metagRoot

F495616

General Info

Members	Datasets	Scaffolds	Average Seq Length
1761	677	1520	286

Family's Representative Sequence

Representative Sequence	3300046524\|Ga0495648_0149733\|Ga0495648_0149733_207_1124
Length	305
Sequence	MATYAVGDLQGCLEPLQCLLERVAFDPAKDRLWLVGDLVNRGPQSLATLRFLYGIRESLVCVLGNHDLHLLAAGRNIERLKKNDTLREILEAPDRAELLEWLRQQKLMHYDELRDIALVHAGIPPQWSLRKALKYAAEVEEALHDDNRIAPYLDGMYGNEPVKWDNDLKGVARLRVITNYFTRMRFCTREGKLDLKSKEGADTALPGYKPWFTYKERKTKDLKIIFGHWAALEGQCDEPGIFALDTGCVWGGAMTLMNVDTGERLQCKCDDQGHSTPPIAPITTEQSPASAPRQTALPTSHRSPP

Samples

	Sample ID	Description	Type	Environment
1	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	2162886011	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
4	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
5	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
6	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
7	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
8	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
9	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
10	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
11	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
12	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
13	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
14	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
15	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
16	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
17	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
18	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
19	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
20	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
21	2511231024	Pseudomonas sp. GM84	Isolate	Nodule
22	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
23	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
24	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
25	2554235231	Pseudomonas putida MTCC 5279	Isolate	Unclassified
26	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
27	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
28	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
29	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
30	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
31	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
32	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
33	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
34	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
35	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
36	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
37	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
38	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
39	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
40	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
41	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
42	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
43	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
44	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
45	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
46	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
47	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
48	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
49	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
50	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
51	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
52	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
53	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
54	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
55	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
56	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
57	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
58	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
59	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
60	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
61	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
62	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
63	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
64	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
65	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
66	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
67	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
68	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
69	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
70	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
71	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
72	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
73	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
74	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
75	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
76	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
77	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
78	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
79	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
80	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
81	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
82	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
83	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
84	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
85	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
86	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
87	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
88	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
89	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
90	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
91	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
92	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
93	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
94	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
95	2643221589	Pseudomonas sp. Root68	Isolate	Unclassified
96	2643221602	Pseudomonas sp. Root71	Isolate	Unclassified
97	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
98	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
99	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
100	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
101	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
102	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
103	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
104	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
105	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
106	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
107	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
108	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
109	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
110	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
111	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
112	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
113	2738541276	Cellvibrio sp. YR554	Isolate	Unclassified
114	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
115	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
116	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
117	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
118	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
119	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
120	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
121	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
122	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
123	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
124	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
125	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
126	2765235841	Pseudomonas putida AA7	Isolate	Unclassified
127	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
128	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
129	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
130	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
131	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
132	2806310737	Pseudomonas mosselii BS011	Isolate	Unclassified
133	2806310745	Pseudomonas mosselii PtA1	Isolate	Unclassified
134	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
135	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
136	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
137	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
138	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
139	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
140	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
141	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
142	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
143	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
144	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
145	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
146	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
147	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
148	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
149	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
150	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
151	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
152	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
153	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
154	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
155	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
156	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
157	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
158	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
159	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
160	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
161	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
162	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
163	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
164	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
165	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
166	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
167	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
168	2904550169	Stutzerimonas stutzeri 1099	Isolate	Rhizosphere
169	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
170	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
171	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
172	2916178963	Pseudoalteromonas rhizosphaerae RA15	Isolate	Rhizosphere
173	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
174	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
175	2919155634	Pseudomonas fulva 1992	Isolate	Unclassified
176	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
177	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
178	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
179	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
180	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
181	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
182	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
183	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
184	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
185	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
186	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
187	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
188	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
189	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
190	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
191	2939636861	Pseudomonas sp. 2725	Isolate	Rhizosphere
192	2939651529	Pseudomonas sp. 2835	Isolate	Rhizosphere
193	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
194	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
195	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
196	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
197	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
198	2952252522	Salinicola sp. DM10	Isolate	Unclassified
199	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
200	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
201	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
202	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
203	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
204	3007252601	Pseudomonas punonensis D1-6	Isolate	Unclassified
205	3007315729	Pseudomonas argentinensis SA190	Isolate	Unclassified
206	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
207	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
208	3007511990	Pseudomonas fluorescens G20-18	Isolate	Rhizosphere
209	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
210	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
211	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
212	3007803356	Pseudomonas sp. CM27	Isolate	Unclassified
213	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
214	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
215	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
216	3007872151	Pseudomonas sp. SWRI51	Isolate	Rhizosphere
217	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
218	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
219	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
220	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
221	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
222	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
223	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
224	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
225	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
226	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
227	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
228	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
229	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
230	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
231	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
232	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
233	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
234	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
235	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
236	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
237	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
238	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
239	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
240	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
241	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
242	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
243	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
244	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
245	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
246	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
247	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
248	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
249	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
250	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
251	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
252	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
253	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
254	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
255	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
256	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
257	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
258	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
259	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
260	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
261	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
262	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
263	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
264	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
265	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
266	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
267	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
268	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
269	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
270	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
271	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
272	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
273	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
274	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
275	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
276	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
277	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
278	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
279	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
280	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
281	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
282	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
283	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
284	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
285	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
286	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
287	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
288	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
289	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
290	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
291	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
292	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
293	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
294	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
295	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
296	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
297	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
298	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
299	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
300	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
301	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
302	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
303	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
304	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
305	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
306	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
307	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
308	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
309	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
310	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
311	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
312	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
313	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
314	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
315	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
316	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
317	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
318	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
319	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
320	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
321	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
322	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
323	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
324	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
325	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
326	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
327	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
328	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
329	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
330	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
331	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
332	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
333	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
334	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
335	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
336	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
337	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
338	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
339	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
340	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
341	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
342	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
343	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
383	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
384	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
391	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
393	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
394	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
395	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
396	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
397	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
398	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
399	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
400	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
401	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
402	3300030879	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
403	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
404	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
405	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
406	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
407	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
408	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
409	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
410	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
411	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
412	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
413	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
414	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
415	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
416	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
417	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
418	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
419	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
420	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
421	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
422	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
423	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
424	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
425	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
426	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
427	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
428	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
429	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
430	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
431	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
432	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
433	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
434	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
435	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
436	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
437	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
438	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
439	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
440	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
441	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
442	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
443	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
444	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
445	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
446	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
447	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
448	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
449	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
450	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
451	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
452	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
453	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
454	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
455	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
456	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
457	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
458	3300042118	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156	Metagenome	Rhizosphere
459	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
460	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
461	3300042124	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423	Metagenome	Rhizosphere
462	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
463	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
464	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
465	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
466	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
467	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
468	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
469	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
470	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
471	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
472	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
473	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
474	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
475	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
476	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
477	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
478	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
479	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
480	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
481	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
482	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
483	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
484	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
485	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
486	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
487	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
488	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
489	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
490	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
491	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
492	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
493	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
494	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
495	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
496	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
497	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
498	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
499	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
500	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
501	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
502	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
503	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
504	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
505	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
506	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
507	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
508	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
509	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
510	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
511	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
512	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
513	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
514	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
515	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
516	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
517	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
518	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
519	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
520	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
521	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
522	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
523	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
524	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
525	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
526	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
527	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
528	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
529	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
530	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
531	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
532	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
533	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
534	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
535	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
536	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
537	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
538	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
539	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
540	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
541	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
542	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
543	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
544	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
545	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
546	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
547	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
548	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
549	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
550	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
551	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
552	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
553	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
554	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
555	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
556	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
557	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
558	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
559	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
560	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
561	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
562	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
563	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
564	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
565	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
566	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
567	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
568	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
569	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
570	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
571	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
572	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
573	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
574	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
575	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
576	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
577	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
578	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
579	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
580	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
581	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
582	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
583	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
584	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
585	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
586	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
587	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
588	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
589	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
590	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
591	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
592	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
593	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
594	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
595	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
596	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
597	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
598	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
599	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
600	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
601	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
602	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
603	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
604	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
605	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
606	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
607	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
608	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
609	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
610	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
611	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
612	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
613	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
614	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
615	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
616	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
617	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
618	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
619	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
620	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
621	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
622	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
623	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
624	3300049656	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought	Metagenome	Rhizosphere
625	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
626	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
627	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
628	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
629	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
630	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
631	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
632	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
633	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
634	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
635	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
636	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
637	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
638	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
639	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
640	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
641	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
642	3300053135	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere	Metagenome	Endosphere
643	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
644	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
645	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
646	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
647	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
648	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
649	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
650	8002745576	Marinomonas spartinae USM8	Isolate	Rhizosphere
651	8011350971	Pseudomonas sp. 30_B	Isolate	Rhizosphere
652	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
653	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
654	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
655	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
656	8052494512	Pseudomonas putida LD6	Isolate	Unclassified
657	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
658	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
659	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
660	8054929484	Pseudomonas vlassakiae RW4S1	Isolate	Rhizosphere
661	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
662	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
663	8055878733	Pseudomonas palmensis BBB001	Isolate	Rhizosphere
664	8056115690	Pseudomonas muyukensis COW39	Isolate	Rhizosphere
665	8056120720	Pseudomonas maumuensis COW77	Isolate	Rhizosphere
666	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
667	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
668	8056137416	Pseudomonas fakonensis COW40	Isolate	Rhizosphere
669	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
670	8056148874	Pseudomonas khavaziana SWRI124	Isolate	Rhizosphere
671	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
672	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
673	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
674	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
675	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
676	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
677	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	86.03
Metatranscriptomes	0.23
Isolates	13.74

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.09
Nodule	1.76
Rhizoplane	4.77
Rhizosphere	78.65
Stem	0
Stem Tuber	0
Unclassified	10.73

