F495525

General Info

Members Datasets Scaffolds Average Seq Length
1736 499 1716 275

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10260413|Ga0207698_102604132
Length 315
Sequence MSTVQALEPGSRYDLRVGISPDAPDEDQFKDEKGAFGYCHSYETSSRYDGPGLRVVLFVSGCLLRCTYCHNPDTWHLKDGTYVSAEHVLRRLGDFAPALRSLGGGLTISGGEAMVQMEFTRRIFAGAKAMGLHTAIQTSGFLGDRVDEDYLSKIDLVLLDIKSSDPETYRRVTGRDLAPTLRFAERLAAQSKPTWIRFTLVPGETDDPANVDGIARFVAPMKNVEWVEVLPFHQLGAFKWKALNMNYTLENTAPASPELVAKMGLSEEEIETLVAERTQAKKTRNFARADAIRAELLAKGVVIEDSKDGVRWKRK

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
3 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
4 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
5 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
6 2791355199
7 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
8 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
9 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
10 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
11 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
12 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
13 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
14 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
15 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
16 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
17 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
18 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
19 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
20 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
21 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
22 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
23 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
29 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
30 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
31 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
32 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
33 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
34 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
35 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
40 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
75 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
80 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
88 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
96 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
97 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
98 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
99 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
120 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
121 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
125 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
139 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
140 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
141 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
146 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
148 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
149 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
150 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
151 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
152 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
153 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
154 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
155 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
156 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
157 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
158 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
159 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
160 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
161 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
162 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
163 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
164 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
165 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
166 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
167 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
168 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
169 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
170 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
171 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
172 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
173 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
174 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
175 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
176 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
177 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
178 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
179 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
180 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
181 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
183 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
184 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
256 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
258 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
262 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
263 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
264 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
265 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
266 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
274 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
275 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
276 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
277 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
278 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
279 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
280 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
281 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
282 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
283 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
284 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
285 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
286 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
287 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
289 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
291 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
292 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
293 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
294 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
295 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
296 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
297 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
298 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
299 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
300 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
301 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
302 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
303 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
304 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
305 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
306 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
307 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
308 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
309 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
312 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
313 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
314 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
