0008738 Ga0373947_0008738_3433_4209 255
726 3300037068 Ga0373925_0057058 Ga0373925_0057058_362_1138 255
727 3300041492 Ga0451835_0493760 Ga0451835_0493760_235_1014 255
728 3300046455 Ga0495603_0155645 Ga0495603_0155645_153_929 255
729 3300046472 Ga0495580_0034551 Ga0495580_0034551_1285_2055 255
730 3300046475 Ga0495639_0067099 Ga0495639_0067099_836_1606 255
731 3300046515 Ga0495620_0073308 Ga0495620_0073308_235_1128 255
732 3300046526 Ga0495666_0045397 Ga0495666_0045397_114_890 255
733 3300046531 Ga0495665_0123334 Ga0495665_0123334_40_816 255
734 3300046538 Ga0495609_0132914 Ga0495609_0132914_143_1036 255
735 3300046559 Ga0495667_0273622 Ga0495667_0273622_35_811 255
736 3300046648 Ga0495611_0157480 Ga0495611_0157480_170_946 255
737 3300046674 Ga0495588_0019668 Ga0495588_0019668_1921_2697 255
738 3300046683 Ga0495658_0014265 Ga0495658_0014265_1271_2047 255
739 3300046684 Ga0495669_0028471 Ga0495669_0028471_801_1694 255
740 3300046690 Ga0495624_0091603 Ga0495624_0091603_938_1714 255
741 3300046690 Ga0495624_0184177 Ga0495624_0184177_256_1092 255
742 3300047315 Ga0495581_0205382 Ga0495581_0205382_234_1010 255
743 3300047319 Ga0495674_0406574 Ga0495674_0406574_38_814 255
744 3300047321 Ga0495676_0130099 Ga0495676_0130099_968_1744 255
745 3300047472 Ga0495686_0172416 Ga0495686_0172416_63_956 255
746 3300048903 Ga0496100_0305060 Ga0496100_0305060_312_1091 255
747 3300048905 Ga0496102_0137970 Ga0496102_0137970_1452_2228 255
748 3300048905 Ga0496102_0362586 Ga0496102_0362586_235_1128 255
749 3300048907 Ga0496104_0018853 Ga0496104_0018853_489_1265 255
750 3300048907 Ga0496104_0036022 Ga0496104_0036022_1398_2177 255
751 3300048908 Ga0496105_0004562 Ga0496105_0004562_8187_8963 255
752 3300048909 Ga0496106_0009344 Ga0496106_0009344_1377_2153 255
753 3300048910 Ga0496107_0194999 Ga0496107_0194999_159_935 255
754 3300048912 Ga0496109_0000340 Ga0496109_0000340_5520_6296 255
755 3300048913 Ga0496110_0014914 Ga0496110_0014914_2116_2892 255
756 3300048913 Ga0496110_0122134 Ga0496110_0122134_376_1155 255
757 3300048914 Ga0496111_0171207 Ga0496111_0171207_750_1526 255
758 3300048916 Ga0496113_0348048 Ga0496113_0348048_356_1132 255
759 3300048918 Ga0496115_0096761 Ga0496115_0096761_750_1625 255
760 3300048918 Ga0496115_0101996 Ga0496115_0101996_21_797 255
761 3300049585 Ga0501069_0046105 Ga0501069_0046105_1428_2207 255
762 3300049586 Ga0501070_0003185 Ga0501070_0003185_13144_13923 255
763 3300049586 Ga0501070_0172111 Ga0501070_0172111_539_1318 255
764 3300049742 Ga0501080_0096741 Ga0501080_0096741_175_954 255
765 3300049822 Ga0501035_0000127 Ga0501035_0000127_56640_57419 255
766 3300050491 nmdc:mga00v17_196983_c1 nmdc:mga00v17_196983_c1_373_1146 255
767 3300050495 nmdc:mga04h51_83923_c1 nmdc:mga04h51_83923_c1_141_1034 255
768 3300050507 nmdc:mga05p37_90850_c1 nmdc:mga05p37_90850_c1_1299_2075 255
769 3300050510 nmdc:mga06r32_230180_c1 nmdc:mga06r32_230180_c1_135_911 255
770 3300050514 nmdc:mga08x19_274819_c1 nmdc:mga08x19_274819_c1_36_812 255
771 3300053077 Ga0495601_0460018 Ga0495601_0460018_25_804 255
772 3300053087 Ga0500643_009516 Ga0500643_009516_2684_3451 255
773 3300053093 Ga0500651_0022942 Ga0500651_0022942_2374_3141 255
774 3300053093 Ga0500651_0180041 Ga0500651_0180041_280_1047 255
775 3300053094 Ga0500566_0094479 Ga0500566_0094479_862_1629 255
776 3300053096 Ga0500641_0020457 Ga0500641_0020457_574_1347 255
777 3300053108 Ga0500562_057978 Ga0500562_057978_198_971 255
778 3300053119 Ga0500595_000010 Ga0500595_000010_63171_63938 255
779 3300053119 Ga0500595_014685 Ga0500595_014685_1933_2706 255
780 3300053119 Ga0500595_048037 Ga0500595_048037_448_1215 255
781 3300053153 Ga0500616_0000001 Ga0500616_0000001_756627_757394 255
782 3300053153 Ga0500616_0061428 Ga0500616_0061428_430_1203 255
783 3300053730 Ga0500645_000015 Ga0500645_000015_114174_114941 255
784 3300054114 Ga0501084_0077346 Ga0501084_0077346_1939_2721 255
785 3300060353 Ga0501082_0000013 Ga0501082_0000013_79351_80136 255
786 3300005329 Ga0070683_100228105 Ga0070683_1002281052 256
787 3300005336 Ga0070680_100094650 Ga0070680_1000946501 256
788 3300005337 Ga0070682_100048274 Ga0070682_1000482743 256
789 3300005406 Ga0070703_10027328 Ga0070703_100273282 256
790 3300005434 Ga0070709_10199392 Ga0070709_101993922 256
791 3300005435 Ga0070714_100111046 Ga0070714_1001110463 256
792 3300005435 Ga0070714_100623688 Ga0070714_1006236881 256
793 3300005436 Ga0070713_100108048 Ga0070713_1001080482 256
794 3300005445 Ga0070708_100249728 Ga0070708_1002497282 256
795 3300005518 Ga0070699_100318041 Ga0070699_1003180412 256
796 3300005530 Ga0070679_100127315 Ga0070679_1001273151 256
797 3300005530 Ga0070679_100212152 Ga0070679_1002121522 256
798 3300005614 Ga0068856_100475444 Ga0068856_1004754441 256
799 3300005937 Ga0081455_10007967 Ga0081455_100079671 256
800 3300006175 Ga0070712_100449611 Ga0070712_1004496111 256
801 3300007265 Ga0099794_10018222 Ga0099794_100182222 256
802 3300009093 Ga0105240_10146994 Ga0105240_101469943 256
803 3300013104 Ga0157370_10180697 Ga0157370_101806973 256
804 3300013308 Ga0157375_10191934 Ga0157375_101919343 256
805 3300021361 Ga0213872_10111987 Ga0213872_101119871 256
806 3300025885 Ga0207653_10009753 Ga0207653_100097533 256
807 3300025910 Ga0207684_10119069 Ga0207684_101190692 256
808 3300025912 Ga0207707_10361291 Ga0207707_103612912 256
809 3300025915 Ga0207693_10010718 Ga0207693_100107188 256
810 3300025915 Ga0207693_10031132 Ga0207693_100311323 256
811 3300025917 Ga0207660_10107168 Ga0207660_101071683 256
812 3300025921 Ga0207652_10257875 Ga0207652_102578752 256
813 3300025921 Ga0207652_10576436 Ga0207652_105764361 256
814 3300025924 Ga0207694_10182297 Ga0207694_101822972 256
815 3300025929 Ga0207664_10388968 Ga0207664_103889682 256
816 3300025929 Ga0207664_10403389 Ga0207664_104033891 256
817 3300025949 Ga0207667_10088810 Ga0207667_100888102 256
818 3300027671 Ga0209588_1021817 Ga0209588_10218172 256
819 3300031711 Ga0265314_10024428 Ga0265314_100244284 256
820 3300046460 Ga0495638_0039767 Ga0495638_0039767_1843_2619 256
821 3300046476 Ga0495662_0237944 Ga0495662_0237944_82_861 256
822 3300050512 nmdc:mga0n895_620401_c1 nmdc:mga0n895_620401_c1_202_978 256
823 3300005293 Ga0065715_10038352 Ga0065715_100383522 257
824 3300005328 Ga0070676_10079340 Ga0070676_100793403 257
825 3300005331 Ga0070670_100215578 Ga0070670_1002155782 257
826 3300005334 Ga0068869_100176034 Ga0068869_1001760341 257
827 3300005340 Ga0070689_100086925 Ga0070689_1000869252 257
828 3300005343 Ga0070687_100209803 Ga0070687_1002098032 257
829 3300005353 Ga0070669_100129722 Ga0070669_1001297222 257
830 3300005365 Ga0070688_100082189 Ga0070688_1000821892 257
831 3300005439 Ga0070711_100163297 Ga0070711_1001632972 257
832 3300005456 Ga0070678_100054346 Ga0070678_1000543462 257
833 3300005577 Ga0068857_100622489 Ga0068857_1006224891 257
834 3300005617 Ga0068859_100242104 Ga0068859_1002421042 257
835 3300005618 Ga0068864_100197788 Ga0068864_1001977882 257
836 3300005840 Ga0068870_10087983 Ga0068870_100879832 257
837 3300005842 Ga0068858_100391148 Ga0068858_1003911481 257
838 3300006914 Ga0075436_100116949 Ga0075436_1001169492 257
839 3300006931 Ga0097620_100242115 Ga0097620_1002421151 257
840 3300009101 Ga0105247_10135646 Ga0105247_101356461 257
841 3300009147 Ga0114129_10240682 Ga0114129_102406823 257
842 3300009148 Ga0105243_10774371 Ga0105243_107743711 257
843 3300009174 Ga0105241_10110703 Ga0105241_101107033 257
844 3300009177 Ga0105248_10451642 Ga0105248_104516421 257
845 3300014326 Ga0157380_10167974 Ga0157380_101679742 257
846 3300014969 Ga0157376_10440512 Ga0157376_104405122 257
847 3300025900 Ga0207710_10018719 Ga0207710_100187192 257
848 3300025901 Ga0207688_10062115 Ga0207688_100621152 257
849 3300025908 Ga0207643_10032530 Ga0207643_100325304 257
850 3300025911 Ga0207654_10361226 Ga0207654_103612262 257
851 3300025915 Ga0207693_10021275 Ga0207693_100212755 257
852 3300025916 Ga0207663_10166343 Ga0207663_101663432 257
853 3300025918 Ga0207662_10244695 Ga0207662_102446952 257
854 3300025923 Ga0207681_10253399 Ga0207681_102533992 257
855 3300025925 Ga0207650_10178535 Ga0207650_101785352 257
856 3300025927 Ga0207687_10030379 Ga0207687_100303793 257
857 3300025928 Ga0207700_10276966 Ga0207700_102769662 257
858 3300025935 Ga0207709_10131293 Ga0207709_101312932 257
859 3300025938 Ga0207704_10266244 Ga0207704_102662442 257
860 3300025939 Ga0207665_10133806 Ga0207665_101338062 257