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS2a_Contig_12	2124908027	Bacteria	39492
2	MRS2a_Contig_9301	2124908027	Bacteria	2213
3	SwRhRL2b_contig_1583477	2162886007	Bacteria	4839
4	MRS1b_contig_2832839	2162886011	Bacteria	2308
5	MRS1b_contig_3623393	2162886011	Bacteria	1264
6	JGI25162J39368_1001036	3300002737	Bacteria	17174
7	JGI25162J39368_1001039	3300002737	Bacteria	17076
8	JGI25154J39366_1006516	3300002738	Bacteria	1699
9	JGI25163J39215_1000762	3300002771	Bacteria	7973
10	JGI25163J39215_1001286	3300002771	Bacteria	4479
11	JGI25164J39214_1000552	3300002772	Bacteria	17174
12	JGI25164J39214_1000554	3300002772	Bacteria	17076
13	JGI25165J46597_1001104	3300003214	Bacteria	17174
14	JGI25165J46597_1001107	3300003214	Bacteria	17076
15	rootH2_10192408	3300003320	Bacteria	3316
16	rootH1_10007647	3300003323	Bacteria	55493
17	rootH1_10034201	3300003316	Bacteria	1912
18	rootH1_10034201	3300003323	Bacteria	9076
19	rootH1_10100973	3300003323	Bacteria	2113
20	rootH1_10147567	3300003323	Bacteria	3110
21	rootH1_10354543	3300003323	Bacteria	1258
22	Ga0055538_1000074	3300003751	Bacteria	90292
23	Ga0055539_1000112	3300003752	Bacteria	90292
24	Ga0055533_1000118	3300003756	Bacteria	90292
25	Ga0055532_1000106	3300003758	Bacteria	90264
26	Ga0055525_1000157	3300003759	Bacteria	90292
27	Ga0055536_1000139	3300003781	Bacteria	62479
28	Ga0055536_1001103	3300003781	Bacteria	16963
29	Ga0055530_10001748	3300003791	Bacteria	15207
30	Ga0055530_10002340	3300003791	Bacteria	12354
31	Ga0055530_10006419	3300003791	Bacteria	5260
32	Ga0055540_1001421	3300003792	Bacteria	14265
33	Ga0055540_1001437	3300003792	Bacteria	14197
34	Ga0055540_1001757	3300003792	Bacteria	12388
35	Ga0055540_1003360	3300003792	Bacteria	7761
36	Ga0055531_10000286	3300003794	Bacteria	51010
37	Ga0055541_1000075	3300003841	Bacteria	90292
38	Ga0065714_10000117	3300005288	Bacteria	10162
39	Ga0065714_10002806	3300005288	Bacteria	14729
40	Ga0065714_10010317	3300005288	Bacteria	2724
41	Ga0065714_10010960	3300005288	Bacteria	3148
42	Ga0065714_10065258	3300005288	Bacteria	11417
43	Ga0065714_10066325	3300005288	Bacteria	7108
44	Ga0065714_10073782	3300005288	Bacteria	3132
45	Ga0065714_10076634	3300005288	Bacteria	2769
46	Ga0065714_10076722	3300005288	Bacteria	2760
47	Ga0065714_10092893	3300005288	Bacteria	1863
48	Ga0065714_10095240	3300005288	Bacteria	1792
49	Ga0065714_10106934	3300005288	Bacteria	1534
50	Ga0065714_10133035	3300005288	Bacteria	1202
51	Ga0065704_10071389	3300005289	Bacteria	11358
52	Ga0065704_10095449	3300005289	Bacteria	2474
53	Ga0065704_10119112	3300005289	Bacteria	1760
54	Ga0065712_10000411	3300005290	Bacteria	15758
55	Ga0065715_10002496	3300005293	Bacteria	5388
56	Ga0065707_10218272	3300005295	Bacteria	1235
57	Ga0070658_10052077	3300005327	Bacteria	3319
58	Ga0070670_100027168	3300005331	Bacteria	4923
59	Ga0070670_100054331	3300005331	Bacteria	3438
60	Ga0068869_100105086	3300005334	Bacteria	2141
61	Ga0070680_100035753	3300005336	Bacteria	4011
62	Ga0070680_100454872	3300005336	Bacteria	1094
63	Ga0070687_100309911	3300005343	Bacteria	1005
64	Ga0070661_100003559	3300005344	Bacteria	10727
65	Ga0070661_100216861	3300005344	Bacteria	1466
66	Ga0070661_100322871	3300005344	Bacteria	1206
67	Ga0070692_10004243	3300005345	Bacteria	5950
68	Ga0070669_100004019	3300005353	Bacteria	10635
69	Ga0070669_100013824	3300005353	Bacteria	5738
70	Ga0070669_100080388	3300005353	Bacteria	2426
71	Ga0070671_100031030	3300005355	Bacteria	4413
72	Ga0070674_100203807	3300005356	Bacteria	1529
73	Ga0070688_100186834	3300005365	Bacteria	1441
74	Ga0070714_100095868	3300005435	Bacteria	2606
75	Ga0070713_100212558	3300005436	Bacteria	1752
76	Ga0070710_10051994	3300005437	Bacteria	2303
77	Ga0070711_100007018	3300005439	Bacteria	6834
78	Ga0070711_100066663	3300005439	Bacteria	2523
79	Ga0070705_100448966	3300005440	Bacteria	967
80	Ga0070700_100003335	3300005441	Bacteria	8278
81	Ga0070694_100308697	3300005444	Bacteria	1214
82	Ga0070708_100502327	3300005445	Bacteria	1144
83	Ga0070663_100310951	3300005455	Bacteria	1264
84	Ga0070662_100001292	3300005457	Bacteria	15373
85	Ga0070662_100010144	3300005457	Bacteria	6172
86	Ga0070662_100525394	3300005457	Bacteria	989
87	Ga0068867_100000126	3300005459	Bacteria	49231
88	Ga0070706_100354115	3300005467	Bacteria	1368
89	Ga0070679_100012887	3300005530	Bacteria	8004
90	Ga0070679_100560640	3300005530	Bacteria	1086
91	Ga0070684_100416223	3300005535	Bacteria	1240
92	Ga0068853_100000211	3300005539	Bacteria	41402
93	Ga0068853_100043647	3300005539	Bacteria	3836
94	Ga0068853_100231949	3300005539	Bacteria	1689
95	Ga0070695_100043013	3300005545	Bacteria	2871
96	Ga0070696_100057276	3300005546	Bacteria	2719
97	Ga0070665_100253582	3300005548	Bacteria	1760
98	Ga0068855_100370394	3300005563	Bacteria	1575
99	Ga0070664_100004896	3300005564	Bacteria	10727
100	Ga0070664_100046300	3300005564	Bacteria	3673
101	Ga0070664_100053098	3300005564	Bacteria	3434
102	Ga0068854_100004022	3300005578	Bacteria	9227
103	Ga0068856_100017043	3300005614	Bacteria	7042
104	Ga0068856_100370505	3300005614	Bacteria	1451
105	Ga0070702_100045834	3300005615	Bacteria	2476
106	Ga0068852_100007460	3300005616	Bacteria	7981
107	Ga0068861_100005473	3300005719	Bacteria	8605
108	Ga0068851_10000063	3300005834	Bacteria	60338
109	Ga0068851_10211916	3300005834	Bacteria	1085
110	Ga0068860_100372283	3300005843	Bacteria	1409
111	Ga0068862_100001111	3300005844	Bacteria	25519
112	Ga0075364_10117527	3300006051	Bacteria	1778
113	Ga0075364_10129195	3300006051	Bacteria	1695
114	Ga0075432_10002774	3300006058	Bacteria	5876
115	Ga0075432_10010744	3300006058	Bacteria	3110
116	Ga0075432_10018421	3300006058	Bacteria	2382
117	Ga0075432_10040342	3300006058	Bacteria	1629
118	Ga0075432_10057546	3300006058	Bacteria	1379
119	Ga0070715_10146603	3300006163	Bacteria	1152
120	Ga0070716_100002786	3300006173	Bacteria	8122
121	Ga0075362_10042605	3300006177	Bacteria	2007
122	Ga0075367_10215120	3300006178	Bacteria	1202
123	Ga0075369_10062448	3300006186	Bacteria	1627
124	Ga0075366_10019806	3300006195	Bacteria	3899
125	Ga0097621_100614877	3300006237	Bacteria	994
126	Ga0075370_10124492	3300006353	Bacteria	1502
127	Ga0075370_10193196	3300006353	Bacteria	1200
128	Ga0075430_100022100	3300006846	Bacteria	5407
129	Ga0075433_10035913	3300006852	Bacteria	4266
130	Ga0075433_10054787	3300006852	Bacteria	3480
131	Ga0068865_100004646	3300006881	Bacteria	8294
132	Ga0099823_1000115	3300006944	Bacteria	40134
133	Ga0079104_1001317	3300006946	Bacteria	17059
134	Ga0079104_1001523	3300006946	Bacteria	15313
135	Ga0079104_1025908	3300006946	Bacteria	1523
136	Ga0099826_10004352	3300006948	Bacteria	9912
137	Ga0075435_100002009	3300007076	Bacteria	13315
138	Ga0075435_100041710	3300007076	Bacteria	3669
139	Ga0099794_10004995	3300007265	Bacteria	5281
140	Ga0099795_10000053	3300007788	Bacteria	22441
141	Ga0099795_10000744	3300007788	Bacteria	6378
142	Ga0105251_10000322	3300009011	Bacteria	48000
143	Ga0105251_10001165	3300009011	Bacteria	22811
144	Ga0105251_10001960	3300009011	Bacteria	16830
145	Ga0105251_10003113	3300009011	Bacteria	12315
146	Ga0105251_10003311	3300009011	Bacteria	11777
147	Ga0105251_10006157	3300009011	Bacteria	7717
148	Ga0105251_10008988	3300009011	Bacteria	5958
149	Ga0105251_10010223	3300009011	Bacteria	5462
150	Ga0105251_10028814	3300009011	Bacteria	2802
151	Ga0105251_10041074	3300009011	Bacteria	2253
152	Ga0105251_10080033	3300009011	Bacteria	1511
153	Ga0105251_10089464	3300009011	Bacteria	1416
154	Ga0105244_10004496	3300009036	Bacteria	9578
155	Ga0105244_10005327	3300009036	Bacteria	8564
156	Ga0105244_10011796	3300009036	Bacteria	5211
157	Ga0105244_10020023	3300009036	Bacteria	3720
158	Ga0105244_10027945	3300009036	Bacteria	3032
159	Ga0105244_10029278	3300009036	Bacteria	2945
160	Ga0105244_10039581	3300009036	Bacteria	2453
161	Ga0105244_10053019	3300009036	Bacteria	2063
162	Ga0105244_10054628	3300009036	Bacteria	2026
163	Ga0105244_10058480	3300009036	Bacteria	1945
164	Ga0105244_10062420	3300009036	Bacteria	1873
165	Ga0105244_10062571	3300009036	Bacteria	1871
166	Ga0105244_10066565	3300009036	Bacteria	1803
167	Ga0105244_10098468	3300009036	Bacteria	1432
168	Ga0105250_10000821	3300009092	Bacteria	18499
169	Ga0105250_10004422	3300009092	Bacteria	6475
170	Ga0105250_10006263	3300009092	Bacteria	5220
171	Ga0105250_10016888	3300009092	Bacteria	2970
172	Ga0105250_10019307	3300009092	Bacteria	2756
173	Ga0105250_10024130	3300009092	Bacteria	2451
174	Ga0105250_10056058	3300009092	Bacteria	1582
175	Ga0105250_10125534	3300009092	Bacteria	1057
176	Ga0105240_10034362	3300009093	Bacteria	6539
177	Ga0105240_10081621	3300009093	Bacteria	3973
178	Ga0105240_10420745	3300009093	Bacteria	1501
179	Ga0111539_10051444	3300009094	Bacteria	4906
180	Ga0111539_10089085	3300009094	Bacteria	3626
181	Ga0105243_10003591	3300009148	Bacteria	12511
182	Ga0105243_10007352	3300009148	Bacteria	8468
183	Ga0105243_10008088	3300009148	Bacteria	8072
184	Ga0105243_10017025	3300009148	Bacteria	5496
185	Ga0105243_10019953	3300009148	Bacteria	5082
186	Ga0105243_10049857	3300009148	Bacteria	3305
187	Ga0105243_10064276	3300009148	Bacteria	2944
188	Ga0105243_10308708	3300009148	Bacteria	1436
189	Ga0105241_10012536	3300009174	Bacteria	6217
190	Ga0105242_10003671	3300009176	Bacteria	11943
191	Ga0105242_10702409	3300009176	Bacteria	990
192	Ga0105248_10034109	3300009177	Bacteria	5689
193	Ga0105237_10000583	3300009545	Bacteria	51030
194	Ga0105238_10024261	3300009551	Bacteria	6183
195	Ga0105249_10002649	3300009553	Bacteria	15482
196	Ga0105249_10020288	3300009553	Bacteria	5942
197	Ga0099796_10000096	3300010159	Bacteria	14200
198	Ga0099796_10000788	3300010159	Bacteria	5719
199	Ga0105246_10000407	3300011119	Bacteria	23121
200	Ga0105246_10002696	3300011119	Bacteria	10752
201	Ga0105246_10023470	3300011119	Bacteria	3992
202	Ga0105246_10081093	3300011119	Bacteria	2311
203	Ga0105246_10132775	3300011119	Bacteria	1862
204	Ga0157345_1000462	3300012498	Bacteria	3899
205	Ga0157373_10009149	3300013100	Bacteria	7324
206	Ga0157373_10041012	3300013100	Bacteria	3312
207	Ga0157373_10044359	3300013100	Bacteria	3174
208	Ga0157373_10049636	3300013100	Bacteria	2990
209	Ga0157373_10065325	3300013100	Bacteria	2575
210	Ga0157373_10066056	3300013100	Bacteria	2560
211	Ga0157373_10066304	3300013100	Bacteria	2554
212	Ga0157373_10144184	3300013100	Bacteria	1675
213	Ga0157373_10163427	3300013100	Bacteria	1567
214	Ga0157373_10275253	3300013100	Bacteria	1192
215	Ga0157371_10000536	3300013102	Bacteria	45189
216	Ga0157371_10005541	3300013102	Bacteria	10622
217	Ga0157371_10005602	3300013102	Bacteria	10555
218	Ga0157371_10050109	3300013102	Bacteria	2967
219	Ga0157371_10083413	3300013102	Bacteria	2263
220	Ga0157371_10132820	3300013102	Bacteria	1771
221	Ga0157371_10451258	3300013102	Bacteria	945
222	Ga0157370_10003046	3300013104	Bacteria	19875
223	Ga0157370_10077506	3300013104	Bacteria	3131
224	Ga0157370_10088218	3300013104	Bacteria	2913
225	Ga0157370_10215265	3300013104	Bacteria	1780
226	Ga0157370_10224380	3300013104	Bacteria	1740
227	Ga0157370_10302825	3300013104	Bacteria	1475
228	Ga0157370_10365552	3300013104	Bacteria	1329
229	Ga0157369_10107978	3300013105	Bacteria	2960
230	Ga0157369_10143035	3300013105	Bacteria	2530
231	Ga0157369_10242806	3300013105	Bacteria	1881
232	Ga0157369_10242920	3300013105	Bacteria	1881
233	Ga0157369_10267611	3300013105	Bacteria	1782
234	Ga0157369_10268135	3300013105	Bacteria	1780
235	Ga0157369_10303718	3300013105	Bacteria	1660
236	Ga0157369_10463158	3300013105	Bacteria	1312
237	Ga0163162_10038462	3300013306	Bacteria	4774
238	Ga0163162_10102133	3300013306	Bacteria	2960
239	Ga0157372_10003469	3300013307	Bacteria	17007
240	Ga0157372_10004093	3300013307	Bacteria	15638
241	Ga0157372_10022649	3300013307	Bacteria	6800
242	Ga0157372_11202358	3300013307	Bacteria	876
243	Ga0157375_10110672	3300013308	Bacteria	2844
244	Ga0157375_10249469	3300013308	Bacteria	1936
245	Ga0157375_10318981	3300013308	Bacteria	1718
246	Ga0157380_10019493	3300014326	Bacteria	5055
247	Ga0182008_10003325	3300014497	Bacteria	9770
248	Ga0182008_10009741	3300014497	Bacteria	5171
249	Ga0182008_10010336	3300014497	Bacteria	4996
250	Ga0182008_10035132	3300014497	Bacteria	2512
251	Ga0182008_10037668	3300014497	Bacteria	2419
252	Ga0182008_10045658	3300014497	Bacteria	2178
253	Ga0182008_10047832	3300014497	Bacteria	2125
254	Ga0182008_10077089	3300014497	Bacteria	1640
255	Ga0182008_10107242	3300014497	Bacteria	1383
256	Ga0182006_1004311	3300015261	Bacteria	7040
257	Ga0182006_1005343	3300015261	Bacteria	6142
258	Ga0182006_1007460	3300015261	Bacteria	5003
259	Ga0182006_1008650	3300015261	Bacteria	4609
260	Ga0182006_1010778	3300015261	Bacteria	4049
261	Ga0182006_1021188	3300015261	Bacteria	2713
262	Ga0182006_1025415	3300015261	Bacteria	2432
263	Ga0182006_1029721	3300015261	Bacteria	2212
264	Ga0182006_1062120	3300015261	Bacteria	1406
265	Ga0182007_10003355	3300015262	Bacteria	7571
266	Ga0182007_10022119	3300015262	Bacteria	2249
267	Ga0182007_10037888	3300015262	Bacteria	1618
268	Ga0182005_1005044	3300015265	Bacteria	4170
269	Ga0182005_1005742	3300015265	Bacteria	3851
270	Ga0182005_1014928	3300015265	Bacteria	2169
271	Ga0182005_1015300	3300015265	Bacteria	2141
272	Ga0182005_1018176	3300015265	Bacteria	1943
273	Ga0182005_1019364	3300015265	Bacteria	1876
274	Ga0163161_10051808	3300017792	Bacteria	2975
275	Ga0163161_10052419	3300017792	Bacteria	2957
276	Ga0163161_10053482	3300017792	Bacteria	2928
277	Ga0163161_10063081	3300017792	Bacteria	2700
278	Ga0163161_10117210	3300017792	Bacteria	1997
279	Ga0163161_10149637	3300017792	Bacteria	1773
280	Ga0163161_10187729	3300017792	Bacteria	1588
281	Ga0163161_10205645	3300017792	Bacteria	1519
282	Ga0163161_10234841	3300017792	Bacteria	1424
283	Ga0163161_10252758	3300017792	Bacteria	1374
284	Ga0213872_10062502	3300021361	Bacteria	1682
285	Ga0209760_100155	3300025207	Bacteria	41538
286	Ga0209760_100259	3300025207	Bacteria	20893
287	Ga0209784_100007	3300025224	Bacteria	747715
288	Ga0209566_100062	3300025225	Bacteria	193033
289	Ga0209674_100132	3300025226	Bacteria	117820
290	Ga0209147_100009	3300025229	Bacteria	747409
291	Ga0209563_100018	3300025230	Bacteria	747850
292	Ga0209563_100185	3300025230	Bacteria	37133
293	Ga0207427_100005	3300025231	Bacteria	797999
294	Ga0207427_100006	3300025231	Bacteria	785415
295	Ga0209437_100013	3300025233	Bacteria	785457
296	Ga0209437_100220	3300025233	Bacteria	104235
297	Ga0209437_103353	3300025233	Bacteria	2913
298	Ga0209258_100451	3300025242	Bacteria	45482
299	Ga0209646_1000185	3300025246	Bacteria	77981
300	Ga0209677_100056	3300025253	Bacteria	165557
301	Ga0209233_1000021	3300025261	Bacteria	798078
302	Ga0209233_1000022	3300025261	Bacteria	785415
303	Ga0209675_1001285	3300025291	Bacteria	14914
304	Ga0209676_1000015	3300025292	Bacteria	784458
305	Ga0209676_1000668	3300025292	Bacteria	48922
306	Ga0209676_1001895	3300025292	Bacteria	17055
307	Ga0209676_1002078	3300025292	Bacteria	15528
308	Ga0209676_1005655	3300025292	Bacteria	6438
309	Ga0209676_1014257	3300025292	Bacteria	3001
310	Ga0209050_1000024	3300025298	Bacteria	533389
311	Ga0209050_1000075	3300025298	Bacteria	286562
312	Ga0209050_1000128	3300025298	Bacteria	187432
313	Ga0209050_1016850	3300025298	Bacteria	2955
314	Ga0209051_1000023	3300025303	Bacteria	437371
315	Ga0209051_1000041	3300025303	Bacteria	311155
316	Ga0209051_1002045	3300025303	Bacteria	15324
317	Ga0209257_1000069	3300025304	Bacteria	339826
318	Ga0209257_1007928	3300025304	Bacteria	6230
319	Ga0207656_10000006	3300025321	Bacteria	395044
320	Ga0207696_1000064	3300025711	Bacteria	238379
321	Ga0207696_1000094	3300025711	Bacteria	184065
322	Ga0207696_1000319	3300025711	Bacteria	51975
323	Ga0207696_1000324	3300025711	Bacteria	51146
324	Ga0207696_1001632	3300025711	Bacteria	11815
325	Ga0207696_1001914	3300025711	Bacteria	10603
326	Ga0207696_1005902	3300025711	Bacteria	5010
327	Ga0207696_1010088	3300025711	Bacteria	3484
328	Ga0207696_1012021	3300025711	Bacteria	3084
329	Ga0207696_1020049	3300025711	Bacteria	2162
330	Ga0207696_1039594	3300025711	Bacteria	1385
331	Ga0207696_1052567	3300025711	Bacteria	1161
332	Ga0207655_1000107	3300025728	Bacteria	178758
333	Ga0207655_1000473	3300025728	Bacteria	52002
334	Ga0207655_1000486	3300025728	Bacteria	51236
335	Ga0207655_1000598	3300025728	Bacteria	44045
336	Ga0207655_1000870	3300025728	Bacteria	31981
337	Ga0207655_1000970	3300025728	Bacteria	29569
338	Ga0207655_1003015	3300025728	Bacteria	12891
339	Ga0207655_1005857	3300025728	Bacteria	8248
340	Ga0207655_1005892	3300025728	Bacteria	8217
341	Ga0207655_1006465	3300025728	Bacteria	7761
342	Ga0207655_1014267	3300025728	Bacteria	4502
343	Ga0207655_1018966	3300025728	Bacteria	3622
344	Ga0207655_1019257	3300025728	Bacteria	3578
345	Ga0207655_1022984	3300025728	Bacteria	3106
346	Ga0207655_1030588	3300025728	Bacteria	2501
347	Ga0207655_1035063	3300025728	Bacteria	2247
348	Ga0207655_1042853	3300025728	Bacteria	1922
349	Ga0207655_1090695	3300025728	Bacteria	1076
350	Ga0207713_1000010	3300025735	Bacteria	528374
351	Ga0207713_1000938	3300025735	Bacteria	26164
352	Ga0207713_1001123	3300025735	Bacteria	22784
353	Ga0207713_1001637	3300025735	Bacteria	17457
354	Ga0207713_1002308	3300025735	Bacteria	14019
355	Ga0207713_1002313	3300025735	Bacteria	13999
356	Ga0207713_1003062	3300025735	Bacteria	11624
357	Ga0207713_1004443	3300025735	Bacteria	9083
358	Ga0207713_1005709	3300025735	Bacteria	7726
359	Ga0207713_1006344	3300025735	Bacteria	7217
360	Ga0207713_1006360	3300025735	Bacteria	7208
361	Ga0207713_1009958	3300025735	Bacteria	5310
362	Ga0207713_1025466	3300025735	Bacteria	2731
363	Ga0207713_1030081	3300025735	Bacteria	2421
364	Ga0207713_1080824	3300025735	Bacteria	1170
365	Ga0207643_10007354	3300025908	Bacteria	5908
366	Ga0207705_10217127	3300025909	Bacteria	1451
367	Ga0207654_10224104	3300025911	Bacteria	1249
368	Ga0207695_10030026	3300025913	Bacteria	5993
369	Ga0207695_10127083	3300025913	Bacteria	2510
370	Ga0207671_10000159	3300025914	Bacteria	105261
371	Ga0207693_10247192	3300025915	Bacteria	1400
372	Ga0207663_10032699	3300025916	Bacteria	3091
373	Ga0207663_10179040	3300025916	Bacteria	1512
374	Ga0207660_10035591	3300025917	Bacteria	3458
375	Ga0207660_10352868	3300025917	Bacteria	1179
376	Ga0207657_10128165	3300025919	Bacteria	2082
377	Ga0207657_10303590	3300025919	Bacteria	1264
378	Ga0207649_10000197	3300025920	Bacteria	50000
379	Ga0207649_10243954	3300025920	Bacteria	1291
380	Ga0207681_10000254	3300025923	Bacteria	40622
381	Ga0207681_10002154	3300025923	Bacteria	12555
382	Ga0207681_10017633	3300025923	Bacteria	4486
383	Ga0207694_10209748	3300025924	Bacteria	1586
384	Ga0207694_10594636	3300025924	Bacteria	930
385	Ga0207650_10000159	3300025925	Bacteria	81496
386	Ga0207650_10001937	3300025925	Bacteria	14576
387	Ga0207687_10261125	3300025927	Bacteria	1381
388	Ga0207700_10494790	3300025928	Bacteria	1082
389	Ga0207690_10273307	3300025932	Bacteria	1313
390	Ga0207706_10000395	3300025933	Bacteria	47041
391	Ga0207706_10002416	3300025933	Bacteria	18221
392	Ga0207686_10009130	3300025934	Bacteria	5376
393	Ga0207709_10000086	3300025935	Bacteria	156177
394	Ga0207709_10001231	3300025935	Bacteria	18388
395	Ga0207709_10003870	3300025935	Bacteria	8765
396	Ga0207709_10009462	3300025935	Bacteria	5361
397	Ga0207709_10040993	3300025935	Bacteria	2776
398	Ga0207709_10045901	3300025935	Bacteria	2649
399	Ga0207709_10105226	3300025935	Bacteria	1874
400	Ga0207709_10134741	3300025935	Bacteria	1689
401	Ga0207704_10002073	3300025938	Bacteria	8974
402	Ga0207665_10033438	3300025939	Bacteria	3408
403	Ga0207711_10140095	3300025941	Bacteria	2175
404	Ga0207689_10244953	3300025942	Bacteria	1482
405	Ga0207679_10000027	3300025945	Bacteria	196811
406	Ga0207679_10009730	3300025945	Bacteria	6165
407	Ga0207679_10185056	3300025945	Bacteria	1726
408	Ga0207667_10007453	3300025949	Bacteria	13148
409	Ga0207667_10503454	3300025949	Bacteria	1228
410	Ga0207668_10002434	3300025972	Bacteria	10869
411	Ga0207640_10021463	3300025981	Bacteria	3849
412	Ga0207640_10283292	3300025981	Bacteria	1303
413	Ga0207639_10000238	3300026041	Bacteria	41262
414	Ga0207639_10042985	3300026041	Bacteria	3390
415	Ga0207678_10058188	3300026067	Bacteria	3326
416	Ga0207708_10000697	3300026075	Bacteria	25504
417	Ga0207708_10141535	3300026075	Bacteria	1887
418	Ga0207702_10201456	3300026078	Bacteria	1845
419	Ga0207702_10248933	3300026078	Bacteria	1668
420	Ga0207648_10000352	3300026089	Bacteria	50550
421	Ga0207676_10145709	3300026095	Bacteria	2034
422	Ga0207675_100000802	3300026118	Bacteria	31217
423	Ga0207698_10016907	3300026142	Bacteria	4933
424	Ga0207698_10542548	3300026142	Bacteria	1138
425	Ga0209281_1000016	3300027111	Bacteria	588107
426	Ga0209281_1000019	3300027111	Bacteria	576164
427	Ga0209281_1003253	3300027111	Bacteria	5523
428	Ga0209281_1012185	3300027111	Bacteria	1898
429	Ga0209281_1013748	3300027111	Bacteria	1735
430	Ga0209389_1000173	3300027296	Bacteria	51663
431	Ga0209371_1000127	3300027312	Bacteria	127069
432	Ga0209371_1000217	3300027312	Bacteria	77949
433	Ga0209995_1019006	3300027471	Bacteria	1134
434	Ga0209179_1000082	3300027512	Bacteria	15283
435	Ga0209971_1013236	3300027682	Bacteria	1955
436	Ga0209998_10003959	3300027717	Bacteria	3188
437	Ga0209974_10110924	3300027876	Unclassified	966
438	Ga0207428_10018666	3300027907	Bacteria	5920
439	Ga0207428_10022659	3300027907	Bacteria	5297
440	Ga0207428_10134759	3300027907	Bacteria	1889
441	Ga0207428_10182965	3300027907	Bacteria	1583
442	Ga0207428_10246716	3300027907	Bacteria	1332
443	Ga0268266_10005929	3300028379	Bacteria	11299
444	Ga0268266_10102431	3300028379	Bacteria	2525
445	Ga0268265_10000579	3300028380	Bacteria	37090
446	Ga0307517_10227299	3300028786	Bacteria	1125
447	Ga0307515_10000047	3300028794	Bacteria	291475
448	Ga0307515_10261885	3300028794	Bacteria	1464
449	Ga0265338_10015233	3300028800	Bacteria	8470
450	Ga0265338_10203782	3300028800	Bacteria	1490
451	Ga0268256_1000104	3300030500	Bacteria	127069
452	Ga0268256_1000173	3300030500	Bacteria	77949
453	Ga0307511_10151689	3300030521	Bacteria	1328
454	Ga0316177_1218477	3300030731	Bacteria	3003
455	Ga0316178_1048908	3300030735	Bacteria	57349
456	Ga0316181_1020117	3300030744	Bacteria	4531
457	Ga0265770_1000151	3300030878	Bacteria	8720
458	Ga0265765_1001116	3300030879	Bacteria	2399
459	Ga0265760_10003281	3300031090	Bacteria	4739
460	Ga0265760_10027460	3300031090	Bacteria	1668
461	Ga0265316_10201324	3300031344	Bacteria	1476
462	Ga0307408_100000049	3300031548	Bacteria	160142
463	Ga0307408_100000065	3300031548	Bacteria	122365
464	Ga0307408_100000914	3300031548	Bacteria	23055
465	Ga0307408_100012882	3300031548	Bacteria	5543
466	Ga0307408_100015049	3300031548	Bacteria	5148
467	Ga0307408_100015370	3300031548	Bacteria	5094
468	Ga0307408_100063555	3300031548	Bacteria	2701
469	Ga0307408_100063778	3300031548	Bacteria	2696
470	Ga0307408_100225523	3300031548	Bacteria	1531
471	Ga0307508_10173285	3300031616	Bacteria	1761
472	Ga0316575_10002994	3300031665	Bacteria	5757
473	Ga0316575_10025686	3300031665	Bacteria	2285
474	Ga0316579_10000567	3300031691	Bacteria	12322
475	Ga0265342_10022958	3300031712	Bacteria	3957
476	Ga0265342_10153749	3300031712	Bacteria	1276
477	Ga0316576_10075156	3300031727	Bacteria	2499
478	Ga0316576_10166963	3300031727	Bacteria	1661
479	Ga0316576_10171819	3300031727	Bacteria	1636
480	Ga0307516_10168191	3300031730	Bacteria	1935
481	Ga0307405_10000799	3300031731	Bacteria	12358
482	Ga0307405_10036482	3300031731	Bacteria	2946
483	Ga0307405_10133465	3300031731	Bacteria	1719
484	Ga0307413_10026147	3300031824	Bacteria	3212
485	Ga0307413_10409253	3300031824	Bacteria	1065
486	Ga0307406_10065807	3300031901	Bacteria	2356
487	Ga0307406_10133469	3300031901	Bacteria	1746
488	Ga0307406_10136138	3300031901	Bacteria	1731
489	Ga0307406_10250587	3300031901	Bacteria	1334
490	Ga0307412_10010723	3300031911	Bacteria	5285
491	Ga0307412_10011539	3300031911	Bacteria	5122
492	Ga0307412_10011820	3300031911	Bacteria	5067
493	Ga0307412_10094962	3300031911	Bacteria	2095
494	Ga0307412_10290006	3300031911	Bacteria	1288
495	Ga0307409_100226521	3300031995	Bacteria	1691
496	Ga0307416_100002539	3300032002	Bacteria	10509
497	Ga0307416_100210155	3300032002	Bacteria	1855
498	Ga0307416_100748881	3300032002	Bacteria	1069
499	Ga0307414_10074051	3300032004	Bacteria	2466
500	Ga0307414_10129328	3300032004	Bacteria	1957
501	Ga0307414_10137649	3300032004	Bacteria	1906
502	Ga0307414_10272958	3300032004	Bacteria	1417
503	Ga0307411_10001537	3300032005	Bacteria	9525
504	Ga0307415_100016027	3300032126	Bacteria	4454
505	Ga0316583_10003027	3300032133	Bacteria	5902
506	Ga0316583_10008762	3300032133	Bacteria	3649
507	Ga0307510_10049701	3300033180	Bacteria	4457
508	Ga0307510_10063219	3300033180	Bacteria	3772
509	Ga0373932_0084106	3300035112	Unclassified	1010
510	Ga0373953_0013284	3300035117	Bacteria	2938
511	Ga0373954_0055180	3300035118	Bacteria	1869
512	Ga0373957_0010630	3300035120	Bacteria	3049
513	Ga0373955_0033665	3300035172	Bacteria	2700
514	Ga0373955_0191276	3300035172	Bacteria	1217
515	Ga0316574_0008658	3300035398	Bacteria	5660
516	Ga0373924_0008535	3300035410	Bacteria	3728
517	Ga0373933_0039451	3300035724	Bacteria	2778
518	Ga0373937_0036233	3300036401	Bacteria	4494
519	Ga0373937_0141776	3300036401	Bacteria	2249
520	Ga0373937_0736036	3300036401	Bacteria	933
521	Ga0316582_0281263	3300036647	Bacteria	1142
522	Ga0316584_0017109	3300036712	Bacteria	5207
523	Ga0316584_0081810	3300036712	Bacteria	2419
524	Ga0395900_0222287	3300037418	Bacteria	1903
525	Ga0395898_0271107	3300037466	Bacteria	1619
526	Ga0395901_0559053	3300038443	Bacteria	1159
527	Ga0237819_01808	3300038705	Bacteria	4989
528	Ga0400483_266630	3300039062	Bacteria	2504
529	Ga0436361_0042094	3300039447	Bacteria	27359
530	Ga0439436_0000128	3300041404	Bacteria	17392
531	Ga0439438_000569	3300041405	Bacteria	16774
532	Ga0439438_001142	3300041405	Bacteria	11812
533	Ga0439438_002538	3300041405	Bacteria	7741
534	Ga0439438_005653	3300041405	Bacteria	4556
535	Ga0439438_006061	3300041405	Bacteria	4337
536	Ga0439438_006680	3300041405	Bacteria	4033
537	Ga0439438_007462	3300041405	Bacteria	3736
538	Ga0439438_010754	3300041405	Bacteria	2880
539	Ga0439438_014691	3300041405	Bacteria	2324
540	Ga0439438_020330	3300041405	Bacteria	1864
541	Ga0439438_021952	3300041405	Bacteria	1775
542	Ga0439439_0037683	3300041406	Bacteria	1247
543	Ga0439447_000852	3300041407	Bacteria	11189
544	Ga0439447_002170	3300041407	Bacteria	7189
545	Ga0439447_002449	3300041407	Bacteria	6758
546	Ga0439447_008568	3300041407	Bacteria	3161
547	Ga0439447_009332	3300041407	Bacteria	2981
548	Ga0439447_010188	3300041407	Bacteria	2802
549	Ga0439461_0013297	3300041410	Bacteria	1552
550	Ga0439461_0043364	3300041410	Bacteria	978
551	Ga0439466_0000570	3300041411	Bacteria	13842
552	Ga0439466_0002242	3300041411	Bacteria	7578
553	Ga0439466_0004132	3300041411	Bacteria	5609
554	Ga0439466_0005680	3300041411	Bacteria	4754
555	Ga0439466_0008678	3300041411	Bacteria	3829
556	Ga0439466_0014824	3300041411	Bacteria	2834
557	Ga0439466_0015283	3300041411	Bacteria	2789
558	Ga0439466_0016978	3300041411	Bacteria	2625
559	Ga0439466_0017284	3300041411	Bacteria	2600
560	Ga0439466_0028609	3300041411	Bacteria	1923
561	Ga0439466_0060601	3300041411	Bacteria	1219
562	Ga0439465_0015077	3300041413	Bacteria	2412
563	Ga0439431_0003458	3300041997	Bacteria	3478
564	Ga0439437_001149	3300042000	Bacteria	2765
565	Ga0439441_000065	3300042001	Bacteria	8054
566	Ga0439441_000681	3300042001	Bacteria	3917
567	Ga0439445_0012655	3300042004	Bacteria	2031
568	Ga0439432_001189	3300042006	Bacteria	9856
569	Ga0439432_002131	3300042006	Bacteria	7455
570	Ga0439432_003133	3300042006	Bacteria	6155
571	Ga0439432_006825	3300042006	Bacteria	4065
572	Ga0439432_007772	3300042006	Bacteria	3782
573	Ga0439432_010569	3300042006	Bacteria	3191
574	Ga0439432_012089	3300042006	Bacteria	2961
575	Ga0439432_018180	3300042006	Bacteria	2352
576	Ga0439432_032769	3300042006	Bacteria	1674
577	Ga0439451_001128	3300042009	Bacteria	5222
578	Ga0439451_003166	3300042009	Bacteria	3342
579	Ga0439451_004672	3300042009	Bacteria	2786
580	Ga0439451_008522	3300042009	Bacteria	2079
581	Ga0439451_013544	3300042009	Bacteria	1648
582	Ga0439451_022770	3300042009	Bacteria	1262
583	Ga0439452_001810	3300042010	Bacteria	8315
584	Ga0439452_002746	3300042010	Bacteria	6368
585	Ga0439452_003344	3300042010	Bacteria	5636
586	Ga0439452_004070	3300042010	Bacteria	4971
587	Ga0439452_012618	3300042010	Bacteria	2396
588	Ga0439452_026770	3300042010	Bacteria	1452
589	Ga0439452_033806	3300042010	Bacteria	1239
590	Ga0439452_039323	3300042010	Bacteria	1120
591	Ga0439452_043364	3300042010	Bacteria	1052
592	Ga0439455_0013513	3300042012	Bacteria	1850
593	Ga0439456_000216	3300042013	Bacteria	15824
594	Ga0439456_001500	3300042013	Bacteria	4702
595	Ga0439456_005526	3300042013	Bacteria	2567
596	Ga0439456_006657	3300042013	Bacteria	2364
597	Ga0439456_007108	3300042013	Bacteria	2292
598	Ga0439456_008743	3300042013	Bacteria	2092
599	Ga0439456_009929	3300042013	Bacteria	1964
600	Ga0439456_011950	3300042013	Bacteria	1798
601	Ga0439456_013728	3300042013	Bacteria	1687
602	Ga0439463_000144	3300042016	Bacteria	18232
603	Ga0439463_001796	3300042016	Bacteria	5582
604	Ga0439463_007514	3300042016	Bacteria	2689
605	Ga0439463_053559	3300042016	Bacteria	1030
606	Ga0450911_000003	3300042115	Bacteria	237055
607	Ga0450911_001878	3300042115	Bacteria	4440
608	Ga0450911_002731	3300042115	Bacteria	3348
609	Ga0450911_003855	3300042115	Bacteria	2555
610	Ga0450911_007633	3300042115	Bacteria	1560
611	Ga0450914_000849	3300042118	Bacteria	1681
612	Ga0450919_001193	3300042121	Bacteria	3386
613	Ga0450920_001174	3300042122	Bacteria	4298
614	Ga0450920_010188	3300042122	Bacteria	1740
615	Ga0450922_001133	3300042124	Bacteria	2644
616	Ga0450922_001315	3300042124	Bacteria	2453
617	Ga0450923_003154	3300042125	Bacteria	2455
618	Ga0450890_002526	3300042127	Bacteria	2503
619	Ga0450894_009268	3300042131	Bacteria	1276
620	Ga0450900_001127	3300042136	Bacteria	2489
621	Ga0450902_001191	3300042137	Bacteria	3487
622	Ga0450902_004999	3300042137	Bacteria	1991
623	Ga0450902_006449	3300042137	Bacteria	1797