315 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
316 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
317 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
320 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
321 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
322 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
323 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
324 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
325 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
328 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
332 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
333 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
339 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
342 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
343 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
344 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
345 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
346 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
347 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
348 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
349 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
350 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
351 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
352 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
353 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
354 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
355 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
356 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
357 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
358 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
359 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
360 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
361 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
362 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
365 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
370 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
371 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
372 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
381 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
382 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
383 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
384 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
385 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
386 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
387 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
388 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
389 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
390 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
391 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
392 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
393 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
394 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
395 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
398 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
399 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
400 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
401 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
402 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
403 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
404 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
408 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
409 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
410 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
411 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
412 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
413 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
414 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
415 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
416 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
436 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
437 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
438 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
439 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
440 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
443 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
445 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
446 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
447 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
448 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
449 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
450 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
451 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
452 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
453 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
454 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
455 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
456 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
457 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
458 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
459 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
460 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
461 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
462 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
463 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
464 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
465 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
466 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
467 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
468 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
469 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
470 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
471 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
472 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
473 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
474 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
475 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
476 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
477 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
478 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
479 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
480 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
481 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
482 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
483 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
484 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
485 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
486 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
487 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
488 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
489 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
490 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
491 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
492 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
493 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
494 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
495 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
496 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
497 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
498 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
499 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0.06
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.97
Nodule 0.86
Rhizoplane 8.76
Rhizosphere 79.9