861 3300025940 Ga0207691_10024434 Ga0207691_100244347 257
862 3300025941 Ga0207711_10469127 Ga0207711_104691271 257
863 3300025942 Ga0207689_10248080 Ga0207689_102480802 257
864 3300025986 Ga0207658_10034444 Ga0207658_100344442 257
865 3300026035 Ga0207703_10423763 Ga0207703_104237632 257
866 3300026041 Ga0207639_10436969 Ga0207639_104369692 257
867 3300026088 Ga0207641_10179572 Ga0207641_101795722 257
868 3300026095 Ga0207676_10100203 Ga0207676_101002032 257
869 3300026116 Ga0207674_10100292 Ga0207674_101002924 257
870 3300026118 Ga0207675_100291146 Ga0207675_1002911462 257
871 3300031241 Ga0265325_10001624 Ga0265325_100016247 257
872 3300031595 Ga0265313_10006723 Ga0265313_100067238 257
873 3300046492 Ga0495585_0196692 Ga0495585_0196692_85_867 257
874 3300046537 Ga0495598_0050085 Ga0495598_0050085_119_898 257
875 3300049571 Ga0501034_0006692 Ga0501034_0006692_9781_10563 257
876 3300049742 Ga0501080_0140519 Ga0501080_0140519_277_1059 257
877 3300050514 nmdc:mga08x19_386216_c1 nmdc:mga08x19_386216_c1_160_939 257
878 3300005436 Ga0070713_100296394 Ga0070713_1002963942 258
879 3300005937 Ga0081455_10054157 Ga0081455_100541572 258
880 3300009094 Ga0111539_10642777 Ga0111539_106427772 258
881 3300025915 Ga0207693_10097721 Ga0207693_100977212 258
882 3300031238 Ga0265332_10085378 Ga0265332_100853781 258
883 3300031241 Ga0265325_10105494 Ga0265325_101054941 258
884 3300044684 Ga0466966_0135867 Ga0466966_0135867_681_1475 258
885 3300049573 Ga0501037_0071272 Ga0501037_0071272_1229_2014 258
886 3300049586 Ga0501070_0097024 Ga0501070_0097024_134_919 258
887 3300049587 Ga0501071_0216273 Ga0501071_0216273_227_1012 258
888 3300049822 Ga0501035_0022579 Ga0501035_0022579_799_1584 258
889 3300049823 Ga0501044_0117406 Ga0501044_0117406_1191_1976 258
890 3300005340 Ga0070689_100063151 Ga0070689_1000631512 259
891 3300005365 Ga0070688_100064296 Ga0070688_1000642962 259
892 3300005466 Ga0070685_10023443 Ga0070685_100234435 259
893 3300006038 Ga0075365_10118964 Ga0075365_101189642 259
894 3300006844 Ga0075428_100099013 Ga0075428_1000990133 259
895 3300009147 Ga0114129_10008001 Ga0114129_100080011 259
896 3300009148 Ga0105243_10209355 Ga0105243_102093552 259
897 3300025918 Ga0207662_10108986 Ga0207662_101089862 259
898 3300031241 Ga0265325_10000901 Ga0265325_100009017 259
899 3300031249 Ga0265339_10000387 Ga0265339_1000038712 259
900 3300031344 Ga0265316_10222699 Ga0265316_102226991 259
901 3300031595 Ga0265313_10000850 Ga0265313_1000085019 259
902 3300037068 Ga0373925_0644593 Ga0373925_0644593_43_831 259
903 3300037418 Ga0395900_0108898 Ga0395900_0108898_1847_2719 259
904 3300044719 Ga0466971_0156124 Ga0466971_0156124_155_940 259
905 3300050507 nmdc:mga05p37_108365_c1 nmdc:mga05p37_108365_c1_2551_3336 259
906 3300050509 nmdc:mga0qj67_169352_c1 nmdc:mga0qj67_169352_c1_522_1307 259
907 3300050510 nmdc:mga06r32_105218_c1 nmdc:mga06r32_105218_c1_1292_2077 259
908 3300005983 Ga0081540_1011112 Ga0081540_10111128 260
909 3300006178 Ga0075367_10186253 Ga0075367_101862532 260
910 3300028381 Ga0268264_10353932 Ga0268264_103539322 260
911 3300031456 Ga0307513_10169054 Ga0307513_101690542 260
912 3300031595 Ga0265313_10174770 Ga0265313_101747701 260
913 3300031711 Ga0265314_10007897 Ga0265314_100078973 260
914 3300036401 Ga0373937_0355286 Ga0373937_0355286_406_1203 260
915 3300044684 Ga0466966_0016428 Ga0466966_0016428_3349_4143 260
916 3300044694 Ga0466963_0013664 Ga0466963_0013664_1050_1844 260
917 3300044694 Ga0466963_0044109 Ga0466963_0044109_1916_2710 260
918 3300044719 Ga0466971_0008622 Ga0466971_0008622_28_822 260
919 3300045836 Ga0466958_0304967 Ga0466958_0304967_10_804 260
920 3300045976 Ga0466967_0000135 Ga0466967_0000135_2868_3662 260
921 3300045976 Ga0466967_0416209 Ga0466967_0416209_411_1205 260
922 3300046460 Ga0495638_0003988 Ga0495638_0003988_6911_7705 260
923 3300046460 Ga0495638_0244708 Ga0495638_0244708_177_971 260
924 3300046460 Ga0495638_0300939 Ga0495638_0300939_44_838 260
925 3300049586 Ga0501070_0027193 Ga0501070_0027193_2829_3629 260
926 3300049588 Ga0501072_0067915 Ga0501072_0067915_1945_2745 260
927 3300049589 Ga0501073_0261578 Ga0501073_0261578_67_858 260
928 3300049590 Ga0501074_0180182 Ga0501074_0180182_537_1337 260
929 3300049742 Ga0501080_0064534 Ga0501080_0064534_978_1778 260
930 3300049823 Ga0501044_0023098 Ga0501044_0023098_1597_2397 260
931 3300050492 nmdc:mga0yw44_89401_c1 nmdc:mga0yw44_89401_c1_488_1282 260
932 3300050494 nmdc:mga06z11_343661_c1 nmdc:mga06z11_343661_c1_67_864 260
933 3300053108 Ga0500562_056036 Ga0500562_056036_24_818 260
934 2209111006 2214772980 2213792850 261
935 3300000041 ARcpr5oldR_c000026 ARcpr5oldR_00002614 261
936 3300000042 ARSoilYngRDRAFT_c00029 ARSoilYngRDRAFT_0002914 261
937 3300000043 ARcpr5yngRDRAFT_c000044 ARcpr5yngRDRAFT_00004414 261
938 3300000044 ARSoilOldRDRAFT_c000037 ARSoilOldRDRAFT_00003720 261
939 3300000045 ARCol0oldRDRAFT_c01671 ARCol0oldRDRAFT_016711 261
940 3300000652 ARCol0yngRDRAFT_1000020 ARCol0yngRDRAFT_100002014 261
941 3300001977 JGI24746J21847_1005093 JGI24746J21847_10050933 261
942 3300001978 JGI24747J21853_1006822 JGI24747J21853_10068222 261
943 3300001979 JGI24740J21852_10036806 JGI24740J21852_100368061 261
944 3300001989 JGI24739J22299_10004550 JGI24739J22299_100045506 261
945 3300001989 JGI24739J22299_10008850 JGI24739J22299_100088503 261
946 3300001990 JGI24737J22298_10001930 JGI24737J22298_100019303 261
947 3300001991 JGI24743J22301_10003452 JGI24743J22301_100034522 261
948 3300002070 JGI24750J21931_1000586 JGI24750J21931_10005866 261
949 3300002073 JGI24745J21846_1000864 JGI24745J21846_10008642 261
950 3300002076 JGI24749J21850_1001223 JGI24749J21850_10012232 261
951 3300002077 JGI24744J21845_10000745 JGI24744J21845_100007456 261
952 3300002126 JGI24035J26624_1001145 JGI24035J26624_10011452 261
953 3300002244 JGI24742J22300_10000139 JGI24742J22300_1000013912 261
954 3300002459 JGI24751J29686_10015704 JGI24751J29686_100157042 261
955 3300005277 Ga0065716_1001673 Ga0065716_10016733 261
956 3300005290 Ga0065712_10071735 Ga0065712_100717353 261
957 3300005290 Ga0065712_10077193 Ga0065712_100771932 261
958 3300005293 Ga0065715_10092917 Ga0065715_100929172 261
959 3300005293 Ga0065715_10113387 Ga0065715_101133872 261
960 3300005327 Ga0070658_10021114 Ga0070658_100211146 261
961 3300005327 Ga0070658_10191350 Ga0070658_101913502 261
962 3300005328 Ga0070676_10001078 Ga0070676_100010786 261
963 3300005329 Ga0070683_100007390 Ga0070683_1000073903 261
964 3300005329 Ga0070683_100138777 Ga0070683_1001387771 261
965 3300005330 Ga0070690_100303803 Ga0070690_1003038032 261
966 3300005331 Ga0070670_100037546 Ga0070670_1000375463 261
967 3300005335 Ga0070666_10162832 Ga0070666_101628322 261
968 3300005336 Ga0070680_100004715 Ga0070680_1000047156 261
969 3300005336 Ga0070680_100021923 Ga0070680_1000219232 261
970 3300005337 Ga0070682_100001091 Ga0070682_10000109118 261
971 3300005337 Ga0070682_100108168 Ga0070682_1001081682 261
972 3300005338 Ga0068868_100037790 Ga0068868_1000377903 261
973 3300005338 Ga0068868_100305139 Ga0068868_1003051392 261
974 3300005339 Ga0070660_100001398 Ga0070660_1000013988 261
975 3300005339 Ga0070660_100058854 Ga0070660_1000588543 261
976 3300005339 Ga0070660_100189907 Ga0070660_1001899072 261
977 3300005339 Ga0070660_100249932 Ga0070660_1002499322 261
978 3300005339 Ga0070660_100409626 Ga0070660_1004096262 261
979 3300005339 Ga0070660_100418893 Ga0070660_1004188932 261
980 3300005340 Ga0070689_100017677 Ga0070689_1000176771 261
981 3300005340 Ga0070689_100316812 Ga0070689_1003168122 261
982 3300005340 Ga0070689_100488322 Ga0070689_1004883221 261
983 3300005341 Ga0070691_10000769 Ga0070691_100007697 261
984 3300005341 Ga0070691_10205457 Ga0070691_102054572 261
985 3300005343 Ga0070687_100177502 Ga0070687_1001775022 261
986 3300005344 Ga0070661_100001076 Ga0070661_10000107619 261
987 3300005344 Ga0070661_100061169 Ga0070661_1000611691 261
988 3300005344 Ga0070661_100061862 Ga0070661_1000618623 261
989 3300005344 Ga0070661_100187879 Ga0070661_1001878792 261
990 3300005345 Ga0070692_10015532 Ga0070692_100155322 261
991 3300005347 Ga0070668_100012317 Ga0070668_1000123172 261
992 3300005347 Ga0070668_100330193 Ga0070668_1003301931 261
993 3300005353 Ga0070669_100005888 Ga0070669_1000058885 261
994 3300005353 Ga0070669_100161681 Ga0070669_1001616812 261
995 3300005354 Ga0070675_100000727 Ga0070675_10000072722 261
996 3300005355 Ga0070671_100000438 Ga0070671_10000043814 261