624	Ga0450902_007615	3300042137	Bacteria	1679
625	Ga0450902_008688	3300042137	Bacteria	1588
626	Ga0450902_010070	3300042137	Bacteria	1493
627	Ga0450902_014675	3300042137	Bacteria	1267
628	Ga0450903_001115	3300042138	Bacteria	5085
629	Ga0450904_000259	3300042139	Bacteria	11397
630	Ga0450904_002022	3300042139	Bacteria	2560
631	Ga0450904_008469	3300042139	Bacteria	1015
632	Ga0450905_000502	3300042142	Bacteria	4780
633	Ga0450905_002841	3300042142	Bacteria	2246
634	Ga0450905_002992	3300042142	Bacteria	2206
635	Ga0450905_003337	3300042142	Bacteria	2106
636	Ga0450905_015256	3300042142	Bacteria	1101
637	Ga0450905_020259	3300042142	Bacteria	977
638	Ga0450906_003788	3300042145	Bacteria	3217
639	Ga0450906_005464	3300042145	Bacteria	2611
640	Ga0450906_009558	3300042145	Bacteria	1847
641	Ga0450906_011227	3300042145	Bacteria	1680
642	Ga0450907_001479	3300042146	Bacteria	5059
643	Ga0450907_005038	3300042146	Bacteria	2243
644	Ga0450907_009698	3300042146	Bacteria	1598
645	Ga0450907_017026	3300042146	Bacteria	1212
646	Ga0450910_002619	3300042147	Bacteria	2367
647	Ga0450910_003174	3300042147	Bacteria	2171
648	Ga0450910_008270	3300042147	Bacteria	1460
649	Ga0439446_0000023	3300042156	Bacteria	27788
650	Ga0439446_0000319	3300042156	Bacteria	9214
651	Ga0439446_0004535	3300042156	Bacteria	3520
652	Ga0439446_0008651	3300042156	Bacteria	2709
653	Ga0439446_0009888	3300042156	Bacteria	2560
654	Ga0439446_0012879	3300042156	Bacteria	2288
655	Ga0450908_003832	3300042184	Bacteria	2912
656	Ga0450908_004588	3300042184	Bacteria	2661
657	Ga0450908_009701	3300042184	Bacteria	1785
658	Ga0450908_012255	3300042184	Bacteria	1558
659	Ga0450909_004747	3300042185	Bacteria	1944
660	Ga0450909_005208	3300042185	Bacteria	1869
661	Ga0439434_0001113	3300042435	Bacteria	7766
662	Ga0439434_0001264	3300042435	Bacteria	7275
663	Ga0439434_0012311	3300042435	Bacteria	2531
664	Ga0439434_0014276	3300042435	Bacteria	2362
665	Ga0439434_0015630	3300042435	Bacteria	2264
666	Ga0439434_0017429	3300042435	Bacteria	2149
667	Ga0439435_0000828	3300042436	Bacteria	5273
668	Ga0439435_0002803	3300042436	Bacteria	3525
669	Ga0439444_0000509	3300042437	Bacteria	4367
670	Ga0439459_0008075	3300042438	Bacteria	1791
671	Ga0439464_0002394	3300042439	Bacteria	4608
672	Ga0439464_0011846	3300042439	Bacteria	2315
673	Ga0439464_0012850	3300042439	Bacteria	2234
674	Ga0439460_0006840	3300042461	Bacteria	2839
675	Ga0439460_0009078	3300042461	Bacteria	2518
676	Ga0439460_0009554	3300042461	Bacteria	2464
677	Ga0450916_000811	3300042530	Bacteria	2923
678	Ga0450918_003252	3300042531	Bacteria	3030
679	Ga0450918_007307	3300042531	Bacteria	1958
680	Ga0450893_0002060	3300042532	Bacteria	3131
681	Ga0450893_0008357	3300042532	Bacteria	1683
682	Ga0450901_001042	3300042533	Bacteria	3214
683	Ga0450901_001712	3300042533	Bacteria	2473
684	Ga0451577_0120172	3300042876	Bacteria	2353
685	Ga0451577_0161596	3300042876	Bacteria	2017
686	Ga0439440_0002021	3300042993	Bacteria	3776
687	Ga0453684_0079553	3300044712	Bacteria	4097
688	Ga0453684_0083069	3300044712	Bacteria	3988
689	Ga0453684_0257929	3300044712	Bacteria	1998
690	Ga0451576_0032812	3300045051	Bacteria	5522
691	Ga0451576_0310853	3300045051	Bacteria	1649
692	Ga0495617_011180	3300046452	Bacteria	3066
693	Ga0495617_020694	3300046452	Bacteria	2223
694	Ga0495617_032225	3300046452	Bacteria	1759
695	Ga0495617_032630	3300046452	Bacteria	1748
696	Ga0495617_060327	3300046452	Bacteria	1255
697	Ga0495627_003175	3300046453	Bacteria	7402
698	Ga0495627_007266	3300046453	Bacteria	4267
699	Ga0495627_011681	3300046453	Bacteria	3143
700	Ga0495627_013275	3300046453	Bacteria	2900
701	Ga0495627_013321	3300046453	Bacteria	2894
702	Ga0495627_014029	3300046453	Bacteria	2808
703	Ga0495627_030240	3300046453	Bacteria	1717
704	Ga0495627_036840	3300046453	Bacteria	1519
705	Ga0495627_051160	3300046453	Bacteria	1242
706	Ga0495592_0120246	3300046454	Bacteria	1848
707	Ga0495603_0038750	3300046455	Bacteria	2857
708	Ga0495590_0009493	3300046457	Bacteria	3693
709	Ga0495590_0013474	3300046457	Bacteria	3003
710	Ga0495590_0015237	3300046457	Bacteria	2794
711	Ga0495590_0019195	3300046457	Bacteria	2438
712	Ga0495590_0022226	3300046457	Bacteria	2243
713	Ga0495590_0042619	3300046457	Bacteria	1582
714	Ga0495590_0049555	3300046457	Bacteria	1465
715	Ga0495591_000469	3300046458	Bacteria	32137
716	Ga0495591_001094	3300046458	Bacteria	18055
717	Ga0495591_001858	3300046458	Bacteria	12430
718	Ga0495591_003657	3300046458	Bacteria	7825
719	Ga0495591_005742	3300046458	Bacteria	5657
720	Ga0495591_008389	3300046458	Bacteria	4235
721	Ga0495591_011974	3300046458	Bacteria	3253
722	Ga0495591_013730	3300046458	Bacteria	2946
723	Ga0495591_015398	3300046458	Bacteria	2703
724	Ga0495591_018426	3300046458	Bacteria	2368
725	Ga0495591_020543	3300046458	Bacteria	2178
726	Ga0495591_032041	3300046458	Bacteria	1569
727	Ga0495591_032202	3300046458	Bacteria	1563
728	Ga0495591_033383	3300046458	Bacteria	1523
729	Ga0495591_048266	3300046458	Bacteria	1174
730	Ga0495591_048657	3300046458	Bacteria	1168
731	Ga0495629_0093558	3300046459	Bacteria	2097
732	Ga0495629_0143484	3300046459	Bacteria	1661
733	Ga0495638_0019976	3300046460	Bacteria	4428
734	Ga0495638_0039235	3300046460	Bacteria	3006
735	Ga0495638_0040288	3300046460	Bacteria	2960
736	Ga0495638_0040325	3300046460	Bacteria	2959
737	Ga0495638_0041577	3300046460	Bacteria	2907
738	Ga0495638_0082152	3300046460	Bacteria	1954
739	Ga0495638_0082315	3300046460	Bacteria	1952
740	Ga0495638_0090259	3300046460	Bacteria	1847
741	Ga0495638_0095474	3300046460	Bacteria	1785
742	Ga0495638_0097501	3300046460	Bacteria	1762
743	Ga0495638_0097502	3300046460	Bacteria	1762
744	Ga0495638_0100901	3300046460	Bacteria	1726
745	Ga0495653_0005671	3300046463	Bacteria	10194
746	Ga0495653_0012238	3300046463	Bacteria	6999
747	Ga0495650_0000573	3300046471	Bacteria	51370
748	Ga0495650_0001099	3300046471	Bacteria	29653
749	Ga0495650_0007109	3300046471	Bacteria	6799
750	Ga0495650_0019350	3300046471	Bacteria	3354
751	Ga0495650_0022462	3300046471	Bacteria	3025
752	Ga0495650_0024331	3300046471	Bacteria	2861
753	Ga0495650_0024500	3300046471	Bacteria	2847
754	Ga0495650_0029344	3300046471	Bacteria	2508
755	Ga0495650_0030327	3300046471	Bacteria	2451
756	Ga0495650_0036603	3300046471	Bacteria	2145
757	Ga0495650_0037944	3300046471	Bacteria	2091
758	Ga0495650_0039499	3300046471	Bacteria	2036
759	Ga0495650_0041507	3300046471	Bacteria	1966
760	Ga0495650_0047326	3300046471	Bacteria	1799
761	Ga0495582_0006380	3300046473	Bacteria	6557
762	Ga0495605_0000278	3300046474	Bacteria	57625
763	Ga0495605_0005628	3300046474	Bacteria	7280
764	Ga0495605_0010941	3300046474	Bacteria	5068
765	Ga0495605_0019402	3300046474	Bacteria	3630
766	Ga0495605_0019856	3300046474	Bacteria	3579
767	Ga0495605_0028461	3300046474	Bacteria	2884
768	Ga0495605_0029972	3300046474	Bacteria	2794
769	Ga0495605_0030876	3300046474	Bacteria	2742
770	Ga0495605_0032229	3300046474	Bacteria	2669
771	Ga0495605_0037296	3300046474	Bacteria	2446
772	Ga0495605_0046179	3300046474	Bacteria	2142
773	Ga0495605_0057240	3300046474	Bacteria	1877
774	Ga0495605_0066069	3300046474	Bacteria	1719
775	Ga0495605_0115475	3300046474	Bacteria	1221
776	Ga0495605_0158818	3300046474	Bacteria	1004
777	Ga0495639_0006484	3300046475	Bacteria	5031
778	Ga0495639_0021868	3300046475	Bacteria	2802
779	Ga0495639_0193236	3300046475	Bacteria	994
780	Ga0495584_0008908	3300046491	Bacteria	5185
781	Ga0495584_0022372	3300046491	Bacteria	3207
782	Ga0495584_0032245	3300046491	Bacteria	2652
783	Ga0495584_0034260	3300046491	Bacteria	2569
784	Ga0495584_0036595	3300046491	Bacteria	2479
785	Ga0495584_0041162	3300046491	Bacteria	2332
786	Ga0495584_0044646	3300046491	Bacteria	2236
787	Ga0495584_0045953	3300046491	Bacteria	2203
788	Ga0495584_0059112	3300046491	Bacteria	1928
789	Ga0495584_0097063	3300046491	Bacteria	1488
790	Ga0495584_0174463	3300046491	Bacteria	1092
791	Ga0495585_0003475	3300046492	Bacteria	10640
792	Ga0495585_0019268	3300046492	Bacteria	3935
793	Ga0495585_0023785	3300046492	Bacteria	3515
794	Ga0495585_0030323	3300046492	Bacteria	3076
795	Ga0495585_0041195	3300046492	Bacteria	2590
796	Ga0495585_0061162	3300046492	Bacteria	2071
797	Ga0495585_0072796	3300046492	Bacteria	1871
798	Ga0495585_0080819	3300046492	Bacteria	1761
799	Ga0495585_0094130	3300046492	Bacteria	1610
800	Ga0495585_0119386	3300046492	Bacteria	1396
801	Ga0495594_0001700	3300046499	Bacteria	11418
802	Ga0495594_0040221	3300046499	Bacteria	2557
803	Ga0495594_0073221	3300046499	Bacteria	1906
804	Ga0495594_0083977	3300046499	Bacteria	1780
805	Ga0495594_0232597	3300046499	Bacteria	1051
806	Ga0495596_0003330	3300046500	Bacteria	8181
807	Ga0495596_0004458	3300046500	Bacteria	6811
808	Ga0495596_0015727	3300046500	Bacteria	3159
809	Ga0495607_0007038	3300046501	Bacteria	7821
810	Ga0495607_0008307	3300046501	Bacteria	7099
811	Ga0495607_0008537	3300046501	Bacteria	7000
812	Ga0495607_0008688	3300046501	Bacteria	6925
813	Ga0495607_0025685	3300046501	Bacteria	3661
814	Ga0495607_0028356	3300046501	Bacteria	3455
815	Ga0495607_0035414	3300046501	Bacteria	3019
816	Ga0495607_0038039	3300046501	Bacteria	2885
817	Ga0495607_0038872	3300046501	Bacteria	2846
818	Ga0495607_0039142	3300046501	Bacteria	2834
819	Ga0495607_0039681	3300046501	Bacteria	2810
820	Ga0495607_0053263	3300046501	Bacteria	2339
821	Ga0495607_0055153	3300046501	Bacteria	2287
822	Ga0495607_0062877	3300046501	Bacteria	2102
823	Ga0495607_0071940	3300046501	Bacteria	1926
824	Ga0495607_0081355	3300046501	Bacteria	1779
825	Ga0495607_0081632	3300046501	Bacteria	1775
826	Ga0495607_0081784	3300046501	Bacteria	1773
827	Ga0495583_0000504	3300046506	Bacteria	56210
828	Ga0495583_0001876	3300046506	Bacteria	19557
829	Ga0495583_0005229	3300046506	Bacteria	8908
830	Ga0495583_0011536	3300046506	Bacteria	5067
831	Ga0495583_0018657	3300046506	Bacteria	3647
832	Ga0495583_0022809	3300046506	Bacteria	3183
833	Ga0495583_0031113	3300046506	Bacteria	2591
834	Ga0495583_0039867	3300046506	Bacteria	2209
835	Ga0495583_0063392	3300046506	Bacteria	1643
836	Ga0495583_0096097	3300046506	Bacteria	1270
837	Ga0495606_0000785	3300046507	Bacteria	48544
838	Ga0495606_0000946	3300046507	Bacteria	42763
839	Ga0495606_0008698	3300046507	Bacteria	8745
840	Ga0495606_0023688	3300046507	Bacteria	4442
841	Ga0495606_0036981	3300046507	Bacteria	3319
842	Ga0495606_0038295	3300046507	Bacteria	3245
843	Ga0495606_0041717	3300046507	Bacteria	3075
844	Ga0495606_0044146	3300046507	Bacteria	2966
845	Ga0495606_0046566	3300046507	Bacteria	2865
846	Ga0495606_0049392	3300046507	Bacteria	2759
847	Ga0495606_0055116	3300046507	Bacteria	2572
848	Ga0495606_0058779	3300046507	Bacteria	2469
849	Ga0495606_0088457	3300046507	Bacteria	1909
850	Ga0495606_0106398	3300046507	Bacteria	1698
851	Ga0495606_0212713	3300046507	Bacteria	1094
852	Ga0495610_0002116	3300046512	Bacteria	16918
853	Ga0495610_0002225	3300046512	Bacteria	16407
854	Ga0495610_0011816	3300046512	Bacteria	5305
855	Ga0495610_0021921	3300046512	Bacteria	3504
856	Ga0495610_0024761	3300046512	Bacteria	3233
857	Ga0495610_0029359	3300046512	Bacteria	2896
858	Ga0495610_0029702	3300046512	Bacteria	2874
859	Ga0495610_0030607	3300046512	Bacteria	2817
860	Ga0495610_0039637	3300046512	Bacteria	2380
861	Ga0495610_0041485	3300046512	Bacteria	2310
862	Ga0495610_0052627	3300046512	Bacteria	1975
863	Ga0495610_0070809	3300046512	Bacteria	1627
864	Ga0495610_0071420	3300046512	Bacteria	1618
865	Ga0495610_0073771	3300046512	Bacteria	1584
866	Ga0495610_0077131	3300046512	Bacteria	1539
867	Ga0495610_0138982	3300046512	Bacteria	1047
868	Ga0495616_0011046	3300046513	Bacteria	5188
869	Ga0495616_0012877	3300046513	Bacteria	4731
870	Ga0495616_0032453	3300046513	Bacteria	2727
871	Ga0495616_0033462	3300046513	Bacteria	2677
872	Ga0495616_0036927	3300046513	Bacteria	2517
873	Ga0495616_0040310	3300046513	Bacteria	2386
874	Ga0495616_0050985	3300046513	Bacteria	2066
875	Ga0495616_0086332	3300046513	Bacteria	1492
876	Ga0495616_0095863	3300046513	Bacteria	1397
877	Ga0495616_0100395	3300046513	Bacteria	1358
878	Ga0495620_0000033	3300046515	Bacteria	118157
879	Ga0495620_0000153	3300046515	Bacteria	56187
880	Ga0495620_0004296	3300046515	Bacteria	8057
881	Ga0495620_0015228	3300046515	Bacteria	3887
882	Ga0495620_0021827	3300046515	Bacteria	3099
883	Ga0495620_0024744	3300046515	Bacteria	2851
884	Ga0495620_0025919	3300046515	Bacteria	2765
885	Ga0495620_0029262	3300046515	Bacteria	2551
886	Ga0495620_0039768	3300046515	Bacteria	2075
887	Ga0495620_0039956	3300046515	Bacteria	2069
888	Ga0495620_0060647	3300046515	Bacteria	1576
889	Ga0495628_0184824	3300046516	Bacteria	1575
890	Ga0495630_0146862	3300046517	Bacteria	1793
891	Ga0495630_0158102	3300046517	Bacteria	1725
892	Ga0495631_0001987	3300046518	Bacteria	11957
893	Ga0495631_0004735	3300046518	Bacteria	7189
894	Ga0495631_0005228	3300046518	Bacteria	6829
895	Ga0495631_0006238	3300046518	Bacteria	6176
896	Ga0495631_0019200	3300046518	Bacteria	3207
897	Ga0495631_0042196	3300046518	Bacteria	2016
898	Ga0495631_0050828	3300046518	Bacteria	1812
899	Ga0495631_0063809	3300046518	Bacteria	1595
900	Ga0495631_0087769	3300046518	Bacteria	1339
901	Ga0495631_0117760	3300046518	Bacteria	1142
902	Ga0495631_0134281	3300046518	Bacteria	1063
903	Ga0495632_0000399	3300046519	Bacteria	40815
904	Ga0495632_0008620	3300046519	Bacteria	6229
905	Ga0495632_0009663	3300046519	Bacteria	5791
906	Ga0495632_0010652	3300046519	Bacteria	5425
907	Ga0495632_0013213	3300046519	Bacteria	4720
908	Ga0495632_0015879	3300046519	Bacteria	4205
909	Ga0495632_0018728	3300046519	Bacteria	3791
910	Ga0495632_0022168	3300046519	Bacteria	3408
911	Ga0495632_0029078	3300046519	Bacteria	2880
912	Ga0495632_0030360	3300046519	Bacteria	2805
913	Ga0495632_0041680	3300046519	Bacteria	2305
914	Ga0495632_0041739	3300046519	Bacteria	2303
915	Ga0495632_0050337	3300046519	Bacteria	2054
916	Ga0495632_0068767	3300046519	Bacteria	1705
917	Ga0495632_0078893	3300046519	Bacteria	1572
918	Ga0495632_0086628	3300046519	Bacteria	1489
919	Ga0495632_0089435	3300046519	Bacteria	1461
920	Ga0495632_0089988	3300046519	Bacteria	1456
921	Ga0495632_0100385	3300046519	Bacteria	1364
922	Ga0495637_0000314	3300046520	Bacteria	37706
923	Ga0495637_0001391	3300046520	Bacteria	14451
924	Ga0495637_0001991	3300046520	Bacteria	11557
925	Ga0495637_0003615	3300046520	Bacteria	8188
926	Ga0495637_0006841	3300046520	Bacteria	5701
927	Ga0495637_0008252	3300046520	Bacteria	5120
928	Ga0495637_0012810	3300046520	Bacteria	4000
929	Ga0495637_0027599	3300046520	Bacteria	2538
930	Ga0495637_0031582	3300046520	Bacteria	2341
931	Ga0495637_0032050	3300046520	Bacteria	2318
932	Ga0495637_0036050	3300046520	Bacteria	2157
933	Ga0495637_0041391	3300046520	Bacteria	1976
934	Ga0495637_0043390	3300046520	Bacteria	1919
935	Ga0495637_0047023	3300046520	Bacteria	1823
936	Ga0495637_0051858	3300046520	Bacteria	1714
937	Ga0495637_0052231	3300046520	Bacteria	1707
938	Ga0495637_0099987	3300046520	Bacteria	1134
939	Ga0495637_0113456	3300046520	Bacteria	1048
940	Ga0495637_0119453	3300046520	Bacteria	1015
941	Ga0495637_0121260	3300046520	Bacteria	1005
942	Ga0495643_0000652	3300046522	Bacteria	41014
943	Ga0495643_0001045	3300046522	Bacteria	28023
944	Ga0495643_0005078	3300046522	Bacteria	9003
945	Ga0495643_0038344	3300046522	Bacteria	2624
946	Ga0495643_0044842	3300046522	Bacteria	2401
947	Ga0495643_0050868	3300046522	Bacteria	2230
948	Ga0495643_0053601	3300046522	Bacteria	2161
949	Ga0495643_0084883	3300046522	Bacteria	1642
950	Ga0495643_0129366	3300046522	Bacteria	1269
951	Ga0495644_0005633	3300046523	Bacteria	4884
952	Ga0495644_0014540	3300046523	Bacteria	3014
953	Ga0495644_0018306	3300046523	Bacteria	2676
954	Ga0495644_0020048	3300046523	Bacteria	2551
955	Ga0495644_0033396	3300046523	Bacteria	1944
956	Ga0495644_0038334	3300046523	Bacteria	1807
957	Ga0495648_0004127	3300046524	Bacteria	12504
958	Ga0495648_0007937	3300046524	Bacteria	8418
959	Ga0495648_0007987	3300046524	Bacteria	8394
960	Ga0495648_0010554	3300046524	Bacteria	7023
961	Ga0495648_0025139	3300046524	Bacteria	4037
962	Ga0495648_0026803	3300046524	Bacteria	3871
963	Ga0495648_0034130	3300046524	Bacteria	3315
964	Ga0495648_0043355	3300046524	Bacteria	2821
965	Ga0495648_0044257	3300046524	Bacteria	2780
966	Ga0495648_0047059	3300046524	Bacteria	2669
967	Ga0495648_0049301	3300046524	Bacteria	2582
968	Ga0495648_0056447	3300046524	Bacteria	2362
969	Ga0495648_0058332	3300046524	Bacteria	2308
970	Ga0495648_0084164	3300046524	Bacteria	1800
971	Ga0495648_0137774	3300046524	Bacteria	1288
972	Ga0495648_0149733	3300046524	Bacteria	1219
973	Ga0495648_0162968	3300046524	Bacteria	1150
974	Ga0495666_0005314	3300046526	Bacteria	6492
975	Ga0495666_0017110	3300046526	Bacteria	3611
976	Ga0495666_0039225	3300046526	Bacteria	2300
977	Ga0495666_0102148	3300046526	Bacteria	1350
978	Ga0495642_0000568	3300046528	Bacteria	18555
979	Ga0495642_0018573	3300046528	Bacteria	2721
980	Ga0495642_0022755	3300046528	Bacteria	2470
981	Ga0495652_0271836	3300046529	Bacteria	1245
982	Ga0495654_0011677	3300046530	Bacteria	4744
983	Ga0495654_0014370	3300046530	Bacteria	4212
984	Ga0495654_0017526	3300046530	Bacteria	3764
985	Ga0495654_0018664	3300046530	Bacteria	3632
986	Ga0495654_0024932	3300046530	Bacteria	3085
987	Ga0495654_0025607	3300046530	Bacteria	3038
988	Ga0495654_0027961	3300046530	Bacteria	2886
989	Ga0495654_0028043	3300046530	Bacteria	2881
990	Ga0495654_0029407	3300046530	Bacteria	2802
991	Ga0495654_0031952	3300046530	Bacteria	2670
992	Ga0495654_0035575	3300046530	Bacteria	2506
993	Ga0495654_0040206	3300046530	Bacteria	2331
994	Ga0495654_0059458	3300046530	Bacteria	1840
995	Ga0495654_0061113	3300046530	Bacteria	1810
996	Ga0495654_0073088	3300046530	Bacteria	1622
997	Ga0495654_0079646	3300046530	Bacteria	1538
998	Ga0495654_0085597	3300046530	Bacteria	1470
999	Ga0495654_0101554	3300046530	Bacteria	1323
1000	Ga0495654_0141538	3300046530	Bacteria	1071
1001	Ga0495654_0148992	3300046530	Bacteria	1036
1002	Ga0495586_0012483	3300046535	Bacteria	4506
1003	Ga0495587_0006263	3300046536	Bacteria	7769
1004	Ga0495587_0031576	3300046536	Bacteria	3205
1005	Ga0495587_0233839	3300046536	Bacteria	1035
1006	Ga0495598_0083897	3300046537	Bacteria	1027
1007	Ga0495609_0000166	3300046538	Bacteria	69064
1008	Ga0495609_0000646	3300046538	Bacteria	27115
1009	Ga0495609_0015024	3300046538	Bacteria	3628
1010	Ga0495609_0020877	3300046538	Bacteria	3022
1011	Ga0495609_0024256	3300046538	Bacteria	2783
1012	Ga0495609_0025547	3300046538	Bacteria	2707
1013	Ga0495609_0027068	3300046538	Bacteria	2622
1014	Ga0495609_0131025	3300046538	Bacteria	1074
1015	Ga0495621_0001452	3300046539	Bacteria	6143
1016	Ga0495597_0008030	3300046542	Bacteria	5311
1017	Ga0495597_0015583	3300046542	Bacteria	3597
1018	Ga0495597_0017991	3300046542	Bacteria	3320
1019	Ga0495597_0020065	3300046542	Bacteria	3119
1020	Ga0495597_0022166	3300046542	Bacteria	2948
1021	Ga0495597_0026045	3300046542	Bacteria	2688
1022	Ga0495597_0035889	3300046542	Bacteria	2234
1023	Ga0495597_0038807	3300046542	Bacteria	2133
1024	Ga0495597_0039975	3300046542	Bacteria	2097
1025	Ga0495597_0045035	3300046542	Bacteria	1960
1026	Ga0495597_0073416	3300046542	Bacteria	1470
1027	Ga0495597_0074512	3300046542	Bacteria	1457
1028	Ga0495597_0109774	3300046542	Bacteria	1157
1029	Ga0495597_0135219	3300046542	Bacteria	1020
1030	Ga0495645_0124255	3300046543	Bacteria	1814
1031	Ga0495645_0137576	3300046543	Bacteria	1707
1032	Ga0495622_0003253	3300046557	Bacteria	7690
1033	Ga0495622_0007840	3300046557	Bacteria	4957
1034	Ga0495622_0024700	3300046557	Bacteria	2806
1035	Ga0495622_0048416	3300046557	Bacteria	1975
1036	Ga0495622_0101353	3300046557	Bacteria	1319
1037	Ga0495633_0020815	3300046558	Bacteria	3292
1038	Ga0495633_0024552	3300046558	Bacteria	2977
1039	Ga0495667_0149234	3300046559	Bacteria	1505
1040	Ga0495656_0044305	3300046615	Bacteria	1872
1041	Ga0495668_0023212	3300046616	Bacteria	3540
1042	Ga0495668_0029916	3300046616	Bacteria	3076
1043	Ga0495668_0030146	3300046616	Bacteria	3064
1044	Ga0495668_0086278	3300046616	Bacteria	1721
1045	Ga0495634_0029174	3300046642	Bacteria	3820
1046	Ga0495611_0000737	3300046648	Bacteria	18459
1047	Ga0495611_0002309	3300046648	Bacteria	8818
1048	Ga0495611_0008005	3300046648	Bacteria	4489
1049	Ga0495611_0025974	3300046648	Bacteria	2554
1050	Ga0495611_0038372	3300046648	Bacteria	2130
1051	Ga0495611_0099630	3300046648	Bacteria	1348
1052	Ga0495625_0000499	3300046660	Bacteria	58578
1053	Ga0495625_0034212	3300046660	Bacteria	3751
1054	Ga0495625_0041634	3300046660	Bacteria	3342
1055	Ga0495625_0053479	3300046660	Bacteria	2887
1056	Ga0495625_0054786	3300046660	Bacteria	2847
1057	Ga0495625_0059397	3300046660	Bacteria	2713
1058	Ga0495625_0063093	3300046660	Bacteria	2617
1059	Ga0495625_0069503	3300046660	Bacteria	2474
1060	Ga0495625_0080989	3300046660	Bacteria	2260
1061	Ga0495625_0102306	3300046660	Bacteria	1966
1062	Ga0495625_0128224	3300046660	Bacteria	1720
1063	Ga0495635_0007500	3300046663	Bacteria	7612
1064	Ga0495635_0014372	3300046663	Bacteria	5538
1065	Ga0495659_0006267	3300046664	Bacteria	3759
1066	Ga0495659_0020084	3300046664	Bacteria	2240
1067	Ga0495661_0000277	3300046665	Bacteria	58877
1068	Ga0495661_0000294	3300046665	Bacteria	56661
1069	Ga0495661_0000320	3300046665	Bacteria	53065
1070	Ga0495661_0000340	3300046665	Bacteria	51118
1071	Ga0495661_0020844	3300046665	Bacteria	4273
1072	Ga0495661_0043736	3300046665	Bacteria	2751
1073	Ga0495661_0054505	3300046665	Bacteria	2400
1074	Ga0495661_0054547	3300046665	Bacteria	2399
1075	Ga0495661_0100323	3300046665	Bacteria	1630
1076	Ga0495588_0040869	3300046674	Bacteria	2366
1077	Ga0495588_0041253	3300046674	Bacteria	2356
1078	Ga0495657_0319420	3300046675	Bacteria	923
1079	Ga0495623_0014876	3300046679	Bacteria	5030
1080	Ga0495623_0049988	3300046679	Bacteria	2649
1081	Ga0495646_0029654	3300046680	Bacteria	3419
1082	Ga0495646_0044959	3300046680	Bacteria	2698
1083	Ga0495646_0073795	3300046680	Bacteria	2003
1084	Ga0495646_0127256	3300046680	Bacteria	1436
1085	Ga0495669_0010614	3300046684	Bacteria	3894
1086	Ga0495613_0076344	3300046689	Bacteria	2438
1087	Ga0495624_0031110	3300046690	Bacteria	3473
1088	Ga0495670_0001901	3300046691	Bacteria	10295
1089	Ga0495670_0006296	3300046691	Bacteria	5826
1090	Ga0495670_0010738	3300046691	Bacteria	4500
1091	Ga0495670_0034464	3300046691	Bacteria	2522
1092	Ga0495670_0035187	3300046691	Bacteria	2495
1093	Ga0495670_0060786	3300046691	Bacteria	1898
1094	Ga0495670_0117465	3300046691	Bacteria	1380
1095	Ga0495671_0003279	3300046692	Bacteria	10019
1096	Ga0495671_0010712	3300046692	Bacteria	5071
1097	Ga0495671_0011516	3300046692	Bacteria	4860
1098	Ga0495671_0029198	3300046692	Bacteria	2834
1099	Ga0495671_0031597	3300046692	Bacteria	2706
1100	Ga0495671_0033378	3300046692	Bacteria	2622
1101	Ga0495671_0034826	3300046692	Bacteria	2558
1102	Ga0495671_0049253	3300046692	Bacteria	2100
1103	Ga0495671_0052545	3300046692	Bacteria	2025
1104	Ga0495671_0054568	3300046692	Bacteria	1981
1105	Ga0495671_0056634	3300046692	Bacteria	1940
1106	Ga0495671_0059568	3300046692	Bacteria	1886
1107	Ga0495671_0064402	3300046692	Bacteria	1804
1108	Ga0495671_0072229	3300046692	Bacteria	1694
1109	Ga0495671_0087307	3300046692	Bacteria	1527
1110	Ga0495671_0167565	3300046692	Bacteria	1068
1111	Ga0495649_0005996	3300046694	Bacteria	7612
1112	Ga0495649_0019233	3300046694	Bacteria	3837
1113	Ga0495649_0030549	3300046694	Bacteria	2975
1114	Ga0495649_0031598	3300046694	Bacteria	2918
1115	Ga0495649_0032479	3300046694	Bacteria	2874
1116	Ga0495649_0039154	3300046694	Bacteria	2599
1117	Ga0495649_0047427	3300046694	Bacteria	2336
1118	Ga0495649_0050007	3300046694	Bacteria	2269
1119	Ga0495649_0059353	3300046694	Bacteria	2059
1120	Ga0495649_0075677	3300046694	Bacteria	1802
1121	Ga0495649_0076264	3300046694	Bacteria	1794
1122	Ga0495649_0078809	3300046694	Bacteria	1762
1123	Ga0495649_0194917	3300046694	Bacteria	1053
1124	Ga0495589_0011950	3300046794	Bacteria	4501
1125	Ga0495589_0016164	3300046794	Bacteria	3834
1126	Ga0495589_0028315	3300046794	Bacteria	2828
1127	Ga0495589_0036250	3300046794	Bacteria	2472
1128	Ga0495589_0036925	3300046794	Bacteria	2448
1129	Ga0495589_0042713	3300046794	Bacteria	2258
1130	Ga0495589_0066804	3300046794	Bacteria	1760
1131	Ga0495589_0069761	3300046794	Bacteria	1718
1132	Ga0495589_0073189	3300046794	Bacteria	1672
1133	Ga0495589_0080239	3300046794	Bacteria	1587
1134	Ga0495600_0015339	3300046809	Bacteria	4842
1135	Ga0495600_0055888	3300046809	Bacteria	2577
1136	Ga0495660_0002839	3300046810	Bacteria	10887
1137	Ga0495660_0007029	3300046810	Bacteria	6637
1138	Ga0495660_0029105	3300046810	Bacteria	3118
1139	Ga0495660_0030313	3300046810	Bacteria	3047
1140	Ga0495660_0040413	3300046810	Bacteria	2585
1141	Ga0495660_0041038	3300046810	Bacteria	2563
1142	Ga0495660_0045138	3300046810	Bacteria	2420
1143	Ga0495660_0046470	3300046810	Bacteria	2380
1144	Ga0495660_0058387	3300046810	Bacteria	2078
1145	Ga0495660_0072639	3300046810	Bacteria	1821
1146	Ga0495660_0096142	3300046810	Bacteria	1531
1147	Ga0495660_0103081	3300046810	Bacteria	1466
1148	Ga0495660_0111430	3300046810	Bacteria	1395
1149	Ga0495660_0128793	3300046810	Bacteria	1272
1150	Ga0495581_0033208	3300047315	Bacteria	2988
1151	Ga0495604_0014150	3300047317	Bacteria	6361
1152	Ga0495604_0059158	3300047317	Bacteria	2938
1153	Ga0495604_0125708	3300047317	Bacteria	1849
1154	Ga0495674_0060181	3300047319	Bacteria	3314
1155	Ga0495672_0011183	3300047320	Bacteria	6343
1156	Ga0495672_0013024	3300047320	Bacteria	5757
1157	Ga0495672_0014708	3300047320	Bacteria	5343
1158	Ga0495672_0016203	3300047320	Bacteria	5034
1159	Ga0495672_0018721	3300047320	Bacteria	4586
1160	Ga0495672_0039050	3300047320	Bacteria	2890
1161	Ga0495672_0039272	3300047320	Bacteria	2878
1162	Ga0495672_0039962	3300047320	Bacteria	2848
1163	Ga0495672_0041839	3300047320	Bacteria	2767
1164	Ga0495672_0042952	3300047320	Bacteria	2721
1165	Ga0495672_0053207	3300047320	Bacteria	2373
1166	Ga0495672_0053632	3300047320	Bacteria	2361
1167	Ga0495672_0055007	3300047320	Bacteria	2323
1168	Ga0495672_0072136	3300047320	Bacteria	1951
1169	Ga0495672_0124869	3300047320	Bacteria	1362
1170	Ga0495672_0144109	3300047320	Bacteria	1241
1171	Ga0495676_0000125	3300047321	Bacteria	58716
1172	Ga0495676_0015603	3300047321	Bacteria	6756
1173	Ga0495676_0063334	3300047321	Bacteria	2882
1174	Ga0495680_0011250	3300047322	Bacteria	7932
1175	Ga0495680_0081430	3300047322	Bacteria	2444
1176	Ga0495680_0099922	3300047322	Bacteria	2162
1177	Ga0495680_0136212	3300047322	Bacteria	1800
1178	Ga0495680_0158133	3300047322	Bacteria	1647
1179	Ga0495680_0273720	3300047322	Bacteria	1191
1180	Ga0495683_0000016	3300047323	Bacteria	191396
1181	Ga0495683_0000196	3300047323	Bacteria	57478
1182	Ga0495683_0003701	3300047323	Bacteria	8852
1183	Ga0495683_0017656	3300047323	Bacteria	3696
1184	Ga0495683_0027958	3300047323	Bacteria	2883
1185	Ga0495683_0045984	3300047323	Bacteria	2191
1186	Ga0495683_0055886	3300047323	Bacteria	1964
1187	Ga0495683_0065181	3300047323	Bacteria	1797
1188	Ga0495683_0077216	3300047323	Bacteria	1628
1189	Ga0495683_0162830	3300047323	Bacteria	1030
1190	Ga0495687_012696	3300047443	Bacteria	4441
1191	Ga0495687_017192	3300047443	Bacteria	3617
1192	Ga0495687_024619	3300047443	Bacteria	2858
1193	Ga0495675_0010227	3300047444	Bacteria	5855
1194	Ga0495675_0019889	3300047444	Bacteria	4266
1195	Ga0495677_0021242	3300047445	Bacteria	2352
1196	Ga0495679_000531	3300047446	Bacteria	26926
1197	Ga0495679_000821	3300047446	Bacteria	19743
1198	Ga0495679_013256	3300047446	Bacteria	3103
1199	Ga0495679_016702	3300047446	Bacteria	2649
1200	Ga0495679_018379	3300047446	Bacteria	2482
1201	Ga0495679_022885	3300047446	Bacteria	2130
1202	Ga0495679_030559	3300047446	Bacteria	1747
1203	Ga0495679_035173	3300047446	Bacteria	1589
1204	Ga0495679_050311	3300047446	Bacteria	1253
1205	Ga0495673_0004454	3300047469	Bacteria	8759
1206	Ga0495673_0010567	3300047469	Bacteria	5010
1207	Ga0495673_0013993	3300047469	Bacteria	4188
1208	Ga0495673_0015636	3300047469	Bacteria	3903
1209	Ga0495673_0017431	3300047469	Bacteria	3647
1210	Ga0495673_0022590	3300047469	Bacteria	3079
1211	Ga0495673_0024097	3300047469	Bacteria	2947
1212	Ga0495673_0027918	3300047469	Bacteria	2678
1213	Ga0495673_0029966	3300047469	Bacteria	2562
1214	Ga0495673_0046873	3300047469	Bacteria	1912
1215	Ga0495673_0053945	3300047469	Bacteria	1750
1216	Ga0495673_0065928	3300047469	Bacteria	1536
1217	Ga0495673_0068547	3300047469	Bacteria	1498
1218	Ga0495673_0075723	3300047469	Bacteria	1405
1219	Ga0495681_0005670	3300047470	Bacteria	8315
1220	Ga0495681_0018133	3300047470	Bacteria	3885
1221	Ga0495681_0020084	3300047470	Bacteria	3632
1222	Ga0495681_0021642	3300047470	Bacteria	3460
1223	Ga0495681_0022675	3300047470	Bacteria	3353
1224	Ga0495681_0024740	3300047470	Bacteria	3153
1225	Ga0495681_0025875	3300047470	Bacteria	3065
1226	Ga0495681_0026354	3300047470	Bacteria	3027
1227	Ga0495681_0032922	3300047470	Bacteria	2603
1228	Ga0495681_0033896	3300047470	Bacteria	2550
1229	Ga0495681_0035167	3300047470	Bacteria	2489
1230	Ga0495681_0040299	3300047470	Bacteria	2275
1231	Ga0495681_0041963	3300047470	Bacteria	2218
1232	Ga0495681_0044834	3300047470	Bacteria	2121
1233	Ga0495681_0050404	3300047470	Bacteria	1962
1234	Ga0495681_0053648	3300047470	Bacteria	1886
1235	Ga0495681_0091476	3300047470	Bacteria	1342
1236	Ga0495684_0074324	3300047471	Bacteria	2582
1237	Ga0495684_0167075	3300047471	Bacteria	1638
1238	Ga0495686_0050820	3300047472	Bacteria	2603
1239	Ga0495686_0053812	3300047472	Bacteria	2521
1240	Ga0495686_0059428	3300047472	Bacteria	2380
1241	Ga0495686_0060626	3300047472	Bacteria	2351
1242	Ga0495686_0086388	3300047472	Bacteria	1909
1243	Ga0495686_0105386	3300047472	Bacteria	1696
1244	Ga0495593_0033060	3300047673	Bacteria	2817
1245	Ga0495593_0067590	3300047673	Bacteria	1860
1246	Ga0495593_0078997	3300047673	Bacteria	1703
1247	Ga0495602_0064252	3300048088	Bacteria	3174
1248	Ga0495626_0000283	3300048091	Bacteria	55345
1249	Ga0495626_0002041	3300048091	Bacteria	14781
1250	Ga0495626_0004879	3300048091	Bacteria	8068
1251	Ga0495626_0012067	3300048091	Bacteria	4545