Stem 0
Stem Tuber 0
Unclassified 3.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214828546 2209111006 Bacteria 9054
2 ARcpr5oldR_c000066 3300000041 Bacteria 19126
3 ARSoilYngRDRAFT_c00024 3300000042 Bacteria 23160
4 ARcpr5yngRDRAFT_c000287 3300000043 Bacteria 7122
5 ARSoilOldRDRAFT_c000018 3300000044 Bacteria 38229
6 ARCol0yngRDRAFT_1000070 3300000652 Bacteria 18935
7 JGI24752J21851_1000498 3300001976 Bacteria 5259
8 JGI24739J22299_10001019 3300001989 Bacteria 10385
9 JGI24739J22299_10005255 3300001989 Bacteria 4933
10 JGI24737J22298_10000089 3300001990 Bacteria 27032
11 JGI24737J22298_10003482 3300001990 Bacteria 5551
12 JGI24743J22301_10008556 3300001991 Bacteria 1796
13 JGI24735J21928_10007734 3300002067 Bacteria 3494
14 JGI24750J21931_1000015 3300002070 Bacteria 21084
15 JGI24738J21930_10000622 3300002075 Bacteria 10193
16 JGI24749J21850_1000310 3300002076 Bacteria 7467
17 JGI24035J26624_1000078 3300002126 Bacteria 7943
18 JGI24033J26618_1003298 3300002155 Bacteria 1695
19 JGI24034J26672_10000183 3300002239 Bacteria 8485
20 JGI24742J22300_10001638 3300002244 Bacteria 3560
21 JGI24751J29686_10040699 3300002459 Bacteria 962
22 JGI25153J46596_10001175 3300003215 Bacteria 15812
23 rootH1_10154409 3300003316 Bacteria 1242
24 rootH1_10154409 3300003323 Bacteria 1536
25 rootH1_10353167 3300003323 Bacteria 2530
26 JGI25404J52841_10000680 3300003659 Bacteria 5218
27 JGI25404J52841_10002384 3300003659 Bacteria 3546
28 JGI25404J52841_10002856 3300003659 Bacteria 3336
29 JGI25404J52841_10010925 3300003659 Bacteria 1954
30 JGI25404J52841_10030387 3300003659 Bacteria 1157
31 Ga0058860_12238834 3300004801 Bacteria 1339
32 Ga0065716_1001769 3300005277 Bacteria 3505
33 Ga0065712_10002621 3300005290 Bacteria 5162
34 Ga0065712_10005537 3300005290 Bacteria 3046
35 Ga0065715_10001265 3300005293 Bacteria 7698
36 Ga0065715_10004852 3300005293 Bacteria 3610
37 Ga0065715_10100520 3300005293 Bacteria 3295
38 Ga0065707_10125803 3300005295 Bacteria 2016
39 Ga0070658_10001973 3300005327 Bacteria 17251
40 Ga0070658_10014461 3300005327 Bacteria 6332
41 Ga0070658_10251602 3300005327 Bacteria 1499
42 Ga0070658_10342445 3300005327 Bacteria 1279
43 Ga0070676_10000050 3300005328 Bacteria 37741
44 Ga0070683_100000159 3300005329 Bacteria 44340
45 Ga0070690_100002858 3300005330 Bacteria 9311
46 Ga0070690_100005723 3300005330 Bacteria 6998
47 Ga0070670_100004244 3300005331 Bacteria 11990
48 Ga0070670_100020718 3300005331 Bacteria 5653
49 Ga0070670_100155384 3300005331 Bacteria 1981
50 Ga0070670_100236344 3300005331 Bacteria 1591
51 Ga0070677_10000902 3300005333 Bacteria 9742
52 Ga0068869_100000171 3300005334 Bacteria 32781
53 Ga0068869_100009191 3300005334 Bacteria 6404
54 Ga0068869_100055624 3300005334 Bacteria 2884
55 Ga0068869_100080355 3300005334 Bacteria 2432
56 Ga0068869_100089538 3300005334 Bacteria 2311
57 Ga0070666_10021770 3300005335 Bacteria 4156
58 Ga0070666_10031042 3300005335 Bacteria 3526
59 Ga0070680_100004647 3300005336 Bacteria 10326
60 Ga0070680_100035382 3300005336 Bacteria 4031
61 Ga0070680_100229389 3300005336 Bacteria 1568
62 Ga0070682_100000572 3300005337 Bacteria 22630
63 Ga0070682_100006064 3300005337 Bacteria 6768
64 Ga0070682_100018988 3300005337 Bacteria 4026
65 Ga0068868_100001791 3300005338 Bacteria 14746
66 Ga0068868_100026836 3300005338 Bacteria 4391
67 Ga0068868_100059128 3300005338 Bacteria 3031
68 Ga0068868_100147290 3300005338 Bacteria 1937
69 Ga0068868_100401761 3300005338 Bacteria 1183
70 Ga0070660_100000375 3300005339 Bacteria 29726
71 Ga0070660_100011917 3300005339 Bacteria 6201
72 Ga0070660_100072708 3300005339 Bacteria 2688
73 Ga0070660_100130071 3300005339 Bacteria 2014
74 Ga0070689_100001188 3300005340 Bacteria 16485
75 Ga0070689_100002253 3300005340 Bacteria 12528
76 Ga0070689_100012317 3300005340 Bacteria 6157
77 Ga0070689_100029736 3300005340 Bacteria 4139
78 Ga0070689_100498174 3300005340 Unclassified 1043
79 Ga0070691_10001969 3300005341 Bacteria 9041
80 Ga0070691_10023318 3300005341 Bacteria 2873
81 Ga0070691_10141366 3300005341 Bacteria 1227
82 Ga0070687_100000165 3300005343 Bacteria 22980
83 Ga0070687_100010913 3300005343 Bacteria 3953
84 Ga0070687_100073849 3300005343 Bacteria 1839
85 Ga0070687_100154889 3300005343 Bacteria 1349
86 Ga0070661_100001486 3300005344 Bacteria 16283
87 Ga0070661_100027428 3300005344 Bacteria 4101
88 Ga0070661_100406522 3300005344 Unclassified 1077
89 Ga0070692_10093741 3300005345 Bacteria 1635
90 Ga0070668_100000296 3300005347 Bacteria 32536
91 Ga0070668_100006143 3300005347 Bacteria 8904
92 Ga0070668_100009054 3300005347 Bacteria 7393
93 Ga0070668_100035472 3300005347 Bacteria 3803
94 Ga0070668_100331341 3300005347 Bacteria 1284
95 Ga0070668_100657489 3300005347 Unclassified 921
96 Ga0070669_100016776 3300005353 Bacteria 5226
97 Ga0070669_100023899 3300005353 Bacteria 4379
98 Ga0070669_100026981 3300005353 Bacteria 4134
99 Ga0070669_100321500 3300005353 Bacteria 1249
100 Ga0070675_100000479 3300005354 Bacteria 27353
101 Ga0070675_100193430 3300005354 Bacteria 1763
102 Ga0070675_100518179 3300005354 Bacteria 1076
103 Ga0070671_100000222 3300005355 Bacteria 37829
104 Ga0070671_100024782 3300005355 Bacteria 4914
105 Ga0070671_100025750 3300005355 Bacteria 4830
106 Ga0070671_100033801 3300005355 Bacteria 4231
107 Ga0070671_100073665 3300005355 Bacteria 2852
108 Ga0070671_100430129 3300005355 Bacteria 1131
109 Ga0070674_100011339 3300005356 Bacteria 5425
110 Ga0070674_100262458 3300005356 Bacteria 1361
111 Ga0070674_100358998 3300005356 Bacteria 1179
112 Ga0070673_100000081 3300005364 Bacteria 41464
113 Ga0070673_100094191 3300005364 Bacteria 2454
114 Ga0070688_100000671 3300005365 Bacteria 17033
115 Ga0070688_100029898 3300005365 Bacteria 3265
116 Ga0070688_100084118 3300005365 Bacteria 2066
117 Ga0070688_100106012 3300005365 Bacteria 1861
118 Ga0070688_100107330 3300005365 Bacteria 1851
119 Ga0070688_100170906 3300005365 Bacteria 1500
120 Ga0070688_100185424 3300005365 Bacteria 1446
121 Ga0070659_100007084 3300005366 Bacteria 8129
122 Ga0070659_100009215 3300005366 Bacteria 7244
123 Ga0070659_100126931 3300005366 Bacteria 2070
124 Ga0070667_100001020 3300005367 Bacteria 25561
125 Ga0070667_100044976 3300005367 Bacteria 3711
126 Ga0070667_100124077 3300005367 Bacteria 2249
127 Ga0070667_100139331 3300005367 Bacteria 2123
128 Ga0070667_100282944 3300005367 Bacteria 1489
129 Ga0070667_100490067 3300005367 Bacteria 1126
130 Ga0070703_10001476 3300005406 Bacteria 7067
131 Ga0070703_10005749 3300005406 Bacteria 3473
132 Ga0070709_10009892 3300005434 Bacteria 5269
133 Ga0070709_10010540 3300005434 Bacteria 5122
134 Ga0070714_100005014 3300005435 Bacteria 10066
135 Ga0070714_100108266 3300005435 Bacteria 2457
136 Ga0070714_100135367 3300005435 Bacteria 2206
137 Ga0070714_100148382 3300005435 Bacteria 2111
138 Ga0070714_100218213 3300005435 Bacteria 1751
139 Ga0070714_100314989 3300005435 Bacteria 1462
140 Ga0070713_100006817 3300005436 Bacteria 7958
141 Ga0070713_100025196 3300005436 Bacteria 4647
142 Ga0070713_100071029 3300005436 Bacteria 2941
143 Ga0070713_100071691 3300005436 Bacteria 2928
144 Ga0070713_100112582 3300005436 Bacteria 2375
145 Ga0070713_100237163 3300005436 Bacteria 1660
146 Ga0070710_10008119 3300005437 Bacteria 5104
147 Ga0070710_10017902 3300005437 Bacteria 3637
148 Ga0070710_10026587 3300005437 Bacteria 3076
149 Ga0070710_10243970 3300005437 Bacteria 1152
150 Ga0070701_10000519 3300005438 Bacteria 13253
151 Ga0070701_10022423 3300005438 Bacteria 3027
152 Ga0070701_10142288 3300005438 Bacteria 1373
153 Ga0070711_100019842 3300005439 Bacteria 4321
154 Ga0070705_100000592 3300005440 Bacteria 21091