997 3300005355 Ga0070671_100017456 Ga0070671_1000174562 261
998 3300005355 Ga0070671_100018195 Ga0070671_1000181952 261
999 3300005355 Ga0070671_100146871 Ga0070671_1001468712 261
1000 3300005356 Ga0070674_100001976 Ga0070674_1000019769 261
1001 3300005356 Ga0070674_100076955 Ga0070674_1000769552 261
1002 3300005364 Ga0070673_100001186 Ga0070673_1000011867 261
1003 3300005364 Ga0070673_100064845 Ga0070673_1000648452 261
1004 3300005364 Ga0070673_100231226 Ga0070673_1002312261 261
1005 3300005365 Ga0070688_100022325 Ga0070688_1000223252 261
1006 3300005365 Ga0070688_100116948 Ga0070688_1001169482 261
1007 3300005365 Ga0070688_100170191 Ga0070688_1001701912 261
1008 3300005366 Ga0070659_100005874 Ga0070659_1000058745 261
1009 3300005366 Ga0070659_100058285 Ga0070659_1000582853 261
1010 3300005366 Ga0070659_100159515 Ga0070659_1001595151 261
1011 3300005367 Ga0070667_100005963 Ga0070667_1000059633 261
1012 3300005367 Ga0070667_100150888 Ga0070667_1001508882 261
1013 3300005406 Ga0070703_10014584 Ga0070703_100145842 261
1014 3300005434 Ga0070709_10015469 Ga0070709_100154694 261
1015 3300005434 Ga0070709_10223114 Ga0070709_102231142 261
1016 3300005435 Ga0070714_100085977 Ga0070714_1000859772 261
1017 3300005436 Ga0070713_100005553 Ga0070713_1000055533 261
1018 3300005436 Ga0070713_100015791 Ga0070713_1000157912 261
1019 3300005437 Ga0070710_10010566 Ga0070710_100105664 261
1020 3300005438 Ga0070701_10000339 Ga0070701_100003397 261
1021 3300005439 Ga0070711_100027442 Ga0070711_1000274423 261
1022 3300005439 Ga0070711_100090812 Ga0070711_1000908122 261
1023 3300005439 Ga0070711_100384579 Ga0070711_1003845792 261
1024 3300005440 Ga0070705_100005352 Ga0070705_1000053527 261
1025 3300005441 Ga0070700_100000783 Ga0070700_10000078312 261
1026 3300005441 Ga0070700_100203189 Ga0070700_1002031892 261
1027 3300005441 Ga0070700_100337910 Ga0070700_1003379102 261
1028 3300005444 Ga0070694_100006633 Ga0070694_1000066334 261
1029 3300005455 Ga0070663_100017471 Ga0070663_1000174713 261
1030 3300005455 Ga0070663_100025858 Ga0070663_1000258583 261
1031 3300005455 Ga0070663_100033005 Ga0070663_1000330053 261
1032 3300005456 Ga0070678_100011564 Ga0070678_1000115643 261
1033 3300005456 Ga0070678_100160180 Ga0070678_1001601802 261
1034 3300005457 Ga0070662_100017941 Ga0070662_1000179414 261
1035 3300005457 Ga0070662_100093667 Ga0070662_1000936671 261
1036 3300005457 Ga0070662_100103866 Ga0070662_1001038663 261
1037 3300005458 Ga0070681_10051242 Ga0070681_100512422 261
1038 3300005458 Ga0070681_10070525 Ga0070681_100705253 261
1039 3300005458 Ga0070681_10089994 Ga0070681_100899942 261
1040 3300005458 Ga0070681_10133426 Ga0070681_101334262 261
1041 3300005459 Ga0068867_100504535 Ga0068867_1005045352 261
1042 3300005459 Ga0068867_100552296 Ga0068867_1005522961 261
1043 3300005466 Ga0070685_10005962 Ga0070685_100059622 261
1044 3300005466 Ga0070685_10022940 Ga0070685_100229403 261
1045 3300005468 Ga0070707_100232584 Ga0070707_1002325841 261
1046 3300005530 Ga0070679_100021002 Ga0070679_1000210027 261
1047 3300005530 Ga0070679_100056408 Ga0070679_1000564082 261
1048 3300005530 Ga0070679_100348569 Ga0070679_1003485692 261
1049 3300005530 Ga0070679_100457082 Ga0070679_1004570822 261
1050 3300005535 Ga0070684_100142264 Ga0070684_1001422642 261
1051 3300005535 Ga0070684_100345226 Ga0070684_1003452261 261
1052 3300005536 Ga0070697_100236973 Ga0070697_1002369732 261
1053 3300005539 Ga0068853_100004375 Ga0068853_1000043756 261
1054 3300005543 Ga0070672_100011149 Ga0070672_1000111492 261
1055 3300005543 Ga0070672_100022463 Ga0070672_1000224635 261
1056 3300005544 Ga0070686_100006762 Ga0070686_1000067627 261
1057 3300005545 Ga0070695_100030227 Ga0070695_1000302271 261
1058 3300005546 Ga0070696_100045814 Ga0070696_1000458142 261
1059 3300005546 Ga0070696_100246747 Ga0070696_1002467472 261
1060 3300005547 Ga0070693_100000577 Ga0070693_10000057714 261
1061 3300005547 Ga0070693_100010134 Ga0070693_1000101344 261
1062 3300005547 Ga0070693_100131349 Ga0070693_1001313492 261
1063 3300005548 Ga0070665_100076321 Ga0070665_1000763213 261
1064 3300005548 Ga0070665_100199540 Ga0070665_1001995402 261
1065 3300005549 Ga0070704_100028556 Ga0070704_1000285562 261
1066 3300005549 Ga0070704_100126371 Ga0070704_1001263711 261
1067 3300005563 Ga0068855_100014148 Ga0068855_1000141487 261
1068 3300005563 Ga0068855_100031300 Ga0068855_1000313002 261
1069 3300005564 Ga0070664_100002073 Ga0070664_1000020735 261
1070 3300005564 Ga0070664_100070153 Ga0070664_1000701533 261
1071 3300005564 Ga0070664_100145042 Ga0070664_1001450423 261
1072 3300005564 Ga0070664_100167671 Ga0070664_1001676713 261
1073 3300005564 Ga0070664_100175888 Ga0070664_1001758883 261
1074 3300005564 Ga0070664_100268699 Ga0070664_1002686992 261
1075 3300005564 Ga0070664_100341265 Ga0070664_1003412652 261
1076 3300005577 Ga0068857_100008536 Ga0068857_1000085362 261
1077 3300005578 Ga0068854_100001074 Ga0068854_10000107420 261
1078 3300005614 Ga0068856_100026335 Ga0068856_1000263352 261
1079 3300005614 Ga0068856_100039625 Ga0068856_1000396255 261
1080 3300005614 Ga0068856_100485250 Ga0068856_1004852502 261
1081 3300005614 Ga0068856_100554185 Ga0068856_1005541852 261
1082 3300005615 Ga0070702_100005245 Ga0070702_1000052457 261
1083 3300005615 Ga0070702_100023173 Ga0070702_1000231733 261
1084 3300005615 Ga0070702_100258096 Ga0070702_1002580962 261
1085 3300005616 Ga0068852_100001086 Ga0068852_10000108614 261
1086 3300005616 Ga0068852_100054483 Ga0068852_1000544833 261
1087 3300005617 Ga0068859_100023234 Ga0068859_1000232345 261
1088 3300005617 Ga0068859_100087792 Ga0068859_1000877923 261
1089 3300005617 Ga0068859_100108837 Ga0068859_1001088372 261
1090 3300005618 Ga0068864_100021486 Ga0068864_1000214865 261
1091 3300005618 Ga0068864_100025772 Ga0068864_1000257723 261
1092 3300005618 Ga0068864_100070454 Ga0068864_1000704542 261
1093 3300005718 Ga0068866_10000403 Ga0068866_1000040320 261
1094 3300005718 Ga0068866_10083848 Ga0068866_100838482 261
1095 3300005718 Ga0068866_10152188 Ga0068866_101521882 261
1096 3300005719 Ga0068861_100001047 Ga0068861_10000104716 261
1097 3300005840 Ga0068870_10000860 Ga0068870_100008607 261
1098 3300005841 Ga0068863_100003728 Ga0068863_1000037283 261
1099 3300005841 Ga0068863_100248601 Ga0068863_1002486012 261
1100 3300005842 Ga0068858_100032605 Ga0068858_1000326052 261
1101 3300005842 Ga0068858_100051742 Ga0068858_1000517424 261
1102 3300005842 Ga0068858_100098651 Ga0068858_1000986512 261
1103 3300005842 Ga0068858_100201782 Ga0068858_1002017823 261
1104 3300005843 Ga0068860_100023327 Ga0068860_1000233273 261
1105 3300005843 Ga0068860_100223447 Ga0068860_1002234472 261
1106 3300005844 Ga0068862_100024080 Ga0068862_1000240805 261
1107 3300005844 Ga0068862_100223767 Ga0068862_1002237672 261
1108 3300005937 Ga0081455_10000012 Ga0081455_10000012129 261
1109 3300005937 Ga0081455_10003284 Ga0081455_100032847 261
1110 3300005937 Ga0081455_10186527 Ga0081455_101865272 261
1111 3300005983 Ga0081540_1000185 Ga0081540_100018539 261
1112 3300006028 Ga0070717_10007114 Ga0070717_100071147 261
1113 3300006058 Ga0075432_10001490 Ga0075432_100014906 261
1114 3300006058 Ga0075432_10043086 Ga0075432_100430862 261
1115 3300006175 Ga0070712_100025089 Ga0070712_1000250892 261
1116 3300006175 Ga0070712_100227496 Ga0070712_1002274962 261
1117 3300006178 Ga0075367_10039470 Ga0075367_100394701 261
1118 3300006194 Ga0075427_10001112 Ga0075427_100011123 261
1119 3300006237 Ga0097621_100000421 Ga0097621_1000004213 261
1120 3300006237 Ga0097621_100008029 Ga0097621_1000080294 261
1121 3300006353 Ga0075370_10163989 Ga0075370_101639892 261
1122 3300006358 Ga0068871_100000515 Ga0068871_10000051513 261
1123 3300006358 Ga0068871_100012948 Ga0068871_1000129484 261
1124 3300006844 Ga0075428_100013216 Ga0075428_1000132161 261
1125 3300006846 Ga0075430_100028858 Ga0075430_1000288584 261
1126 3300006847 Ga0075431_100072177 Ga0075431_1000721773 261
1127 3300006852 Ga0075433_10002034 Ga0075433_100020349 261
1128 3300006852 Ga0075433_10008633 Ga0075433_100086335 261
1129 3300006852 Ga0075433_10062911 Ga0075433_100629114 261
1130 3300006871 Ga0075434_100000693 Ga0075434_10000069319 261
1131 3300006871 Ga0075434_100005025 Ga0075434_1000050252 261
1132 3300006871 Ga0075434_100038594 Ga0075434_1000385944 261
1133 3300006871 Ga0075434_100152317 Ga0075434_1001523172 261
1134 3300006880 Ga0075429_100006663 Ga0075429_1000066639 261