1252	Ga0495626_0017521	3300048091	Bacteria	3613
1253	Ga0495626_0021166	3300048091	Bacteria	3229
1254	Ga0495626_0024702	3300048091	Bacteria	2943
1255	Ga0495626_0032780	3300048091	Bacteria	2492
1256	Ga0495626_0050863	3300048091	Bacteria	1913
1257	Ga0495626_0055923	3300048091	Bacteria	1807
1258	Ga0495626_0064751	3300048091	Bacteria	1655
1259	Ga0495626_0090404	3300048091	Bacteria	1346
1260	Ga0495626_0132246	3300048091	Bacteria	1064
1261	Ga0496102_0010442	3300048905	Bacteria	7988
1262	Ga0496102_0072952	3300048905	Bacteria	3155
1263	Ga0496102_0358043	3300048905	Bacteria	1374
1264	Ga0496103_0023758	3300048906	Bacteria	3696
1265	Ga0496104_0043406	3300048907	Bacteria	4223
1266	Ga0496105_0002839	3300048908	Bacteria	12678
1267	Ga0496105_0119120	3300048908	Bacteria	2178
1268	Ga0496106_0355175	3300048909	Bacteria	1177
1269	Ga0496109_0036107	3300048912	Bacteria	4461
1270	Ga0496110_0129451	3300048913	Bacteria	2278
1271	Ga0496110_0160023	3300048913	Bacteria	2041
1272	Ga0496110_0191097	3300048913	Bacteria	1859
1273	Ga0496111_0075006	3300048914	Bacteria	2464
1274	Ga0496111_0123938	3300048914	Bacteria	1910
1275	Ga0496112_0001690	3300048915	Bacteria	17198
1276	Ga0496113_0429568	3300048916	Bacteria	1061
1277	Ga0496114_0001490	3300048917	Bacteria	17773
1278	Ga0496114_0022231	3300048917	Bacteria	5167
1279	Ga0496114_0064863	3300048917	Bacteria	3060
1280	Ga0496115_0121469	3300048918	Bacteria	2150
1281	Ga0496116_0000401	3300048919	Bacteria	62910
1282	Ga0496116_0025141	3300048919	Bacteria	4384
1283	Ga0496116_0030490	3300048919	Bacteria	3872
1284	Ga0496116_0045565	3300048919	Bacteria	2967
1285	Ga0496116_0049206	3300048919	Bacteria	2821
1286	Ga0496116_0061993	3300048919	Bacteria	2417
1287	Ga0496116_0064174	3300048919	Bacteria	2361
1288	Ga0496117_0003306	3300048920	Bacteria	18852
1289	Ga0496117_0004235	3300048920	Bacteria	16011
1290	Ga0496117_0008992	3300048920	Bacteria	9400
1291	Ga0496117_0029128	3300048920	Bacteria	4262
1292	Ga0496117_0046001	3300048920	Bacteria	3144
1293	Ga0496117_0053402	3300048920	Bacteria	2839
1294	Ga0496117_0070958	3300048920	Bacteria	2336
1295	Ga0496117_0078691	3300048920	Bacteria	2175
1296	Ga0496117_0086353	3300048920	Bacteria	2039
1297	Ga0496117_0094035	3300048920	Bacteria	1920
1298	Ga0496117_0106483	3300048920	Bacteria	1759
1299	Ga0496117_0111901	3300048920	Bacteria	1699
1300	Ga0496117_0133534	3300048920	Bacteria	1499
1301	Ga0496117_0187445	3300048920	Bacteria	1182
1302	Ga0496118_0014228	3300048921	Bacteria	7460
1303	Ga0496118_0040646	3300048921	Bacteria	3694
1304	Ga0496118_0053834	3300048921	Bacteria	3053
1305	Ga0496118_0054564	3300048921	Bacteria	3025
1306	Ga0496118_0056848	3300048921	Bacteria	2937
1307	Ga0496118_0083648	3300048921	Bacteria	2230
1308	Ga0496118_0097491	3300048921	Bacteria	2000
1309	Ga0496118_0180007	3300048921	Bacteria	1278
1310	Ga0496118_0189582	3300048921	Bacteria	1231
1311	Ga0496118_0191740	3300048921	Bacteria	1221
1312	Ga0496118_0219919	3300048921	Bacteria	1106
1313	Ga0496119_0000071	3300048922	Bacteria	153652
1314	Ga0496119_0051679	3300048922	Bacteria	2523
1315	Ga0496119_0073843	3300048922	Bacteria	1988
1316	Ga0496119_0094592	3300048922	Bacteria	1690
1317	Ga0496119_0101346	3300048922	Bacteria	1616
1318	Ga0496120_0002379	3300048923	Bacteria	19199
1319	Ga0496120_0029308	3300048923	Bacteria	3361
1320	Ga0496120_0068970	3300048923	Bacteria	1948
1321	Ga0496121_0000688	3300048924	Bacteria	63017
1322	Ga0496121_0004830	3300048924	Bacteria	17744
1323	Ga0496121_0032852	3300048924	Bacteria	4708
1324	Ga0496121_0066497	3300048924	Bacteria	2926
1325	Ga0496121_0066973	3300048924	Bacteria	2912
1326	Ga0496121_0085152	3300048924	Bacteria	2489
1327	Ga0496121_0094244	3300048924	Bacteria	2329
1328	Ga0496121_0099285	3300048924	Bacteria	2250
1329	Ga0496121_0106781	3300048924	Bacteria	2146
1330	Ga0496121_0112975	3300048924	Bacteria	2068
1331	Ga0496121_0119307	3300048924	Bacteria	1995
1332	Ga0496121_0120195	3300048924	Bacteria	1985
1333	Ga0496121_0133792	3300048924	Bacteria	1850
1334	Ga0496121_0134088	3300048924	Bacteria	1848
1335	Ga0496121_0232633	3300048924	Bacteria	1289
1336	Ga0496122_0002470	3300048925	Bacteria	26144
1337	Ga0496122_0003730	3300048925	Bacteria	19663
1338	Ga0496122_0061549	3300048925	Bacteria	2754
1339	Ga0496122_0064118	3300048925	Bacteria	2675
1340	Ga0496122_0093010	3300048925	Bacteria	2047
1341	Ga0496122_0093757	3300048925	Bacteria	2035
1342	Ga0496122_0134923	3300048925	Bacteria	1558
1343	Ga0496122_0145218	3300048925	Bacteria	1476
1344	Ga0496122_0188117	3300048925	Bacteria	1222
1345	Ga0496123_0002423	3300048926	Bacteria	23210
1346	Ga0496123_0002964	3300048926	Bacteria	19767
1347	Ga0496123_0006543	3300048926	Bacteria	11253
1348	Ga0496123_0036540	3300048926	Bacteria	3482
1349	Ga0496123_0043049	3300048926	Bacteria	3107
1350	Ga0496123_0074870	3300048926	Bacteria	2092
1351	Ga0496123_0111502	3300048926	Bacteria	1562
1352	Ga0496123_0168916	3300048926	Bacteria	1156
1353	Ga0496124_0000730	3300048927	Bacteria	53903
1354	Ga0496124_0013620	3300048927	Bacteria	7928
1355	Ga0496124_0023515	3300048927	Bacteria	5624
1356	Ga0496124_0025634	3300048927	Bacteria	5337
1357	Ga0496124_0031348	3300048927	Bacteria	4706
1358	Ga0496124_0044184	3300048927	Bacteria	3825
1359	Ga0496124_0050868	3300048927	Bacteria	3527
1360	Ga0496124_0071986	3300048927	Bacteria	2863
1361	Ga0496124_0080002	3300048927	Bacteria	2690
1362	Ga0496124_0087221	3300048927	Bacteria	2552
1363	Ga0496124_0100486	3300048927	Bacteria	2344
1364	Ga0496124_0106112	3300048927	Bacteria	2268
1365	Ga0496124_0131100	3300048927	Bacteria	1991
1366	Ga0496124_0133256	3300048927	Bacteria	1971
1367	Ga0496124_0170533	3300048927	Bacteria	1686
1368	Ga0496124_0174887	3300048927	Bacteria	1658
1369	Ga0496124_0176971	3300048927	Bacteria	1646
1370	Ga0496125_0001109	3300048928	Bacteria	41385
1371	Ga0496125_0057690	3300048928	Bacteria	3142
1372	Ga0496125_0057887	3300048928	Bacteria	3135
1373	Ga0496125_0084284	3300048928	Bacteria	2414
1374	Ga0496125_0084608	3300048928	Bacteria	2408
1375	Ga0496125_0092347	3300048928	Bacteria	2263
1376	Ga0496125_0092867	3300048928	Bacteria	2254
1377	Ga0496125_0100998	3300048928	Bacteria	2124
1378	Ga0496125_0101748	3300048928	Bacteria	2113
1379	Ga0496125_0118626	3300048928	Bacteria	1894
1380	Ga0496126_0111057	3300048929	Bacteria	2387
1381	Ga0496126_0170099	3300048929	Bacteria	1857
1382	Ga0496126_0195118	3300048929	Bacteria	1712
1383	Ga0495678_000268	3300049459	Bacteria	57604
1384	Ga0495678_002235	3300049459	Bacteria	13491
1385	Ga0495678_009680	3300049459	Bacteria	4739
1386	Ga0495678_017554	3300049459	Bacteria	3240
1387	Ga0495678_018303	3300049459	Bacteria	3152
1388	Ga0495678_020076	3300049459	Bacteria	2966
1389	Ga0495678_021909	3300049459	Bacteria	2804
1390	Ga0495678_023033	3300049459	Bacteria	2714
1391	Ga0495678_024909	3300049459	Bacteria	2576
1392	Ga0495678_027780	3300049459	Bacteria	2395
1393	Ga0495678_028773	3300049459	Bacteria	2340
1394	Ga0495678_030683	3300049459	Bacteria	2247
1395	Ga0495678_034735	3300049459	Bacteria	2072
1396	Ga0495678_039558	3300049459	Bacteria	1901
1397	Ga0495678_058369	3300049459	Bacteria	1458
1398	Ga0495678_089966	3300049459	Bacteria	1083
1399	Ga0495682_0000198	3300049460	Bacteria	48570
1400	Ga0495682_0004976	3300049460	Bacteria	5591
1401	Ga0495682_0016137	3300049460	Bacteria	2825
1402	Ga0495682_0022947	3300049460	Bacteria	2331
1403	Ga0495682_0053102	3300049460	Bacteria	1471
1404	Ga0495682_0084156	3300049460	Bacteria	1143
1405	Ga0495682_0114670	3300049460	Bacteria	965
1406	Ga0501031_0008281	3300049568	Bacteria	6764
1407	Ga0501031_0029801	3300049568	Bacteria	3560
1408	Ga0501031_0065529	3300049568	Bacteria	2367
1409	Ga0501031_0210116	3300049568	Bacteria	1268
1410	Ga0501032_0009565	3300049569	Bacteria	7028
1411	Ga0501033_0000949	3300049570	Bacteria	26319
1412	Ga0501033_0000982	3300049570	Bacteria	25928
1413	Ga0501034_0000165	3300049571	Bacteria	123084
1414	Ga0501034_0085349	3300049571	Bacteria	3159
1415	Ga0501034_0093274	3300049571	Bacteria	3007
1416	Ga0501034_0352328	3300049571	Bacteria	1400
1417	Ga0501034_0449281	3300049571	Bacteria	1207
1418	Ga0501036_0000382	3300049572	Bacteria	31346
1419	Ga0501036_0015634	3300049572	Bacteria	6339
1420	Ga0501036_0167370	3300049572	Bacteria	1852
1421	Ga0501036_0169553	3300049572	Bacteria	1839
1422	Ga0501037_0019729	3300049573	Bacteria	4974
1423	Ga0501037_0073761	3300049573	Bacteria	2481
1424	Ga0501037_0169032	3300049573	Bacteria	1555
1425	Ga0501038_0013475	3300049574	Bacteria	7454
1426	Ga0501038_0033468	3300049574	Bacteria	4528
1427	Ga0501038_0035410	3300049574	Bacteria	4383
1428	Ga0501038_0063882	3300049574	Bacteria	3141
1429	Ga0501038_0105877	3300049574	Bacteria	2335
1430	Ga0501039_0010322	3300049575	Bacteria	7124
1431	Ga0501039_0050462	3300049575	Bacteria	3219
1432	Ga0501039_0446664	3300049575	Bacteria	1015
1433	Ga0501040_0005587	3300049576	Bacteria	8132
1434	Ga0501040_0014776	3300049576	Bacteria	5152
1435	Ga0501041_0050634	3300049577	Bacteria	2531
1436	Ga0501041_0058041	3300049577	Bacteria	2367
1437	Ga0501041_0088284	3300049577	Bacteria	1914
1438	Ga0501041_0134883	3300049577	Bacteria	1538
1439	Ga0501042_0014561	3300049578	Bacteria	5371
1440	Ga0501042_0015971	3300049578	Bacteria	5150
1441	Ga0501043_0019833	3300049579	Bacteria	5280
1442	Ga0501043_0045806	3300049579	Bacteria	3439
1443	Ga0501043_0092133	3300049579	Bacteria	2382
1444	Ga0501046_0004540	3300049580	Bacteria	12577
1445	Ga0501046_0148061	3300049580	Bacteria	1772
1446	Ga0501046_0171248	3300049580	Bacteria	1629
1447	Ga0501046_0230559	3300049580	Bacteria	1368
1448	Ga0501047_0002642	3300049581	Bacteria	17050
1449	Ga0501047_0012087	3300049581	Bacteria	8172
1450	Ga0501048_0014480	3300049582	Bacteria	5839
1451	Ga0501048_0322919	3300049582	Bacteria	1100
1452	Ga0501068_0110704	3300049584	Bacteria	1707
1453	Ga0501069_0000966	3300049585	Bacteria	13694
1454	Ga0501069_0038981	3300049585	Bacteria	2624
1455	Ga0501070_0003140	3300049586	Bacteria	14381
1456	Ga0501071_0002579	3300049587	Bacteria	11061
1457	Ga0501071_0024364	3300049587	Bacteria	4233
1458	Ga0501071_0238578	3300049587	Bacteria	1371
1459	Ga0501072_0000916	3300049588	Bacteria	21646
1460	Ga0501072_0001990	3300049588	Bacteria	15222
1461	Ga0501072_0039365	3300049588	Bacteria	3712
1462	Ga0501073_0001300	3300049589	Bacteria	18356
1463	Ga0501073_0087840	3300049589	Bacteria	2162
1464	Ga0501074_0000762	3300049590	Bacteria	20258
1465	Ga0501074_0125685	3300049590	Bacteria	1834
1466	Ga0501075_0034141	3300049591	Bacteria	3786
1467	Ga0501075_0036835	3300049591	Bacteria	3651
1468	Ga0501075_0099708	3300049591	Unclassified	2206
1469	Ga0501075_0366508	3300049591	Bacteria	1098
1470	Ga0501076_0002115	3300049592	Bacteria	13620
1471	Ga0501076_0002162	3300049592	Bacteria	13478
1472	Ga0501076_0265411	3300049592	Bacteria	1406
1473	Ga0501076_0467923	3300049592	Bacteria	1038
1474	Ga0501077_0017246	3300049593	Bacteria	4555
1475	Ga0501209_000313	3300049656	Bacteria	5816
1476	Ga0501222_002321	3300049662	Bacteria	2642
1477	Ga0501079_0006888	3300049741	Bacteria	8562
1478	Ga0501079_0011808	3300049741	Bacteria	6668
1479	Ga0501079_0337168	3300049741	Bacteria	1181
1480	Ga0501080_0125758	3300049742	Bacteria	2375
1481	Ga0501081_0000370	3300049743	Bacteria	24563
1482	Ga0501083_0291389	3300049744	Bacteria	1062
1483	Ga0501241_004447	3300049758	Bacteria	2627
1484	Ga0501269_002363	3300049766	Bacteria	2331
1485	Ga0501035_0001429	3300049822	Bacteria	24468
1486	Ga0501035_0001968	3300049822	Bacteria	20568
1487	Ga0501035_0035620	3300049822	Bacteria	4516
1488	Ga0501035_0043499	3300049822	Bacteria	4047
1489	Ga0501035_0084541	3300049822	Bacteria	2798
1490	Ga0501035_0497231	3300049822	Bacteria	1004
1491	Ga0501044_0000111	3300049823	Bacteria	100080
1492	Ga0501044_0000614	3300049823	Bacteria	43165
1493	Ga0501044_0024664	3300049823	Bacteria	6380
1494	Ga0501044_0250207	3300049823	Bacteria	1713
1495	Ga0501044_0250363	3300049823	Bacteria	1713
1496	Ga0501044_0257310	3300049823	Bacteria	1685
1497	Ga0501045_0008070	3300049824	Bacteria	7334
1498	Ga0501045_0021656	3300049824	Bacteria	4601
1499	Ga0501045_0241667	3300049824	Bacteria	1344
1500	Ga0501226_000033	3300049853	Bacteria	72088
1501	Ga0501226_005743	3300049853	Bacteria	1409
1502	nmdc:mga00v17_225042_c1	3300050491	Bacteria	1215
1503	nmdc:mga00v17_68553_c1	3300050491	Bacteria	2193
1504	nmdc:mga0n895_163052_c1	3300050512	Bacteria	2261
1505	nmdc:mga0rr50_45654_c1	3300050513	Bacteria	3222
1506	nmdc:mga0rr50_51020_c1	3300050513	Bacteria	3068
1507	nmdc:mga08x19_10314_c1	3300050514	Bacteria	5608
1508	nmdc:mga0a205_12550_c1	3300050515	Bacteria	7842
1509	nmdc:mga0a205_35630_c1	3300050515	Bacteria	4778
1510	Ga0500572_006534	3300053111	Bacteria	2673
1511	Ga0500659_0019629	3300053135	Bacteria	3684
1512	Ga0500568_0003355	3300053139	Bacteria	8965
1513	Ga0500586_035628	3300053145	Bacteria	1665
1514	Ga0500634_0081624	3300053161	Bacteria	1665
1515	Ga0501084_0064687	3300054114	Bacteria	3060
1516	Ga0501084_0525772	3300054114	Bacteria	1000
1517	Ga0501082_0021407	3300060353	Bacteria	5578
1518	Ga0501082_0376519	3300060353	Bacteria	1239
1519	Ga0530510_0001081	3300061734	Bacteria	18085
1520	Ga0530510_0115753	3300061734	Bacteria	1965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049822	Ga0501035_0497231	Ga0501035_0497231_298_975	223
2	3300048920	Ga0496117_0133534	Ga0496117_0133534_10_717	235
3	3300046518	Ga0495631_0087769	Ga0495631_0087769_574_1311	244
4	3300046675	Ga0495657_0319420	Ga0495657_0319420_17_784	244
5	3300046491	Ga0495584_0174463	Ga0495584_0174463_338_1075	245
6	3300041410	Ga0439461_0043364	Ga0439461_0043364_175_957	246
7	3300031712	Ga0265342_10022958	Ga0265342_100229586	247
8	3300014497	Ga0182008_10047832	Ga0182008_100478323	249
9	3300042016	Ga0439463_053559	Ga0439463_053559_116_997	250
10	3300046665	Ga0495661_0100323	Ga0495661_0100323_324_1172	251
11	3300053161	Ga0500634_0081624	Ga0500634_0081624_533_1381	251
12	3300005365	Ga0070688_100186834	Ga0070688_1001868342	252
13	3300026075	Ga0207708_10141535	Ga0207708_101415352	252
14	3300038443	Ga0395901_0559053	Ga0395901_0559053_20_781	252
15	3300025927	Ga0207687_10261125	Ga0207687_102611252	253
16	3300025981	Ga0207640_10283292	Ga0207640_102832922	253
17	3300046542	Ga0495597_0039975	Ga0495597_0039975_214_1098	253
18	3300047470	Ga0495681_0032922	Ga0495681_0032922_1289_2173	253
19	3300006178	Ga0075367_10215120	Ga0075367_102151202	254
20	3300006195	Ga0075366_10019806	Ga0075366_100198063	254
21	3300006353	Ga0075370_10124492	Ga0075370_101244922	254
22	3300046453	Ga0495627_051160	Ga0495627_051160_143_1024	256
23	3300046459	Ga0495629_0093558	Ga0495629_0093558_989_1870	256
24	3300046460	Ga0495638_0095474	Ga0495638_0095474_530_1411	256
25	3300046463	Ga0495653_0012238	Ga0495653_0012238_670_1551	256
26	3300046473	Ga0495582_0006380	Ga0495582_0006380_5425_6306	256
27	3300046475	Ga0495639_0021868	Ga0495639_0021868_412_1293	256
28	3300046499	Ga0495594_0232597	Ga0495594_0232597_62_943	256
29	3300046516	Ga0495628_0184824	Ga0495628_0184824_269_1150	256
30	3300046526	Ga0495666_0005314	Ga0495666_0005314_537_1418	256
31	3300046535	Ga0495586_0012483	Ga0495586_0012483_382_1263	256
32	3300046536	Ga0495587_0006263	Ga0495587_0006263_463_1344	256
33	3300046543	Ga0495645_0137576	Ga0495645_0137576_233_1114	256
34	3300046660	Ga0495625_0128224	Ga0495625_0128224_339_1220	256
35	3300046663	Ga0495635_0007500	Ga0495635_0007500_6422_7303	256
36	3300046680	Ga0495646_0073795	Ga0495646_0073795_735_1616	256
37	3300046689	Ga0495613_0076344	Ga0495613_0076344_273_1154	256
38	3300046809	Ga0495600_0015339	Ga0495600_0015339_3452_4333	256
39	3300047315	Ga0495581_0033208	Ga0495581_0033208_1771_2652	256
40	3300047317	Ga0495604_0014150	Ga0495604_0014150_19_900	256
41	3300047322	Ga0495680_0011250	Ga0495680_0011250_6436_7317	256
42	3300047444	Ga0495675_0019889	Ga0495675_0019889_490_1371	256
43	3300054114	Ga0501084_0525772	Ga0501084_0525772_184_966	257
44	3300007265	Ga0099794_10004995	Ga0099794_100049954	259
45	3300007788	Ga0099795_10000744	Ga0099795_100007447	259
46	3300010159	Ga0099796_10000788	Ga0099796_100007884	259
47	3300042184	Ga0450908_009701	Ga0450908_009701_861_1649	260
48	3300011119	Ga0105246_10002696	Ga0105246_100026962	261
49	3300042530	Ga0450916_000811	Ga0450916_000811_1014_1844	261
50	3300048928	Ga0496125_0101748	Ga0496125_0101748_617_1468	261
51	3300049568	Ga0501031_0008281	Ga0501031_0008281_5961_6749	261
52	3300036401	Ga0373937_0141776	Ga0373937_0141776_252_1073	262
53	3300041406	Ga0439439_0037683	Ga0439439_0037683_114_944	262
54	3300042156	Ga0439446_0009888	Ga0439446_0009888_178_1008	262
55	3300031727	Ga0316576_10171819	Ga0316576_101718192	263
56	3300005439	Ga0070711_100066663	Ga0070711_1000666633	264
57	3300006173	Ga0070716_100002786	Ga0070716_1000027868	264
58	3300006237	Ga0097621_100614877	Ga0097621_1006148772	264
59	3300025915	Ga0207693_10247192	Ga0207693_102471922	264
60	3300025916	Ga0207663_10179040	Ga0207663_101790402	264
61	3300025939	Ga0207665_10033438	Ga0207665_100334382	264
62	3300049568	Ga0501031_0210116	Ga0501031_0210116_91_909	264
63	3300049581	Ga0501047_0012087	Ga0501047_0012087_5394_6212	264
64	3300049822	Ga0501035_0043499	Ga0501035_0043499_372_1190	264
65	3300049823	Ga0501044_0000614	Ga0501044_0000614_20428_21246	264
66	3300042137	Ga0450902_014675	Ga0450902_014675_82_963	265
67	3300046530	Ga0495654_0085597	Ga0495654_0085597_369_1220	265
68	3300013104	Ga0157370_10088218	Ga0157370_100882183	266
69	3300013306	Ga0163162_10102133	Ga0163162_101021333	266
70	3300017792	Ga0163161_10205645	Ga0163161_102056452	266
71	3300031548	Ga0307408_100063555	Ga0307408_1000635553	266
72	3300046455	Ga0495603_0038750	Ga0495603_0038750_749_1666	266
73	3300046499	Ga0495594_0083977	Ga0495594_0083977_136_1053	266
74	3300046557	Ga0495622_0024700	Ga0495622_0024700_1354_2271	266
75	3300048924	Ga0496121_0099285	Ga0496121_0099285_865_1782	266
76	3300049572	Ga0501036_0167370	Ga0501036_0167370_153_956	266
77	iso_pu_bacteria	2738541276	2738716944	266
78	3300005344	Ga0070661_100216861	Ga0070661_1002168612	267
79	3300005444	Ga0070694_100308697	Ga0070694_1003086972	267
80	3300006852	Ga0075433_10054787	Ga0075433_100547871	267
81	3300007076	Ga0075435_100041710	Ga0075435_1000417102	267
82	3300025920	Ga0207649_10243954	Ga0207649_102439542	267
83	3300031665	Ga0316575_10025686	Ga0316575_100256862	267
84	3300031727	Ga0316576_10166963	Ga0316576_101669633	267
85	3300032133	Ga0316583_10003027	Ga0316583_100030271	267
86	3300035112	Ga0373932_0084106	Ga0373932_0084106_184_990	267
87	3300036712	Ga0316584_0017109	Ga0316584_0017109_949_1788	267
88	3300042146	Ga0450907_017026	Ga0450907_017026_295_1107	267
89	3300050512	nmdc:mga0n895_163052_c1	nmdc:mga0n895_163052_c1_10_816	267
90	3300050513	nmdc:mga0rr50_45654_c1	nmdc:mga0rr50_45654_c1_1232_2038	267
91	3300050514	nmdc:mga08x19_10314_c1	nmdc:mga08x19_10314_c1_2884_3690	267
92	3300050515	nmdc:mga0a205_12550_c1	nmdc:mga0a205_12550_c1_2746_3552	267
93	iso_pu_bacteria	2916178963	2916181770	267
94	3300027876	Ga0209974_10110924	Ga0209974_101109241	268
95	3300048920	Ga0496117_0053402	Ga0496117_0053402_1152_1958	268
96	iso_pu_bacteria	2919501602	2919506513	268
97	iso_pu_bacteria	2926063275	2926068171	268
98	iso_pu_bacteria	2952252522	2952255527	268
99	iso_pu_bacteria	8002745576	8002745636	268
100	3300002737	JGI25162J39368_1001039	JGI25162J39368_10010396	269
101	3300002771	JGI25163J39215_1001286	JGI25163J39215_10012862	269
102	3300002772	JGI25164J39214_1000554	JGI25164J39214_100055411	269
103	3300003214	JGI25165J46597_1001107	JGI25165J46597_100110711	269
104	3300005295	Ga0065707_10218272	Ga0065707_102182722	269
105	3300005334	Ga0068869_100105086	Ga0068869_1001050863	269
106	3300005336	Ga0070680_100454872	Ga0070680_1004548722	269
107	3300005343	Ga0070687_100309911	Ga0070687_1003099111	269
108	3300005345	Ga0070692_10004243	Ga0070692_100042432	269
109	3300005353	Ga0070669_100080388	Ga0070669_1000803882	269
110	3300005356	Ga0070674_100203807	Ga0070674_1002038072	269
111	3300005437	Ga0070710_10051994	Ga0070710_100519942	269
112	3300005440	Ga0070705_100448966	Ga0070705_1004489661	269
113	3300005441	Ga0070700_100003335	Ga0070700_1000033356	269
114	3300005457	Ga0070662_100525394	Ga0070662_1005253941	269
115	3300005459	Ga0068867_100000126	Ga0068867_10000012641	269
116	3300005545	Ga0070695_100043013	Ga0070695_1000430133	269
117	3300005546	Ga0070696_100057276	Ga0070696_1000572764	269
118	3300005615	Ga0070702_100045834	Ga0070702_1000458343	269
119	3300005719	Ga0068861_100005473	Ga0068861_1000054737	269
120	3300005843	Ga0068860_100372283	Ga0068860_1003722833	269
121	3300005844	Ga0068862_100001111	Ga0068862_10000111123	269
122	3300006852	Ga0075433_10035913	Ga0075433_100359134	269
123	3300006881	Ga0068865_100004646	Ga0068865_1000046466	269
124	3300007076	Ga0075435_100002009	Ga0075435_10000200913	269
125	3300009094	Ga0111539_10051444	Ga0111539_100514442	269
126	3300009148	Ga0105243_10007352	Ga0105243_100073527	269
127	3300009176	Ga0105242_10702409	Ga0105242_107024091	269
128	3300009553	Ga0105249_10002649	Ga0105249_1000264915	269
129	3300013308	Ga0157375_10249469	Ga0157375_102494692	269
130	3300014326	Ga0157380_10019493	Ga0157380_100194933	269
131	3300025207	Ga0209760_100259	Ga0209760_10025911	269
132	3300025231	Ga0207427_100005	Ga0207427_10000545	269
133	3300025233	Ga0209437_100220	Ga0209437_10022047	269
134	3300025261	Ga0209233_1000021	Ga0209233_100002145	269
135	3300025908	Ga0207643_10007354	Ga0207643_100073543	269
136	3300025917	Ga0207660_10035591	Ga0207660_100355915	269
137	3300025917	Ga0207660_10352868	Ga0207660_103528681	269
138	3300025923	Ga0207681_10002154	Ga0207681_100021546	269
139	3300025935	Ga0207709_10003870	Ga0207709_100038707	269
140	3300025938	Ga0207704_10002073	Ga0207704_100020736	269
141	3300025942	Ga0207689_10244953	Ga0207689_102449532	269
142	3300025972	Ga0207668_10002434	Ga0207668_100024348	269
143	3300026075	Ga0207708_10000697	Ga0207708_1000069722	269
144	3300026089	Ga0207648_10000352	Ga0207648_1000035226	269
145	3300026118	Ga0207675_100000802	Ga0207675_1000008025	269
146	3300028380	Ga0268265_10000579	Ga0268265_1000057932	269
147	3300031665	Ga0316575_10002994	Ga0316575_100029946	269
148	3300031691	Ga0316579_10000567	Ga0316579_100005676	269
149	3300031901	Ga0307406_10250587	Ga0307406_102505872	269
150	3300032133	Ga0316583_10008762	Ga0316583_100087623	269
151	3300035117	Ga0373953_0013284	Ga0373953_0013284_1745_2557	269
152	3300035118	Ga0373954_0055180	Ga0373954_0055180_186_998	269
153	3300035120	Ga0373957_0010630	Ga0373957_0010630_1399_2211	269
154	3300035172	Ga0373955_0033665	Ga0373955_0033665_888_1700	269
155	3300035410	Ga0373924_0008535	Ga0373924_0008535_1257_2069	269
156	3300035724	Ga0373933_0039451	Ga0373933_0039451_835_1647	269
157	3300036401	Ga0373937_0036233	Ga0373937_0036233_1134_1946	269
158	3300039062	Ga0400483_266630	Ga0400483_266630_481_1293	269
159	3300041410	Ga0439461_0013297	Ga0439461_0013297_469_1281	269
160	3300042435	Ga0439434_0001264	Ga0439434_0001264_5326_6138	269
161	3300042436	Ga0439435_0000828	Ga0439435_0000828_2851_3663	269
162	3300042876	Ga0451577_0120172	Ga0451577_0120172_340_1158	269
163	3300044712	Ga0453684_0257929	Ga0453684_0257929_118_936	269
164	3300045051	Ga0451576_0310853	Ga0451576_0310853_703_1521	269
165	3300046559	Ga0495667_0149234	Ga0495667_0149234_163_975	269
166	3300047322	Ga0495680_0136212	Ga0495680_0136212_436_1248	269
167	3300049575	Ga0501039_0446664	Ga0501039_0446664_130_948	269
168	3300049577	Ga0501041_0088284	Ga0501041_0088284_1081_1899	269
169	3300049582	Ga0501048_0322919	Ga0501048_0322919_57_875	269
170	3300049591	Ga0501075_0099708	Ga0501075_0099708_24_848	269
171	3300049591	Ga0501075_0366508	Ga0501075_0366508_115_933	269
172	3300049592	Ga0501076_0265411	Ga0501076_0265411_65_889	269
173	3300049592	Ga0501076_0467923	Ga0501076_0467923_92_910	269
174	3300049741	Ga0501079_0337168	Ga0501079_0337168_319_1143	269
175	3300049824	Ga0501045_0241667	Ga0501045_0241667_64_882	269
176	3300050513	nmdc:mga0rr50_51020_c1	nmdc:mga0rr50_51020_c1_424_1236	269
177	3300050515	nmdc:mga0a205_35630_c1	nmdc:mga0a205_35630_c1_1907_2719	269
178	3300003320	rootH2_10192408	rootH2_101924081	270
179	3300003323	rootH1_10007647	rootH1_1000764743	270
180	3300003323	rootH1_10034201	rootH1_100342018	270
181	3300003781	Ga0055536_1000139	Ga0055536_10001396	270
182	3300003791	Ga0055530_10001748	Ga0055530_100017488	270
183	3300003792	Ga0055540_1001421	Ga0055540_10014216	270
184	3300003792	Ga0055540_1003360	Ga0055540_10033602	270
185	3300005445	Ga0070708_100502327	Ga0070708_1005023273	270
186	3300006846	Ga0075430_100022100	Ga0075430_1000221003	270
187	3300009094	Ga0111539_10089085	Ga0111539_100890853	270
188	3300009148	Ga0105243_10003591	Ga0105243_1000359111	270
189	3300009553	Ga0105249_10020288	Ga0105249_100202883	270
190	3300014497	Ga0182008_10003325	Ga0182008_100033256	270
191	3300025292	Ga0209676_1000668	Ga0209676_100066838	270
192	3300025298	Ga0209050_1000128	Ga0209050_100012838	270
193	3300025303	Ga0209051_1002045	Ga0209051_10020458	270
194	3300025935	Ga0207709_10001231	Ga0207709_1000123113	270
195	3300027471	Ga0209995_1019006	Ga0209995_10190061	270
196	3300031548	Ga0307408_100000049	Ga0307408_100000049127	270
197	3300031548	Ga0307408_100000914	Ga0307408_10000091417	270
198	3300031901	Ga0307406_10136138	Ga0307406_101361382	270
199	3300036401	Ga0373937_0736036	Ga0373937_0736036_91_912	270
200	3300042001	Ga0439441_000065	Ga0439441_000065_6416_7234	270
201	3300046471	Ga0495650_0001099	Ga0495650_0001099_4323_5144	270
202	3300048919	Ga0496116_0000401	Ga0496116_0000401_48385_49254	270
203	3300048920	Ga0496117_0004235	Ga0496117_0004235_8206_9075	270
204	3300048921	Ga0496118_0191740	Ga0496118_0191740_260_1129	270
205	3300048926	Ga0496123_0006543	Ga0496123_0006543_5613_6482	270
206	3300048927	Ga0496124_0176971	Ga0496124_0176971_469_1290	270
207	3300049571	Ga0501034_0352328	Ga0501034_0352328_470_1282	270
208	3300049572	Ga0501036_0169553	Ga0501036_0169553_597_1415	270
209	3300049574	Ga0501038_0033468	Ga0501038_0033468_310_1128	270
210	3300049575	Ga0501039_0010322	Ga0501039_0010322_2562_3380	270
211	3300049576	Ga0501040_0014776	Ga0501040_0014776_1611_2429	270
212	3300049577	Ga0501041_0058041	Ga0501041_0058041_1184_2002	270
213	3300049577	Ga0501041_0134883	Ga0501041_0134883_292_1110	270
214	3300049578	Ga0501042_0015971	Ga0501042_0015971_1989_2807	270
215	3300049579	Ga0501043_0045806	Ga0501043_0045806_1469_2287	270
216	3300049580	Ga0501046_0230559	Ga0501046_0230559_444_1262	270
217	3300049587	Ga0501071_0024364	Ga0501071_0024364_1455_2273	270
218	3300049587	Ga0501071_0238578	Ga0501071_0238578_493_1314	270
219	3300049588	Ga0501072_0000916	Ga0501072_0000916_19059_19877	270
220	3300049588	Ga0501072_0039365	Ga0501072_0039365_1198_2016	270
221	3300049591	Ga0501075_0036835	Ga0501075_0036835_817_1635	270
222	3300049592	Ga0501076_0002115	Ga0501076_0002115_9698_10516	270
223	3300049593	Ga0501077_0017246	Ga0501077_0017246_430_1248	270
224	3300049741	Ga0501079_0011808	Ga0501079_0011808_2048_2866	270
225	3300049743	Ga0501081_0000370	Ga0501081_0000370_11252_12070	270
226	3300049824	Ga0501045_0021656	Ga0501045_0021656_1411_2229	270
227	3300060353	Ga0501082_0021407	Ga0501082_0021407_979_1797	270
228	3300061734	Ga0530510_0001081	Ga0530510_0001081_6842_7660	270
229	iso_pu_bacteria	2738543020	2739289781	270
230	iso_pu_bacteria	2738543021	2739295093	270
231	iso_pu_bacteria	2808606379	2808941976	270
232	iso_pu_bacteria	3007252601	3007255512	270
233	iso_pu_bacteria	3007315729	3007320390	270
234	iso_pu_bacteria	8011350971	8011353592	270
235	3300005327	Ga0070658_10052077	Ga0070658_100520772	271
236	3300005539	Ga0068853_100043647	Ga0068853_1000436474	271
237	3300005563	Ga0068855_100370394	Ga0068855_1003703943	271
238	3300005614	Ga0068856_100370505	Ga0068856_1003705052	271
239	3300005616	Ga0068852_100007460	Ga0068852_1000074608	271
240	3300009093	Ga0105240_10034362	Ga0105240_100343627	271
241	3300013102	Ga0157371_10451258	Ga0157371_104512582	271
242	3300013104	Ga0157370_10365552	Ga0157370_103655521	271
243	3300013307	Ga0157372_10004093	Ga0157372_100040938	271
244	3300025909	Ga0207705_10217127	Ga0207705_102171272	271
245	3300025913	Ga0207695_10127083	Ga0207695_101270833	271
246	3300025919	Ga0207657_10128165	Ga0207657_101281653	271
247	3300025924	Ga0207694_10594636	Ga0207694_105946361	271
248	3300025949	Ga0207667_10503454	Ga0207667_105034542	271
249	3300026041	Ga0207639_10042985	Ga0207639_100429854	271
250	3300026078	Ga0207702_10248933	Ga0207702_102489332	271
251	3300026142	Ga0207698_10016907	Ga0207698_100169076	271
252	3300028794	Ga0307515_10000047	Ga0307515_1000004730	271
253	3300028800	Ga0265338_10203782	Ga0265338_102037822	271
254	3300042016	Ga0439463_001796	Ga0439463_001796_1071_1952	271
255	3300005344	Ga0070661_100322871	Ga0070661_1003228711	272
256	3300005530	Ga0070679_100012887	Ga0070679_1000128872	272
257	3300005530	Ga0070679_100560640	Ga0070679_1005606401	272
258	3300005614	Ga0068856_100017043	Ga0068856_1000170435	272
259	3300005834	Ga0068851_10211916	Ga0068851_102119162	272
260	3300009093	Ga0105240_10081621	Ga0105240_100816212	272
261	3300009093	Ga0105240_10420745	Ga0105240_104207452	272
262	3300009174	Ga0105241_10012536	Ga0105241_100125365	272
263	3300009551	Ga0105238_10024261	Ga0105238_100242615	272
264	3300013105	Ga0157369_10463158	Ga0157369_104631581	272
265	3300013307	Ga0157372_11202358	Ga0157372_112023581	272
266	3300025911	Ga0207654_10224104	Ga0207654_102241042	272
267	3300025913	Ga0207695_10030026	Ga0207695_100300265	272
268	3300025919	Ga0207657_10303590	Ga0207657_103035901	272
269	3300025924	Ga0207694_10209748	Ga0207694_102097482	272
270	3300025949	Ga0207667_10007453	Ga0207667_1000745310	272
271	3300026078	Ga0207702_10201456	Ga0207702_102014562	272
272	3300026142	Ga0207698_10542548	Ga0207698_105425482	272
273	3300031548	Ga0307408_100000065	Ga0307408_10000006544	272
274	3300031616	Ga0307508_10173285	Ga0307508_101732852	272
275	3300035398	Ga0316574_0008658	Ga0316574_0008658_4732_5562	272
276	3300037466	Ga0395898_0271107	Ga0395898_0271107_115_942	272
277	3300046537	Ga0495598_0083897	Ga0495598_0083897_21_842	272
278	3300046539	Ga0495621_0001452	Ga0495621_0001452_4665_5486	272