155 Ga0070705_100043727 3300005440 Bacteria 2569
156 Ga0070705_100060819 3300005440 Bacteria 2242
157 Ga0070705_100300773 3300005440 Bacteria 1149
158 Ga0070700_100003391 3300005441 Bacteria 8215
159 Ga0070700_100033577 3300005441 Bacteria 3091
160 Ga0070700_100145831 3300005441 Bacteria 1613
161 Ga0070700_100220675 3300005441 Bacteria 1343
162 Ga0070694_100006159 3300005444 Bacteria 7282
163 Ga0070694_100021576 3300005444 Bacteria 4117
164 Ga0070708_100005035 3300005445 Bacteria 10454
165 Ga0070708_100286318 3300005445 Bacteria 1551
166 Ga0070663_100007153 3300005455 Bacteria 6776
167 Ga0070663_100019665 3300005455 Bacteria 4458
168 Ga0070663_100022020 3300005455 Bacteria 4252
169 Ga0070663_100029267 3300005455 Bacteria 3761
170 Ga0070663_100038056 3300005455 Bacteria 3353
171 Ga0070663_100121094 3300005455 Bacteria 1976
172 Ga0070663_100152090 3300005455 Bacteria 1775
173 Ga0070663_100164620 3300005455 Bacteria 1709
174 Ga0070663_100219648 3300005455 Bacteria 1491
175 Ga0070663_100541959 3300005455 Bacteria 971
176 Ga0070678_100000464 3300005456 Bacteria 19354
177 Ga0070678_100002919 3300005456 Bacteria 9472
178 Ga0070678_100008372 3300005456 Bacteria 6195
179 Ga0070678_100040022 3300005456 Bacteria 3314
180 Ga0070678_100104206 3300005456 Bacteria 2205
181 Ga0070678_100153067 3300005456 Bacteria 1860
182 Ga0070678_100437577 3300005456 Bacteria 1143
183 Ga0070662_100012986 3300005457 Bacteria 5534
184 Ga0070662_100017117 3300005457 Bacteria 4878
185 Ga0070662_100053784 3300005457 Bacteria 2916
186 Ga0070662_100173977 3300005457 Bacteria 1693
187 Ga0070662_100508056 3300005457 Bacteria 1006
188 Ga0070681_10020065 3300005458 Bacteria 6697
189 Ga0070681_10043199 3300005458 Bacteria 4515
190 Ga0070681_10211221 3300005458 Bacteria 1857
191 Ga0068867_100140150 3300005459 Bacteria 1889
192 Ga0070685_10019717 3300005466 Bacteria 3643
193 Ga0070685_10108511 3300005466 Bacteria 1706
194 Ga0070685_10187159 3300005466 Bacteria 1337
195 Ga0070685_10325582 3300005466 Bacteria 1043
196 Ga0070706_100029910 3300005467 Bacteria 5017
197 Ga0070707_100103447 3300005468 Bacteria 2760
198 Ga0070698_100075300 3300005471 Bacteria 3379
199 Ga0070699_100071679 3300005518 Bacteria 3014
200 Ga0070679_100083520 3300005530 Bacteria 3182
201 Ga0070679_100093507 3300005530 Bacteria 2994
202 Ga0070679_100212647 3300005530 Bacteria 1897
203 Ga0070684_100000239 3300005535 Bacteria 37945
204 Ga0070684_100037174 3300005535 Bacteria 4174
205 Ga0070684_100476423 3300005535 Bacteria 1155
206 Ga0070697_100080480 3300005536 Bacteria 2684
207 Ga0068853_100001830 3300005539 Bacteria 15643
208 Ga0068853_100004035 3300005539 Bacteria 11297
209 Ga0068853_100028494 3300005539 Bacteria 4698
210 Ga0068853_100058467 3300005539 Bacteria 3328
211 Ga0068853_100129873 3300005539 Bacteria 2255
212 Ga0070672_100000156 3300005543 Bacteria 37724
213 Ga0070672_100011572 3300005543 Bacteria 6157
214 Ga0070672_100050128 3300005543 Bacteria 3251
215 Ga0070686_100000241 3300005544 Bacteria 37284
216 Ga0070686_100013648 3300005544 Bacteria 4658
217 Ga0070686_100023938 3300005544 Bacteria 3656
218 Ga0070686_100128705 3300005544 Bacteria 1748
219 Ga0070686_100302779 3300005544 Bacteria 1186
220 Ga0070695_100008015 3300005545 Bacteria 6259
221 Ga0070695_100134316 3300005545 Bacteria 1708
222 Ga0070695_100140770 3300005545 Bacteria 1673
223 Ga0070695_100335855 3300005545 Bacteria 1128
224 Ga0070696_100029010 3300005546 Bacteria 3778
225 Ga0070696_100064133 3300005546 Bacteria 2574
226 Ga0070696_100113127 3300005546 Bacteria 1957
227 Ga0070693_100014360 3300005547 Bacteria 4057
228 Ga0070693_100033077 3300005547 Bacteria 2851
229 Ga0070693_100095074 3300005547 Bacteria 1804
230 Ga0070665_100001310 3300005548 Bacteria 29719
231 Ga0070665_100017922 3300005548 Bacteria 7110
232 Ga0070665_100085361 3300005548 Bacteria 3162
233 Ga0070665_100125836 3300005548 Bacteria 2565
234 Ga0070665_100127338 3300005548 Bacteria 2549
235 Ga0070665_100183136 3300005548 Bacteria 2095
236 Ga0070704_100002509 3300005549 Bacteria 10327
237 Ga0070704_100012828 3300005549 Bacteria 5182
238 Ga0068855_100020591 3300005563 Bacteria 7910
239 Ga0068855_100338171 3300005563 Bacteria 1660
240 Ga0070664_100013448 3300005564 Bacteria 6664
241 Ga0070664_100051609 3300005564 Bacteria 3482
242 Ga0070664_100077687 3300005564 Bacteria 2855
243 Ga0070664_100308227 3300005564 Bacteria 1432
244 Ga0070664_100438640 3300005564 Bacteria 1198
245 Ga0068857_100000480 3300005577 Bacteria 28499
246 Ga0068857_100017290 3300005577 Bacteria 6319
247 Ga0068857_100047256 3300005577 Bacteria 3821
248 Ga0068857_100391458 3300005577 Bacteria 1292
249 Ga0068857_100681276 3300005577 Bacteria 976
250 Ga0068854_100002442 3300005578 Bacteria 11495
251 Ga0068854_100243971 3300005578 Bacteria 1432
252 Ga0068854_100269249 3300005578 Bacteria 1367
253 Ga0068856_100002369 3300005614 Bacteria 19388
254 Ga0068856_100007499 3300005614 Bacteria 10650
255 Ga0068856_100228379 3300005614 Bacteria 1877
256 Ga0070702_100000553 3300005615 Bacteria 13617
257 Ga0070702_100076230 3300005615 Bacteria 1995
258 Ga0070702_100138527 3300005615 Bacteria 1547
259 Ga0070702_100203893 3300005615 Bacteria 1311
260 Ga0070702_100293468 3300005615 Bacteria 1121
261 Ga0068852_100039958 3300005616 Bacteria 3954
262 Ga0068852_100509117 3300005616 Bacteria 1200
263 Ga0068859_100001516 3300005617 Bacteria 23701
264 Ga0068859_100101409 3300005617 Bacteria 2935
265 Ga0068859_100153635 3300005617 Bacteria 2378
266 Ga0068859_100435354 3300005617 Bacteria 1408
267 Ga0068859_100551037 3300005617 Bacteria 1247
268 Ga0068864_100001359 3300005618 Bacteria 20319
269 Ga0068864_100013076 3300005618 Bacteria 6875
270 Ga0068864_100014618 3300005618 Bacteria 6520
271 Ga0068864_100015657 3300005618 Bacteria 6308
272 Ga0068864_100025060 3300005618 Bacteria 5022
273 Ga0068866_10000422 3300005718 Bacteria 19686
274 Ga0068866_10173861 3300005718 Bacteria 1266
275 Ga0068861_100013756 3300005719 Bacteria 5668
276 Ga0068861_100057714 3300005719 Bacteria 2966
277 Ga0068861_100168651 3300005719 Bacteria 1812
278 Ga0068861_100462214 3300005719 Bacteria 1139
279 Ga0068861_100539379 3300005719 Bacteria 1061
280 Ga0068851_10012441 3300005834 Bacteria 4011
281 Ga0068851_10313886 3300005834 Bacteria 904
282 Ga0068870_10000043 3300005840 Bacteria 38376
283 Ga0068863_100053978 3300005841 Bacteria 3808
284 Ga0068863_100238099 3300005841 Bacteria 1757
285 Ga0068858_100017864 3300005842 Bacteria 6642
286 Ga0068858_100055921 3300005842 Bacteria 3647
287 Ga0068858_100073264 3300005842 Bacteria 3179
288 Ga0068858_100089444 3300005842 Bacteria 2865
289 Ga0068858_100091453 3300005842 Bacteria 2832
290 Ga0068858_100248414 3300005842 Bacteria 1689
291 Ga0068858_100283765 3300005842 Bacteria 1577
292 Ga0068858_100327573 3300005842 Bacteria 1465
293 Ga0068858_100349732 3300005842 Bacteria 1416
294 Ga0068858_100573284 3300005842 Bacteria 1093
295 Ga0068860_100000223 3300005843 Bacteria 88152
296 Ga0068860_100013205 3300005843 Bacteria 8102
297 Ga0068860_100039560 3300005843 Bacteria 4510
298 Ga0068860_100048218 3300005843 Bacteria 4059
299 Ga0068860_100073195 3300005843 Bacteria 3257
300 Ga0068860_100074089 3300005843 Bacteria 3236
301 Ga0068860_100142147 3300005843 Bacteria 2307
302 Ga0068860_100176919 3300005843 Bacteria 2062
303 Ga0068860_100820123 3300005843 Bacteria 944
304 Ga0068862_100001098 3300005844 Bacteria 25717
305 Ga0068862_100075170 3300005844 Bacteria 2921
306 Ga0068862_100317805 3300005844 Bacteria 1436
307 Ga0068862_100379910 3300005844 Bacteria 1317
308 Ga0068862_100386348 3300005844 Bacteria 1307
309 Ga0068862_100529112 3300005844 Bacteria 1123
310 Ga0068862_100533538 3300005844 Bacteria 1118