1135 3300006880 Ga0075429_100026387 Ga0075429_1000263873 261
1136 3300006881 Ga0068865_100002115 Ga0068865_1000021157 261
1137 3300006914 Ga0075436_100155144 Ga0075436_1001551442 261
1138 3300006931 Ga0097620_100023234 Ga0097620_1000232345 261
1139 3300006931 Ga0097620_100087787 Ga0097620_1000877873 261
1140 3300006931 Ga0097620_100108838 Ga0097620_1001088382 261
1141 3300007076 Ga0075435_100039209 Ga0075435_1000392092 261
1142 3300007076 Ga0075435_100049630 Ga0075435_1000496302 261
1143 3300009011 Ga0105251_10040087 Ga0105251_100400872 261
1144 3300009093 Ga0105240_10037315 Ga0105240_100373156 261
1145 3300009094 Ga0111539_10004448 Ga0111539_1000444810 261
1146 3300009094 Ga0111539_10005607 Ga0111539_100056077 261
1147 3300009094 Ga0111539_10017591 Ga0111539_100175917 261
1148 3300009094 Ga0111539_10197563 Ga0111539_101975633 261
1149 3300009098 Ga0105245_10069147 Ga0105245_100691473 261
1150 3300009098 Ga0105245_10183449 Ga0105245_101834492 261
1151 3300009098 Ga0105245_10536001 Ga0105245_105360012 261
1152 3300009101 Ga0105247_10011296 Ga0105247_100112962 261
1153 3300009101 Ga0105247_10012837 Ga0105247_100128374 261
1154 3300009147 Ga0114129_10065278 Ga0114129_100652784 261
1155 3300009147 Ga0114129_10097190 Ga0114129_100971904 261
1156 3300009147 Ga0114129_10105879 Ga0114129_101058794 261
1157 3300009148 Ga0105243_10002574 Ga0105243_100025747 261
1158 3300009148 Ga0105243_10011951 Ga0105243_100119516 261
1159 3300009148 Ga0105243_10319277 Ga0105243_103192772 261
1160 3300009174 Ga0105241_10111008 Ga0105241_101110082 261
1161 3300009174 Ga0105241_10235651 Ga0105241_102356512 261
1162 3300009176 Ga0105242_10056433 Ga0105242_100564332 261
1163 3300009177 Ga0105248_10000821 Ga0105248_100008212 261
1164 3300009177 Ga0105248_10084997 Ga0105248_100849973 261
1165 3300009177 Ga0105248_10121013 Ga0105248_101210132 261
1166 3300009177 Ga0105248_10196174 Ga0105248_101961743 261
1167 3300009177 Ga0105248_10204882 Ga0105248_102048822 261
1168 3300009545 Ga0105237_10128596 Ga0105237_101285963 261
1169 3300009551 Ga0105238_10009936 Ga0105238_100099369 261
1170 3300009551 Ga0105238_10732457 Ga0105238_107324571 261
1171 3300009553 Ga0105249_10015879 Ga0105249_100158795 261
1172 3300009553 Ga0105249_10084737 Ga0105249_100847373 261
1173 3300010375 Ga0105239_10004537 Ga0105239_100045377 261
1174 3300010375 Ga0105239_10196874 Ga0105239_101968742 261
1175 3300010375 Ga0105239_10405567 Ga0105239_104055672 261
1176 3300011119 Ga0105246_10001092 Ga0105246_1000109212 261
1177 3300011119 Ga0105246_10097849 Ga0105246_100978492 261
1178 3300011119 Ga0105246_10147153 Ga0105246_101471532 261
1179 3300012492 Ga0157335_1001913 Ga0157335_10019132 261
1180 3300012498 Ga0157345_1001831 Ga0157345_10018312 261
1181 3300012515 Ga0157338_1014273 Ga0157338_10142731 261
1182 3300013100 Ga0157373_10188691 Ga0157373_101886912 261
1183 3300013100 Ga0157373_10239296 Ga0157373_102392962 261
1184 3300013100 Ga0157373_10448647 Ga0157373_104486471 261
1185 3300013102 Ga0157371_10007315 Ga0157371_100073153 261
1186 3300013102 Ga0157371_10248820 Ga0157371_102488201 261
1187 3300013104 Ga0157370_10158470 Ga0157370_101584702 261
1188 3300013105 Ga0157369_10312214 Ga0157369_103122142 261
1189 3300013296 Ga0157374_10002049 Ga0157374_1000204917 261
1190 3300013296 Ga0157374_10032857 Ga0157374_100328573 261
1191 3300013296 Ga0157374_10527076 Ga0157374_105270762 261
1192 3300013297 Ga0157378_10007541 Ga0157378_100075415 261
1193 3300013297 Ga0157378_10213406 Ga0157378_102134062 261
1194 3300013297 Ga0157378_10312686 Ga0157378_103126862 261
1195 3300013297 Ga0157378_10325547 Ga0157378_103255471 261
1196 3300013297 Ga0157378_10573049 Ga0157378_105730492 261
1197 3300013306 Ga0163162_10005029 Ga0163162_100050297 261
1198 3300013306 Ga0163162_10077208 Ga0163162_100772082 261
1199 3300013306 Ga0163162_10077995 Ga0163162_100779953 261
1200 3300013307 Ga0157372_10012748 Ga0157372_100127487 261
1201 3300013307 Ga0157372_10343424 Ga0157372_103434242 261
1202 3300013307 Ga0157372_11036284 Ga0157372_110362842 261
1203 3300013308 Ga0157375_10005227 Ga0157375_100052271 261
1204 3300013308 Ga0157375_10019784 Ga0157375_100197843 261
1205 3300013308 Ga0157375_10180264 Ga0157375_101802642 261
1206 3300013308 Ga0157375_10207198 Ga0157375_102071983 261
1207 3300014325 Ga0163163_10005574 Ga0163163_100055749 261
1208 3300014326 Ga0157380_10001279 Ga0157380_100012797 261
1209 3300014745 Ga0157377_10000312 Ga0157377_1000031215 261
1210 3300014968 Ga0157379_10001989 Ga0157379_100019897 261
1211 3300014968 Ga0157379_10029559 Ga0157379_100295595 261
1212 3300014968 Ga0157379_10063884 Ga0157379_100638843 261
1213 3300014969 Ga0157376_10001372 Ga0157376_1000137216 261
1214 3300014969 Ga0157376_10019925 Ga0157376_100199256 261
1215 3300014969 Ga0157376_10054749 Ga0157376_100547494 261
1216 3300017792 Ga0163161_10003480 Ga0163161_100034809 261
1217 3300025271 Ga0207666_1000038 Ga0207666_100003821 261
1218 3300025271 Ga0207666_1000670 Ga0207666_10006702 261
1219 3300025315 Ga0207697_10000373 Ga0207697_1000037318 261
1220 3300025321 Ga0207656_10080070 Ga0207656_100800702 261
1221 3300025885 Ga0207653_10005254 Ga0207653_100052542 261
1222 3300025893 Ga0207682_10000071 Ga0207682_1000007122 261
1223 3300025898 Ga0207692_10010499 Ga0207692_100104995 261
1224 3300025899 Ga0207642_10004072 Ga0207642_100040724 261
1225 3300025900 Ga0207710_10007122 Ga0207710_100071222 261
1226 3300025900 Ga0207710_10125777 Ga0207710_101257772 261
1227 3300025901 Ga0207688_10000237 Ga0207688_1000023712 261
1228 3300025903 Ga0207680_10016997 Ga0207680_100169972 261
1229 3300025903 Ga0207680_10037949 Ga0207680_100379492 261
1230 3300025904 Ga0207647_10009005 Ga0207647_100090053 261
1231 3300025904 Ga0207647_10064700 Ga0207647_100647001 261
1232 3300025906 Ga0207699_10073451 Ga0207699_100734511 261
1233 3300025906 Ga0207699_10126789 Ga0207699_101267892 261
1234 3300025907 Ga0207645_10000779 Ga0207645_1000077921 261
1235 3300025907 Ga0207645_10093669 Ga0207645_100936692 261
1236 3300025908 Ga0207643_10000276 Ga0207643_1000027611 261
1237 3300025909 Ga0207705_10077767 Ga0207705_100777672 261
1238 3300025909 Ga0207705_10223975 Ga0207705_102239751 261
1239 3300025911 Ga0207654_10014702 Ga0207654_100147023 261
1240 3300025911 Ga0207654_10093334 Ga0207654_100933341 261
1241 3300025912 Ga0207707_10000454 Ga0207707_1000045417 261
1242 3300025912 Ga0207707_10069691 Ga0207707_100696913 261
1243 3300025912 Ga0207707_10070862 Ga0207707_100708622 261
1244 3300025912 Ga0207707_10236855 Ga0207707_102368552 261
1245 3300025913 Ga0207695_10213968 Ga0207695_102139682 261
1246 3300025914 Ga0207671_10016484 Ga0207671_100164843 261
1247 3300025914 Ga0207671_10037376 Ga0207671_100373763 261
1248 3300025914 Ga0207671_10211283 Ga0207671_102112832 261
1249 3300025915 Ga0207693_10005073 Ga0207693_100050734 261
1250 3300025915 Ga0207693_10073450 Ga0207693_100734503 261
1251 3300025916 Ga0207663_10072881 Ga0207663_100728813 261
1252 3300025916 Ga0207663_10141582 Ga0207663_101415822 261
1253 3300025916 Ga0207663_10247050 Ga0207663_102470502 261
1254 3300025917 Ga0207660_10000087 Ga0207660_1000008710 261
1255 3300025917 Ga0207660_10065427 Ga0207660_100654273 261
1256 3300025917 Ga0207660_10398957 Ga0207660_103989572 261
1257 3300025918 Ga0207662_10000659 Ga0207662_1000065912 261
1258 3300025918 Ga0207662_10009020 Ga0207662_100090203 261
1259 3300025919 Ga0207657_10003101 Ga0207657_1000310111 261
1260 3300025919 Ga0207657_10005173 Ga0207657_1000517310 261
1261 3300025919 Ga0207657_10035321 Ga0207657_100353212 261
1262 3300025919 Ga0207657_10090738 Ga0207657_100907383 261
1263 3300025919 Ga0207657_10189285 Ga0207657_101892852 261
1264 3300025920 Ga0207649_10000662 Ga0207649_1000066212 261
1265 3300025920 Ga0207649_10039165 Ga0207649_100391652 261
1266 3300025921 Ga0207652_10001908 Ga0207652_1000190816 261
1267 3300025921 Ga0207652_10008147 Ga0207652_100081472 261
1268 3300025921 Ga0207652_10111416 Ga0207652_101114163 261
1269 3300025921 Ga0207652_10133337 Ga0207652_101333373 261
1270 3300025921 Ga0207652_10385849 Ga0207652_103858492 261
1271 3300025923 Ga0207681_10001262 Ga0207681_100012624 261
1272 3300025923 Ga0207681_10151297 Ga0207681_101512972 261
1273 3300025924 Ga0207694_10017984 Ga0207694_100179844 261
1274 3300025924 Ga0207694_10435899 Ga0207694_104358992 261
1275 3300025925 Ga0207650_10005107 Ga0207650_100051073 261
1276 3300025925 Ga0207650_10097382 Ga0207650_100973822 261