279	3300049580	Ga0501046_0148061	Ga0501046_0148061_139_960	272
280	3300049581	Ga0501047_0002642	Ga0501047_0002642_7848_8669	272
281	3300049584	Ga0501068_0110704	Ga0501068_0110704_27_848	272
282	3300049585	Ga0501069_0000966	Ga0501069_0000966_7731_8552	272
283	3300049586	Ga0501070_0003140	Ga0501070_0003140_8381_9202	272
284	3300049589	Ga0501073_0001300	Ga0501073_0001300_6895_7716	272
285	3300049589	Ga0501073_0087840	Ga0501073_0087840_63_884	272
286	3300049590	Ga0501074_0000762	Ga0501074_0000762_11592_12413	272
287	3300049741	Ga0501079_0006888	Ga0501079_0006888_151_972	272
288	3300049822	Ga0501035_0035620	Ga0501035_0035620_3187_4008	272
289	3300049823	Ga0501044_0250363	Ga0501044_0250363_542_1363	272
290	3300054114	Ga0501084_0064687	Ga0501084_0064687_816_1637	272
291	3300060353	Ga0501082_0376519	Ga0501082_0376519_408_1229	272
292	iso_pu_bacteria	2554235231	2555246703	272
293	iso_pu_bacteria	2765235841	2765586351	272
294	3300003323	rootH1_10100973	rootH1_101009731	273
295	3300021361	Ga0213872_10062502	Ga0213872_100625022	273
296	3300026095	Ga0207676_10145709	Ga0207676_101457093	273
297	3300027682	Ga0209971_1013236	Ga0209971_10132364	273
298	3300027717	Ga0209998_10003959	Ga0209998_100039592	273
299	3300028794	Ga0307515_10261885	Ga0307515_102618852	273
300	3300028800	Ga0265338_10015233	Ga0265338_100152338	273
301	3300031727	Ga0316576_10075156	Ga0316576_100751562	273
302	3300031824	Ga0307413_10026147	Ga0307413_100261472	273
303	3300031901	Ga0307406_10133469	Ga0307406_101334693	273
304	3300032002	Ga0307416_100002539	Ga0307416_1000025395	273
305	3300032126	Ga0307415_100016027	Ga0307415_1000160275	273
306	3300036712	Ga0316584_0081810	Ga0316584_0081810_550_1389	273
307	3300039447	Ga0436361_0042094	Ga0436361_0042094_10907_11731	273
308	3300042001	Ga0439441_000681	Ga0439441_000681_1015_1845	273
309	3300042009	Ga0439451_004672	Ga0439451_004672_995_1876	273
310	3300042122	Ga0450920_001174	Ga0450920_001174_1765_2595	273
311	3300042125	Ga0450923_003154	Ga0450923_003154_589_1470	273
312	3300042146	Ga0450907_009698	Ga0450907_009698_299_1129	273
313	3300042156	Ga0439446_0000023	Ga0439446_0000023_26183_27013	273
314	3300042435	Ga0439434_0015630	Ga0439434_0015630_1390_2220	273
315	3300042435	Ga0439434_0017429	Ga0439434_0017429_450_1280	273
316	3300042436	Ga0439435_0002803	Ga0439435_0002803_2645_3475	273
317	3300042437	Ga0439444_0000509	Ga0439444_0000509_2634_3464	273
318	3300048912	Ga0496109_0036107	Ga0496109_0036107_1523_2347	273
319	3300048913	Ga0496110_0160023	Ga0496110_0160023_390_1214	273
320	3300048915	Ga0496112_0001690	Ga0496112_0001690_7842_8666	273
321	3300048916	Ga0496113_0429568	Ga0496113_0429568_17_841	273
322	3300049568	Ga0501031_0029801	Ga0501031_0029801_1204_2034	273
323	3300049572	Ga0501036_0015634	Ga0501036_0015634_4932_5762	273
324	3300049573	Ga0501037_0019729	Ga0501037_0019729_2749_3579	273
325	3300049574	Ga0501038_0035410	Ga0501038_0035410_1992_2822	273
326	3300049576	Ga0501040_0005587	Ga0501040_0005587_2021_2851	273
327	3300049577	Ga0501041_0050634	Ga0501041_0050634_1017_1847	273
328	3300049578	Ga0501042_0014561	Ga0501042_0014561_2262_3092	273
329	3300049582	Ga0501048_0014480	Ga0501048_0014480_3040_3870	273
330	3300049585	Ga0501069_0038981	Ga0501069_0038981_1126_1956	273
331	3300049587	Ga0501071_0002579	Ga0501071_0002579_2448_3278	273
332	3300049588	Ga0501072_0001990	Ga0501072_0001990_11058_11888	273
333	3300049590	Ga0501074_0125685	Ga0501074_0125685_216_1046	273
334	3300049591	Ga0501075_0034141	Ga0501075_0034141_212_1042	273
335	3300049592	Ga0501076_0002162	Ga0501076_0002162_1090_1920	273
336	3300049656	Ga0501209_000313	Ga0501209_000313_3911_4738	273
337	3300049742	Ga0501080_0125758	Ga0501080_0125758_609_1439	273
338	3300049744	Ga0501083_0291389	Ga0501083_0291389_119_949	273
339	3300049822	Ga0501035_0084541	Ga0501035_0084541_1853_2683	273
340	3300049824	Ga0501045_0008070	Ga0501045_0008070_1932_2762	273
341	3300061734	Ga0530510_0115753	Ga0530510_0115753_157_987	273
342	3300003323	rootH1_10354543	rootH1_103545432	274
343	3300005336	Ga0070680_100035753	Ga0070680_1000357534	274
344	3300005355	Ga0070671_100031030	Ga0070671_1000310302	274
345	3300005435	Ga0070714_100095868	Ga0070714_1000958681	274
346	3300005467	Ga0070706_100354115	Ga0070706_1003541152	274
347	3300005535	Ga0070684_100416223	Ga0070684_1004162232	274
348	3300005539	Ga0068853_100231949	Ga0068853_1002319492	274
349	3300005564	Ga0070664_100053098	Ga0070664_1000530984	274
350	3300007788	Ga0099795_10000053	Ga0099795_1000005324	274
351	3300010159	Ga0099796_10000096	Ga0099796_1000009610	274
352	3300013100	Ga0157373_10049636	Ga0157373_100496363	274
353	3300013104	Ga0157370_10003046	Ga0157370_1000304613	274
354	3300015261	Ga0182006_1004311	Ga0182006_10043114	274
355	3300015261	Ga0182006_1008650	Ga0182006_10086504	274
356	3300017792	Ga0163161_10117210	Ga0163161_101172103	274
357	3300025932	Ga0207690_10273307	Ga0207690_102733072	274
358	3300025945	Ga0207679_10009730	Ga0207679_100097304	274
359	3300026067	Ga0207678_10058188	Ga0207678_100581884	274
360	3300027312	Ga0209371_1000127	Ga0209371_100012755	274
361	3300027512	Ga0209179_1000082	Ga0209179_100008211	274
362	3300030500	Ga0268256_1000104	Ga0268256_100010455	274
363	3300037418	Ga0395900_0222287	Ga0395900_0222287_405_1232	274
364	3300041404	Ga0439436_0000128	Ga0439436_0000128_7681_8508	274
365	3300041405	Ga0439438_005653	Ga0439438_005653_2536_3363	274
366	3300041407	Ga0439447_000852	Ga0439447_000852_1365_2192	274
367	3300041407	Ga0439447_008568	Ga0439447_008568_884_1765	274
368	3300041411	Ga0439466_0000570	Ga0439466_0000570_160_987	274
369	3300041411	Ga0439466_0002242	Ga0439466_0002242_6147_7028	274
370	3300041411	Ga0439466_0015283	Ga0439466_0015283_1354_2178	274
371	3300041997	Ga0439431_0003458	Ga0439431_0003458_660_1484	274
372	3300042000	Ga0439437_001149	Ga0439437_001149_1054_1878	274
373	3300042006	Ga0439432_003133	Ga0439432_003133_4245_5072	274
374	3300042006	Ga0439432_006825	Ga0439432_006825_2274_3155	274
375	3300042009	Ga0439451_003166	Ga0439451_003166_912_1793	274
376	3300042010	Ga0439452_002746	Ga0439452_002746_4205_5032	274
377	3300042010	Ga0439452_039323	Ga0439452_039323_193_1017	274
378	3300042012	Ga0439455_0013513	Ga0439455_0013513_571_1395	274
379	3300042013	Ga0439456_001500	Ga0439456_001500_1398_2222	274
380	3300042013	Ga0439456_013728	Ga0439456_013728_694_1575	274
381	3300042115	Ga0450911_000003	Ga0450911_000003_215649_216473	274
382	3300042118	Ga0450914_000849	Ga0450914_000849_425_1249	274
383	3300042139	Ga0450904_000259	Ga0450904_000259_5617_6441	274
384	3300042145	Ga0450906_011227	Ga0450906_011227_763_1644	274
385	3300042156	Ga0439446_0000319	Ga0439446_0000319_1295_2122	274
386	3300042156	Ga0439446_0004535	Ga0439446_0004535_1493_2317	274
387	3300042435	Ga0439434_0001113	Ga0439434_0001113_3448_4275	274
388	3300042438	Ga0439459_0008075	Ga0439459_0008075_366_1190	274
389	3300042439	Ga0439464_0002394	Ga0439464_0002394_1771_2595	274
390	3300042532	Ga0450893_0002060	Ga0450893_0002060_853_1677	274
391	3300042876	Ga0451577_0161596	Ga0451577_0161596_1044_1886	274
392	3300044712	Ga0453684_0079553	Ga0453684_0079553_3099_3941	274
393	3300044712	Ga0453684_0083069	Ga0453684_0083069_3117_3959	274
394	3300045051	Ga0451576_0032812	Ga0451576_0032812_627_1469	274
395	3300046522	Ga0495643_0005078	Ga0495643_0005078_1828_2652	274
396	3300046692	Ga0495671_0003279	Ga0495671_0003279_500_1324	274
397	3300046694	Ga0495649_0047427	Ga0495649_0047427_1013_1837	274
398	3300047470	Ga0495681_0021642	Ga0495681_0021642_1868_2692	274
399	3300049568	Ga0501031_0065529	Ga0501031_0065529_797_1621	274
400	3300049569	Ga0501032_0009565	Ga0501032_0009565_4921_5748	274
401	3300049570	Ga0501033_0000949	Ga0501033_0000949_9383_10210	274
402	3300049570	Ga0501033_0000982	Ga0501033_0000982_1211_2038	274
403	3300049571	Ga0501034_0085349	Ga0501034_0085349_1173_2000	274
404	3300049571	Ga0501034_0093274	Ga0501034_0093274_2145_2969	274
405	3300049571	Ga0501034_0449281	Ga0501034_0449281_36_863	274
406	3300049572	Ga0501036_0000382	Ga0501036_0000382_7495_8322	274
407	3300049573	Ga0501037_0073761	Ga0501037_0073761_1260_2087	274
408	3300049573	Ga0501037_0169032	Ga0501037_0169032_12_839	274
409	3300049574	Ga0501038_0013475	Ga0501038_0013475_1655_2482	274
410	3300049574	Ga0501038_0063882	Ga0501038_0063882_808_1635	274
411	3300049574	Ga0501038_0105877	Ga0501038_0105877_1467_2294	274
412	3300049575	Ga0501039_0050462	Ga0501039_0050462_1055_1882	274
413	3300049579	Ga0501043_0019833	Ga0501043_0019833_3363_4190	274
414	3300049579	Ga0501043_0092133	Ga0501043_0092133_496_1323	274
415	3300049580	Ga0501046_0004540	Ga0501046_0004540_1800_2627	274
416	3300049580	Ga0501046_0171248	Ga0501046_0171248_226_1053	274
417	3300049822	Ga0501035_0001429	Ga0501035_0001429_10194_11021	274
418	3300049822	Ga0501035_0001968	Ga0501035_0001968_1287_2114	274
419	3300049823	Ga0501044_0000111	Ga0501044_0000111_79726_80553	274
420	3300049823	Ga0501044_0024664	Ga0501044_0024664_838_1665	274
421	3300049823	Ga0501044_0250207	Ga0501044_0250207_44_871	274
422	3300049823	Ga0501044_0257310	Ga0501044_0257310_293_1120	274
423	3300049853	Ga0501226_000033	Ga0501226_000033_32401_33225	274
424	3300005436	Ga0070713_100212558	Ga0070713_1002125582	275
425	3300005439	Ga0070711_100007018	Ga0070711_1000070186	275
426	3300006163	Ga0070715_10146603	Ga0070715_101466032	275
427	3300025916	Ga0207663_10032699	Ga0207663_100326995	275
428	3300025928	Ga0207700_10494790	Ga0207700_104947901	275
429	3300030878	Ga0265770_1000151	Ga0265770_10001514	275
430	3300030879	Ga0265765_1001116	Ga0265765_10011162	275
431	3300031090	Ga0265760_10003281	Ga0265760_100032814	275
432	3300035172	Ga0373955_0191276	Ga0373955_0191276_183_1019	275
433	3300048907	Ga0496104_0043406	Ga0496104_0043406_210_1046	275
434	3300048908	Ga0496105_0002839	Ga0496105_0002839_4213_5049	275
435	3300048908	Ga0496105_0119120	Ga0496105_0119120_941_1777	275
436	3300048917	Ga0496114_0001490	Ga0496114_0001490_15067_15903	275
437	3300009011	Ga0105251_10010223	Ga0105251_100102234	276
438	3300025735	Ga0207713_1006344	Ga0207713_10063444	276
439	3300048914	Ga0496111_0123938	Ga0496111_0123938_679_1518	276
440	3300048926	Ga0496123_0043049	Ga0496123_0043049_1074_1913	276
441	3300048927	Ga0496124_0013620	Ga0496124_0013620_1647_2486	276
442	3300048928	Ga0496125_0057690	Ga0496125_0057690_1128_1967	276
443	3300053139	Ga0500568_0003355	Ga0500568_0003355_4115_4960	276
444	3300009011	Ga0105251_10001960	Ga0105251_1000196012	278
445	3300025735	Ga0207713_1000938	Ga0207713_100093819	278
446	3300031712	Ga0265342_10153749	Ga0265342_101537492	278
447	3300036647	Ga0316582_0281263	Ga0316582_0281263_174_1028	278
448	iso_pu_bacteria	2806310737	2807410585	278
449	iso_pu_bacteria	2806310745	2807458930	278
450	iso_pu_bacteria	2908446538	2908452293	278
451	iso_pu_bacteria	2945928738	2945931189	278
452	iso_pu_bacteria	2946006987	2946007225	278
453	iso_pu_bacteria	8056115690	8056115877	278
454	iso_pu_bacteria	8056120720	8056121163	278
455	iso_pu_bacteria	8056131705	8056137046	278
456	iso_pu_bacteria	8056161164	8056163343	278
457	3300031548	Ga0307408_100012882	Ga0307408_1000128824	279
458	iso_pu_bacteria	2597489888	2597866353	279
459	iso_pu_bacteria	2597489889	2597872196	279
460	iso_pu_bacteria	2599185167	2599400818	279
461	iso_pu_bacteria	2599185179	2599450145	279
462	iso_pu_bacteria	2599185189	2599505484	279
463	iso_pu_bacteria	2599185190	2599512217	279
464	iso_pu_bacteria	2599185191	2599517198	279
465	iso_pu_bacteria	2599185288	2599878758	279
466	iso_pu_bacteria	2599185290	2599892421	279
467	iso_pu_bacteria	2599185303	2599951095	279
468	iso_pu_bacteria	2600255296	2601693714	279
469	iso_pu_bacteria	2619619299	2621297113	279
470	iso_pu_bacteria	2643221571	2643871990	279
471	iso_pu_bacteria	2643221713	2644620653	279
472	iso_pu_bacteria	2675903420	2677901271	279
473	iso_pu_bacteria	2721755607	2723251090	279
474	iso_pu_bacteria	2738541265	2738671932	279
475	iso_pu_bacteria	2738541282	2738750326	279
476	iso_pu_bacteria	2738541294	2738812021	279
477	iso_pu_bacteria	2738541303	2738859366	279
478	iso_pu_bacteria	2738541309	2738899381	279
479	iso_pu_bacteria	2808606385	2808975870	279
480	iso_pu_bacteria	2808606388	2808992979	279
481	iso_pu_bacteria	2816332298	2817493774	279
482	iso_pu_bacteria	2834028612	2834034490	279
483	iso_pu_bacteria	2842826826	2842829285	279
484	iso_pu_bacteria	2842837860	2842842134	279
485	iso_pu_bacteria	2852612431	2852616060	279
486	iso_pu_bacteria	2852667396	2852671028	279
487	iso_pu_bacteria	2860867994	2860872754	279
488	iso_pu_bacteria	2929189879	2929194866	279
489	iso_pu_bacteria	2931390751	2931396144	279
490	iso_pu_bacteria	2945961074	2945966515	279
491	iso_pu_bacteria	2946027586	2946027629	279
492	iso_pu_bacteria	2947233263	2947234144	279
493	iso_pu_bacteria	8054285046	8054291658	279
494	iso_pu_bacteria	8054347763	8054349852	279
495	iso_pu_bacteria	8054503363	8054508642	279
496	iso_pu_bacteria	8055817908	8055823617	279
497	iso_pu_bacteria	8056148874	8056151775	279
498	3300031090	Ga0265760_10027460	Ga0265760_100274601	280
499	iso_pu_bacteria	2511231024	2511373653	281
500	iso_pu_bacteria	3007803356	3007803771	281
501	iso_pu_bacteria	8052494512	8052499563	281
502	iso_pu_bacteria	8054929484	8054934258	281
503	3300005331	Ga0070670_100054331	Ga0070670_1000543313	282
504	3300009011	Ga0105251_10000322	Ga0105251_1000032211	282
505	3300009036	Ga0105244_10062571	Ga0105244_100625713	282
506	3300009092	Ga0105250_10000821	Ga0105250_1000082115	282
507	3300013308	Ga0157375_10110672	Ga0157375_101106724	282
508	3300025711	Ga0207696_1000094	Ga0207696_100009437	282
509	3300025711	Ga0207696_1052567	Ga0207696_10525671	282
510	3300025728	Ga0207655_1005857	Ga0207655_10058573	282
511	3300025735	Ga0207713_1000010	Ga0207713_100001037	282
512	3300025925	Ga0207650_10001937	Ga0207650_100019374	282
513	3300028786	Ga0307517_10227299	Ga0307517_102272991	282
514	3300030521	Ga0307511_10151689	Ga0307511_101516892	282
515	3300046529	Ga0495652_0271836	Ga0495652_0271836_375_1223	282
516	3300046810	Ga0495660_0040413	Ga0495660_0040413_633_1481	282
517	3300047446	Ga0495679_022885	Ga0495679_022885_878_1726	282
518	3300047446	Ga0495679_035173	Ga0495679_035173_419_1267	282
519	3300047470	Ga0495681_0020084	Ga0495681_0020084_1427_2308	282
520	3300048925	Ga0496122_0134923	Ga0496122_0134923_276_1124	282
521	3300048926	Ga0496123_0111502	Ga0496123_0111502_414_1262	282
522	3300048927	Ga0496124_0071986	Ga0496124_0071986_707_1564	282
523	3300048928	Ga0496125_0084608	Ga0496125_0084608_1063_1911	282
524	iso_pu_bacteria	8019769354	8019770058	282
525	iso_pu_bacteria	8057798959	8057801643	282
526	3300002738	JGI25154J39366_1006516	JGI25154J39366_10065162	283
527	3300003751	Ga0055538_1000074	Ga0055538_10000747	283
528	3300003752	Ga0055539_1000112	Ga0055539_10001127	283
529	3300003756	Ga0055533_1000118	Ga0055533_10001187	283
530	3300003758	Ga0055532_1000106	Ga0055532_100010676	283
531	3300003759	Ga0055525_1000157	Ga0055525_100015776	283
532	3300003841	Ga0055541_1000075	Ga0055541_10000757	283
533	3300005288	Ga0065714_10066325	Ga0065714_100663255	283
534	3300005288	Ga0065714_10106934	Ga0065714_101069342	283
535	3300005331	Ga0070670_100027168	Ga0070670_1000271683	283
536	3300005344	Ga0070661_100003559	Ga0070661_10000355910	283
537	3300005353	Ga0070669_100004019	Ga0070669_1000040196	283
538	3300005455	Ga0070663_100310951	Ga0070663_1003109512	283
539	3300005457	Ga0070662_100001292	Ga0070662_1000012926	283
540	3300005539	Ga0068853_100000211	Ga0068853_10000021137	283
541	3300005564	Ga0070664_100004896	Ga0070664_10000489610	283
542	3300005564	Ga0070664_100046300	Ga0070664_1000463002	283
543	3300005578	Ga0068854_100004022	Ga0068854_1000040225	283
544	3300005834	Ga0068851_10000063	Ga0068851_1000006320	283
545	3300009011	Ga0105251_10003113	Ga0105251_100031136	283
546	3300009011	Ga0105251_10003311	Ga0105251_100033113	283
547	3300009011	Ga0105251_10006157	Ga0105251_100061574	283
548	3300009036	Ga0105244_10004496	Ga0105244_100044969	283
549	3300009092	Ga0105250_10004422	Ga0105250_100044224	283
550	3300009092	Ga0105250_10056058	Ga0105250_100560582	283
551	3300009148	Ga0105243_10049857	Ga0105243_100498573	283
552	3300009176	Ga0105242_10003671	Ga0105242_1000367111	283
553	3300009177	Ga0105248_10034109	Ga0105248_100341095	283
554	3300009545	Ga0105237_10000583	Ga0105237_1000058344	283
555	3300011119	Ga0105246_10081093	Ga0105246_100810933	283
556	3300013100	Ga0157373_10044359	Ga0157373_100443593	283
557	3300013100	Ga0157373_10066056	Ga0157373_100660562	283
558	3300013100	Ga0157373_10066304	Ga0157373_100663042	283
559	3300013100	Ga0157373_10163427	Ga0157373_101634272	283
560	3300013102	Ga0157371_10132820	Ga0157371_101328203	283
561	3300013104	Ga0157370_10215265	Ga0157370_102152652	283
562	3300013105	Ga0157369_10267611	Ga0157369_102676112	283
563	3300013105	Ga0157369_10268135	Ga0157369_102681352	283
564	3300013105	Ga0157369_10303718	Ga0157369_103037182	283
565	3300013308	Ga0157375_10318981	Ga0157375_103189812	283
566	3300014497	Ga0182008_10037668	Ga0182008_100376682	283
567	3300014497	Ga0182008_10045658	Ga0182008_100456582	283
568	3300015261	Ga0182006_1005343	Ga0182006_10053433	283
569	3300015262	Ga0182007_10022119	Ga0182007_100221192	283
570	3300017792	Ga0163161_10149637	Ga0163161_101496373	283
571	3300017792	Ga0163161_10234841	Ga0163161_102348412	283
572	3300017792	Ga0163161_10252758	Ga0163161_102527582	283
573	3300025224	Ga0209784_100007	Ga0209784_100007658	283
574	3300025225	Ga0209566_100062	Ga0209566_100062143	283
575	3300025226	Ga0209674_100132	Ga0209674_10013277	283
576	3300025229	Ga0209147_100009	Ga0209147_100009658	283
577	3300025230	Ga0209563_100018	Ga0209563_100018658	283
578	3300025233	Ga0209437_103353	Ga0209437_1033532	283
579	3300025242	Ga0209258_100451	Ga0209258_1004517	283
580	3300025246	Ga0209646_1000185	Ga0209646_100018572	283
581	3300025253	Ga0209677_100056	Ga0209677_100056143	283
582	3300025321	Ga0207656_10000006	Ga0207656_10000006334	283
583	3300025711	Ga0207696_1000324	Ga0207696_100032437	283
584	3300025711	Ga0207696_1020049	Ga0207696_10200492	283
585	3300025728	Ga0207655_1000107	Ga0207655_1000107127	283
586	3300025735	Ga0207713_1001123	Ga0207713_100112315	283
587	3300025735	Ga0207713_1002313	Ga0207713_100231310	283
588	3300025735	Ga0207713_1003062	Ga0207713_100306210	283
589	3300025914	Ga0207671_10000159	Ga0207671_1000015940	283
590	3300025920	Ga0207649_10000197	Ga0207649_1000019712	283
591	3300025923	Ga0207681_10000254	Ga0207681_1000025437	283
592	3300025925	Ga0207650_10000159	Ga0207650_100001596	283
593	3300025933	Ga0207706_10000395	Ga0207706_1000039537	283
594	3300025934	Ga0207686_10009130	Ga0207686_100091303	283
595	3300025935	Ga0207709_10040993	Ga0207709_100409933	283
596	3300025941	Ga0207711_10140095	Ga0207711_101400953	283
597	3300025945	Ga0207679_10000027	Ga0207679_10000027138	283
598	3300025945	Ga0207679_10185056	Ga0207679_101850562	283
599	3300025981	Ga0207640_10021463	Ga0207640_100214634	283
600	3300026041	Ga0207639_10000238	Ga0207639_100002384	283
601	3300028379	Ga0268266_10102431	Ga0268266_101024313	283
602	3300031344	Ga0265316_10201324	Ga0265316_102013241	283
603	3300031731	Ga0307405_10133465	Ga0307405_101334652	283
604	3300042006	Ga0439432_001189	Ga0439432_001189_1342_2193	283
605	3300042131	Ga0450894_009268	Ga0450894_009268_120_971	283
606	3300046453	Ga0495627_011681	Ga0495627_011681_1337_2188	283
607	3300046458	Ga0495591_011974	Ga0495591_011974_1069_1920	283
608	3300046460	Ga0495638_0041577	Ga0495638_0041577_1412_2296	283
609	3300046491	Ga0495584_0041162	Ga0495584_0041162_792_1676	283
610	3300046492	Ga0495585_0023785	Ga0495585_0023785_1890_2774	283
611	3300046501	Ga0495607_0081784	Ga0495607_0081784_144_995	283
612	3300046506	Ga0495583_0063392	Ga0495583_0063392_482_1333	283
613	3300046507	Ga0495606_0041717	Ga0495606_0041717_1284_2135	283
614	3300046507	Ga0495606_0212713	Ga0495606_0212713_14_898	283
615	3300046512	Ga0495610_0011816	Ga0495610_0011816_813_1697	283
616	3300046512	Ga0495610_0030607	Ga0495610_0030607_766_1617	283
617	3300046513	Ga0495616_0100395	Ga0495616_0100395_62_946	283
618	3300046515	Ga0495620_0025919	Ga0495620_0025919_1310_2161	283
619	3300046519	Ga0495632_0018728	Ga0495632_0018728_1702_2553	283
620	3300046520	Ga0495637_0001391	Ga0495637_0001391_8344_9228	283
621	3300046522	Ga0495643_0129366	Ga0495643_0129366_51_935	283
622	3300046530	Ga0495654_0024932	Ga0495654_0024932_1351_2202	283
623	3300046530	Ga0495654_0061113	Ga0495654_0061113_415_1299	283
624	3300046542	Ga0495597_0026045	Ga0495597_0026045_1294_2178	283
625	3300046665	Ga0495661_0020844	Ga0495661_0020844_1336_2187	283
626	3300046794	Ga0495589_0028315	Ga0495589_0028315_691_1542	283
627	3300046810	Ga0495660_0128793	Ga0495660_0128793_366_1250	283
628	3300047446	Ga0495679_050311	Ga0495679_050311_305_1156	283
629	3300047470	Ga0495681_0026354	Ga0495681_0026354_1117_1968	283
630	3300047470	Ga0495681_0040299	Ga0495681_0040299_950_1801	283
631	3300047470	Ga0495681_0050404	Ga0495681_0050404_563_1447	283
632	3300047472	Ga0495686_0059428	Ga0495686_0059428_503_1387	283
633	3300048920	Ga0496117_0029128	Ga0496117_0029128_1314_2165	283
634	3300048920	Ga0496117_0070958	Ga0496117_0070958_1119_1970	283
635	3300048920	Ga0496117_0106483	Ga0496117_0106483_340_1191	283
636	3300048921	Ga0496118_0056848	Ga0496118_0056848_952_1803	283
637	3300048921	Ga0496118_0189582	Ga0496118_0189582_76_927	283
638	3300048921	Ga0496118_0219919	Ga0496118_0219919_121_972	283
639	3300048922	Ga0496119_0073843	Ga0496119_0073843_886_1737	283
640	3300048922	Ga0496119_0101346	Ga0496119_0101346_259_1110	283
641	3300048923	Ga0496120_0029308	Ga0496120_0029308_1035_1886	283
642	3300048924	Ga0496121_0094244	Ga0496121_0094244_936_1787	283
643	3300048924	Ga0496121_0120195	Ga0496121_0120195_134_985	283
644	3300048925	Ga0496122_0145218	Ga0496122_0145218_542_1393	283
645	3300048925	Ga0496122_0188117	Ga0496122_0188117_178_1029	283
646	3300048927	Ga0496124_0050868	Ga0496124_0050868_1369_2220	283
647	3300048927	Ga0496124_0080002	Ga0496124_0080002_849_1700	283
648	3300048927	Ga0496124_0131100	Ga0496124_0131100_599_1450	283
649	3300048928	Ga0496125_0057887	Ga0496125_0057887_977_1828	283
650	3300048928	Ga0496125_0092867	Ga0496125_0092867_210_1061	283
651	3300048929	Ga0496126_0111057	Ga0496126_0111057_970_1821	283
652	3300048929	Ga0496126_0195118	Ga0496126_0195118_295_1146	283
653	iso_pu_bacteria	2912963787	2912968624	283
654	iso_pu_bacteria	2939651529	2939653964	283
655	iso_pu_bacteria	8055878733	8055879328	283
656	iso_pu_bacteria	8056137416	8056137880	283
657	3300005289	Ga0065704_10095449	Ga0065704_100954492	285
658	3300006944	Ga0099823_1000115	Ga0099823_100011537	285
659	3300009011	Ga0105251_10080033	Ga0105251_100800332	285
660	3300009036	Ga0105244_10005327	Ga0105244_100053275	285
661	3300009036	Ga0105244_10011796	Ga0105244_100117964	285
662	3300009036	Ga0105244_10020023	Ga0105244_100200233	285
663	3300009036	Ga0105244_10053019	Ga0105244_100530193	285
664	3300009036	Ga0105244_10062420	Ga0105244_100624202	285
665	3300009092	Ga0105250_10019307	Ga0105250_100193073	285
666	3300009148	Ga0105243_10019953	Ga0105243_100199533	285
667	3300009148	Ga0105243_10064276	Ga0105243_100642763	285
668	3300025292	Ga0209676_1002078	Ga0209676_10020784	285
669	3300025711	Ga0207696_1000064	Ga0207696_1000064175	285
670	3300025711	Ga0207696_1010088	Ga0207696_10100883	285
671	3300025711	Ga0207696_1012021	Ga0207696_10120213	285
672	3300025728	Ga0207655_1000473	Ga0207655_100047337	285
673	3300025728	Ga0207655_1000486	Ga0207655_100048638	285
674	3300025728	Ga0207655_1014267	Ga0207655_10142674	285
675	3300025728	Ga0207655_1022984	Ga0207655_10229844	285
676	3300025735	Ga0207713_1001637	Ga0207713_100163710	285
677	3300025735	Ga0207713_1005709	Ga0207713_10057096	285
678	3300025935	Ga0207709_10045901	Ga0207709_100459012	285
679	3300025935	Ga0207709_10105226	Ga0207709_101052263	285
680	3300027296	Ga0209389_1000173	Ga0209389_100017337	285
681	3300027312	Ga0209371_1000217	Ga0209371_100021765	285
682	3300030500	Ga0268256_1000173	Ga0268256_10001733	285
683	3300042006	Ga0439432_007772	Ga0439432_007772_1903_2769	285
684	3300042136	Ga0450900_001127	Ga0450900_001127_1232_2098	285
685	3300042137	Ga0450902_001191	Ga0450902_001191_1413_2279	285
686	3300042142	Ga0450905_000502	Ga0450905_000502_2435_3301	285
687	3300042142	Ga0450905_002841	Ga0450905_002841_948_1814	285
688	3300042439	Ga0439464_0011846	Ga0439464_0011846_918_1784	285
689	3300042533	Ga0450901_001042	Ga0450901_001042_1031_1897	285
690	3300046515	Ga0495620_0000033	Ga0495620_0000033_38348_39214	285
691	3300046519	Ga0495632_0000399	Ga0495632_0000399_38352_39218	285
692	3300046522	Ga0495643_0000652	Ga0495643_0000652_1194_2060	285
693	3300046522	Ga0495643_0001045	Ga0495643_0001045_13761_14627	285
694	3300046524	Ga0495648_0025139	Ga0495648_0025139_1073_1939	285
695	3300046526	Ga0495666_0039225	Ga0495666_0039225_18_878	285
696	3300046526	Ga0495666_0102148	Ga0495666_0102148_473_1333	285
697	3300046680	Ga0495646_0029654	Ga0495646_0029654_2548_3408	285
698	3300046680	Ga0495646_0127256	Ga0495646_0127256_565_1425	285
699	3300048917	Ga0496114_0022231	Ga0496114_0022231_620_1486	285
700	3300048917	Ga0496114_0064863	Ga0496114_0064863_518_1384	285
701	3300048920	Ga0496117_0003306	Ga0496117_0003306_17047_17913	285
702	3300048920	Ga0496117_0008992	Ga0496117_0008992_1929_2795	285
703	3300048920	Ga0496117_0078691	Ga0496117_0078691_779_1645	285
704	3300048921	Ga0496118_0014228	Ga0496118_0014228_5633_6499	285
705	3300048921	Ga0496118_0040646	Ga0496118_0040646_1336_2202	285
706	3300048922	Ga0496119_0094592	Ga0496119_0094592_661_1527	285
707	3300048924	Ga0496121_0106781	Ga0496121_0106781_921_1787	285
708	3300048924	Ga0496121_0112975	Ga0496121_0112975_321_1187	285
709	3300048924	Ga0496121_0134088	Ga0496121_0134088_562_1428	285
710	3300048925	Ga0496122_0002470	Ga0496122_0002470_12471_13337	285
711	3300048925	Ga0496122_0093010	Ga0496122_0093010_630_1496	285
712	3300048926	Ga0496123_0002964	Ga0496123_0002964_17445_18311	285
713	3300048927	Ga0496124_0025634	Ga0496124_0025634_2325_3191	285
714	3300048928	Ga0496125_0001109	Ga0496125_0001109_38790_39656	285
715	3300048929	Ga0496126_0170099	Ga0496126_0170099_396_1262	285
716	3300049571	Ga0501034_0000165	Ga0501034_0000165_83483_84349	285
717	3300053135	Ga0500659_0019629	Ga0500659_0019629_1254_2120	285
718	iso_pu_bacteria	2554235341	2555672548	285
719	iso_pu_bacteria	2599185160	2599356250	285
720	iso_pu_bacteria	2599185161	2599362353	285
721	iso_pu_bacteria	2599185162	2599369341	285
722	iso_pu_bacteria	2599185163	2599375462	285
723	iso_pu_bacteria	2599185164	2599381355	285
724	iso_pu_bacteria	2599185165	2599387129	285
725	iso_pu_bacteria	2599185166	2599394320	285
726	iso_pu_bacteria	2599185168	2599406085	285
727	iso_pu_bacteria	2599185181	2599463083	285
728	iso_pu_bacteria	2599185182	2599467498	285
729	iso_pu_bacteria	2599185186	2599492100	285
730	iso_pu_bacteria	2599185356	2600215711	285
731	iso_pu_bacteria	2600255313	2601775878	285
732	iso_pu_bacteria	2667528171	2671098992	285
733	iso_pu_bacteria	2818991464	2819704114	285
734	iso_pu_bacteria	2842815866	2842819468	285
735	iso_pu_bacteria	2842849001	2842852439	285
736	iso_pu_bacteria	2844665904	2844666716	285
737	iso_pu_bacteria	2917070673	2917076435	285
738	iso_pu_bacteria	2935353572	2935358592	285
739	iso_pu_bacteria	637000220	637322986	285
740	3300013102	Ga0157371_10000536	Ga0157371_1000053611	286
741	3300046507	Ga0495606_0000785	Ga0495606_0000785_530_1411	286
742	iso_pu_bacteria	2511231156	2511827357	286
743	iso_pu_bacteria	2599185212	2599614113	286
744	iso_pu_bacteria	2599185248	2599768456	286
745	iso_pu_bacteria	2599185289	2599885876	286
746	iso_pu_bacteria	2599185291	2599897590	286
747	iso_pu_bacteria	2599185302	2599945740	286
748	iso_pu_bacteria	2599185304	2599956734	286
749	iso_pu_bacteria	2599185305	2599961503	286
750	iso_pu_bacteria	2599185306	2599965720	286
751	iso_pu_bacteria	2599185308	2599978606	286
752	iso_pu_bacteria	2599185309	2599984825	286
753	iso_pu_bacteria	2599185310	2599988090	286
754	iso_pu_bacteria	2599185311	2599993745	286
755	iso_pu_bacteria	2599185312	2599998880	286
756	iso_pu_bacteria	2599185313	2600008515	286
757	iso_pu_bacteria	2599185314	2600012673	286
758	iso_pu_bacteria	2599185315	2600018696	286
759	iso_pu_bacteria	2599185316	2600025157	286
760	iso_pu_bacteria	2599185317	2600030042	286
761	iso_pu_bacteria	2599185318	2600036571	286
762	iso_pu_bacteria	2599185319	2600041880	286
763	iso_pu_bacteria	2599185320	2600046418	286
764	iso_pu_bacteria	2599185321	2600053132	286
765	iso_pu_bacteria	2599185322	2600060846	286
766	iso_pu_bacteria	2599185323	2600066065	286
767	iso_pu_bacteria	2599185324	2600073643	286
768	iso_pu_bacteria	2599185325	2600079662	286
769	iso_pu_bacteria	2600254930	2600359673	286
770	iso_pu_bacteria	2643221650	2644283395	286
771	iso_pu_bacteria	2651869719	2652546092	286
772	iso_pu_bacteria	2667528170	2671089257	286
773	iso_pu_bacteria	2667528176	2671128761	286
774	iso_pu_bacteria	2675903515	2678265869	286
775	iso_pu_bacteria	2744054620	2745007101	286
776	iso_pu_bacteria	2825651385	2825655380	286
777	iso_pu_bacteria	2842854478	2842855341	286
778	iso_pu_bacteria	2913036834	2913042279	286
779	iso_pu_bacteria	2919155634	2919155669	286
780	iso_pu_bacteria	2923586266	2923591949	286
781	iso_pu_bacteria	2929144301	2929149666	286
782	iso_pu_bacteria	2931369376	2931372929	286
783	iso_pu_bacteria	3007866637	3007867027	286
784	iso_pu_bacteria	3007872151	3007872773	286
785	iso_pu_bacteria	8056143049	8056148488	286
786	3300041411	Ga0439466_0017284	Ga0439466_0017284_864_1736	287
787	3300042013	Ga0439456_000216	Ga0439456_000216_1476_2351	287
788	3300046453	Ga0495627_003175	Ga0495627_003175_5409_6275	287
789	3300046471	Ga0495650_0039499	Ga0495650_0039499_753_1619	287
790	3300046518	Ga0495631_0004735	Ga0495631_0004735_5426_6292	287
791	3300046519	Ga0495632_0029078	Ga0495632_0029078_977_1843	287
792	3300046519	Ga0495632_0050337	Ga0495632_0050337_813_1679	287
793	3300046530	Ga0495654_0025607	Ga0495654_0025607_1031_1897	287
794	3300046692	Ga0495671_0033378	Ga0495671_0033378_1152_2018	287