311 Ga0081455_10000855 3300005937 Bacteria 39247
312 Ga0081455_10001692 3300005937 Bacteria 26689
313 Ga0081455_10010613 3300005937 Bacteria 9321
314 Ga0081455_10012279 3300005937 Bacteria 8548
315 Ga0081455_10023973 3300005937 Bacteria 5662
316 Ga0081455_10028392 3300005937 Bacteria 5112
317 Ga0081455_10041587 3300005937 Bacteria 4040
318 Ga0081455_10061057 3300005937 Bacteria 3174
319 Ga0081455_10094668 3300005937 Bacteria 2412
320 Ga0081455_10207173 3300005937 Bacteria 1463
321 Ga0081455_10370276 3300005937 Bacteria 1004
322 Ga0081538_10004294 3300005981 Bacteria 13185
323 Ga0081538_10035690 3300005981 Bacteria 3261
324 Ga0081538_10095192 3300005981 Bacteria 1522
325 Ga0081540_1000022 3300005983 Bacteria 161205
326 Ga0081540_1000729 3300005983 Bacteria 30326
327 Ga0081540_1001212 3300005983 Bacteria 22548
328 Ga0081540_1001375 3300005983 Bacteria 21094
329 Ga0081540_1002044 3300005983 Bacteria 16825
330 Ga0081540_1002180 3300005983 Bacteria 16191
331 Ga0081540_1004468 3300005983 Bacteria 10649
332 Ga0081540_1006127 3300005983 Bacteria 8833
333 Ga0081540_1006813 3300005983 Bacteria 8256
334 Ga0081540_1020177 3300005983 Bacteria 4019
335 Ga0081540_1076508 3300005983 Bacteria 1525
336 Ga0081540_1081093 3300005983 Bacteria 1460
337 Ga0081540_1092726 3300005983 Bacteria 1325
338 Ga0081539_10002071 3300005985 Bacteria 30041
339 Ga0081539_10010540 3300005985 Bacteria 7485
340 Ga0081539_10032404 3300005985 Bacteria 3201
341 Ga0070717_10004651 3300006028 Bacteria 9955
342 Ga0070717_10019867 3300006028 Bacteria 5275
343 Ga0070717_10060308 3300006028 Bacteria 3141
344 Ga0070717_10090625 3300006028 Bacteria 2580
345 Ga0070717_10129420 3300006028 Bacteria 2169
346 Ga0070717_10273316 3300006028 Bacteria 1497
347 Ga0070717_10333163 3300006028 Bacteria 1354
348 Ga0070717_10510769 3300006028 Bacteria 1087
349 Ga0070717_10791493 3300006028 Bacteria 863
350 Ga0075365_10001751 3300006038 Bacteria 10097
351 Ga0075365_10004934 3300006038 Bacteria 7137
352 Ga0075365_10015976 3300006038 Bacteria 4553
353 Ga0075365_10026778 3300006038 Bacteria 3664
354 Ga0075365_10028292 3300006038 Bacteria 3574
355 Ga0075365_10036867 3300006038 Bacteria 3171
356 Ga0075365_10041243 3300006038 Bacteria 3015
357 Ga0075365_10073187 3300006038 Bacteria 2309
358 Ga0075365_10125811 3300006038 Bacteria 1771
359 Ga0075365_10187428 3300006038 Bacteria 1447
360 Ga0075365_10276027 3300006038 Bacteria 1182
361 Ga0075365_10278663 3300006038 Bacteria 1176
362 Ga0075368_10007766 3300006042 Bacteria 3799
363 Ga0075368_10031028 3300006042 Bacteria 2071
364 Ga0075363_100013624 3300006048 Bacteria 3948
365 Ga0075363_100015046 3300006048 Bacteria 3794
366 Ga0075363_100073387 3300006048 Bacteria 1862
367 Ga0075363_100160599 3300006048 Bacteria 1272
368 Ga0075364_10017953 3300006051 Bacteria 4425
369 Ga0075364_10023135 3300006051 Bacteria 3932
370 Ga0075364_10040388 3300006051 Bacteria 3026
371 Ga0075364_10052397 3300006051 Bacteria 2666
372 Ga0070715_10030381 3300006163 Bacteria 2184
373 Ga0070715_10058951 3300006163 Bacteria 1678
374 Ga0070716_100034667 3300006173 Bacteria 2769
375 Ga0070716_100273374 3300006173 Bacteria 1162
376 Ga0070712_100031362 3300006175 Bacteria 3580
377 Ga0070712_100034084 3300006175 Bacteria 3449
378 Ga0070712_100188588 3300006175 Bacteria 1612
379 Ga0070712_100296345 3300006175 Bacteria 1307
380 Ga0075362_10045762 3300006177 Bacteria 1944
381 Ga0075362_10047899 3300006177 Bacteria 1905
382 Ga0075362_10098889 3300006177 Bacteria 1362
383 Ga0075367_10005687 3300006178 Bacteria 6224
384 Ga0075367_10014843 3300006178 Bacteria 4220
385 Ga0075367_10030436 3300006178 Bacteria 3095
386 Ga0075367_10043684 3300006178 Bacteria 2625
387 Ga0075367_10058029 3300006178 Bacteria 2303
388 Ga0075367_10107883 3300006178 Bacteria 1707
389 Ga0075369_10024658 3300006186 Bacteria 2494
390 Ga0075369_10072123 3300006186 Bacteria 1521
391 Ga0075369_10159450 3300006186 Bacteria 1034
392 Ga0075366_10039136 3300006195 Bacteria 2802
393 Ga0075366_10117339 3300006195 Bacteria 1603
394 Ga0075366_10266237 3300006195 Bacteria 1046
395 Ga0097621_100000253 3300006237 Bacteria 36157
396 Ga0097621_100110647 3300006237 Bacteria 2321
397 Ga0097621_100185405 3300006237 Bacteria 1800
398 Ga0097621_100205457 3300006237 Bacteria 1711
399 Ga0075370_10009612 3300006353 Bacteria 5030
400 Ga0075370_10011205 3300006353 Bacteria 4705
401 Ga0075370_10050819 3300006353 Bacteria 2352
402 Ga0075370_10057235 3300006353 Bacteria 2216
403 Ga0075370_10163023 3300006353 Bacteria 1309
404 Ga0068871_100008626 3300006358 Bacteria 7331
405 Ga0068871_100058133 3300006358 Bacteria 3147
406 Ga0068871_100332767 3300006358 Bacteria 1340
407 Ga0068871_100640437 3300006358 Bacteria 970
408 Ga0075428_100025586 3300006844 Bacteria 6535
409 Ga0075428_100034340 3300006844 Bacteria 5595
410 Ga0075428_100049879 3300006844 Bacteria 4592
411 Ga0075428_100306955 3300006844 Bacteria 1705
412 Ga0075428_100357872 3300006844 Bacteria 1566
413 Ga0075428_100473746 3300006844 Bacteria 1340
414 Ga0075428_100792039 3300006844 Bacteria 1008
415 Ga0075430_100004687 3300006846 Bacteria 11500
416 Ga0075431_100030055 3300006847 Bacteria 5595
417 Ga0075431_100030955 3300006847 Bacteria 5511
418 Ga0075433_10003735 3300006852 Bacteria 11782
419 Ga0075433_10008502 3300006852 Bacteria 8194
420 Ga0075433_10021781 3300006852 Bacteria 5377
421 Ga0075433_10033995 3300006852 Bacteria 4375
422 Ga0075433_10051355 3300006852 Bacteria 3590
423 Ga0075434_100000333 3300006871 Bacteria 34001
424 Ga0075434_100010867 3300006871 Bacteria 8557
425 Ga0075434_100023442 3300006871 Bacteria 6015
426 Ga0075434_100058672 3300006871 Bacteria 3825
427 Ga0075434_100086715 3300006871 Bacteria 3131
428 Ga0075434_100582067 3300006871 Bacteria 1139
429 Ga0075434_100626768 3300006871 Bacteria 1094
430 Ga0075429_100021807 3300006880 Bacteria 5553
431 Ga0075429_100027479 3300006880 Bacteria 4939
432 Ga0075429_100032991 3300006880 Bacteria 4500
433 Ga0068865_100000166 3300006881 Bacteria 36443
434 Ga0068865_100092534 3300006881 Bacteria 2197
435 Ga0075436_100021961 3300006914 Bacteria 4382
436 Ga0075436_100201764 3300006914 Bacteria 1409
437 Ga0097620_100001517 3300006931 Bacteria 23701
438 Ga0097620_100101402 3300006931 Bacteria 2935
439 Ga0097620_100153626 3300006931 Bacteria 2378
440 Ga0097620_100435359 3300006931 Bacteria 1408
441 Ga0097620_100551037 3300006931 Bacteria 1247
442 Ga0097620_100791696 3300006931 Bacteria 1036
443 Ga0075435_100075206 3300007076 Bacteria 2765
444 Ga0075435_100076229 3300007076 Bacteria 2747
445 Ga0075435_100088336 3300007076 Bacteria 2555
446 Ga0075435_100342655 3300007076 Bacteria 1281
447 Ga0075435_100383730 3300007076 Bacteria 1207
448 Ga0075435_100399339 3300007076 Bacteria 1182
449 Ga0099794_10010283 3300007265 Bacteria 3966
450 Ga0099795_10021447 3300007788 Bacteria 2119
451 Ga0105250_10026689 3300009092 Bacteria 2327
452 Ga0105250_10058301 3300009092 Bacteria 1550
453 Ga0105240_10001508 3300009093 Bacteria 39623
454 Ga0105240_10016402 3300009093 Bacteria 10030
455 Ga0105240_10213454 3300009093 Bacteria 2253
456 Ga0105240_10379352 3300009093 Bacteria 1597
457 Ga0111539_10003204 3300009094 Bacteria 21653
458 Ga0111539_10008321 3300009094 Bacteria 13202
459 Ga0111539_10041026 3300009094 Bacteria 5567
460 Ga0111539_10041126 3300009094 Bacteria 5559
461 Ga0111539_10068066 3300009094 Bacteria 4203
462 Ga0111539_10455780 3300009094 Bacteria 1489
463 Ga0111539_10512185 3300009094 Bacteria 1398
464 Ga0111539_11050001 3300009094 Bacteria 947
465 Ga0105245_10000403 3300009098 Bacteria 40109
466 Ga0105245_10000584 3300009098 Bacteria 33110
467 Ga0105245_10008764 3300009098 Bacteria 8822