1277 3300025926 Ga0207659_10000143 Ga0207659_1000014322 261
1278 3300025926 Ga0207659_10026549 Ga0207659_100265492 261
1279 3300025927 Ga0207687_10000865 Ga0207687_1000086517 261
1280 3300025927 Ga0207687_10052245 Ga0207687_100522454 261
1281 3300025927 Ga0207687_10122905 Ga0207687_101229052 261
1282 3300025927 Ga0207687_10246166 Ga0207687_102461662 261
1283 3300025928 Ga0207700_10000323 Ga0207700_1000032319 261
1284 3300025929 Ga0207664_10104335 Ga0207664_101043353 261
1285 3300025929 Ga0207664_10337725 Ga0207664_103377252 261
1286 3300025931 Ga0207644_10000532 Ga0207644_1000053214 261
1287 3300025931 Ga0207644_10042290 Ga0207644_100422903 261
1288 3300025931 Ga0207644_10243525 Ga0207644_102435252 261
1289 3300025932 Ga0207690_10000409 Ga0207690_1000040913 261
1290 3300025932 Ga0207690_10127841 Ga0207690_101278412 261
1291 3300025932 Ga0207690_10269905 Ga0207690_102699052 261
1292 3300025933 Ga0207706_10001338 Ga0207706_1000133820 261
1293 3300025933 Ga0207706_10006705 Ga0207706_100067058 261
1294 3300025933 Ga0207706_10058641 Ga0207706_100586413 261
1295 3300025934 Ga0207686_10000500 Ga0207686_1000050019 261
1296 3300025934 Ga0207686_10042200 Ga0207686_100422002 261
1297 3300025934 Ga0207686_10141181 Ga0207686_101411812 261
1298 3300025935 Ga0207709_10001266 Ga0207709_1000126615 261
1299 3300025935 Ga0207709_10037338 Ga0207709_100373382 261
1300 3300025936 Ga0207670_10007354 Ga0207670_100073542 261
1301 3300025936 Ga0207670_10207631 Ga0207670_102076311 261
1302 3300025936 Ga0207670_10229327 Ga0207670_102293272 261
1303 3300025936 Ga0207670_10249011 Ga0207670_102490112 261
1304 3300025937 Ga0207669_10001125 Ga0207669_100011258 261
1305 3300025937 Ga0207669_10397944 Ga0207669_103979441 261
1306 3300025937 Ga0207669_10539886 Ga0207669_105398862 261
1307 3300025938 Ga0207704_10000613 Ga0207704_100006138 261
1308 3300025938 Ga0207704_10075416 Ga0207704_100754162 261
1309 3300025939 Ga0207665_10001192 Ga0207665_1000119212 261
1310 3300025940 Ga0207691_10003339 Ga0207691_1000333912 261
1311 3300025940 Ga0207691_10130622 Ga0207691_101306222 261
1312 3300025941 Ga0207711_10029326 Ga0207711_100293263 261
1313 3300025941 Ga0207711_10032877 Ga0207711_100328774 261
1314 3300025941 Ga0207711_10041693 Ga0207711_100416932 261
1315 3300025941 Ga0207711_10050370 Ga0207711_100503703 261
1316 3300025941 Ga0207711_10162221 Ga0207711_101622212 261
1317 3300025942 Ga0207689_10000440 Ga0207689_1000044021 261
1318 3300025942 Ga0207689_10445733 Ga0207689_104457332 261
1319 3300025944 Ga0207661_10059018 Ga0207661_100590183 261
1320 3300025944 Ga0207661_10061762 Ga0207661_100617623 261
1321 3300025945 Ga0207679_10000131 Ga0207679_1000013131 261
1322 3300025945 Ga0207679_10016049 Ga0207679_100160493 261
1323 3300025945 Ga0207679_10203794 Ga0207679_102037942 261
1324 3300025949 Ga0207667_10092846 Ga0207667_100928464 261
1325 3300025960 Ga0207651_10000335 Ga0207651_100003357 261
1326 3300025961 Ga0207712_10002448 Ga0207712_100024487 261
1327 3300025961 Ga0207712_10030909 Ga0207712_100309094 261
1328 3300025961 Ga0207712_10048380 Ga0207712_100483802 261
1329 3300025972 Ga0207668_10000065 Ga0207668_100000657 261
1330 3300025972 Ga0207668_10100099 Ga0207668_101000993 261
1331 3300025981 Ga0207640_10000339 Ga0207640_1000033913 261
1332 3300025986 Ga0207658_10004428 Ga0207658_100044288 261
1333 3300026023 Ga0207677_10003580 Ga0207677_100035807 261
1334 3300026023 Ga0207677_10458159 Ga0207677_104581592 261
1335 3300026035 Ga0207703_10001885 Ga0207703_1000188520 261
1336 3300026035 Ga0207703_10056702 Ga0207703_100567024 261
1337 3300026035 Ga0207703_10124556 Ga0207703_101245563 261
1338 3300026035 Ga0207703_10141154 Ga0207703_101411542 261
1339 3300026041 Ga0207639_10041384 Ga0207639_100413843 261
1340 3300026041 Ga0207639_10209690 Ga0207639_102096902 261
1341 3300026067 Ga0207678_10000944 Ga0207678_100009447 261
1342 3300026067 Ga0207678_10036592 Ga0207678_100365923 261
1343 3300026067 Ga0207678_10056937 Ga0207678_100569374 261
1344 3300026067 Ga0207678_10058587 Ga0207678_100585872 261
1345 3300026067 Ga0207678_10160477 Ga0207678_101604772 261
1346 3300026075 Ga0207708_10002019 Ga0207708_100020197 261
1347 3300026075 Ga0207708_10237196 Ga0207708_102371962 261
1348 3300026078 Ga0207702_10028991 Ga0207702_100289912 261
1349 3300026078 Ga0207702_10056555 Ga0207702_100565552 261
1350 3300026088 Ga0207641_10005810 Ga0207641_100058103 261
1351 3300026088 Ga0207641_10085777 Ga0207641_100857773 261
1352 3300026089 Ga0207648_10004730 Ga0207648_1000473014 261
1353 3300026089 Ga0207648_10049631 Ga0207648_100496314 261
1354 3300026095 Ga0207676_10008134 Ga0207676_100081343 261
1355 3300026095 Ga0207676_10139552 Ga0207676_101395523 261
1356 3300026095 Ga0207676_10151364 Ga0207676_101513642 261
1357 3300026116 Ga0207674_10005364 Ga0207674_1000536412 261
1358 3300026116 Ga0207674_10488334 Ga0207674_104883341 261
1359 3300026118 Ga0207675_100000815 Ga0207675_10000081514 261
1360 3300026118 Ga0207675_100442262 Ga0207675_1004422622 261
1361 3300026121 Ga0207683_10000001 Ga0207683_10000001330 261
1362 3300026121 Ga0207683_10081084 Ga0207683_100810842 261
1363 3300026142 Ga0207698_10051342 Ga0207698_100513424 261
1364 3300026142 Ga0207698_10144287 Ga0207698_101442872 261
1365 3300027617 Ga0210002_1033724 Ga0210002_10337241 261
1366 3300027695 Ga0209966_1000743 Ga0209966_10007434 261
1367 3300027717 Ga0209998_10001042 Ga0209998_100010423 261
1368 3300027717 Ga0209998_10002206 Ga0209998_100022064 261
1369 3300027876 Ga0209974_10065047 Ga0209974_100650471 261
1370 3300027907 Ga0207428_10000172 Ga0207428_100001729 261
1371 3300027907 Ga0207428_10000255 Ga0207428_1000025532 261
1372 3300027907 Ga0207428_10003313 Ga0207428_1000331312 261
1373 3300028379 Ga0268266_10020037 Ga0268266_100200373 261
1374 3300028379 Ga0268266_10175367 Ga0268266_101753672 261
1375 3300028380 Ga0268265_10029653 Ga0268265_100296533 261
1376 3300028381 Ga0268264_10001153 Ga0268264_1000115312 261
1377 3300028381 Ga0268264_10330445 Ga0268264_103304451 261
1378 3300028381 Ga0268264_10350221 Ga0268264_103502212 261
1379 3300028573 Ga0265334_10075822 Ga0265334_100758222 261
1380 3300028800 Ga0265338_10038131 Ga0265338_100381314 261
1381 3300031241 Ga0265325_10000320 Ga0265325_1000032011 261
1382 3300031241 Ga0265325_10013945 Ga0265325_100139455 261
1383 3300031247 Ga0265340_10099607 Ga0265340_100996072 261
1384 3300031249 Ga0265339_10082085 Ga0265339_100820852 261
1385 3300031595 Ga0265313_10004004 Ga0265313_100040042 261
1386 3300031595 Ga0265313_10127706 Ga0265313_101277062 261
1387 3300031712 Ga0265342_10000196 Ga0265342_1000019662 261
1388 3300031712 Ga0265342_10024497 Ga0265342_100244974 261
1389 3300034816 Ga0373930_0000014 Ga0373930_0000014_10336_11121 261
1390 3300034817 Ga0373948_0000493 Ga0373948_0000493_2461_3246 261
1391 3300034817 Ga0373948_0000950 Ga0373948_0000950_2390_3175 261
1392 3300034818 Ga0373950_0000145 Ga0373950_0000145_3980_4765 261
1393 3300034819 Ga0373958_0000064 Ga0373958_0000064_1986_2771 261
1394 3300034819 Ga0373958_0012499 Ga0373958_0012499_537_1322 261
1395 3300034819 Ga0373958_0015415 Ga0373958_0015415_306_1100 261
1396 3300034820 Ga0373959_0005735 Ga0373959_0005735_567_1352 261
1397 3300034957 Ga0373938_0001531 Ga0373938_0001531_717_1502 261
1398 3300034957 Ga0373938_0014379 Ga0373938_0014379_38_823 261
1399 3300034957 Ga0373938_0037550 Ga0373938_0037550_16_810 261
1400 3300035083 Ga0373926_0017053 Ga0373926_0017053_369_1175 261
1401 3300035083 Ga0373926_0049141 Ga0373926_0049141_529_1323 261
1402 3300035084 Ga0373928_0001389 Ga0373928_0001389_889_1674 261
1403 3300035084 Ga0373928_0007010 Ga0373928_0007010_889_1674 261
1404 3300035085 Ga0373929_0000101 Ga0373929_0000101_10099_10884 261
1405 3300035085 Ga0373929_0002108 Ga0373929_0002108_2884_3678 261
1406 3300035086 Ga0373934_0010944 Ga0373934_0010944_2182_2988 261
1407 3300035088 Ga0373940_0003765 Ga0373940_0003765_2130_2915 261
1408 3300035089 Ga0373944_0011177 Ga0373944_0011177_912_1718 261
1409 3300035089 Ga0373944_0013599 Ga0373944_0013599_209_1003 261
1410 3300035089 Ga0373944_0045478 Ga0373944_0045478_249_1043 261
1411 3300035090 Ga0373949_0000293 Ga0373949_0000293_7003_7788 261
1412 3300035090 Ga0373949_0000952 Ga0373949_0000952_4408_5193 261
1413 3300035091 Ga0373951_0000154 Ga0373951_0000154_95_880 261
1414 3300035091 Ga0373951_0014795 Ga0373951_0014795_544_1338 261
1415 3300035092 Ga0373952_0000030 Ga0373952_0000030_8122_8907 261