795	3300047320	Ga0495672_0011183	Ga0495672_0011183_973_1839	287
796	iso_pu_bacteria	2599185188	2599502380	287
797	iso_pu_bacteria	2599185300	2599933925	287
798	iso_pu_bacteria	2791355520	2794598562	287
799	iso_pu_bacteria	2919481497	2919486706	287
800	iso_pu_bacteria	2988728565	2988731213	287
801	iso_pu_bacteria	3007419365	3007425438	287
802	3300046501	Ga0495607_0039142	Ga0495607_0039142_1108_1983	288
803	3300046518	Ga0495631_0117760	Ga0495631_0117760_10_885	288
804	3300046520	Ga0495637_0031582	Ga0495637_0031582_820_1695	288
805	3300046692	Ga0495671_0054568	Ga0495671_0054568_555_1430	288
806	3300046694	Ga0495649_0019233	Ga0495649_0019233_1181_2056	288
807	3300047321	Ga0495676_0015603	Ga0495676_0015603_665_1540	288
808	3300047323	Ga0495683_0000016	Ga0495683_0000016_37348_38223	288
809	3300049460	Ga0495682_0000198	Ga0495682_0000198_12228_13127	288
810	iso_pu_bacteria	2511231004	2511256885	288
811	iso_pu_bacteria	2511231007	2511270957	288
812	iso_pu_bacteria	2511231008	2511279564	288
813	iso_pu_bacteria	2511231016	2511325452	288
814	iso_pu_bacteria	2511231022	2511360541	288
815	iso_pu_bacteria	2623620446	2624494662	288
816	iso_pu_bacteria	2808606361	2808858139	288
817	iso_pu_bacteria	2808606376	2808925992	288
818	iso_pu_bacteria	2808606378	2808938310	288
819	iso_pu_bacteria	2808606380	2808948121	288
820	iso_pu_bacteria	2808606382	2808960803	288
821	iso_pu_bacteria	2808606383	2808966624	288
822	iso_pu_bacteria	2808606389	2809001454	288
823	iso_pu_bacteria	2919456309	2919457276	288
824	iso_pu_bacteria	2919697872	2919700844	288
825	iso_pu_bacteria	3007395558	3007398897	288
826	iso_pu_bacteria	3007511990	3007516914	288
827	iso_pu_bacteria	8019775933	8019777952	288
828	iso_pu_bacteria	8056155041	8056160566	288
829	2162886011	MRS1b_contig_2832839	MRS1b_0004.00000510	289
830	3300013102	Ga0157371_10005541	Ga0157371_100055417	289
831	3300041405	Ga0439438_000569	Ga0439438_000569_14674_15552	289
832	3300048924	Ga0496121_0000688	Ga0496121_0000688_13630_14499	289
833	iso_pu_bacteria	2511231006	2511265726	289
834	iso_pu_bacteria	2511231010	2511292921	289
835	iso_pu_bacteria	2511231011	2511296909	289
836	iso_pu_bacteria	2511231012	2511304612	289
837	iso_pu_bacteria	2511231014	2511311856	289
838	iso_pu_bacteria	2511231015	2511317269	289
839	iso_pu_bacteria	2511231017	2511331319	289
840	iso_pu_bacteria	2511231018	2511337390	289
841	iso_pu_bacteria	2511231019	2511341753	289
842	iso_pu_bacteria	2511231020	2511351415	289
843	iso_pu_bacteria	2511231021	2511357660	289
844	iso_pu_bacteria	2511231023	2511370929	289
845	iso_pu_bacteria	2511231031	2511411631	289
846	iso_pu_bacteria	2512047018	2512327528	289
847	iso_pu_bacteria	2582580891	2583795046	289
848	iso_pu_bacteria	2597489887	2597860607	289
849	iso_pu_bacteria	2599185185	2599486157	289
850	iso_pu_bacteria	2599185257	2599804940	289
851	iso_pu_bacteria	2599185307	2599974728	289
852	iso_pu_bacteria	2600254931	2600366263	289
853	iso_pu_bacteria	2600255283	2601628531	289
854	iso_pu_bacteria	2600255318	2601801065	289
855	iso_pu_bacteria	2603880185	2606073159	289
856	iso_pu_bacteria	2603880199	2606125953	289
857	iso_pu_bacteria	2623620443	2624483132	289
858	iso_pu_bacteria	2643221565	2643842365	289
859	iso_pu_bacteria	2643221589	2643955917	289
860	iso_pu_bacteria	2643221602	2644020711	289
861	iso_pu_bacteria	2643221633	2644186220	289
862	iso_pu_bacteria	2671180172	2671771946	289
863	iso_pu_bacteria	2713897148	2715750099	289
864	iso_pu_bacteria	2713897149	2715756500	289
865	iso_pu_bacteria	2718217725	2718636334	289
866	iso_pu_bacteria	2738541271	2738690317	289
867	iso_pu_bacteria	2738543004	2739198781	289
868	iso_pu_bacteria	2738543015	2739261510	289
869	iso_pu_bacteria	2738543016	2739266091	289
870	iso_pu_bacteria	2738543025	2739312789	289
871	iso_pu_bacteria	2740892503	2743740157	289
872	iso_pu_bacteria	2773857670	2774123657	289
873	iso_pu_bacteria	2773857673	2774135842	289
874	iso_pu_bacteria	2784132063	2784262096	289
875	iso_pu_bacteria	2784132072	2784317533	289
876	iso_pu_bacteria	2808606377	2808932253	289
877	iso_pu_bacteria	2808606381	2808954374	289
878	iso_pu_bacteria	2808606445	2809216909	289
879	iso_pu_bacteria	2818991456	2819654856	289
880	iso_pu_bacteria	2842832357	2842833184	289
881	iso_pu_bacteria	2842843487	2842845423	289
882	iso_pu_bacteria	2852657418	2852662523	289
883	iso_pu_bacteria	2860339153	2860341437	289
884	iso_pu_bacteria	2878029506	2878035070	289
885	iso_pu_bacteria	2880230671	2880235713	289
886	iso_pu_bacteria	2904518522	2904519228	289
887	iso_pu_bacteria	2904550169	2904555479	289
888	iso_pu_bacteria	2919063839	2919065845	289
889	iso_pu_bacteria	2919385768	2919389466	289
890	iso_pu_bacteria	2919487758	2919488433	289
891	iso_pu_bacteria	2923153595	2923159249	289
892	iso_pu_bacteria	2931396565	2931397787	289
893	iso_pu_bacteria	2939636861	2939642151	289
894	iso_pu_bacteria	2969304461	2969309899	289
895	iso_pu_bacteria	2974289157	2974294354	289
896	iso_pu_bacteria	2984286254	2984286898	289
897	iso_pu_bacteria	2998139840	2998145125	289
898	iso_pu_bacteria	3007614139	3007614163	289
899	iso_pu_bacteria	3007619802	3007622229	289
900	iso_pu_bacteria	3007718800	3007720820	289
901	iso_pu_bacteria	3007855910	3007858153	289
902	iso_pu_bacteria	3007861166	3007866585	289
903	iso_pu_bacteria	8015687852	8015693338	289
904	iso_pu_bacteria	8029995093	8029995772	289
905	iso_pu_bacteria	8055770955	8055776588	289
906	iso_pu_bacteria	8056125926	8056131331	289
907	iso_pu_bacteria	8056166840	8056171444	289
908	iso_pu_bacteria	8056172158	8056177688	289
909	iso_pu_bacteria	8056177738	8056181726	289
910	iso_pu_bacteria	8056569372	8056570193	289
911	2162886007	SwRhRL2b_contig_1583477	SwRhRL2b_0836.00002960	290
912	3300003791	Ga0055530_10002340	Ga0055530_100023408	290
913	3300003792	Ga0055540_1001757	Ga0055540_10017578	290
914	3300005288	Ga0065714_10065258	Ga0065714_100652585	290
915	3300005289	Ga0065704_10071389	Ga0065704_100713895	290
916	3300006946	Ga0079104_1001523	Ga0079104_10015236	290
917	3300006948	Ga0099826_10004352	Ga0099826_100043527	290
918	3300013307	Ga0157372_10003469	Ga0157372_1000346911	290
919	3300015261	Ga0182006_1062120	Ga0182006_10621201	290
920	3300015262	Ga0182007_10037888	Ga0182007_100378881	290
921	3300025292	Ga0209676_1005655	Ga0209676_10056555	290
922	3300025298	Ga0209050_1000024	Ga0209050_1000024453	290
923	3300025303	Ga0209051_1000023	Ga0209051_1000023369	290
924	3300025304	Ga0209257_1007928	Ga0209257_10079283	290
925	3300027111	Ga0209281_1000019	Ga0209281_1000019491	290
926	3300030731	Ga0316177_1218477	Ga0316177_12184771	290
927	3300030744	Ga0316181_1020117	Ga0316181_10201174	290
928	3300031548	Ga0307408_100015049	Ga0307408_1000150495	290
929	3300031548	Ga0307408_100015370	Ga0307408_1000153705	290
930	3300031548	Ga0307408_100063778	Ga0307408_1000637782	290
931	3300031548	Ga0307408_100225523	Ga0307408_1002255232	290
932	3300031731	Ga0307405_10000799	Ga0307405_100007998	290
933	3300031731	Ga0307405_10036482	Ga0307405_100364822	290
934	3300031901	Ga0307406_10065807	Ga0307406_100658072	290
935	3300031911	Ga0307412_10010723	Ga0307412_100107234	290
936	3300031911	Ga0307412_10011539	Ga0307412_100115392	290
937	3300031911	Ga0307412_10011820	Ga0307412_100118205	290
938	3300032002	Ga0307416_100210155	Ga0307416_1002101552	290
939	3300032004	Ga0307414_10129328	Ga0307414_101293282	290
940	3300032004	Ga0307414_10137649	Ga0307414_101376492	290
941	3300032004	Ga0307414_10272958	Ga0307414_102729582	290
942	3300032005	Ga0307411_10001537	Ga0307411_100015375	290
943	3300041405	Ga0439438_006061	Ga0439438_006061_2332_3207	290
944	3300041405	Ga0439438_020330	Ga0439438_020330_457_1332	290
945	3300041411	Ga0439466_0028609	Ga0439466_0028609_576_1451	290
946	3300042006	Ga0439432_018180	Ga0439432_018180_961_1836	290
947	3300042010	Ga0439452_026770	Ga0439452_026770_47_922	290
948	3300042145	Ga0450906_009558	Ga0450906_009558_676_1551	290
949	3300042185	Ga0450909_004747	Ga0450909_004747_218_1093	290
950	3300048922	Ga0496119_0000071	Ga0496119_0000071_37844_38728	290
951	3300048923	Ga0496120_0002379	Ga0496120_0002379_2005_2889	290
952	3300048927	Ga0496124_0044184	Ga0496124_0044184_1425_2306	290
953	3300049662	Ga0501222_002321	Ga0501222_002321_456_1331	290
954	3300049853	Ga0501226_005743	Ga0501226_005743_478_1353	290
955	3300005288	Ga0065714_10073782	Ga0065714_100737823	291
956	3300005288	Ga0065714_10076722	Ga0065714_100767223	291
957	3300005288	Ga0065714_10092893	Ga0065714_100928933	291
958	3300005288	Ga0065714_10133035	Ga0065714_101330351	291
959	3300006058	Ga0075432_10018421	Ga0075432_100184213	291
960	3300009011	Ga0105251_10001165	Ga0105251_1000116513	291
961	3300009148	Ga0105243_10017025	Ga0105243_100170253	291
962	3300013100	Ga0157373_10009149	Ga0157373_100091497	291
963	3300014497	Ga0182008_10010336	Ga0182008_100103366	291
964	3300025728	Ga0207655_1000598	Ga0207655_10005989	291
965	3300025735	Ga0207713_1030081	Ga0207713_10300811	291
966	3300025935	Ga0207709_10009462	Ga0207709_100094622	291
967	3300041405	Ga0439438_007462	Ga0439438_007462_579_1457	291
968	3300042006	Ga0439432_010569	Ga0439432_010569_41_919	291
969	3300042147	Ga0450910_003174	Ga0450910_003174_412_1290	291
970	3300046458	Ga0495591_001858	Ga0495591_001858_582_1460	291
971	3300046458	Ga0495591_032202	Ga0495591_032202_259_1137	291
972	3300046471	Ga0495650_0036603	Ga0495650_0036603_390_1268	291
973	3300046474	Ga0495605_0000278	Ga0495605_0000278_13741_14619	291
974	3300046499	Ga0495594_0001700	Ga0495594_0001700_8969_9847	291
975	3300046506	Ga0495583_0000504	Ga0495583_0000504_12425_13303	291
976	3300046512	Ga0495610_0002116	Ga0495610_0002116_1151_2029	291
977	3300046512	Ga0495610_0070809	Ga0495610_0070809_348_1226	291
978	3300046515	Ga0495620_0000153	Ga0495620_0000153_42885_43763	291
979	3300046518	Ga0495631_0006238	Ga0495631_0006238_3759_4637	291
980	3300046520	Ga0495637_0041391	Ga0495637_0041391_169_1047	291
981	3300046524	Ga0495648_0026803	Ga0495648_0026803_1553_2431	291
982	3300046538	Ga0495609_0000166	Ga0495609_0000166_25265_26143	291
983	3300046542	Ga0495597_0020065	Ga0495597_0020065_686_1564	291
984	3300046648	Ga0495611_0000737	Ga0495611_0000737_7798_8676	291
985	3300046665	Ga0495661_0000294	Ga0495661_0000294_13060_13938	291
986	3300046691	Ga0495670_0001901	Ga0495670_0001901_306_1184	291
987	3300046692	Ga0495671_0059568	Ga0495671_0059568_720_1598	291
988	3300046794	Ga0495589_0011950	Ga0495589_0011950_1595_2473	291
989	3300046810	Ga0495660_0007029	Ga0495660_0007029_4323_5201	291
990	3300047323	Ga0495683_0000196	Ga0495683_0000196_43034_43912	291
991	3300047446	Ga0495679_000821	Ga0495679_000821_3097_3975	291
992	3300047470	Ga0495681_0025875	Ga0495681_0025875_1404_2282	291
993	3300047470	Ga0495681_0044834	Ga0495681_0044834_976_1854	291
994	3300049459	Ga0495678_000268	Ga0495678_000268_13818_14696	291
995	2124908027	MRS2a_Contig_9301	MRS2a_00201730	292
996	3300002737	JGI25162J39368_1001036	JGI25162J39368_10010366	292
997	3300002771	JGI25163J39215_1000762	JGI25163J39215_10007622	292
998	3300002772	JGI25164J39214_1000552	JGI25164J39214_100055211	292
999	3300003214	JGI25165J46597_1001104	JGI25165J46597_100110411	292
1000	3300005288	Ga0065714_10002806	Ga0065714_100028066	292
1001	3300005288	Ga0065714_10076634	Ga0065714_100766342	292
1002	3300005289	Ga0065704_10119112	Ga0065704_101191123	292
1003	3300006058	Ga0075432_10010744	Ga0075432_100107444	292
1004	3300009036	Ga0105244_10029278	Ga0105244_100292783	292
1005	3300011119	Ga0105246_10132775	Ga0105246_101327752	292
1006	3300013104	Ga0157370_10302825	Ga0157370_103028252	292
1007	3300014497	Ga0182008_10009741	Ga0182008_100097415	292
1008	3300015261	Ga0182006_1010778	Ga0182006_10107783	292
1009	3300015262	Ga0182007_10003355	Ga0182007_100033556	292
1010	3300015265	Ga0182005_1005044	Ga0182005_10050445	292
1011	3300015265	Ga0182005_1015300	Ga0182005_10153003	292
1012	3300015265	Ga0182005_1018176	Ga0182005_10181762	292
1013	3300017792	Ga0163161_10063081	Ga0163161_100630813	292
1014	3300025207	Ga0209760_100155	Ga0209760_10015528	292
1015	3300025231	Ga0207427_100006	Ga0207427_100006703	292
1016	3300025233	Ga0209437_100013	Ga0209437_100013703	292
1017	3300025261	Ga0209233_1000022	Ga0209233_1000022703	292
1018	3300025728	Ga0207655_1018966	Ga0207655_10189663	292
1019	3300032004	Ga0307414_10074051	Ga0307414_100740513	292
1020	3300041405	Ga0439438_001142	Ga0439438_001142_9615_10496	292
1021	3300041407	Ga0439447_002449	Ga0439447_002449_1072_1953	292
1022	3300041411	Ga0439466_0014824	Ga0439466_0014824_744_1625	292
1023	3300041413	Ga0439465_0015077	Ga0439465_0015077_735_1616	292
1024	3300042006	Ga0439432_002131	Ga0439432_002131_5770_6651	292
1025	3300042009	Ga0439451_001128	Ga0439451_001128_2842_3723	292
1026	3300042010	Ga0439452_012618	Ga0439452_012618_787_1668	292
1027	3300042013	Ga0439456_007108	Ga0439456_007108_721_1602	292
1028	3300042016	Ga0439463_007514	Ga0439463_007514_869_1750	292
1029	3300042115	Ga0450911_002731	Ga0450911_002731_715_1596	292
1030	3300042121	Ga0450919_001193	Ga0450919_001193_1683_2564	292
1031	3300042124	Ga0450922_001315	Ga0450922_001315_817_1698	292
1032	3300042127	Ga0450890_002526	Ga0450890_002526_1013_1894	292
1033	3300042137	Ga0450902_007615	Ga0450902_007615_175_1056	292
1034	3300042138	Ga0450903_001115	Ga0450903_001115_3487_4368	292
1035	3300042139	Ga0450904_008469	Ga0450904_008469_124_1005	292
1036	3300042142	Ga0450905_020259	Ga0450905_020259_76_957	292
1037	3300042145	Ga0450906_003788	Ga0450906_003788_1513_2394	292
1038	3300042147	Ga0450910_002619	Ga0450910_002619_658_1539	292
1039	3300042156	Ga0439446_0008651	Ga0439446_0008651_1015_1896	292
1040	3300042184	Ga0450908_003832	Ga0450908_003832_1316_2197	292
1041	3300042435	Ga0439434_0014276	Ga0439434_0014276_550_1431	292
1042	3300042439	Ga0439464_0012850	Ga0439464_0012850_867_1748	292
1043	3300042461	Ga0439460_0009554	Ga0439460_0009554_691_1572	292
1044	3300042531	Ga0450918_003252	Ga0450918_003252_580_1461	292
1045	3300042532	Ga0450893_0008357	Ga0450893_0008357_628_1509	292
1046	3300042533	Ga0450901_001712	Ga0450901_001712_699_1580	292
1047	3300042993	Ga0439440_0002021	Ga0439440_0002021_714_1595	292
1048	3300046452	Ga0495617_011180	Ga0495617_011180_695_1576	292
1049	3300046457	Ga0495590_0009493	Ga0495590_0009493_803_1684	292
1050	3300046458	Ga0495591_033383	Ga0495591_033383_532_1413	292
1051	3300046460	Ga0495638_0082315	Ga0495638_0082315_889_1770	292
1052	3300046471	Ga0495650_0022462	Ga0495650_0022462_1455_2336	292
1053	3300046471	Ga0495650_0024331	Ga0495650_0024331_586_1467	292
1054	3300046474	Ga0495605_0010941	Ga0495605_0010941_925_1806	292
1055	3300046474	Ga0495605_0037296	Ga0495605_0037296_728_1609	292
1056	3300046474	Ga0495605_0066069	Ga0495605_0066069_262_1143	292
1057	3300046474	Ga0495605_0115475	Ga0495605_0115475_237_1118	292
1058	3300046475	Ga0495639_0006484	Ga0495639_0006484_574_1455	292
1059	3300046491	Ga0495584_0008908	Ga0495584_0008908_3564_4445	292
1060	3300046491	Ga0495584_0022372	Ga0495584_0022372_1637_2518	292
1061	3300046491	Ga0495584_0032245	Ga0495584_0032245_377_1258	292
1062	3300046492	Ga0495585_0030323	Ga0495585_0030323_716_1597	292
1063	3300046492	Ga0495585_0080819	Ga0495585_0080819_552_1433	292
1064	3300046492	Ga0495585_0119386	Ga0495585_0119386_317_1198	292
1065	3300046499	Ga0495594_0073221	Ga0495594_0073221_655_1536	292
1066	3300046501	Ga0495607_0028356	Ga0495607_0028356_1642_2523	292
1067	3300046501	Ga0495607_0035414	Ga0495607_0035414_741_1622	292
1068	3300046501	Ga0495607_0081355	Ga0495607_0081355_502_1383	292
1069	3300046501	Ga0495607_0081632	Ga0495607_0081632_95_976	292
1070	3300046506	Ga0495583_0039867	Ga0495583_0039867_974_1855	292
1071	3300046507	Ga0495606_0044146	Ga0495606_0044146_697_1578	292
1072	3300046512	Ga0495610_0052627	Ga0495610_0052627_887_1768	292
1073	3300046512	Ga0495610_0071420	Ga0495610_0071420_627_1508	292
1074	3300046513	Ga0495616_0011046	Ga0495616_0011046_3586_4467	292
1075	3300046513	Ga0495616_0086332	Ga0495616_0086332_490_1371	292
1076	3300046515	Ga0495620_0039956	Ga0495620_0039956_217_1098	292
1077	3300046517	Ga0495630_0158102	Ga0495630_0158102_106_987	292
1078	3300046518	Ga0495631_0019200	Ga0495631_0019200_731_1612	292
1079	3300046518	Ga0495631_0063809	Ga0495631_0063809_676_1557	292
1080	3300046519	Ga0495632_0022168	Ga0495632_0022168_1817_2698	292
1081	3300046520	Ga0495637_0008252	Ga0495637_0008252_704_1585	292
1082	3300046520	Ga0495637_0047023	Ga0495637_0047023_369_1250	292
1083	3300046522	Ga0495643_0053601	Ga0495643_0053601_550_1431	292
1084	3300046524	Ga0495648_0047059	Ga0495648_0047059_229_1110	292
1085	3300046524	Ga0495648_0056447	Ga0495648_0056447_661_1542	292
1086	3300046524	Ga0495648_0149733	Ga0495648_0149733_207_1124	292
1087	3300046528	Ga0495642_0018573	Ga0495642_0018573_1097_1978	292
1088	3300046530	Ga0495654_0018664	Ga0495654_0018664_2275_3156	292
1089	3300046530	Ga0495654_0035575	Ga0495654_0035575_1534_2415	292
1090	3300046530	Ga0495654_0040206	Ga0495654_0040206_521_1402	292
1091	3300046530	Ga0495654_0073088	Ga0495654_0073088_292_1209	292
1092	3300046536	Ga0495587_0233839	Ga0495587_0233839_85_966	292
1093	3300046538	Ga0495609_0020877	Ga0495609_0020877_744_1625	292
1094	3300046538	Ga0495609_0027068	Ga0495609_0027068_541_1458	292
1095	3300046538	Ga0495609_0131025	Ga0495609_0131025_128_1009	292
1096	3300046542	Ga0495597_0017991	Ga0495597_0017991_693_1574	292
1097	3300046557	Ga0495622_0007840	Ga0495622_0007840_3565_4446	292
1098	3300046558	Ga0495633_0020815	Ga0495633_0020815_2269_3150	292
1099	3300046648	Ga0495611_0038372	Ga0495611_0038372_966_1847	292
1100	3300046660	Ga0495625_0054786	Ga0495625_0054786_1325_2206	292
1101	3300046660	Ga0495625_0063093	Ga0495625_0063093_689_1570	292
1102	3300046664	Ga0495659_0006267	Ga0495659_0006267_2294_3175	292
1103	3300046664	Ga0495659_0020084	Ga0495659_0020084_853_1734	292
1104	3300046665	Ga0495661_0054547	Ga0495661_0054547_766_1647	292
1105	3300046691	Ga0495670_0006296	Ga0495670_0006296_3455_4336	292
1106	3300046691	Ga0495670_0035187	Ga0495670_0035187_553_1470	292
1107	3300046691	Ga0495670_0117465	Ga0495670_0117465_96_977	292
1108	3300046692	Ga0495671_0010712	Ga0495671_0010712_731_1612	292
1109	3300046692	Ga0495671_0064402	Ga0495671_0064402_306_1223	292
1110	3300046692	Ga0495671_0167565	Ga0495671_0167565_157_1038	292
1111	3300046694	Ga0495649_0005996	Ga0495649_0005996_907_1788	292
1112	3300046694	Ga0495649_0059353	Ga0495649_0059353_679_1560	292
1113	3300046694	Ga0495649_0075677	Ga0495649_0075677_95_976	292
1114	3300046794	Ga0495589_0042713	Ga0495589_0042713_828_1709	292
1115	3300046794	Ga0495589_0069761	Ga0495589_0069761_95_976	292
1116	3300046794	Ga0495589_0073189	Ga0495589_0073189_13_894	292
1117	3300046810	Ga0495660_0072639	Ga0495660_0072639_453_1370	292
1118	3300046810	Ga0495660_0103081	Ga0495660_0103081_171_1052	292
1119	3300047320	Ga0495672_0018721	Ga0495672_0018721_3611_4492	292
1120	3300047320	Ga0495672_0053207	Ga0495672_0053207_95_976	292
1121	3300047322	Ga0495680_0099922	Ga0495680_0099922_147_1028	292
1122	3300047323	Ga0495683_0003701	Ga0495683_0003701_1540_2421	292
1123	3300047323	Ga0495683_0055886	Ga0495683_0055886_526_1407	292
1124	3300047443	Ga0495687_012696	Ga0495687_012696_2875_3756	292
1125	3300047443	Ga0495687_017192	Ga0495687_017192_2288_3169	292
1126	3300047469	Ga0495673_0010567	Ga0495673_0010567_1569_2450	292
1127	3300047469	Ga0495673_0013993	Ga0495673_0013993_3296_4177	292
1128	3300047469	Ga0495673_0053945	Ga0495673_0053945_826_1707	292
1129	3300047673	Ga0495593_0067590	Ga0495593_0067590_831_1712	292
1130	3300048091	Ga0495626_0012067	Ga0495626_0012067_109_990	292
1131	3300048091	Ga0495626_0032780	Ga0495626_0032780_1503_2384	292
1132	3300048905	Ga0496102_0358043	Ga0496102_0358043_458_1339	292
1133	3300048909	Ga0496106_0355175	Ga0496106_0355175_17_898	292
1134	3300048919	Ga0496116_0030490	Ga0496116_0030490_2280_3161	292
1135	3300048920	Ga0496117_0111901	Ga0496117_0111901_129_1010	292
1136	3300048920	Ga0496117_0187445	Ga0496117_0187445_253_1134	292
1137	3300048921	Ga0496118_0097491	Ga0496118_0097491_337_1218	292
1138	3300048924	Ga0496121_0119307	Ga0496121_0119307_93_974	292
1139	3300048924	Ga0496121_0133792	Ga0496121_0133792_448_1329	292
1140	3300048925	Ga0496122_0093757	Ga0496122_0093757_868_1749	292
1141	3300048926	Ga0496123_0168916	Ga0496123_0168916_104_985	292
1142	3300048927	Ga0496124_0133256	Ga0496124_0133256_252_1133	292
1143	3300048927	Ga0496124_0170533	Ga0496124_0170533_764_1645	292
1144	3300048928	Ga0496125_0092347	Ga0496125_0092347_694_1575	292
1145	3300048928	Ga0496125_0118626	Ga0496125_0118626_468_1385	292
1146	3300049459	Ga0495678_018303	Ga0495678_018303_726_1607	292
1147	3300049459	Ga0495678_021909	Ga0495678_021909_1816_2697	292
1148	3300049460	Ga0495682_0084156	Ga0495682_0084156_95_976	292
1149	3300049460	Ga0495682_0114670	Ga0495682_0114670_61_942	292
1150	2124908027	MRS2a_Contig_12	MRS2a_00021460	293
1151	2162886011	MRS1b_contig_3623393	MRS1b_0059.00002830	293
1152	3300003323	rootH1_10147567	rootH1_101475673	293
1153	3300003781	Ga0055536_1001103	Ga0055536_100110310	293
1154	3300003791	Ga0055530_10006419	Ga0055530_100064193	293
1155	3300003792	Ga0055540_1001437	Ga0055540_100143710	293
1156	3300003794	Ga0055531_10000286	Ga0055531_1000028613	293
1157	3300005288	Ga0065714_10000117	Ga0065714_100001173	293
1158	3300005288	Ga0065714_10010317	Ga0065714_100103173	293
1159	3300005288	Ga0065714_10010960	Ga0065714_100109603	293
1160	3300005288	Ga0065714_10095240	Ga0065714_100952402	293
1161	3300005290	Ga0065712_10000411	Ga0065712_100004116	293
1162	3300005293	Ga0065715_10002496	Ga0065715_100024963	293
1163	3300005353	Ga0070669_100013824	Ga0070669_1000138244	293
1164	3300005457	Ga0070662_100010144	Ga0070662_1000101445	293
1165	3300005548	Ga0070665_100253582	Ga0070665_1002535822	293
1166	3300006051	Ga0075364_10117527	Ga0075364_101175272	293
1167	3300006051	Ga0075364_10129195	Ga0075364_101291952	293
1168	3300006058	Ga0075432_10002774	Ga0075432_100027744	293
1169	3300006058	Ga0075432_10040342	Ga0075432_100403422	293
1170	3300006058	Ga0075432_10057546	Ga0075432_100575461	293
1171	3300006177	Ga0075362_10042605	Ga0075362_100426052	293
1172	3300006186	Ga0075369_10062448	Ga0075369_100624482	293
1173	3300006353	Ga0075370_10193196	Ga0075370_101931962	293
1174	3300006946	Ga0079104_1001317	Ga0079104_100131710	293
1175	3300006946	Ga0079104_1025908	Ga0079104_10259082	293
1176	3300009011	Ga0105251_10008988	Ga0105251_100089883	293
1177	3300009011	Ga0105251_10028814	Ga0105251_100288143	293
1178	3300009011	Ga0105251_10041074	Ga0105251_100410743	293
1179	3300009011	Ga0105251_10089464	Ga0105251_100894642	293
1180	3300009036	Ga0105244_10027945	Ga0105244_100279452	293
1181	3300009036	Ga0105244_10039581	Ga0105244_100395813	293
1182	3300009036	Ga0105244_10054628	Ga0105244_100546283	293
1183	3300009036	Ga0105244_10058480	Ga0105244_100584803	293
1184	3300009036	Ga0105244_10066565	Ga0105244_100665652	293
1185	3300009036	Ga0105244_10098468	Ga0105244_100984682	293
1186	3300009092	Ga0105250_10006263	Ga0105250_100062632	293
1187	3300009092	Ga0105250_10016888	Ga0105250_100168883	293
1188	3300009092	Ga0105250_10024130	Ga0105250_100241303	293
1189	3300009092	Ga0105250_10125534	Ga0105250_101255342	293
1190	3300009148	Ga0105243_10008088	Ga0105243_100080886	293
1191	3300009148	Ga0105243_10308708	Ga0105243_103087082	293
1192	3300011119	Ga0105246_10000407	Ga0105246_1000040714	293
1193	3300011119	Ga0105246_10023470	Ga0105246_100234705	293
1194	3300012498	Ga0157345_1000462	Ga0157345_10004625	293
1195	3300013100	Ga0157373_10041012	Ga0157373_100410124	293
1196	3300013100	Ga0157373_10065325	Ga0157373_100653253	293
1197	3300013100	Ga0157373_10144184	Ga0157373_101441842	293
1198	3300013100	Ga0157373_10275253	Ga0157373_102752532	293
1199	3300013102	Ga0157371_10005602	Ga0157371_100056026	293
1200	3300013102	Ga0157371_10050109	Ga0157371_100501092	293
1201	3300013102	Ga0157371_10083413	Ga0157371_100834132	293
1202	3300013104	Ga0157370_10077506	Ga0157370_100775063	293
1203	3300013104	Ga0157370_10224380	Ga0157370_102243802	293
1204	3300013105	Ga0157369_10107978	Ga0157369_101079783	293
1205	3300013105	Ga0157369_10143035	Ga0157369_101430352	293
1206	3300013105	Ga0157369_10242806	Ga0157369_102428062	293
1207	3300013105	Ga0157369_10242920	Ga0157369_102429202	293
1208	3300013306	Ga0163162_10038462	Ga0163162_100384624	293
1209	3300013307	Ga0157372_10022649	Ga0157372_100226494	293
1210	3300014497	Ga0182008_10035132	Ga0182008_100351322	293
1211	3300014497	Ga0182008_10077089	Ga0182008_100770892	293
1212	3300014497	Ga0182008_10107242	Ga0182008_101072422	293
1213	3300015261	Ga0182006_1007460	Ga0182006_10074603	293
1214	3300015261	Ga0182006_1021188	Ga0182006_10211883	293
1215	3300015261	Ga0182006_1025415	Ga0182006_10254152	293
1216	3300015261	Ga0182006_1029721	Ga0182006_10297213	293
1217	3300015265	Ga0182005_1005742	Ga0182005_10057423	293
1218	3300015265	Ga0182005_1014928	Ga0182005_10149284	293
1219	3300015265	Ga0182005_1019364	Ga0182005_10193643	293
1220	3300017792	Ga0163161_10051808	Ga0163161_100518083	293
1221	3300017792	Ga0163161_10052419	Ga0163161_100524193	293
1222	3300017792	Ga0163161_10053482	Ga0163161_100534823	293
1223	3300017792	Ga0163161_10187729	Ga0163161_101877292	293
1224	3300025230	Ga0209563_100185	Ga0209563_1001858	293
1225	3300025291	Ga0209675_1001285	Ga0209675_10012859	293
1226	3300025292	Ga0209676_1000015	Ga0209676_1000015687	293
1227	3300025292	Ga0209676_1001895	Ga0209676_100189510	293
1228	3300025292	Ga0209676_1014257	Ga0209676_10142573	293
1229	3300025298	Ga0209050_1000075	Ga0209050_10000756	293
1230	3300025298	Ga0209050_1016850	Ga0209050_10168503	293
1231	3300025303	Ga0209051_1000041	Ga0209051_100004139	293
1232	3300025304	Ga0209257_1000069	Ga0209257_1000069270	293
1233	3300025711	Ga0207696_1000319	Ga0207696_100031940	293
1234	3300025711	Ga0207696_1001632	Ga0207696_10016323	293
1235	3300025711	Ga0207696_1001914	Ga0207696_10019146	293
1236	3300025711	Ga0207696_1005902	Ga0207696_10059024	293
1237	3300025711	Ga0207696_1039594	Ga0207696_10395942	293
1238	3300025728	Ga0207655_1000870	Ga0207655_100087022	293
1239	3300025728	Ga0207655_1000970	Ga0207655_10009708	293
1240	3300025728	Ga0207655_1003015	Ga0207655_10030156	293
1241	3300025728	Ga0207655_1005892	Ga0207655_10058923	293
1242	3300025728	Ga0207655_1006465	Ga0207655_10064656	293
1243	3300025728	Ga0207655_1019257	Ga0207655_10192573	293
1244	3300025728	Ga0207655_1030588	Ga0207655_10305883	293
1245	3300025728	Ga0207655_1035063	Ga0207655_10350633	293
1246	3300025728	Ga0207655_1042853	Ga0207655_10428533	293
1247	3300025728	Ga0207655_1090695	Ga0207655_10906952	293
1248	3300025735	Ga0207713_1002308	Ga0207713_100230810	293
1249	3300025735	Ga0207713_1004443	Ga0207713_10044435	293
1250	3300025735	Ga0207713_1006360	Ga0207713_10063603	293
1251	3300025735	Ga0207713_1009958	Ga0207713_10099582	293
1252	3300025735	Ga0207713_1025466	Ga0207713_10254663	293
1253	3300025735	Ga0207713_1080824	Ga0207713_10808242	293
1254	3300025923	Ga0207681_10017633	Ga0207681_100176335	293
1255	3300025933	Ga0207706_10002416	Ga0207706_1000241610	293
1256	3300025935	Ga0207709_10000086	Ga0207709_10000086122	293
1257	3300025935	Ga0207709_10134741	Ga0207709_101347413	293
1258	3300027111	Ga0209281_1000016	Ga0209281_100001639	293
1259	3300027111	Ga0209281_1003253	Ga0209281_10032534	293
1260	3300027111	Ga0209281_1012185	Ga0209281_10121852	293
1261	3300027111	Ga0209281_1013748	Ga0209281_10137483	293
1262	3300027907	Ga0207428_10018666	Ga0207428_100186663	293
1263	3300027907	Ga0207428_10022659	Ga0207428_100226593	293
1264	3300027907	Ga0207428_10134759	Ga0207428_101347593	293
1265	3300027907	Ga0207428_10182965	Ga0207428_101829652	293
1266	3300027907	Ga0207428_10246716	Ga0207428_102467162	293
1267	3300028379	Ga0268266_10005929	Ga0268266_1000592910	293
1268	3300030735	Ga0316178_1048908	Ga0316178_104890812	293
1269	3300031730	Ga0307516_10168191	Ga0307516_101681912	293
1270	3300031824	Ga0307413_10409253	Ga0307413_104092532	293
1271	3300031911	Ga0307412_10094962	Ga0307412_100949622	293
1272	3300031911	Ga0307412_10290006	Ga0307412_102900062	293
1273	3300031995	Ga0307409_100226521	Ga0307409_1002265212	293
1274	3300032002	Ga0307416_100748881	Ga0307416_1007488812	293
1275	3300033180	Ga0307510_10049701	Ga0307510_100497014	293
1276	3300033180	Ga0307510_10063219	Ga0307510_100632191	293
1277	3300038705	Ga0237819_01808	Ga0237819_01808_2034_2915	293
1278	3300041405	Ga0439438_002538	Ga0439438_002538_6452_7336	293
1279	3300041405	Ga0439438_006680	Ga0439438_006680_2706_3587	293
1280	3300041405	Ga0439438_010754	Ga0439438_010754_1272_2153	293
1281	3300041405	Ga0439438_014691	Ga0439438_014691_187_1068	293
1282	3300041405	Ga0439438_021952	Ga0439438_021952_81_965	293
1283	3300041407	Ga0439447_002170	Ga0439447_002170_3083_3964	293
1284	3300041407	Ga0439447_009332	Ga0439447_009332_1405_2289	293
1285	3300041407	Ga0439447_010188	Ga0439447_010188_654_1535	293
1286	3300041411	Ga0439466_0004132	Ga0439466_0004132_3675_4556	293
1287	3300041411	Ga0439466_0005680	Ga0439466_0005680_292_1176	293
1288	3300041411	Ga0439466_0008678	Ga0439466_0008678_786_1670	293
1289	3300041411	Ga0439466_0016978	Ga0439466_0016978_878_1759	293
1290	3300041411	Ga0439466_0060601	Ga0439466_0060601_213_1094	293
1291	3300042004	Ga0439445_0012655	Ga0439445_0012655_883_1764	293
1292	3300042006	Ga0439432_012089	Ga0439432_012089_862_1743	293
1293	3300042006	Ga0439432_032769	Ga0439432_032769_103_987	293
1294	3300042009	Ga0439451_008522	Ga0439451_008522_428_1312	293
1295	3300042009	Ga0439451_013544	Ga0439451_013544_663_1544	293
1296	3300042009	Ga0439451_022770	Ga0439451_022770_133_1014	293
1297	3300042010	Ga0439452_001810	Ga0439452_001810_984_1868	293
1298	3300042010	Ga0439452_003344	Ga0439452_003344_3375_4256	293
1299	3300042010	Ga0439452_004070	Ga0439452_004070_3556_4440	293
1300	3300042010	Ga0439452_033806	Ga0439452_033806_65_949	293
1301	3300042010	Ga0439452_043364	Ga0439452_043364_125_1006	293
1302	3300042013	Ga0439456_005526	Ga0439456_005526_976_1857	293
1303	3300042013	Ga0439456_006657	Ga0439456_006657_785_1666	293
1304	3300042013	Ga0439456_008743	Ga0439456_008743_1092_1973	293