468 Ga0105245_10015400 3300009098 Bacteria 6666
469 Ga0105245_10041279 3300009098 Bacteria 4112
470 Ga0105245_10047106 3300009098 Bacteria 3853
471 Ga0105245_10059785 3300009098 Bacteria 3432
472 Ga0105245_10076655 3300009098 Bacteria 3046
473 Ga0105245_10212787 3300009098 Bacteria 1861
474 Ga0105245_10538141 3300009098 Bacteria 1189
475 Ga0105247_10001853 3300009101 Bacteria 14787
476 Ga0105247_10010137 3300009101 Bacteria 5709
477 Ga0105247_10032886 3300009101 Bacteria 3152
478 Ga0114129_10003291 3300009147 Bacteria 22689
479 Ga0114129_10047381 3300009147 Bacteria 6039
480 Ga0114129_10055220 3300009147 Bacteria 5567
481 Ga0114129_10055350 3300009147 Bacteria 5559
482 Ga0114129_10086378 3300009147 Bacteria 4351
483 Ga0114129_10236000 3300009147 Bacteria 2460
484 Ga0114129_10328929 3300009147 Bacteria 2030
485 Ga0105243_10010307 3300009148 Bacteria 7099
486 Ga0105243_10023764 3300009148 Bacteria 4671
487 Ga0105243_10060204 3300009148 Bacteria 3033
488 Ga0105243_10153299 3300009148 Bacteria 1979
489 Ga0105243_10263773 3300009148 Bacteria 1543
490 Ga0105243_10304348 3300009148 Bacteria 1446
491 Ga0105243_10633856 3300009148 Bacteria 1034
492 Ga0105243_10732485 3300009148 Bacteria 967
493 Ga0105241_10000943 3300009174 Bacteria 21983
494 Ga0105241_10027441 3300009174 Bacteria 4241
495 Ga0105241_10106125 3300009174 Bacteria 2241
496 Ga0105242_10001911 3300009176 Bacteria 16376
497 Ga0105242_10013524 3300009176 Bacteria 6311
498 Ga0105242_10025641 3300009176 Bacteria 4667
499 Ga0105242_10099273 3300009176 Bacteria 2464
500 Ga0105242_10851755 3300009176 Bacteria 907
501 Ga0105248_10001400 3300009177 Bacteria 26933
502 Ga0105248_10022512 3300009177 Bacteria 6990
503 Ga0105248_10052816 3300009177 Bacteria 4561
504 Ga0105248_10087456 3300009177 Bacteria 3507
505 Ga0105248_10099978 3300009177 Bacteria 3268
506 Ga0105248_10107321 3300009177 Bacteria 3149
507 Ga0105248_10134748 3300009177 Bacteria 2786
508 Ga0105248_10142034 3300009177 Bacteria 2709
509 Ga0105248_10818590 3300009177 Bacteria 1051
510 Ga0105237_10002392 3300009545 Bacteria 23301
511 Ga0105237_10002883 3300009545 Bacteria 20878
512 Ga0105237_10018059 3300009545 Bacteria 7306
513 Ga0105237_10203788 3300009545 Bacteria 1979
514 Ga0105237_10280928 3300009545 Bacteria 1667
515 Ga0105237_10297253 3300009545 Bacteria 1617
516 Ga0105237_10863208 3300009545 Bacteria 912
517 Ga0105238_10011718 3300009551 Bacteria 8838
518 Ga0105238_10048186 3300009551 Bacteria 4295
519 Ga0105238_10165683 3300009551 Bacteria 2186
520 Ga0105238_10227000 3300009551 Bacteria 1844
521 Ga0105238_10287032 3300009551 Bacteria 1627
522 Ga0105249_10001241 3300009553 Bacteria 22407
523 Ga0105249_10024700 3300009553 Bacteria 5402
524 Ga0105249_10037905 3300009553 Bacteria 4375
525 Ga0105249_10045111 3300009553 Bacteria 4008
526 Ga0105249_10121130 3300009553 Bacteria 2486
527 Ga0105249_10287365 3300009553 Bacteria 1645
528 Ga0105249_10513508 3300009553 Bacteria 1245
529 Ga0105249_10633648 3300009553 Bacteria 1126
530 Ga0099796_10015395 3300010159 Bacteria 2234
531 Ga0099796_10043899 3300010159 Bacteria 1525
532 Ga0105239_10001903 3300010375 Bacteria 27203
533 Ga0105239_10006882 3300010375 Bacteria 13120
534 Ga0105239_10010296 3300010375 Bacteria 10474
535 Ga0105239_10043808 3300010375 Bacteria 4907
536 Ga0105239_10090518 3300010375 Bacteria 3375
537 Ga0105239_10093335 3300010375 Bacteria 3323
538 Ga0105239_10194691 3300010375 Bacteria 2270
539 Ga0105239_10378496 3300010375 Bacteria 1600
540 Ga0105239_10759239 3300010375 Bacteria 1110
541 Ga0105239_10772597 3300010375 Bacteria 1100
542 Ga0105246_10000253 3300011119 Bacteria 27562
543 Ga0105246_10031816 3300011119 Bacteria 3494
544 Ga0105246_10064311 3300011119 Bacteria 2562
545 Ga0105246_10099060 3300011119 Bacteria 2118
546 Ga0105246_10101517 3300011119 Bacteria 2096
547 Ga0105246_10182458 3300011119 Bacteria 1617
548 Ga0105246_10291499 3300011119 Bacteria 1313
549 Ga0157373_10010937 3300013100 Bacteria 6681
550 Ga0157373_10228921 3300013100 Bacteria 1312
551 Ga0157371_10005968 3300013102 Bacteria 10160
552 Ga0157371_10048371 3300013102 Bacteria 3022
553 Ga0157370_10008846 3300013104 Bacteria 10824
554 Ga0157374_10001693 3300013296 Bacteria 18460
555 Ga0157374_10006637 3300013296 Bacteria 9830
556 Ga0157374_10033805 3300013296 Bacteria 4667
557 Ga0157374_10050064 3300013296 Bacteria 3882
558 Ga0157374_10072012 3300013296 Bacteria 3260
559 Ga0157374_10100625 3300013296 Bacteria 2771
560 Ga0157374_10542465 3300013296 Bacteria 1170
561 Ga0157374_10757056 3300013296 Bacteria 986
562 Ga0157378_10000526 3300013297 Bacteria 36333
563 Ga0157378_10012102 3300013297 Bacteria 7558
564 Ga0157378_10037158 3300013297 Bacteria 4313
565 Ga0157378_10037216 3300013297 Bacteria 4309
566 Ga0157378_10071696 3300013297 Bacteria 3112
567 Ga0157378_10090563 3300013297 Bacteria 2780
568 Ga0157378_10096103 3300013297 Bacteria 2700
569 Ga0157378_10121208 3300013297 Bacteria 2411
570 Ga0163162_10007789 3300013306 Bacteria 10441
571 Ga0163162_10011192 3300013306 Bacteria 8744
572 Ga0163162_10023684 3300013306 Bacteria 6060
573 Ga0163162_10089592 3300013306 Bacteria 3157
574 Ga0163162_10257981 3300013306 Bacteria 1875
575 Ga0163162_10306243 3300013306 Bacteria 1721
576 Ga0163162_10597636 3300013306 Bacteria 1230
577 Ga0163162_10791926 3300013306 Bacteria 1066
578 Ga0163162_10924461 3300013306 Bacteria 984
579 Ga0157372_10135961 3300013307 Bacteria 2830
580 Ga0157372_10300984 3300013307 Bacteria 1865
581 Ga0157375_10002585 3300013308 Bacteria 15717
582 Ga0157375_10009105 3300013308 Bacteria 8698
583 Ga0157375_10030351 3300013308 Bacteria 5096
584 Ga0157375_10087809 3300013308 Bacteria 3163
585 Ga0157375_10132182 3300013308 Bacteria 2616
586 Ga0157375_10406296 3300013308 Bacteria 1528
587 Ga0157375_10424568 3300013308 Bacteria 1495
588 Ga0163163_10001510 3300014325 Bacteria 19657
589 Ga0163163_10008344 3300014325 Bacteria 9200
590 Ga0163163_10025356 3300014325 Bacteria 5653
591 Ga0163163_10050386 3300014325 Bacteria 4100
592 Ga0163163_10154555 3300014325 Bacteria 2338
593 Ga0163163_10167275 3300014325 Bacteria 2245
594 Ga0163163_10192347 3300014325 Bacteria 2089
595 Ga0163163_10237208 3300014325 Bacteria 1873
596 Ga0163163_10349533 3300014325 Bacteria 1534
597 Ga0163163_10429650 3300014325 Bacteria 1380
598 Ga0163163_10471953 3300014325 Bacteria 1315
599 Ga0163163_10507661 3300014325 Bacteria 1268
600 Ga0163163_10532930 3300014325 Bacteria 1237
601 Ga0157380_10004267 3300014326 Bacteria 9896
602 Ga0157380_10169253 3300014326 Bacteria 1907
603 Ga0157380_10257533 3300014326 Bacteria 1583
604 Ga0157380_10571427 3300014326 Bacteria 1113
605 Ga0157377_10000292 3300014745 Bacteria 23826
606 Ga0157377_10031900 3300014745 Bacteria 2866
607 Ga0157377_10073797 3300014745 Bacteria 1978
608 Ga0157377_10075338 3300014745 Bacteria 1960
609 Ga0157379_10019280 3300014968 Bacteria 6023
610 Ga0157379_10079784 3300014968 Bacteria 2931
611 Ga0157379_10092212 3300014968 Bacteria 2717
612 Ga0157379_10141654 3300014968 Bacteria 2167
613 Ga0157379_10240989 3300014968 Bacteria 1640
614 Ga0157379_10281921 3300014968 Bacteria 1512
615 Ga0157379_10628880 3300014968 Unclassified 1004
616 Ga0157376_10005970 3300014969 Bacteria 8556
617 Ga0157376_10103122 3300014969 Bacteria 2497
618 Ga0157376_10300652 3300014969 Bacteria 1519
619 Ga0157376_10412373 3300014969 Bacteria 1309
620 Ga0157376_10417464 3300014969 Bacteria 1301
621 Ga0163161_10000399 3300017792 Bacteria 36275
622 Ga0163161_10073324 3300017792 Bacteria 2508
623 Ga0163161_10205476 3300017792 Bacteria 1519
624 Ga0228598_1000457 3300024227 Bacteria 8320
625 Ga0207666_1000041 3300025271 Bacteria 25683
626 Ga0207666_1000259 3300025271 Bacteria 7742