1416 3300035092 Ga0373952_0000920 Ga0373952_0000920_156_941 261
1417 3300035092 Ga0373952_0050550 Ga0373952_0050550_126_920 261
1418 3300035112 Ga0373932_0001243 Ga0373932_0001243_298_1083 261
1419 3300035112 Ga0373932_0049425 Ga0373932_0049425_142_936 261
1420 3300035113 Ga0373936_0017372 Ga0373936_0017372_876_1670 261
1421 3300035113 Ga0373936_0019684 Ga0373936_0019684_1329_2135 261
1422 3300035114 Ga0373939_0000791 Ga0373939_0000791_4305_5090 261
1423 3300035114 Ga0373939_0003691 Ga0373939_0003691_962_1747 261
1424 3300035114 Ga0373939_0021740 Ga0373939_0021740_150_944 261
1425 3300035114 Ga0373939_0024887 Ga0373939_0024887_215_1015 261
1426 3300035115 Ga0373941_0000050 Ga0373941_0000050_13804_14589 261
1427 3300035116 Ga0373945_0001214 Ga0373945_0001214_896_1690 261
1428 3300035116 Ga0373945_0005087 Ga0373945_0005087_2730_3536 261
1429 3300035116 Ga0373945_0010949 Ga0373945_0010949_749_1543 261
1430 3300035117 Ga0373953_0013693 Ga0373953_0013693_897_1703 261
1431 3300035118 Ga0373954_0001943 Ga0373954_0001943_4198_4992 261
1432 3300035118 Ga0373954_0021614 Ga0373954_0021614_945_1751 261
1433 3300035118 Ga0373954_0023220 Ga0373954_0023220_275_1075 261
1434 3300035118 Ga0373954_0025068 Ga0373954_0025068_179_985 261
1435 3300035119 Ga0373956_0024897 Ga0373956_0024897_863_1669 261
1436 3300035119 Ga0373956_0044007 Ga0373956_0044007_1113_1919 261
1437 3300035120 Ga0373957_0003309 Ga0373957_0003309_1310_2110 261
1438 3300035120 Ga0373957_0024044 Ga0373957_0024044_143_949 261
1439 3300035121 Ga0373960_0003068 Ga0373960_0003068_2781_3566 261
1440 3300035170 Ga0373943_0001792 Ga0373943_0001792_4845_5639 261
1441 3300035170 Ga0373943_0010229 Ga0373943_0010229_460_1254 261
1442 3300035170 Ga0373943_0115598 Ga0373943_0115598_603_1400 261
1443 3300035171 Ga0373946_0000496 Ga0373946_0000496_686_1480 261
1444 3300035171 Ga0373946_0005660 Ga0373946_0005660_3220_4026 261
1445 3300035171 Ga0373946_0007440 Ga0373946_0007440_1257_2051 261
1446 3300035172 Ga0373955_0005131 Ga0373955_0005131_2124_2924 261
1447 3300035172 Ga0373955_0057467 Ga0373955_0057467_845_1651 261
1448 3300035172 Ga0373955_0067556 Ga0373955_0067556_574_1371 261
1449 3300035172 Ga0373955_0084642 Ga0373955_0084642_897_1691 261
1450 3300035172 Ga0373955_0127120 Ga0373955_0127120_252_1046 261
1451 3300035172 Ga0373955_0146766 Ga0373955_0146766_356_1162 261
1452 3300035207 Ga0373942_0000073 Ga0373942_0000073_9090_9875 261
1453 3300035207 Ga0373942_0025665 Ga0373942_0025665_554_1339 261
1454 3300035207 Ga0373942_0026622 Ga0373942_0026622_625_1419 261
1455 3300035241 Ga0373961_0000480 Ga0373961_0000480_886_1671 261
1456 3300035241 Ga0373961_0009096 Ga0373961_0009096_68_853 261
1457 3300035241 Ga0373961_0081398 Ga0373961_0081398_28_834 261
1458 3300035242 Ga0373962_0001214 Ga0373962_0001214_1160_1945 261
1459 3300035242 Ga0373962_0001920 Ga0373962_0001920_4152_4937 261
1460 3300035242 Ga0373962_0011212 Ga0373962_0011212_374_1168 261
1461 3300035242 Ga0373962_0023763 Ga0373962_0023763_14_799 261
1462 3300035410 Ga0373924_0039884 Ga0373924_0039884_326_1120 261
1463 3300035691 Ga0373931_0000537 Ga0373931_0000537_10410_11195 261
1464 3300035691 Ga0373931_0006018 Ga0373931_0006018_2316_3101 261
1465 3300035691 Ga0373931_0010273 Ga0373931_0010273_2828_3622 261
1466 3300035691 Ga0373931_0119575 Ga0373931_0119575_408_1214 261
1467 3300035691 Ga0373931_0129610 Ga0373931_0129610_61_855 261
1468 3300035692 Ga0373935_0001261 Ga0373935_0001261_7256_8050 261
1469 3300035692 Ga0373935_0046856 Ga0373935_0046856_1313_2110 261
1470 3300035692 Ga0373935_0130097 Ga0373935_0130097_263_1057 261
1471 3300035692 Ga0373935_0187924 Ga0373935_0187924_181_987 261
1472 3300035695 Ga0373927_0116233 Ga0373927_0116233_473_1267 261
1473 3300035695 Ga0373927_0120334 Ga0373927_0120334_489_1295 261
1474 3300035724 Ga0373933_0002786 Ga0373933_0002786_5774_6574 261
1475 3300035724 Ga0373933_0021557 Ga0373933_0021557_1861_2658 261
1476 3300035724 Ga0373933_0022272 Ga0373933_0022272_398_1204 261
1477 3300035724 Ga0373933_0051395 Ga0373933_0051395_1183_1977 261
1478 3300035725 Ga0373947_0001656 Ga0373947_0001656_12153_12947 261
1479 3300035725 Ga0373947_0009288 Ga0373947_0009288_963_1757 261
1480 3300035725 Ga0373947_0054577 Ga0373947_0054577_1462_2256 261
1481 3300035725 Ga0373947_0065243 Ga0373947_0065243_768_1574 261
1482 3300036401 Ga0373937_0000907 Ga0373937_0000907_22317_23123 261
1483 3300036401 Ga0373937_0001504 Ga0373937_0001504_8675_9481 261
1484 3300036401 Ga0373937_0003255 Ga0373937_0003255_4613_5407 261
1485 3300036401 Ga0373937_0029085 Ga0373937_0029085_3794_4588 261
1486 3300036401 Ga0373937_0036814 Ga0373937_0036814_898_1695 261
1487 3300037068 Ga0373925_0019842 Ga0373925_0019842_2736_3530 261
1488 3300037068 Ga0373925_0178500 Ga0373925_0178500_525_1319 261
1489 3300037312 Ga0395899_0052594 Ga0395899_0052594_871_1680 261
1490 3300037418 Ga0395900_0009186 Ga0395900_0009186_4408_5217 261
1491 3300037418 Ga0395900_0022366 Ga0395900_0022366_2659_3468 261
1492 3300037466 Ga0395898_0003941 Ga0395898_0003941_3136_3945 261
1493 3300037466 Ga0395898_0024197 Ga0395898_0024197_1173_1982 261
1494 3300037466 Ga0395898_0310833 Ga0395898_0310833_321_1130 261
1495 3300038443 Ga0395901_0014006 Ga0395901_0014006_6682_7491 261
1496 3300038443 Ga0395901_0075175 Ga0395901_0075175_283_1092 261
1497 3300038443 Ga0395901_0161489 Ga0395901_0161489_122_931 261
1498 3300038443 Ga0395901_0321676 Ga0395901_0321676_300_1109 261
1499 3300038996 Ga0242420_033121 Ga0242420_033121_152_937 261
1500 3300042001 Ga0439441_022166 Ga0439441_022166_81_866 261
1501 3300042439 Ga0439464_0034111 Ga0439464_0034111_457_1242 261
1502 3300044694 Ga0466963_0431546 Ga0466963_0431546_61_855 261
1503 3300044712 Ga0453684_0283538 Ga0453684_0283538_67_852 261
1504 3300045051 Ga0451576_0117936 Ga0451576_0117936_95_880 261
1505 3300046452 Ga0495617_038698 Ga0495617_038698_93_887 261
1506 3300046454 Ga0495592_0001393 Ga0495592_0001393_7473_8279 261
1507 3300046454 Ga0495592_0002484 Ga0495592_0002484_9279_10073 261
1508 3300046454 Ga0495592_0078729 Ga0495592_0078729_220_1014 261
1509 3300046455 Ga0495603_0001804 Ga0495603_0001804_11744_12538 261
1510 3300046455 Ga0495603_0002249 Ga0495603_0002249_4353_5147 261
1511 3300046455 Ga0495603_0008354 Ga0495603_0008354_682_1488 261
1512 3300046455 Ga0495603_0014184 Ga0495603_0014184_1026_1820 261
1513 3300046459 Ga0495629_0000594 Ga0495629_0000594_22347_23141 261
1514 3300046459 Ga0495629_0001140 Ga0495629_0001140_1996_2790 261
1515 3300046459 Ga0495629_0088951 Ga0495629_0088951_16_822 261
1516 3300046461 Ga0495641_0007754 Ga0495641_0007754_5471_6265 261
1517 3300046461 Ga0495641_0011331 Ga0495641_0011331_1209_2015 261
1518 3300046461 Ga0495641_0017820 Ga0495641_0017820_1978_2772 261
1519 3300046462 Ga0495651_0004816 Ga0495651_0004816_6814_7611 261
1520 3300046462 Ga0495651_0047233 Ga0495651_0047233_2495_3289 261
1521 3300046463 Ga0495653_0004798 Ga0495653_0004798_2764_3558 261
1522 3300046463 Ga0495653_0024139 Ga0495653_0024139_333_1139 261
1523 3300046463 Ga0495653_0290993 Ga0495653_0290993_152_949 261
1524 3300046472 Ga0495580_0057444 Ga0495580_0057444_510_1316 261
1525 3300046472 Ga0495580_0074214 Ga0495580_0074214_994_1788 261
1526 3300046473 Ga0495582_0000379 Ga0495582_0000379_883_1677 261
1527 3300046473 Ga0495582_0010594 Ga0495582_0010594_3058_3864 261
1528 3300046475 Ga0495639_0004321 Ga0495639_0004321_4350_5144 261
1529 3300046475 Ga0495639_0046773 Ga0495639_0046773_125_919 261
1530 3300046476 Ga0495662_0000084 Ga0495662_0000084_28737_29531 261
1531 3300046476 Ga0495662_0027194 Ga0495662_0027194_446_1252 261
1532 3300046477 Ga0495664_0007745 Ga0495664_0007745_1109_1903 261
1533 3300046477 Ga0495664_0043029 Ga0495664_0043029_584_1378 261
1534 3300046477 Ga0495664_0050575 Ga0495664_0050575_1208_2014 261
1535 3300046491 Ga0495584_0033756 Ga0495584_0033756_1703_2497 261
1536 3300046491 Ga0495584_0048021 Ga0495584_0048021_1131_1916 261
1537 3300046492 Ga0495585_0001932 Ga0495585_0001932_9487_10281 261
1538 3300046499 Ga0495594_0002726 Ga0495594_0002726_826_1620 261
1539 3300046499 Ga0495594_0009110 Ga0495594_0009110_2725_3531 261
1540 3300046499 Ga0495594_0011284 Ga0495594_0011284_1020_1814 261
1541 3300046501 Ga0495607_0095599 Ga0495607_0095599_719_1513 261
1542 3300046511 Ga0495608_0012927 Ga0495608_0012927_879_1685 261
1543 3300046511 Ga0495608_0017846 Ga0495608_0017846_2980_3774 261