1305	3300042013	Ga0439456_009929	Ga0439456_009929_824_1705	293
1306	3300042013	Ga0439456_011950	Ga0439456_011950_802_1686	293
1307	3300042016	Ga0439463_000144	Ga0439463_000144_15912_16793	293
1308	3300042115	Ga0450911_001878	Ga0450911_001878_2335_3216	293
1309	3300042115	Ga0450911_003855	Ga0450911_003855_1025_1909	293
1310	3300042115	Ga0450911_007633	Ga0450911_007633_503_1387	293
1311	3300042122	Ga0450920_010188	Ga0450920_010188_774_1655	293
1312	3300042124	Ga0450922_001133	Ga0450922_001133_1262_2143	293
1313	3300042137	Ga0450902_004999	Ga0450902_004999_581_1465	293
1314	3300042137	Ga0450902_006449	Ga0450902_006449_46_927	293
1315	3300042137	Ga0450902_008688	Ga0450902_008688_636_1517	293
1316	3300042137	Ga0450902_010070	Ga0450902_010070_338_1222	293
1317	3300042139	Ga0450904_002022	Ga0450904_002022_728_1609	293
1318	3300042142	Ga0450905_002992	Ga0450905_002992_627_1511	293
1319	3300042142	Ga0450905_003337	Ga0450905_003337_958_1839	293
1320	3300042142	Ga0450905_015256	Ga0450905_015256_89_973	293
1321	3300042145	Ga0450906_005464	Ga0450906_005464_1023_1904	293
1322	3300042146	Ga0450907_001479	Ga0450907_001479_567_1448	293
1323	3300042146	Ga0450907_005038	Ga0450907_005038_856_1737	293
1324	3300042147	Ga0450910_008270	Ga0450910_008270_305_1186	293
1325	3300042156	Ga0439446_0012879	Ga0439446_0012879_420_1301	293
1326	3300042184	Ga0450908_004588	Ga0450908_004588_226_1107	293
1327	3300042184	Ga0450908_012255	Ga0450908_012255_469_1353	293
1328	3300042185	Ga0450909_005208	Ga0450909_005208_721_1602	293
1329	3300042435	Ga0439434_0012311	Ga0439434_0012311_556_1437	293
1330	3300042461	Ga0439460_0006840	Ga0439460_0006840_679_1560	293
1331	3300042461	Ga0439460_0009078	Ga0439460_0009078_1172_2053	293
1332	3300042531	Ga0450918_007307	Ga0450918_007307_885_1766	293
1333	3300046452	Ga0495617_020694	Ga0495617_020694_270_1154	293
1334	3300046452	Ga0495617_032225	Ga0495617_032225_362_1243	293
1335	3300046452	Ga0495617_032630	Ga0495617_032630_173_1054	293
1336	3300046452	Ga0495617_060327	Ga0495617_060327_55_936	293
1337	3300046453	Ga0495627_007266	Ga0495627_007266_2274_3155	293
1338	3300046453	Ga0495627_013275	Ga0495627_013275_709_1590	293
1339	3300046453	Ga0495627_013321	Ga0495627_013321_826_1707	293
1340	3300046453	Ga0495627_014029	Ga0495627_014029_1322_2206	293
1341	3300046453	Ga0495627_030240	Ga0495627_030240_317_1198	293
1342	3300046453	Ga0495627_036840	Ga0495627_036840_431_1315	293
1343	3300046454	Ga0495592_0120246	Ga0495592_0120246_54_935	293
1344	3300046457	Ga0495590_0013474	Ga0495590_0013474_662_1543	293
1345	3300046457	Ga0495590_0015237	Ga0495590_0015237_858_1739	293
1346	3300046457	Ga0495590_0019195	Ga0495590_0019195_396_1280	293
1347	3300046457	Ga0495590_0022226	Ga0495590_0022226_322_1203	293
1348	3300046457	Ga0495590_0042619	Ga0495590_0042619_617_1498	293
1349	3300046457	Ga0495590_0049555	Ga0495590_0049555_354_1238	293
1350	3300046458	Ga0495591_000469	Ga0495591_000469_9631_10515	293
1351	3300046458	Ga0495591_001094	Ga0495591_001094_590_1471	293
1352	3300046458	Ga0495591_003657	Ga0495591_003657_6441_7322	293
1353	3300046458	Ga0495591_005742	Ga0495591_005742_3689_4570	293
1354	3300046458	Ga0495591_008389	Ga0495591_008389_2083_2964	293
1355	3300046458	Ga0495591_013730	Ga0495591_013730_523_1404	293
1356	3300046458	Ga0495591_015398	Ga0495591_015398_523_1404	293
1357	3300046458	Ga0495591_018426	Ga0495591_018426_1317_2198	293
1358	3300046458	Ga0495591_020543	Ga0495591_020543_36_920	293
1359	3300046458	Ga0495591_032041	Ga0495591_032041_588_1469	293
1360	3300046458	Ga0495591_048266	Ga0495591_048266_151_1032	293
1361	3300046458	Ga0495591_048657	Ga0495591_048657_84_968	293
1362	3300046459	Ga0495629_0143484	Ga0495629_0143484_482_1363	293
1363	3300046460	Ga0495638_0019976	Ga0495638_0019976_801_1685	293
1364	3300046460	Ga0495638_0039235	Ga0495638_0039235_1396_2277	293
1365	3300046460	Ga0495638_0040288	Ga0495638_0040288_730_1611	293
1366	3300046460	Ga0495638_0040325	Ga0495638_0040325_1316_2200	293
1367	3300046460	Ga0495638_0082152	Ga0495638_0082152_695_1579	293
1368	3300046460	Ga0495638_0090259	Ga0495638_0090259_255_1136	293
1369	3300046460	Ga0495638_0097501	Ga0495638_0097501_466_1350	293
1370	3300046460	Ga0495638_0097502	Ga0495638_0097502_503_1387	293
1371	3300046460	Ga0495638_0100901	Ga0495638_0100901_430_1314	293
1372	3300046463	Ga0495653_0005671	Ga0495653_0005671_1494_2375	293
1373	3300046471	Ga0495650_0000573	Ga0495650_0000573_44210_45091	293
1374	3300046471	Ga0495650_0007109	Ga0495650_0007109_2213_3094	293
1375	3300046471	Ga0495650_0019350	Ga0495650_0019350_695_1579	293
1376	3300046471	Ga0495650_0024500	Ga0495650_0024500_569_1450	293
1377	3300046471	Ga0495650_0029344	Ga0495650_0029344_648_1529	293
1378	3300046471	Ga0495650_0030327	Ga0495650_0030327_730_1611	293
1379	3300046471	Ga0495650_0037944	Ga0495650_0037944_898_1779	293
1380	3300046471	Ga0495650_0041507	Ga0495650_0041507_416_1300	293
1381	3300046471	Ga0495650_0047326	Ga0495650_0047326_414_1298	293
1382	3300046474	Ga0495605_0005628	Ga0495605_0005628_504_1385	293
1383	3300046474	Ga0495605_0019402	Ga0495605_0019402_1251_2132	293
1384	3300046474	Ga0495605_0019856	Ga0495605_0019856_1310_2191	293
1385	3300046474	Ga0495605_0028461	Ga0495605_0028461_1267_2148	293
1386	3300046474	Ga0495605_0029972	Ga0495605_0029972_1339_2223	293
1387	3300046474	Ga0495605_0030876	Ga0495605_0030876_818_1699	293
1388	3300046474	Ga0495605_0032229	Ga0495605_0032229_505_1389	293
1389	3300046474	Ga0495605_0046179	Ga0495605_0046179_82_963	293
1390	3300046474	Ga0495605_0057240	Ga0495605_0057240_926_1810	293
1391	3300046474	Ga0495605_0158818	Ga0495605_0158818_39_920	293
1392	3300046475	Ga0495639_0193236	Ga0495639_0193236_67_948	293
1393	3300046491	Ga0495584_0034260	Ga0495584_0034260_1178_2062	293
1394	3300046491	Ga0495584_0036595	Ga0495584_0036595_1087_1971	293
1395	3300046491	Ga0495584_0044646	Ga0495584_0044646_663_1544	293
1396	3300046491	Ga0495584_0045953	Ga0495584_0045953_811_1692	293
1397	3300046491	Ga0495584_0059112	Ga0495584_0059112_629_1513	293
1398	3300046491	Ga0495584_0097063	Ga0495584_0097063_15_896	293
1399	3300046492	Ga0495585_0003475	Ga0495585_0003475_5699_6583	293
1400	3300046492	Ga0495585_0019268	Ga0495585_0019268_1163_2068	293
1401	3300046492	Ga0495585_0041195	Ga0495585_0041195_455_1336	293
1402	3300046492	Ga0495585_0061162	Ga0495585_0061162_174_1055	293
1403	3300046492	Ga0495585_0072796	Ga0495585_0072796_89_970	293
1404	3300046492	Ga0495585_0094130	Ga0495585_0094130_672_1553	293
1405	3300046499	Ga0495594_0040221	Ga0495594_0040221_269_1150	293
1406	3300046500	Ga0495596_0003330	Ga0495596_0003330_723_1607	293
1407	3300046500	Ga0495596_0004458	Ga0495596_0004458_5844_6725	293
1408	3300046500	Ga0495596_0015727	Ga0495596_0015727_1526_2407	293
1409	3300046501	Ga0495607_0007038	Ga0495607_0007038_5628_6509	293
1410	3300046501	Ga0495607_0008307	Ga0495607_0008307_5484_6365	293
1411	3300046501	Ga0495607_0008537	Ga0495607_0008537_5589_6470	293
1412	3300046501	Ga0495607_0008688	Ga0495607_0008688_711_1592	293
1413	3300046501	Ga0495607_0025685	Ga0495607_0025685_986_1867	293
1414	3300046501	Ga0495607_0038039	Ga0495607_0038039_504_1388	293
1415	3300046501	Ga0495607_0038872	Ga0495607_0038872_1238_2119	293
1416	3300046501	Ga0495607_0039681	Ga0495607_0039681_681_1562	293
1417	3300046501	Ga0495607_0053263	Ga0495607_0053263_1302_2186	293
1418	3300046501	Ga0495607_0055153	Ga0495607_0055153_418_1299	293
1419	3300046501	Ga0495607_0062877	Ga0495607_0062877_1153_2034	293
1420	3300046501	Ga0495607_0071940	Ga0495607_0071940_867_1748	293
1421	3300046506	Ga0495583_0001876	Ga0495583_0001876_6468_7349	293
1422	3300046506	Ga0495583_0005229	Ga0495583_0005229_4326_5207	293
1423	3300046506	Ga0495583_0011536	Ga0495583_0011536_570_1451	293
1424	3300046506	Ga0495583_0018657	Ga0495583_0018657_1553_2434	293
1425	3300046506	Ga0495583_0022809	Ga0495583_0022809_752_1633	293
1426	3300046506	Ga0495583_0031113	Ga0495583_0031113_517_1398	293
1427	3300046506	Ga0495583_0096097	Ga0495583_0096097_281_1162	293
1428	3300046507	Ga0495606_0000946	Ga0495606_0000946_37996_38877	293
1429	3300046507	Ga0495606_0008698	Ga0495606_0008698_4420_5325	293
1430	3300046507	Ga0495606_0023688	Ga0495606_0023688_2831_3712	293
1431	3300046507	Ga0495606_0036981	Ga0495606_0036981_1145_2026	293
1432	3300046507	Ga0495606_0038295	Ga0495606_0038295_1256_2137	293
1433	3300046507	Ga0495606_0046566	Ga0495606_0046566_688_1569	293
1434	3300046507	Ga0495606_0049392	Ga0495606_0049392_1278_2162	293
1435	3300046507	Ga0495606_0055116	Ga0495606_0055116_1276_2160	293
1436	3300046507	Ga0495606_0058779	Ga0495606_0058779_1334_2215	293
1437	3300046507	Ga0495606_0088457	Ga0495606_0088457_270_1151	293
1438	3300046507	Ga0495606_0106398	Ga0495606_0106398_764_1645	293
1439	3300046512	Ga0495610_0002225	Ga0495610_0002225_2106_2987	293
1440	3300046512	Ga0495610_0021921	Ga0495610_0021921_182_1066	293
1441	3300046512	Ga0495610_0024761	Ga0495610_0024761_1564_2445	293
1442	3300046512	Ga0495610_0029359	Ga0495610_0029359_606_1487	293
1443	3300046512	Ga0495610_0029702	Ga0495610_0029702_708_1589	293
1444	3300046512	Ga0495610_0039637	Ga0495610_0039637_730_1611	293
1445	3300046512	Ga0495610_0041485	Ga0495610_0041485_1221_2102	293
1446	3300046512	Ga0495610_0073771	Ga0495610_0073771_577_1458	293
1447	3300046512	Ga0495610_0077131	Ga0495610_0077131_409_1290	293
1448	3300046512	Ga0495610_0138982	Ga0495610_0138982_104_985	293
1449	3300046513	Ga0495616_0012877	Ga0495616_0012877_3312_4196	293
1450	3300046513	Ga0495616_0032453	Ga0495616_0032453_1284_2165	293
1451	3300046513	Ga0495616_0033462	Ga0495616_0033462_534_1415	293
1452	3300046513	Ga0495616_0036927	Ga0495616_0036927_1064_1945	293
1453	3300046513	Ga0495616_0040310	Ga0495616_0040310_534_1415	293
1454	3300046513	Ga0495616_0050985	Ga0495616_0050985_362_1246	293
1455	3300046513	Ga0495616_0095863	Ga0495616_0095863_434_1315	293
1456	3300046515	Ga0495620_0004296	Ga0495620_0004296_6442_7323	293
1457	3300046515	Ga0495620_0015228	Ga0495620_0015228_2277_3158	293
1458	3300046515	Ga0495620_0021827	Ga0495620_0021827_1582_2466	293
1459	3300046515	Ga0495620_0024744	Ga0495620_0024744_1313_2194	293
1460	3300046515	Ga0495620_0029262	Ga0495620_0029262_186_1070	293
1461	3300046515	Ga0495620_0039768	Ga0495620_0039768_730_1611	293
1462	3300046515	Ga0495620_0060647	Ga0495620_0060647_231_1112	293
1463	3300046517	Ga0495630_0146862	Ga0495630_0146862_179_1063	293
1464	3300046518	Ga0495631_0001987	Ga0495631_0001987_1426_2307	293
1465	3300046518	Ga0495631_0005228	Ga0495631_0005228_5671_6552	293
1466	3300046518	Ga0495631_0042196	Ga0495631_0042196_1076_1960	293
1467	3300046518	Ga0495631_0050828	Ga0495631_0050828_430_1311	293
1468	3300046518	Ga0495631_0134281	Ga0495631_0134281_110_994	293
1469	3300046519	Ga0495632_0008620	Ga0495632_0008620_1706_2587	293
1470	3300046519	Ga0495632_0009663	Ga0495632_0009663_824_1705	293
1471	3300046519	Ga0495632_0010652	Ga0495632_0010652_2869_3750	293
1472	3300046519	Ga0495632_0013213	Ga0495632_0013213_3502_4383	293
1473	3300046519	Ga0495632_0015879	Ga0495632_0015879_2907_3791	293
1474	3300046519	Ga0495632_0030360	Ga0495632_0030360_146_1030	293
1475	3300046519	Ga0495632_0041680	Ga0495632_0041680_997_1878	293
1476	3300046519	Ga0495632_0041739	Ga0495632_0041739_800_1681	293
1477	3300046519	Ga0495632_0068767	Ga0495632_0068767_266_1150	293
1478	3300046519	Ga0495632_0078893	Ga0495632_0078893_376_1260	293
1479	3300046519	Ga0495632_0086628	Ga0495632_0086628_510_1394	293
1480	3300046519	Ga0495632_0089435	Ga0495632_0089435_554_1438	293
1481	3300046519	Ga0495632_0089988	Ga0495632_0089988_493_1377	293
1482	3300046519	Ga0495632_0100385	Ga0495632_0100385_411_1292	293
1483	3300046520	Ga0495637_0000314	Ga0495637_0000314_27080_27961	293
1484	3300046520	Ga0495637_0001991	Ga0495637_0001991_1496_2377	293
1485	3300046520	Ga0495637_0003615	Ga0495637_0003615_665_1546	293
1486	3300046520	Ga0495637_0006841	Ga0495637_0006841_4130_5014	293
1487	3300046520	Ga0495637_0012810	Ga0495637_0012810_901_1782	293
1488	3300046520	Ga0495637_0027599	Ga0495637_0027599_714_1595	293
1489	3300046520	Ga0495637_0032050	Ga0495637_0032050_143_1024	293
1490	3300046520	Ga0495637_0036050	Ga0495637_0036050_634_1515	293
1491	3300046520	Ga0495637_0043390	Ga0495637_0043390_526_1407	293
1492	3300046520	Ga0495637_0051858	Ga0495637_0051858_21_905	293
1493	3300046520	Ga0495637_0052231	Ga0495637_0052231_577_1482	293
1494	3300046520	Ga0495637_0099987	Ga0495637_0099987_157_1041	293
1495	3300046520	Ga0495637_0113456	Ga0495637_0113456_86_967	293
1496	3300046520	Ga0495637_0119453	Ga0495637_0119453_111_995	293
1497	3300046520	Ga0495637_0121260	Ga0495637_0121260_75_956	293
1498	3300046522	Ga0495643_0038344	Ga0495643_0038344_397_1281	293
1499	3300046522	Ga0495643_0044842	Ga0495643_0044842_1052_1933	293
1500	3300046522	Ga0495643_0050868	Ga0495643_0050868_554_1438	293
1501	3300046522	Ga0495643_0084883	Ga0495643_0084883_496_1377	293
1502	3300046523	Ga0495644_0005633	Ga0495644_0005633_1535_2416	293
1503	3300046523	Ga0495644_0014540	Ga0495644_0014540_783_1667	293
1504	3300046523	Ga0495644_0018306	Ga0495644_0018306_385_1269	293
1505	3300046523	Ga0495644_0020048	Ga0495644_0020048_1577_2461	293
1506	3300046523	Ga0495644_0033396	Ga0495644_0033396_995_1879	293
1507	3300046523	Ga0495644_0038334	Ga0495644_0038334_41_922	293
1508	3300046524	Ga0495648_0004127	Ga0495648_0004127_8831_9712	293
1509	3300046524	Ga0495648_0007937	Ga0495648_0007937_2114_2995	293
1510	3300046524	Ga0495648_0007987	Ga0495648_0007987_6448_7329	293
1511	3300046524	Ga0495648_0010554	Ga0495648_0010554_5439_6320	293
1512	3300046524	Ga0495648_0034130	Ga0495648_0034130_902_1783	293
1513	3300046524	Ga0495648_0043355	Ga0495648_0043355_1225_2106	293
1514	3300046524	Ga0495648_0044257	Ga0495648_0044257_1498_2379	293
1515	3300046524	Ga0495648_0049301	Ga0495648_0049301_386_1270	293
1516	3300046524	Ga0495648_0058332	Ga0495648_0058332_20_901	293
1517	3300046524	Ga0495648_0084164	Ga0495648_0084164_848_1729	293
1518	3300046524	Ga0495648_0137774	Ga0495648_0137774_73_954	293
1519	3300046524	Ga0495648_0162968	Ga0495648_0162968_246_1127	293
1520	3300046526	Ga0495666_0017110	Ga0495666_0017110_503_1387	293
1521	3300046528	Ga0495642_0000568	Ga0495642_0000568_801_1682	293
1522	3300046528	Ga0495642_0022755	Ga0495642_0022755_190_1071	293
1523	3300046530	Ga0495654_0011677	Ga0495654_0011677_2193_3077	293
1524	3300046530	Ga0495654_0014370	Ga0495654_0014370_94_978	293
1525	3300046530	Ga0495654_0017526	Ga0495654_0017526_996_1877	293
1526	3300046530	Ga0495654_0027961	Ga0495654_0027961_663_1544	293
1527	3300046530	Ga0495654_0028043	Ga0495654_0028043_1285_2166	293
1528	3300046530	Ga0495654_0029407	Ga0495654_0029407_498_1382	293
1529	3300046530	Ga0495654_0031952	Ga0495654_0031952_610_1494	293
1530	3300046530	Ga0495654_0059458	Ga0495654_0059458_709_1590	293
1531	3300046530	Ga0495654_0079646	Ga0495654_0079646_564_1448	293
1532	3300046530	Ga0495654_0101554	Ga0495654_0101554_129_1010	293
1533	3300046530	Ga0495654_0141538	Ga0495654_0141538_88_969	293
1534	3300046530	Ga0495654_0148992	Ga0495654_0148992_92_973	293
1535	3300046536	Ga0495587_0031576	Ga0495587_0031576_602_1486	293
1536	3300046538	Ga0495609_0000646	Ga0495609_0000646_9797_10678	293
1537	3300046538	Ga0495609_0015024	Ga0495609_0015024_567_1448	293
1538	3300046538	Ga0495609_0024256	Ga0495609_0024256_730_1611	293
1539	3300046538	Ga0495609_0025547	Ga0495609_0025547_788_1669	293
1540	3300046542	Ga0495597_0008030	Ga0495597_0008030_3329_4213	293
1541	3300046542	Ga0495597_0015583	Ga0495597_0015583_2301_3185	293
1542	3300046542	Ga0495597_0022166	Ga0495597_0022166_720_1601	293
1543	3300046542	Ga0495597_0035889	Ga0495597_0035889_850_1734	293
1544	3300046542	Ga0495597_0038807	Ga0495597_0038807_884_1768	293
1545	3300046542	Ga0495597_0045035	Ga0495597_0045035_995_1876	293
1546	3300046542	Ga0495597_0073416	Ga0495597_0073416_303_1184	293
1547	3300046542	Ga0495597_0074512	Ga0495597_0074512_385_1269	293
1548	3300046542	Ga0495597_0109774	Ga0495597_0109774_164_1048	293
1549	3300046542	Ga0495597_0135219	Ga0495597_0135219_79_963	293
1550	3300046543	Ga0495645_0124255	Ga0495645_0124255_19_900	293
1551	3300046557	Ga0495622_0003253	Ga0495622_0003253_6453_7334	293
1552	3300046557	Ga0495622_0048416	Ga0495622_0048416_342_1223	293
1553	3300046557	Ga0495622_0101353	Ga0495622_0101353_348_1229	293
1554	3300046558	Ga0495633_0024552	Ga0495633_0024552_1367_2248	293
1555	3300046615	Ga0495656_0044305	Ga0495656_0044305_849_1730	293
1556	3300046616	Ga0495668_0023212	Ga0495668_0023212_2251_3135	293
1557	3300046616	Ga0495668_0029916	Ga0495668_0029916_791_1672	293
1558	3300046616	Ga0495668_0030146	Ga0495668_0030146_1160_2041	293
1559	3300046616	Ga0495668_0086278	Ga0495668_0086278_315_1196	293
1560	3300046642	Ga0495634_0029174	Ga0495634_0029174_610_1494	293
1561	3300046648	Ga0495611_0002309	Ga0495611_0002309_1690_2571	293
1562	3300046648	Ga0495611_0008005	Ga0495611_0008005_1337_2218	293
1563	3300046648	Ga0495611_0025974	Ga0495611_0025974_723_1604	293
1564	3300046648	Ga0495611_0099630	Ga0495611_0099630_125_1006	293
1565	3300046660	Ga0495625_0000499	Ga0495625_0000499_13459_14340	293
1566	3300046660	Ga0495625_0034212	Ga0495625_0034212_623_1504	293
1567	3300046660	Ga0495625_0041634	Ga0495625_0041634_1654_2535	293
1568	3300046660	Ga0495625_0053479	Ga0495625_0053479_93_977	293
1569	3300046660	Ga0495625_0059397	Ga0495625_0059397_1210_2091	293
1570	3300046660	Ga0495625_0069503	Ga0495625_0069503_804_1688	293
1571	3300046660	Ga0495625_0080989	Ga0495625_0080989_1013_1897	293
1572	3300046660	Ga0495625_0102306	Ga0495625_0102306_554_1438	293
1573	3300046663	Ga0495635_0014372	Ga0495635_0014372_4066_4950	293
1574	3300046665	Ga0495661_0000277	Ga0495661_0000277_44484_45365	293
1575	3300046665	Ga0495661_0000320	Ga0495661_0000320_42339_43220	293
1576	3300046665	Ga0495661_0000340	Ga0495661_0000340_13623_14528	293
1577	3300046665	Ga0495661_0043736	Ga0495661_0043736_1501_2385	293
1578	3300046665	Ga0495661_0054505	Ga0495661_0054505_80_964	293
1579	3300046674	Ga0495588_0040869	Ga0495588_0040869_385_1266	293
1580	3300046674	Ga0495588_0041253	Ga0495588_0041253_211_1092	293
1581	3300046679	Ga0495623_0014876	Ga0495623_0014876_556_1440	293
1582	3300046679	Ga0495623_0049988	Ga0495623_0049988_360_1244	293
1583	3300046680	Ga0495646_0044959	Ga0495646_0044959_857_1738	293
1584	3300046684	Ga0495669_0010614	Ga0495669_0010614_2559_3440	293
1585	3300046690	Ga0495624_0031110	Ga0495624_0031110_1476_2357	293
1586	3300046691	Ga0495670_0010738	Ga0495670_0010738_1602_2483	293
1587	3300046691	Ga0495670_0034464	Ga0495670_0034464_165_1046	293
1588	3300046691	Ga0495670_0060786	Ga0495670_0060786_489_1370	293
1589	3300046692	Ga0495671_0011516	Ga0495671_0011516_460_1341	293
1590	3300046692	Ga0495671_0029198	Ga0495671_0029198_716_1597	293
1591	3300046692	Ga0495671_0031597	Ga0495671_0031597_510_1394	293
1592	3300046692	Ga0495671_0034826	Ga0495671_0034826_405_1289	293
1593	3300046692	Ga0495671_0049253	Ga0495671_0049253_1159_2040	293
1594	3300046692	Ga0495671_0052545	Ga0495671_0052545_1113_1994	293
1595	3300046692	Ga0495671_0056634	Ga0495671_0056634_344_1225	293
1596	3300046692	Ga0495671_0072229	Ga0495671_0072229_91_975	293
1597	3300046692	Ga0495671_0087307	Ga0495671_0087307_143_1024	293
1598	3300046694	Ga0495649_0030549	Ga0495649_0030549_241_1122	293
1599	3300046694	Ga0495649_0031598	Ga0495649_0031598_1525_2409	293
1600	3300046694	Ga0495649_0032479	Ga0495649_0032479_653_1534	293
1601	3300046694	Ga0495649_0039154	Ga0495649_0039154_438_1322	293
1602	3300046694	Ga0495649_0050007	Ga0495649_0050007_906_1787	293
1603	3300046694	Ga0495649_0076264	Ga0495649_0076264_482_1366	293
1604	3300046694	Ga0495649_0078809	Ga0495649_0078809_196_1077	293
1605	3300046694	Ga0495649_0194917	Ga0495649_0194917_103_984	293
1606	3300046794	Ga0495589_0016164	Ga0495589_0016164_1477_2358	293
1607	3300046794	Ga0495589_0036250	Ga0495589_0036250_573_1454	293
1608	3300046794	Ga0495589_0036925	Ga0495589_0036925_731_1615	293
1609	3300046794	Ga0495589_0066804	Ga0495589_0066804_97_978	293
1610	3300046794	Ga0495589_0080239	Ga0495589_0080239_211_1092	293
1611	3300046809	Ga0495600_0055888	Ga0495600_0055888_854_1735	293
1612	3300046810	Ga0495660_0002839	Ga0495660_0002839_1579_2460	293
1613	3300046810	Ga0495660_0029105	Ga0495660_0029105_716_1597	293
1614	3300046810	Ga0495660_0030313	Ga0495660_0030313_1891_2772	293
1615	3300046810	Ga0495660_0041038	Ga0495660_0041038_953_1834	293
1616	3300046810	Ga0495660_0045138	Ga0495660_0045138_1402_2283	293
1617	3300046810	Ga0495660_0046470	Ga0495660_0046470_977_1858	293
1618	3300046810	Ga0495660_0058387	Ga0495660_0058387_1082_1963	293
1619	3300046810	Ga0495660_0096142	Ga0495660_0096142_211_1095	293
1620	3300046810	Ga0495660_0111430	Ga0495660_0111430_442_1326	293
1621	3300047317	Ga0495604_0059158	Ga0495604_0059158_1119_2000	293
1622	3300047317	Ga0495604_0125708	Ga0495604_0125708_364_1248	293
1623	3300047319	Ga0495674_0060181	Ga0495674_0060181_1842_2726	293
1624	3300047320	Ga0495672_0013024	Ga0495672_0013024_3520_4401	293
1625	3300047320	Ga0495672_0014708	Ga0495672_0014708_3919_4803	293
1626	3300047320	Ga0495672_0016203	Ga0495672_0016203_3610_4494	293
1627	3300047320	Ga0495672_0039050	Ga0495672_0039050_1114_1995	293
1628	3300047320	Ga0495672_0039272	Ga0495672_0039272_722_1603	293
1629	3300047320	Ga0495672_0039962	Ga0495672_0039962_1305_2186	293
1630	3300047320	Ga0495672_0041839	Ga0495672_0041839_629_1510	293
1631	3300047320	Ga0495672_0042952	Ga0495672_0042952_708_1592	293
1632	3300047320	Ga0495672_0053632	Ga0495672_0053632_1386_2270	293
1633	3300047320	Ga0495672_0055007	Ga0495672_0055007_716_1597	293
1634	3300047320	Ga0495672_0072136	Ga0495672_0072136_25_906	293
1635	3300047320	Ga0495672_0124869	Ga0495672_0124869_179_1060	293
1636	3300047320	Ga0495672_0144109	Ga0495672_0144109_338_1222	293
1637	3300047321	Ga0495676_0000125	Ga0495676_0000125_13406_14287	293
1638	3300047321	Ga0495676_0063334	Ga0495676_0063334_1137_2018	293
1639	3300047322	Ga0495680_0081430	Ga0495680_0081430_1059_1943	293
1640	3300047322	Ga0495680_0158133	Ga0495680_0158133_359_1243	293
1641	3300047322	Ga0495680_0273720	Ga0495680_0273720_260_1144	293
1642	3300047323	Ga0495683_0017656	Ga0495683_0017656_552_1436	293
1643	3300047323	Ga0495683_0027958	Ga0495683_0027958_716_1597	293
1644	3300047323	Ga0495683_0045984	Ga0495683_0045984_922_1806	293
1645	3300047323	Ga0495683_0065181	Ga0495683_0065181_786_1670	293
1646	3300047323	Ga0495683_0077216	Ga0495683_0077216_717_1598	293
1647	3300047323	Ga0495683_0162830	Ga0495683_0162830_124_1005	293
1648	3300047443	Ga0495687_024619	Ga0495687_024619_1275_2156	293
1649	3300047444	Ga0495675_0010227	Ga0495675_0010227_98_982	293
1650	3300047445	Ga0495677_0021242	Ga0495677_0021242_1007_1888	293
1651	3300047446	Ga0495679_000531	Ga0495679_000531_12529_13410	293
1652	3300047446	Ga0495679_013256	Ga0495679_013256_1060_1941	293
1653	3300047446	Ga0495679_016702	Ga0495679_016702_1255_2139	293
1654	3300047446	Ga0495679_018379	Ga0495679_018379_1068_1949	293
1655	3300047446	Ga0495679_030559	Ga0495679_030559_24_908	293
1656	3300047469	Ga0495673_0004454	Ga0495673_0004454_3595_4476	293
1657	3300047469	Ga0495673_0015636	Ga0495673_0015636_1240_2121	293
1658	3300047469	Ga0495673_0017431	Ga0495673_0017431_489_1373	293
1659	3300047469	Ga0495673_0022590	Ga0495673_0022590_1460_2344	293
1660	3300047469	Ga0495673_0024097	Ga0495673_0024097_899_1780	293
1661	3300047469	Ga0495673_0027918	Ga0495673_0027918_534_1415	293
1662	3300047469	Ga0495673_0029966	Ga0495673_0029966_257_1141	293
1663	3300047469	Ga0495673_0046873	Ga0495673_0046873_1021_1902	293
1664	3300047469	Ga0495673_0065928	Ga0495673_0065928_274_1158	293
1665	3300047469	Ga0495673_0068547	Ga0495673_0068547_190_1074	293
1666	3300047469	Ga0495673_0075723	Ga0495673_0075723_284_1165	293
1667	3300047470	Ga0495681_0005670	Ga0495681_0005670_4348_5229	293
1668	3300047470	Ga0495681_0018133	Ga0495681_0018133_731_1612	293
1669	3300047470	Ga0495681_0022675	Ga0495681_0022675_507_1391	293
1670	3300047470	Ga0495681_0024740	Ga0495681_0024740_1555_2436	293
1671	3300047470	Ga0495681_0033896	Ga0495681_0033896_640_1521	293
1672	3300047470	Ga0495681_0035167	Ga0495681_0035167_958_1839	293
1673	3300047470	Ga0495681_0041963	Ga0495681_0041963_222_1103	293
1674	3300047470	Ga0495681_0053648	Ga0495681_0053648_416_1300	293
1675	3300047470	Ga0495681_0091476	Ga0495681_0091476_152_1036	293
1676	3300047471	Ga0495684_0074324	Ga0495684_0074324_438_1322	293
1677	3300047471	Ga0495684_0167075	Ga0495684_0167075_707_1588	293
1678	3300047472	Ga0495686_0050820	Ga0495686_0050820_1325_2209	293
1679	3300047472	Ga0495686_0053812	Ga0495686_0053812_1171_2052	293
1680	3300047472	Ga0495686_0060626	Ga0495686_0060626_811_1692	293
1681	3300047472	Ga0495686_0086388	Ga0495686_0086388_702_1583	293
1682	3300047472	Ga0495686_0105386	Ga0495686_0105386_227_1108	293
1683	3300047673	Ga0495593_0033060	Ga0495593_0033060_404_1288	293
1684	3300047673	Ga0495593_0078997	Ga0495593_0078997_91_972	293
1685	3300048088	Ga0495602_0064252	Ga0495602_0064252_1063_1944	293
1686	3300048091	Ga0495626_0000283	Ga0495626_0000283_44267_45148	293
1687	3300048091	Ga0495626_0002041	Ga0495626_0002041_721_1605	293
1688	3300048091	Ga0495626_0004879	Ga0495626_0004879_6454_7338	293
1689	3300048091	Ga0495626_0017521	Ga0495626_0017521_1508_2389	293
1690	3300048091	Ga0495626_0021166	Ga0495626_0021166_168_1049	293
1691	3300048091	Ga0495626_0024702	Ga0495626_0024702_787_1668	293
1692	3300048091	Ga0495626_0050863	Ga0495626_0050863_937_1818	293
1693	3300048091	Ga0495626_0055923	Ga0495626_0055923_404_1285	293
1694	3300048091	Ga0495626_0064751	Ga0495626_0064751_716_1597	293
1695	3300048091	Ga0495626_0090404	Ga0495626_0090404_62_943	293
1696	3300048091	Ga0495626_0132246	Ga0495626_0132246_148_1029	293
1697	3300048905	Ga0496102_0010442	Ga0496102_0010442_6442_7326	293
1698	3300048905	Ga0496102_0072952	Ga0496102_0072952_1206_2087	293
1699	3300048906	Ga0496103_0023758	Ga0496103_0023758_567_1451	293
1700	3300048913	Ga0496110_0129451	Ga0496110_0129451_302_1183	293
1701	3300048913	Ga0496110_0191097	Ga0496110_0191097_501_1382	293
1702	3300048914	Ga0496111_0075006	Ga0496111_0075006_1438_2319	293
1703	3300048918	Ga0496115_0121469	Ga0496115_0121469_199_1083	293
1704	3300048919	Ga0496116_0025141	Ga0496116_0025141_2286_3167	293
1705	3300048919	Ga0496116_0045565	Ga0496116_0045565_1202_2083	293
1706	3300048919	Ga0496116_0049206	Ga0496116_0049206_1010_1891	293
1707	3300048919	Ga0496116_0061993	Ga0496116_0061993_577_1458	293
1708	3300048919	Ga0496116_0064174	Ga0496116_0064174_629_1513	293
1709	3300048920	Ga0496117_0046001	Ga0496117_0046001_1616_2500	293
1710	3300048920	Ga0496117_0086353	Ga0496117_0086353_87_968	293
1711	3300048920	Ga0496117_0094035	Ga0496117_0094035_901_1782	293
1712	3300048921	Ga0496118_0053834	Ga0496118_0053834_598_1482	293
1713	3300048921	Ga0496118_0054564	Ga0496118_0054564_889_1770	293
1714	3300048921	Ga0496118_0083648	Ga0496118_0083648_1291_2172	293
1715	3300048921	Ga0496118_0180007	Ga0496118_0180007_160_1041	293
1716	3300048922	Ga0496119_0051679	Ga0496119_0051679_930_1811	293
1717	3300048923	Ga0496120_0068970	Ga0496120_0068970_506_1387	293
1718	3300048924	Ga0496121_0004830	Ga0496121_0004830_16099_16980	293
1719	3300048924	Ga0496121_0032852	Ga0496121_0032852_3734_4615	293
1720	3300048924	Ga0496121_0066497	Ga0496121_0066497_818_1699	293
1721	3300048924	Ga0496121_0066973	Ga0496121_0066973_1032_1913	293
1722	3300048924	Ga0496121_0085152	Ga0496121_0085152_709_1593	293
1723	3300048924	Ga0496121_0232633	Ga0496121_0232633_273_1154	293
1724	3300048925	Ga0496122_0003730	Ga0496122_0003730_12307_13188	293
1725	3300048925	Ga0496122_0061549	Ga0496122_0061549_736_1617	293
1726	3300048925	Ga0496122_0064118	Ga0496122_0064118_770_1651	293
1727	3300048926	Ga0496123_0002423	Ga0496123_0002423_21247_22128	293
1728	3300048926	Ga0496123_0036540	Ga0496123_0036540_1960_2841	293
1729	3300048926	Ga0496123_0074870	Ga0496123_0074870_713_1594	293
1730	3300048927	Ga0496124_0000730	Ga0496124_0000730_9756_10637	293
1731	3300048927	Ga0496124_0023515	Ga0496124_0023515_1075_1956	293
1732	3300048927	Ga0496124_0031348	Ga0496124_0031348_715_1599	293
1733	3300048927	Ga0496124_0087221	Ga0496124_0087221_669_1550	293
1734	3300048927	Ga0496124_0100486	Ga0496124_0100486_867_1748	293
1735	3300048927	Ga0496124_0106112	Ga0496124_0106112_1288_2169	293
1736	3300048927	Ga0496124_0174887	Ga0496124_0174887_301_1182	293
1737	3300048928	Ga0496125_0084284	Ga0496125_0084284_684_1565	293
1738	3300048928	Ga0496125_0100998	Ga0496125_0100998_1026_1907	293
1739	3300049459	Ga0495678_002235	Ga0495678_002235_4669_5550	293
1740	3300049459	Ga0495678_009680	Ga0495678_009680_3600_4481	293
1741	3300049459	Ga0495678_017554	Ga0495678_017554_71_955	293
1742	3300049459	Ga0495678_020076	Ga0495678_020076_1356_2237	293
1743	3300049459	Ga0495678_023033	Ga0495678_023033_401_1285	293
1744	3300049459	Ga0495678_024909	Ga0495678_024909_1162_2043	293
1745	3300049459	Ga0495678_027780	Ga0495678_027780_981_1862	293
1746	3300049459	Ga0495678_028773	Ga0495678_028773_1271_2152	293
1747	3300049459	Ga0495678_030683	Ga0495678_030683_1142_2023	293
1748	3300049459	Ga0495678_034735	Ga0495678_034735_33_938	293
1749	3300049459	Ga0495678_039558	Ga0495678_039558_66_950	293
1750	3300049459	Ga0495678_058369	Ga0495678_058369_430_1311	293
1751	3300049459	Ga0495678_089966	Ga0495678_089966_127_1008	293
1752	3300049460	Ga0495682_0004976	Ga0495682_0004976_3787_4668	293
1753	3300049460	Ga0495682_0016137	Ga0495682_0016137_1053_1934	293
1754	3300049460	Ga0495682_0022947	Ga0495682_0022947_1367_2248	293
1755	3300049460	Ga0495682_0053102	Ga0495682_0053102_423_1304	293
1756	3300049758	Ga0501241_004447	Ga0501241_004447_1074_1955	293
1757	3300049766	Ga0501269_002363	Ga0501269_002363_584_1465	293
1758	3300050491	nmdc:mga00v17_225042_c1	nmdc:mga00v17_225042_c1_34_915	293
1759	3300050491	nmdc:mga00v17_68553_c1	nmdc:mga00v17_68553_c1_841_1722	293
1760	3300053111	Ga0500572_006534	Ga0500572_006534_981_1862	293
1761	3300053145	Ga0500586_035628	Ga0500586_035628_761_1642	293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