627 Ga0207673_1001337 3300025290 Bacteria 2669
628 Ga0209758_1000240 3300025297 Bacteria 114169
629 Ga0209758_1001774 3300025297 Bacteria 23930
630 Ga0209758_1012599 3300025297 Bacteria 4713
631 Ga0207697_10000016 3300025315 Bacteria 57769
632 Ga0207656_10107487 3300025321 Bacteria 1286
633 Ga0207653_10004182 3300025885 Bacteria 4538
634 Ga0207682_10002011 3300025893 Bacteria 9212
635 Ga0207682_10025806 3300025893 Bacteria 2331
636 Ga0207692_10000441 3300025898 Bacteria 14629
637 Ga0207642_10002271 3300025899 Bacteria 5982
638 Ga0207642_10030099 3300025899 Bacteria 2257
639 Ga0207642_10057294 3300025899 Bacteria 1792
640 Ga0207710_10002823 3300025900 Bacteria 7920
641 Ga0207710_10004825 3300025900 Bacteria 5852
642 Ga0207710_10008445 3300025900 Bacteria 4343
643 Ga0207688_10000124 3300025901 Bacteria 31905
644 Ga0207688_10010933 3300025901 Bacteria 4940
645 Ga0207688_10023789 3300025901 Bacteria 3358
646 Ga0207688_10062180 3300025901 Bacteria 2105
647 Ga0207688_10098777 3300025901 Bacteria 1683
648 Ga0207680_10006141 3300025903 Bacteria 5791
649 Ga0207647_10000853 3300025904 Bacteria 23651
650 Ga0207647_10004068 3300025904 Bacteria 10874
651 Ga0207647_10009329 3300025904 Bacteria 6975
652 Ga0207685_10048086 3300025905 Bacteria 1632
653 Ga0207699_10015147 3300025906 Bacteria 4000
654 Ga0207699_10115517 3300025906 Bacteria 1727
655 Ga0207699_10196373 3300025906 Bacteria 1365
656 Ga0207699_10321424 3300025906 Bacteria 1086
657 Ga0207645_10000119 3300025907 Bacteria 59494
658 Ga0207645_10018243 3300025907 Bacteria 4622
659 Ga0207645_10059039 3300025907 Bacteria 2450
660 Ga0207645_10121244 3300025907 Bacteria 1697
661 Ga0207643_10000050 3300025908 Bacteria 78102
662 Ga0207643_10004145 3300025908 Bacteria 7808
663 Ga0207643_10254756 3300025908 Bacteria 1082
664 Ga0207705_10013593 3300025909 Bacteria 5876
665 Ga0207705_10260091 3300025909 Bacteria 1325
666 Ga0207684_10018577 3300025910 Bacteria 5953
667 Ga0207654_10007924 3300025911 Bacteria 5356
668 Ga0207654_10014951 3300025911 Bacteria 4018
669 Ga0207707_10013286 3300025912 Bacteria 7176
670 Ga0207707_10043045 3300025912 Bacteria 3940
671 Ga0207707_10053839 3300025912 Bacteria 3503
672 Ga0207707_10171500 3300025912 Bacteria 1896
673 Ga0207695_10018200 3300025913 Bacteria 8130
674 Ga0207695_10186410 3300025913 Bacteria 1993
675 Ga0207695_10483178 3300025913 Unclassified 1121
676 Ga0207671_10004877 3300025914 Bacteria 12609
677 Ga0207671_10040763 3300025914 Bacteria 3436
678 Ga0207671_10222316 3300025914 Bacteria 1480
679 Ga0207671_10362818 3300025914 Bacteria 1150
680 Ga0207671_10417019 3300025914 Bacteria 1068
681 Ga0207693_10008660 3300025915 Bacteria 8324
682 Ga0207693_10014415 3300025915 Bacteria 6356
683 Ga0207693_10019341 3300025915 Bacteria 5418
684 Ga0207693_10021977 3300025915 Bacteria 5071
685 Ga0207693_10022758 3300025915 Bacteria 4976
686 Ga0207693_10043862 3300025915 Bacteria 3516
687 Ga0207663_10003995 3300025916 Bacteria 7302
688 Ga0207663_10020015 3300025916 Bacteria 3783
689 Ga0207663_10021501 3300025916 Bacteria 3674
690 Ga0207663_10041071 3300025916 Bacteria 2816
691 Ga0207660_10002304 3300025917 Bacteria 12575
692 Ga0207660_10012722 3300025917 Bacteria 5511
693 Ga0207660_10075012 3300025917 Bacteria 2469
694 Ga0207662_10000072 3300025918 Bacteria 45471
695 Ga0207662_10007121 3300025918 Bacteria 6078
696 Ga0207662_10021293 3300025918 Bacteria 3705
697 Ga0207662_10025136 3300025918 Bacteria 3429
698 Ga0207662_10035052 3300025918 Bacteria 2930
699 Ga0207662_10093217 3300025918 Bacteria 1855
700 Ga0207657_10000518 3300025919 Bacteria 40723
701 Ga0207657_10063215 3300025919 Bacteria 3166
702 Ga0207657_10152966 3300025919 Bacteria 1878
703 Ga0207649_10000341 3300025920 Bacteria 35529
704 Ga0207649_10018737 3300025920 Bacteria 3943
705 Ga0207652_10001108 3300025921 Bacteria 24316
706 Ga0207652_10138217 3300025921 Bacteria 2177
707 Ga0207652_10339798 3300025921 Bacteria 1355
708 Ga0207681_10044801 3300025923 Bacteria 2966
709 Ga0207681_10104427 3300025923 Bacteria 2050
710 Ga0207681_10228457 3300025923 Bacteria 1443
711 Ga0207694_10022220 3300025924 Bacteria 4811
712 Ga0207694_10120683 3300025924 Bacteria 2093
713 Ga0207650_10002975 3300025925 Bacteria 11691
714 Ga0207650_10012242 3300025925 Bacteria 5920
715 Ga0207650_10166878 3300025925 Bacteria 1747
716 Ga0207650_10213692 3300025925 Bacteria 1550
717 Ga0207650_10305692 3300025925 Bacteria 1300
718 Ga0207650_10312510 3300025925 Bacteria 1286
719 Ga0207659_10000057 3300025926 Bacteria 72017
720 Ga0207659_10026919 3300025926 Bacteria 3886
721 Ga0207659_10189738 3300025926 Bacteria 1635
722 Ga0207659_10201344 3300025926 Bacteria 1590
723 Ga0207659_10331050 3300025926 Bacteria 1259
724 Ga0207659_10559024 3300025926 Bacteria 973
725 Ga0207687_10001969 3300025927 Bacteria 14127
726 Ga0207687_10002258 3300025927 Bacteria 13132
727 Ga0207687_10007594 3300025927 Bacteria 7131
728 Ga0207687_10019268 3300025927 Bacteria 4519
729 Ga0207687_10068746 3300025927 Bacteria 2524
730 Ga0207687_10075823 3300025927 Bacteria 2414
731 Ga0207687_10184188 3300025927 Bacteria 1620
732 Ga0207700_10018082 3300025928 Bacteria 4726
733 Ga0207700_10018345 3300025928 Bacteria 4698
734 Ga0207700_10026769 3300025928 Bacteria 4026
735 Ga0207700_10052266 3300025928 Bacteria 3054
736 Ga0207700_10081649 3300025928 Bacteria 2525
737 Ga0207700_10428364 3300025928 Bacteria 1163
738 Ga0207664_10205704 3300025929 Bacteria 1701
739 Ga0207664_10243278 3300025929 Bacteria 1567
740 Ga0207664_10330768 3300025929 Bacteria 1346
741 Ga0207644_10000959 3300025931 Bacteria 18417
742 Ga0207644_10040827 3300025931 Bacteria 3280
743 Ga0207644_10054232 3300025931 Bacteria 2887
744 Ga0207644_10074922 3300025931 Bacteria 2485
745 Ga0207644_10098733 3300025931 Bacteria 2189
746 Ga0207644_10117504 3300025931 Bacteria 2020
747 Ga0207644_10273027 3300025931 Bacteria 1355
748 Ga0207690_10000349 3300025932 Bacteria 30729
749 Ga0207690_10055171 3300025932 Bacteria 2675
750 Ga0207706_10004379 3300025933 Bacteria 13271
751 Ga0207706_10006777 3300025933 Bacteria 10593
752 Ga0207706_10012362 3300025933 Bacteria 7777
753 Ga0207706_10027334 3300025933 Bacteria 5102
754 Ga0207706_10029532 3300025933 Bacteria 4894
755 Ga0207706_10075230 3300025933 Bacteria 2969
756 Ga0207706_10331345 3300025933 Bacteria 1324
757 Ga0207706_10346251 3300025933 Bacteria 1292
758 Ga0207706_10422071 3300025933 Bacteria 1155
759 Ga0207686_10002370 3300025934 Bacteria 10293
760 Ga0207686_10009181 3300025934 Bacteria 5364
761 Ga0207686_10155153 3300025934 Bacteria 1598
762 Ga0207686_10307554 3300025934 Bacteria 1179
763 Ga0207686_10338581 3300025934 Bacteria 1129
764 Ga0207709_10000232 3300025935 Bacteria 70482
765 Ga0207709_10023146 3300025935 Bacteria 3532
766 Ga0207709_10035469 3300025935 Bacteria 2949
767 Ga0207709_10037639 3300025935 Bacteria 2876
768 Ga0207709_10208191 3300025935 Bacteria 1402
769 Ga0207670_10000575 3300025936 Bacteria 20312
770 Ga0207670_10003325 3300025936 Bacteria 8522
771 Ga0207670_10012519 3300025936 Bacteria 4966
772 Ga0207670_10030603 3300025936 Bacteria 3439
773 Ga0207670_10092199 3300025936 Bacteria 2144
774 Ga0207670_10122966 3300025936 Bacteria 1889
775 Ga0207670_10169569 3300025936 Bacteria 1635
776 Ga0207669_10051847 3300025937 Bacteria 2461
777 Ga0207704_10000295 3300025938 Bacteria 23634
778 Ga0207704_10140097 3300025938 Bacteria 1690
779 Ga0207704_10220628 3300025938 Bacteria 1403
780 Ga0207704_10350445 3300025938 Bacteria 1149
781 Ga0207665_10003165 3300025939 Bacteria 11027
782 Ga0207665_10039647 3300025939 Bacteria 3140
783 Ga0207665_10056669 3300025939 Bacteria 2646
784 Ga0207665_10190139 3300025939 Bacteria 1491