1544 3300046511 Ga0495608_0082397 Ga0495608_0082397_31_831 261
1545 3300046514 Ga0495618_0001547 Ga0495618_0001547_4379_5173 261
1546 3300046516 Ga0495628_0003624 Ga0495628_0003624_9896_10693 261
1547 3300046516 Ga0495628_0027943 Ga0495628_0027943_2408_3214 261
1548 3300046516 Ga0495628_0032270 Ga0495628_0032270_2587_3381 261
1549 3300046516 Ga0495628_0101756 Ga0495628_0101756_1052_1846 261
1550 3300046517 Ga0495630_0005622 Ga0495630_0005622_4359_5153 261
1551 3300046517 Ga0495630_0042264 Ga0495630_0042264_1111_1905 261
1552 3300046520 Ga0495637_0020521 Ga0495637_0020521_198_992 261
1553 3300046523 Ga0495644_0003085 Ga0495644_0003085_1504_2298 261
1554 3300046526 Ga0495666_0001508 Ga0495666_0001508_4351_5145 261
1555 3300046526 Ga0495666_0012392 Ga0495666_0012392_2974_3768 261
1556 3300046526 Ga0495666_0034119 Ga0495666_0034119_1032_1838 261
1557 3300046529 Ga0495652_0013904 Ga0495652_0013904_4378_5172 261
1558 3300046529 Ga0495652_0019057 Ga0495652_0019057_4216_5013 261
1559 3300046529 Ga0495652_0078363 Ga0495652_0078363_1855_2649 261
1560 3300046531 Ga0495665_0003909 Ga0495665_0003909_5605_6399 261
1561 3300046531 Ga0495665_0014689 Ga0495665_0014689_703_1509 261
1562 3300046531 Ga0495665_0084846 Ga0495665_0084846_202_996 261
1563 3300046533 Ga0495640_0006199 Ga0495640_0006199_1895_2689 261
1564 3300046533 Ga0495640_0010455 Ga0495640_0010455_1996_2790 261
1565 3300046533 Ga0495640_0050524 Ga0495640_0050524_442_1236 261
1566 3300046533 Ga0495640_0113463 Ga0495640_0113463_849_1646 261
1567 3300046535 Ga0495586_0032879 Ga0495586_0032879_482_1276 261
1568 3300046535 Ga0495586_0097810 Ga0495586_0097810_160_966 261
1569 3300046536 Ga0495587_0002979 Ga0495587_0002979_1840_2634 261
1570 3300046536 Ga0495587_0016339 Ga0495587_0016339_2614_3420 261
1571 3300046536 Ga0495587_0179519 Ga0495587_0179519_218_1012 261
1572 3300046537 Ga0495598_0004396 Ga0495598_0004396_838_1632 261
1573 3300046538 Ga0495609_0065459 Ga0495609_0065459_223_1017 261
1574 3300046543 Ga0495645_0010875 Ga0495645_0010875_4341_5147 261
1575 3300046543 Ga0495645_0011025 Ga0495645_0011025_5198_5995 261
1576 3300046543 Ga0495645_0125919 Ga0495645_0125919_56_850 261
1577 3300046557 Ga0495622_0013050 Ga0495622_0013050_799_1605 261
1578 3300046557 Ga0495622_0049494 Ga0495622_0049494_896_1690 261
1579 3300046558 Ga0495633_0071043 Ga0495633_0071043_697_1491 261
1580 3300046559 Ga0495667_0000202 Ga0495667_0000202_33631_34425 261
1581 3300046559 Ga0495667_0000365 Ga0495667_0000365_510_1316 261
1582 3300046559 Ga0495667_0111739 Ga0495667_0111739_690_1487 261
1583 3300046559 Ga0495667_0188265 Ga0495667_0188265_517_1311 261
1584 3300046615 Ga0495656_0000360 Ga0495656_0000360_658_1452 261
1585 3300046642 Ga0495634_0008544 Ga0495634_0008544_4098_4892 261
1586 3300046663 Ga0495635_0000981 Ga0495635_0000981_375_1169 261
1587 3300046663 Ga0495635_0013894 Ga0495635_0013894_2298_3104 261
1588 3300046663 Ga0495635_0081639 Ga0495635_0081639_499_1299 261
1589 3300046665 Ga0495661_0010683 Ga0495661_0010683_2506_3300 261
1590 3300046674 Ga0495588_0075208 Ga0495588_0075208_715_1509 261
1591 3300046674 Ga0495588_0090074 Ga0495588_0090074_541_1347 261
1592 3300046674 Ga0495588_0092431 Ga0495588_0092431_408_1202 261
1593 3300046675 Ga0495657_0031463 Ga0495657_0031463_294_1100 261
1594 3300046675 Ga0495657_0045253 Ga0495657_0045253_1767_2567 261
1595 3300046678 Ga0495599_0002835 Ga0495599_0002835_7820_8617 261
1596 3300046678 Ga0495599_0046540 Ga0495599_0046540_775_1569 261
1597 3300046679 Ga0495623_0001448 Ga0495623_0001448_1372_2178 261
1598 3300046679 Ga0495623_0204206 Ga0495623_0204206_250_1047 261
1599 3300046680 Ga0495646_0002316 Ga0495646_0002316_10389_11183 261
1600 3300046681 Ga0495647_0000122 Ga0495647_0000122_7304_8098 261
1601 3300046681 Ga0495647_0000393 Ga0495647_0000393_6320_7114 261
1602 3300046681 Ga0495647_0001922 Ga0495647_0001922_2548_3354 261
1603 3300046681 Ga0495647_0052367 Ga0495647_0052367_646_1440 261
1604 3300046683 Ga0495658_0000210 Ga0495658_0000210_14804_15598 261
1605 3300046683 Ga0495658_0005298 Ga0495658_0005298_491_1285 261
1606 3300046683 Ga0495658_0009937 Ga0495658_0009937_2638_3444 261
1607 3300046683 Ga0495658_0026729 Ga0495658_0026729_1344_2138 261
1608 3300046684 Ga0495669_0040626 Ga0495669_0040626_44_838 261
1609 3300046689 Ga0495613_0018397 Ga0495613_0018397_3731_4525 261
1610 3300046689 Ga0495613_0083862 Ga0495613_0083862_397_1191 261
1611 3300046689 Ga0495613_0288357 Ga0495613_0288357_237_1043 261
1612 3300046690 Ga0495624_0000222 Ga0495624_0000222_9884_10678 261
1613 3300046690 Ga0495624_0034304 Ga0495624_0034304_108_914 261
1614 3300046690 Ga0495624_0063300 Ga0495624_0063300_66_860 261
1615 3300046691 Ga0495670_0001624 Ga0495670_0001624_2245_3039 261
1616 3300046809 Ga0495600_0000506 Ga0495600_0000506_1592_2386 261
1617 3300046809 Ga0495600_0002658 Ga0495600_0002658_2740_3537 261
1618 3300046809 Ga0495600_0030323 Ga0495600_0030323_1443_2249 261
1619 3300047315 Ga0495581_0005193 Ga0495581_0005193_4745_5539 261
1620 3300047315 Ga0495581_0020808 Ga0495581_0020808_1979_2773 261
1621 3300047317 Ga0495604_0001089 Ga0495604_0001089_3612_4406 261
1622 3300047317 Ga0495604_0002751 Ga0495604_0002751_2823_3620 261
1623 3300047317 Ga0495604_0007025 Ga0495604_0007025_6179_6985 261
1624 3300047317 Ga0495604_0082269 Ga0495604_0082269_465_1259 261
1625 3300047319 Ga0495674_0001490 Ga0495674_0001490_21086_21880 261
1626 3300047319 Ga0495674_0014630 Ga0495674_0014630_3615_4409 261
1627 3300047321 Ga0495676_0000289 Ga0495676_0000289_14845_15639 261
1628 3300047321 Ga0495676_0021676 Ga0495676_0021676_2984_3790 261
1629 3300047321 Ga0495676_0079695 Ga0495676_0079695_673_1467 261
1630 3300047321 Ga0495676_0096501 Ga0495676_0096501_561_1355 261
1631 3300047322 Ga0495680_0001414 Ga0495680_0001414_12991_13785 261
1632 3300047322 Ga0495680_0012301 Ga0495680_0012301_800_1594 261
1633 3300047322 Ga0495680_0018026 Ga0495680_0018026_482_1288 261
1634 3300047322 Ga0495680_0037109 Ga0495680_0037109_2581_3378 261
1635 3300047322 Ga0495680_0072323 Ga0495680_0072323_1437_2231 261
1636 3300047444 Ga0495675_0063292 Ga0495675_0063292_683_1480 261
1637 3300047446 Ga0495679_046890 Ga0495679_046890_350_1144 261
1638 3300047471 Ga0495684_0000075 Ga0495684_0000075_57850_58644 261
1639 3300047471 Ga0495684_0073421 Ga0495684_0073421_758_1552 261
1640 3300047471 Ga0495684_0128149 Ga0495684_0128149_745_1539 261
1641 3300047471 Ga0495684_0383201 Ga0495684_0383201_21_818 261
1642 3300047673 Ga0495593_0000228 Ga0495593_0000228_772_1566 261
1643 3300047673 Ga0495593_0014059 Ga0495593_0014059_2795_3601 261
1644 3300048088 Ga0495602_0002033 Ga0495602_0002033_8066_8872 261
1645 3300048088 Ga0495602_0018847 Ga0495602_0018847_3630_4427 261
1646 3300048089 Ga0495614_0017130 Ga0495614_0017130_668_1474 261
1647 3300048089 Ga0495614_0024948 Ga0495614_0024948_1100_1894 261
1648 3300048903 Ga0496100_0000404 Ga0496100_0000404_18382_19167 261
1649 3300048903 Ga0496100_0000823 Ga0496100_0000823_1928_2722 261
1650 3300048903 Ga0496100_0017884 Ga0496100_0017884_2770_3564 261
1651 3300048904 Ga0496101_0000423 Ga0496101_0000423_18749_19534 261
1652 3300048904 Ga0496101_0013330 Ga0496101_0013330_696_1490 261
1653 3300048904 Ga0496101_0051874 Ga0496101_0051874_190_984 261
1654 3300048905 Ga0496102_0003323 Ga0496102_0003323_11207_11992 261
1655 3300048905 Ga0496102_0017907 Ga0496102_0017907_4817_5623 261
1656 3300048905 Ga0496102_0050819 Ga0496102_0050819_1972_2766 261
1657 3300048905 Ga0496102_0216909 Ga0496102_0216909_286_1092 261
1658 3300048905 Ga0496102_0443883 Ga0496102_0443883_408_1196 261
1659 3300048905 Ga0496102_0726698 Ga0496102_0726698_99_887 261
1660 3300048906 Ga0496103_0000967 Ga0496103_0000967_1079_1864 261
1661 3300048906 Ga0496103_0009318 Ga0496103_0009318_638_1432 261
1662 3300048906 Ga0496103_0023575 Ga0496103_0023575_1924_2718 261
1663 3300048907 Ga0496104_0005466 Ga0496104_0005466_7407_8204 261
1664 3300048907 Ga0496104_0014835 Ga0496104_0014835_3184_3990 261
1665 3300048907 Ga0496104_0018532 Ga0496104_0018532_2578_3372 261
1666 3300048907 Ga0496104_0037286 Ga0496104_0037286_774_1568 261
1667 3300048907 Ga0496104_0181717 Ga0496104_0181717_1147_1932 261
1668 3300048907 Ga0496104_0307758 Ga0496104_0307758_191_979 261
1669 3300048907 Ga0496104_0319118 Ga0496104_0319118_155_949 261
1670 3300048908 Ga0496105_0010049 Ga0496105_0010049_6329_7135 261
1671 3300048908 Ga0496105_0025218 Ga0496105_0025218_2599_3396 261