252

0.74 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2dfj-assembly1.cif.gz_B	crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a	0.9595	2	266
2dfj-assembly1.cif.gz_B	crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a	0.949	2	266
2qjc-assembly1.cif.gz_A	crystal structure of a putative diadenosine tetraphosphatase	0.8457	3	267
2qjc-assembly1.cif.gz_A	crystal structure of a putative diadenosine tetraphosphatase	0.7854	3	267
4j6o-assembly2.cif.gz_B	crystal structure of the phosphatase domain of c. thermocellum (bacterial) pnkp	0.6989	2	272

ID	Description	Score	Start	End	Superfamily
2dfjA00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.96	2	264	3.60.21.10
2dfjA00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.9425	2	264	3.60.21.10
af_Q94230_157_226_3.10.450.700	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.8522	251	268	3.10.450.700
2qjcA00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.844	3	267	3.60.21.10
2qjcA00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.7828	3	267	3.60.21.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7C6WGA6-F1-model_v4	deleted	0.9971	1	241
AF-A0A1Y3P071-F1-model_v4	Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase)	0.9942	1	274	GO:0008803
AF-A0A2W5W5G0-F1-model_v4	deleted	0.9918	1	181
AF-F3GJI6-F1-model_v4	Diadenosine tetraphosphatase (EC 3.6.1.41)	0.9904	1	183	GO:0008803
AF-A0A2T6FKE4-F1-model_v4	Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase)	0.9903	1	267	GO:0008803

Feature Viewer

pLDDT	pTM	Quality
94.25	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495616

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

252

0.74

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map