1672 3300048908 Ga0496105_0079464 Ga0496105_0079464_1109_1903 261
1673 3300048908 Ga0496105_0081682 Ga0496105_0081682_933_1727 261
1674 3300048908 Ga0496105_0197097 Ga0496105_0197097_697_1485 261
1675 3300048909 Ga0496106_0002446 Ga0496106_0002446_11196_11981 261
1676 3300048909 Ga0496106_0005520 Ga0496106_0005520_366_1160 261
1677 3300048909 Ga0496106_0015174 Ga0496106_0015174_4078_4884 261
1678 3300048909 Ga0496106_0046079 Ga0496106_0046079_1728_2522 261
1679 3300048909 Ga0496106_0138098 Ga0496106_0138098_197_985 261
1680 3300048909 Ga0496106_0204770 Ga0496106_0204770_23_808 261
1681 3300048909 Ga0496106_0278662 Ga0496106_0278662_191_997 261
1682 3300048910 Ga0496107_0000500 Ga0496107_0000500_11068_11853 261
1683 3300048910 Ga0496107_0021517 Ga0496107_0021517_29_814 261
1684 3300048910 Ga0496107_0036271 Ga0496107_0036271_791_1585 261
1685 3300048910 Ga0496107_0130304 Ga0496107_0130304_1006_1812 261
1686 3300048911 Ga0496108_0039555 Ga0496108_0039555_2748_3533 261
1687 3300048911 Ga0496108_0048346 Ga0496108_0048346_1973_2767 261
1688 3300048911 Ga0496108_0227952 Ga0496108_0227952_591_1385 261
1689 3300048912 Ga0496109_0000359 Ga0496109_0000359_7890_8678 261
1690 3300048912 Ga0496109_0000976 Ga0496109_0000976_17808_18593 261
1691 3300048912 Ga0496109_0015600 Ga0496109_0015600_4653_5447 261
1692 3300048912 Ga0496109_0060588 Ga0496109_0060588_2111_2905 261
1693 3300048912 Ga0496109_0411173 Ga0496109_0411173_333_1118 261
1694 3300048913 Ga0496110_0003362 Ga0496110_0003362_7744_8538 261
1695 3300048913 Ga0496110_0020674 Ga0496110_0020674_4710_5504 261
1696 3300048913 Ga0496110_0027384 Ga0496110_0027384_894_1679 261
1697 3300048913 Ga0496110_0034978 Ga0496110_0034978_620_1414 261
1698 3300048913 Ga0496110_0054089 Ga0496110_0054089_648_1433 261
1699 3300048913 Ga0496110_0061174 Ga0496110_0061174_1578_2366 261
1700 3300048913 Ga0496110_0269120 Ga0496110_0269120_646_1452 261
1701 3300048914 Ga0496111_0021239 Ga0496111_0021239_781_1575 261
1702 3300048914 Ga0496111_0030852 Ga0496111_0030852_161_946 261
1703 3300048914 Ga0496111_0040590 Ga0496111_0040590_1081_1875 261
1704 3300048914 Ga0496111_0069085 Ga0496111_0069085_562_1368 261
1705 3300048915 Ga0496112_0021049 Ga0496112_0021049_2820_3614 261
1706 3300048915 Ga0496112_0044120 Ga0496112_0044120_933_1727 261
1707 3300048915 Ga0496112_0051703 Ga0496112_0051703_1973_2767 261
1708 3300048916 Ga0496113_0001950 Ga0496113_0001950_2678_3466 261
1709 3300048916 Ga0496113_0008785 Ga0496113_0008785_4715_5509 261
1710 3300048916 Ga0496113_0008826 Ga0496113_0008826_788_1582 261
1711 3300048917 Ga0496114_0046871 Ga0496114_0046871_847_1641 261
1712 3300048917 Ga0496114_0111990 Ga0496114_0111990_739_1545 261
1713 3300048917 Ga0496114_0137536 Ga0496114_0137536_975_1772 261
1714 3300048917 Ga0496114_0428142 Ga0496114_0428142_13_798 261
1715 3300048918 Ga0496115_0019987 Ga0496115_0019987_1433_2227 261
1716 3300048918 Ga0496115_0073699 Ga0496115_0073699_876_1670 261
1717 3300048918 Ga0496115_0173197 Ga0496115_0173197_616_1410 261
1718 3300048918 Ga0496115_0263324 Ga0496115_0263324_84_878 261
1719 3300049571 Ga0501034_0198853 Ga0501034_0198853_522_1319 261
1720 3300049581 Ga0501047_0009067 Ga0501047_0009067_5388_6182 261
1721 3300049586 Ga0501070_0056684 Ga0501070_0056684_805_1620 261
1722 3300049586 Ga0501070_0580399 Ga0501070_0580399_23_817 261
1723 3300049588 Ga0501072_0356005 Ga0501072_0356005_10_810 261
1724 3300049593 Ga0501077_0034622 Ga0501077_0034622_2123_2908 261
1725 3300049742 Ga0501080_0260592 Ga0501080_0260592_487_1272 261
1726 3300049742 Ga0501080_0504713 Ga0501080_0504713_250_1044 261
1727 3300049743 Ga0501081_0038168 Ga0501081_0038168_1700_2485 261
1728 3300049823 Ga0501044_0030205 Ga0501044_0030205_910_1704 261
1729 3300049823 Ga0501044_0281404 Ga0501044_0281404_737_1552 261
1730 3300050494 nmdc:mga06z11_124102_c1 nmdc:mga06z11_124102_c1_410_1198 261
1731 3300050494 nmdc:mga06z11_137595_c1 nmdc:mga06z11_137595_c1_112_900 261
1732 3300050494 nmdc:mga06z11_23201_c1 nmdc:mga06z11_23201_c1_2086_2871 261
1733 3300050507 nmdc:mga05p37_148901_c1 nmdc:mga05p37_148901_c1_135_929 261
1734 3300050507 nmdc:mga05p37_1808_c2 nmdc:mga05p37_1808_c2_6757_7548 261
1735 3300050508 nmdc:mga09592_141748_c1 nmdc:mga09592_141748_c1_144_962 261
1736 3300050508 nmdc:mga09592_5057_c1 nmdc:mga09592_5057_c1_9220_10011 261
1737 3300050509 nmdc:mga0qj67_119224_c1 nmdc:mga0qj67_119224_c1_1105_1923 261
1738 3300050510 nmdc:mga06r32_3441_c1 nmdc:mga06r32_3441_c1_8231_9022 261
1739 3300050511 nmdc:mga08y16_3146_c1 nmdc:mga08y16_3146_c1_1993_2784 261
1740 3300050511 nmdc:mga08y16_3939_c1 nmdc:mga08y16_3939_c1_9682_10467 261
1741 3300050512 nmdc:mga0n895_159698_c1 nmdc:mga0n895_159698_c1_70_855 261
1742 3300050512 nmdc:mga0n895_37534_c1 nmdc:mga0n895_37534_c1_2743_3528 261
1743 3300050512 nmdc:mga0n895_69426_c1 nmdc:mga0n895_69426_c1_102_896 261
1744 3300050512 nmdc:mga0n895_79449_c1 nmdc:mga0n895_79449_c1_346_1140 261
1745 3300050513 nmdc:mga0rr50_25674_c1 nmdc:mga0rr50_25674_c1_3008_3802 261
1746 3300050513 nmdc:mga0rr50_26927_c1 nmdc:mga0rr50_26927_c1_2463_3257 261
1747 3300050513 nmdc:mga0rr50_42859_c1 nmdc:mga0rr50_42859_c1_1670_2455 261
1748 3300050513 nmdc:mga0rr50_48815_c1 nmdc:mga0rr50_48815_c1_1024_1815 261
1749 3300050513 nmdc:mga0rr50_59705_c1 nmdc:mga0rr50_59705_c1_1516_2310 261
1750 3300050514 nmdc:mga08x19_33203_c1 nmdc:mga08x19_33203_c1_1113_1907 261
1751 3300050515 nmdc:mga0a205_2724_c1 nmdc:mga0a205_2724_c1_5901_6692 261
1752 3300050515 nmdc:mga0a205_297338_c1 nmdc:mga0a205_297338_c1_332_1126 261
1753 3300050515 nmdc:mga0a205_44400_c1 nmdc:mga0a205_44400_c1_1335_2120 261
1754 3300053077 Ga0495601_0001042 Ga0495601_0001042_12424_13221 261
1755 3300053077 Ga0495601_0001925 Ga0495601_0001925_9632_10426 261
1756 3300053077 Ga0495601_0029283 Ga0495601_0029283_1773_2567 261
1757 3300053077 Ga0495601_0044685 Ga0495601_0044685_469_1275 261
1758 3300053077 Ga0495601_0094550 Ga0495601_0094550_989_1789 261
1759 3300053078 Ga0495612_0000858 Ga0495612_0000858_4657_5451 261
1760 3300053078 Ga0495612_0012643 Ga0495612_0012643_2049_2846 261
1761 3300053078 Ga0495612_0032977 Ga0495612_0032977_221_1015 261
1762 3300053084 Ga0495595_0000879 Ga0495595_0000879_1480_2286 261
1763 3300053084 Ga0495595_0006336 Ga0495595_0006336_1848_2645 261
1764 3300053084 Ga0495595_0010002 Ga0495595_0010002_1445_2245 261
1765 3300053084 Ga0495595_0011017 Ga0495595_0011017_893_1687 261
1766 3300053084 Ga0495595_0014880 Ga0495595_0014880_168_962 261
1767 3300053085 Ga0495619_0000229 Ga0495619_0000229_14780_15574 261
1768 3300053085 Ga0495619_0002881 Ga0495619_0002881_10230_11024 261
1769 3300053085 Ga0495619_0005795 Ga0495619_0005795_2403_3197 261
1770 3300053085 Ga0495619_0013992 Ga0495619_0013992_2824_3621 261
1771 3300053085 Ga0495619_0018217 Ga0495619_0018217_2322_3128 261
1772 3300054114 Ga0501084_0150596 Ga0501084_0150596_887_1672 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

62

203

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_C crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9309 3 221
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9295 3 221
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9238 4 221
1v43-assembly1.cif.gz_A crystal structure of atpase subunit of abc sugar transporter 0.9234 1 221
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.922 3 223
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9606 4 243 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9452 4 243 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9288 3 220 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9164 3 220 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9137 1 221 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1J5HAE4-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9478 1 221 GO:0005524
GO:0008643
GO:0016887
GO:0055052
GO:0140359
AF-A0A537ZXY3-F1-model_v4 ABC transporter ATP-binding protein 0.9448 4 221 GO:0005524
GO:0016887
GO:0022857
GO:0043190
AF-A0A6G2KRN3-F1-model_v4 deleted 0.9443 1 247
AF-A0A382ZAC4-F1-model_v4 ABC transporter domain-containing protein 0.9438 2 208 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A7Z0MMF1-F1-model_v4 sn-glycerol-3-phosphate import ATP-binding protein UgpC 0.9436 1 221 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359

Feature Viewer

pLDDT pTM Quality
86.81 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map