785 Ga0207691_10000139 3300025940 Bacteria 66544
786 Ga0207691_10003960 3300025940 Bacteria 14389
787 Ga0207691_10030240 3300025940 Bacteria 5062
788 Ga0207691_10042634 3300025940 Bacteria 4183
789 Ga0207691_10050485 3300025940 Bacteria 3808
790 Ga0207691_10061056 3300025940 Bacteria 3424
791 Ga0207711_10001724 3300025941 Bacteria 20070
792 Ga0207711_10023879 3300025941 Bacteria 5118
793 Ga0207711_10087124 3300025941 Bacteria 2739
794 Ga0207711_10094875 3300025941 Bacteria 2630
795 Ga0207711_10096066 3300025941 Bacteria 2614
796 Ga0207711_10133716 3300025941 Bacteria 2226
797 Ga0207711_10154111 3300025941 Bacteria 2075
798 Ga0207711_10271820 3300025941 Bacteria 1559
799 Ga0207689_10000085 3300025942 Bacteria 75467
800 Ga0207689_10005371 3300025942 Bacteria 11469
801 Ga0207689_10013317 3300025942 Bacteria 7017
802 Ga0207689_10013921 3300025942 Bacteria 6851
803 Ga0207689_10026475 3300025942 Bacteria 4856
804 Ga0207689_10028214 3300025942 Bacteria 4695
805 Ga0207689_10077338 3300025942 Bacteria 2736
806 Ga0207689_10097997 3300025942 Bacteria 2408
807 Ga0207689_10249926 3300025942 Bacteria 1466
808 Ga0207661_10000520 3300025944 Bacteria 24900
809 Ga0207661_10066184 3300025944 Bacteria 2935
810 Ga0207661_10198950 3300025944 Bacteria 1761
811 Ga0207661_10714816 3300025944 Unclassified 922
812 Ga0207679_10000130 3300025945 Bacteria 61412
813 Ga0207679_10066621 3300025945 Bacteria 2699
814 Ga0207679_10121437 3300025945 Bacteria 2081
815 Ga0207679_10310565 3300025945 Bacteria 1362
816 Ga0207667_10003769 3300025949 Bacteria 18670
817 Ga0207667_10182821 3300025949 Bacteria 2152
818 Ga0207651_10001543 3300025960 Bacteria 10516
819 Ga0207712_10000235 3300025961 Bacteria 54322
820 Ga0207712_10076548 3300025961 Bacteria 2423
821 Ga0207712_10081532 3300025961 Bacteria 2356
822 Ga0207712_10099705 3300025961 Bacteria 2157
823 Ga0207668_10001986 3300025972 Bacteria 11957
824 Ga0207668_10004361 3300025972 Bacteria 8305
825 Ga0207668_10005404 3300025972 Bacteria 7524
826 Ga0207668_10051199 3300025972 Bacteria 2851
827 Ga0207668_10070085 3300025972 Bacteria 2499
828 Ga0207668_10106747 3300025972 Bacteria 2092
829 Ga0207668_10267530 3300025972 Bacteria 1396
830 Ga0207640_10000141 3300025981 Bacteria 52638
831 Ga0207640_10058427 3300025981 Bacteria 2541
832 Ga0207640_10515713 3300025981 Bacteria 998
833 Ga0207640_10534263 3300025981 Bacteria 982
834 Ga0207658_10006961 3300025986 Bacteria 7698
835 Ga0207658_10129286 3300025986 Bacteria 2027
836 Ga0207658_10159593 3300025986 Bacteria 1847
837 Ga0207658_10209871 3300025986 Bacteria 1631
838 Ga0207658_10380132 3300025986 Bacteria 1237
839 Ga0207677_10002848 3300026023 Bacteria 9121
840 Ga0207677_10009359 3300026023 Bacteria 5513
841 Ga0207677_10023633 3300026023 Bacteria 3801
842 Ga0207677_10120635 3300026023 Bacteria 1972
843 Ga0207677_10134194 3300026023 Bacteria 1885
844 Ga0207677_10335750 3300026023 Bacteria 1261
845 Ga0207677_10356013 3300026023 Bacteria 1228
846 Ga0207703_10013268 3300026035 Bacteria 6418
847 Ga0207703_10033559 3300026035 Bacteria 4070
848 Ga0207703_10083374 3300026035 Bacteria 2671
849 Ga0207703_10087653 3300026035 Bacteria 2610
850 Ga0207703_10177954 3300026035 Bacteria 1875
851 Ga0207703_10232477 3300026035 Bacteria 1653
852 Ga0207703_10255084 3300026035 Bacteria 1583
853 Ga0207639_10010542 3300026041 Bacteria 6402
854 Ga0207639_10029044 3300026041 Bacteria 4045
855 Ga0207639_10033896 3300026041 Bacteria 3770
856 Ga0207639_10103896 3300026041 Bacteria 2303
857 Ga0207639_10562396 3300026041 Bacteria 1048
858 Ga0207678_10003515 3300026067 Bacteria 14093
859 Ga0207678_10004014 3300026067 Bacteria 13245
860 Ga0207678_10006492 3300026067 Bacteria 10381
861 Ga0207678_10011918 3300026067 Bacteria 7636
862 Ga0207678_10014686 3300026067 Bacteria 6891
863 Ga0207678_10015871 3300026067 Bacteria 6618
864 Ga0207678_10018097 3300026067 Bacteria 6188
865 Ga0207678_10091821 3300026067 Bacteria 2595
866 Ga0207678_10143562 3300026067 Bacteria 2037
867 Ga0207678_10381161 3300026067 Bacteria 1219
868 Ga0207708_10002604 3300026075 Bacteria 13267
869 Ga0207708_10003656 3300026075 Bacteria 11349
870 Ga0207708_10015788 3300026075 Bacteria 5668
871 Ga0207702_10002285 3300026078 Bacteria 18387
872 Ga0207702_10021392 3300026078 Bacteria 5355
873 Ga0207702_10064960 3300026078 Bacteria 3124
874 Ga0207641_10000741 3300026088 Bacteria 35103
875 Ga0207641_10032281 3300026088 Bacteria 4347
876 Ga0207641_10496943 3300026088 Bacteria 1184
877 Ga0207641_10706548 3300026088 Bacteria 993
878 Ga0207648_10000593 3300026089 Bacteria 40723
879 Ga0207648_10053092 3300026089 Bacteria 3544
880 Ga0207648_10406251 3300026089 Bacteria 1235
881 Ga0207676_10001818 3300026095 Bacteria 15632
882 Ga0207676_10014197 3300026095 Bacteria 5722
883 Ga0207676_10146630 3300026095 Bacteria 2028
884 Ga0207676_10429261 3300026095 Bacteria 1241
885 Ga0207676_10696248 3300026095 Bacteria 984
886 Ga0207674_10001199 3300026116 Bacteria 33740
887 Ga0207674_10001282 3300026116 Bacteria 32785
888 Ga0207674_10059748 3300026116 Bacteria 3857
889 Ga0207674_10289941 3300026116 Bacteria 1585
890 Ga0207675_100002277 3300026118 Bacteria 19063
891 Ga0207675_100004644 3300026118 Bacteria 13233
892 Ga0207675_100010520 3300026118 Bacteria 8669
893 Ga0207675_100040749 3300026118 Bacteria 4338
894 Ga0207675_100183803 3300026118 Bacteria 2003
895 Ga0207675_100336930 3300026118 Bacteria 1476
896 Ga0207683_10000014 3300026121 Bacteria 128817
897 Ga0207683_10010652 3300026121 Bacteria 7837
898 Ga0207683_10017246 3300026121 Bacteria 6150
899 Ga0207683_10019811 3300026121 Bacteria 5747
900 Ga0207683_10031441 3300026121 Bacteria 4607
901 Ga0207683_10058072 3300026121 Bacteria 3397
902 Ga0207683_10128497 3300026121 Bacteria 2279
903 Ga0207683_10167093 3300026121 Bacteria 1991
904 Ga0207683_10248351 3300026121 Bacteria 1623
905 Ga0207683_10355222 3300026121 Bacteria 1345
906 Ga0207698_10001182 3300026142 Bacteria 15226
907 Ga0207698_10139166 3300026142 Bacteria 2088
908 Ga0207698_10185031 3300026142 Bacteria 1849
909 Ga0207698_10190742 3300026142 Bacteria 1825
910 Ga0207698_10205200 3300026142 Bacteria 1768
911 Ga0207698_10260413 3300026142 Bacteria 1593
912 Ga0207698_10515263 3300026142 Bacteria 1166
913 Ga0209982_1016806 3300027552 Bacteria 1113
914 Ga0209588_1011822 3300027671 Bacteria 2643
915 Ga0209966_1001359 3300027695 Bacteria 4287
916 Ga0209998_10000773 3300027717 Bacteria 8294
917 Ga0209998_10000956 3300027717 Bacteria 7331
918 Ga0209998_10020563 3300027717 Bacteria 1413
919 Ga0209813_10009307 3300027866 Bacteria 2509
920 Ga0209813_10031965 3300027866 Bacteria 1557
921 Ga0209974_10001409 3300027876 Bacteria 8696
922 Ga0209974_10021636 3300027876 Bacteria 2131
923 Ga0207428_10000064 3300027907 Bacteria 151185
924 Ga0207428_10000720 3300027907 Bacteria 38176
925 Ga0207428_10002050 3300027907 Bacteria 20323
926 Ga0207428_10002399 3300027907 Bacteria 18724
927 Ga0268266_10001382 3300028379 Bacteria 29229
928 Ga0268266_10001560 3300028379 Bacteria 26820
929 Ga0268266_10013183 3300028379 Bacteria 7128
930 Ga0268266_10021857 3300028379 Bacteria 5451
931 Ga0268266_10070951 3300028379 Bacteria 3019
932 Ga0268266_10137383 3300028379 Bacteria 2190
933 Ga0268265_10000709 3300028380 Bacteria 32797
934 Ga0268265_10027436 3300028380 Bacteria 4064
935 Ga0268265_10088685 3300028380 Bacteria 2465
936 Ga0268265_10150282 3300028380 Bacteria 1963
937 Ga0268265_10220685 3300028380 Bacteria 1658
938 Ga0268265_10385949 3300028380 Bacteria 1290
939 Ga0268264_10000119 3300028381 Bacteria 192507
940 Ga0268264_10000908 3300028381 Bacteria 31083
941 Ga0268264_10030274 3300028381 Bacteria 4436
942 Ga0268264_10041023 3300028381 Bacteria 3826
943 Ga0268264_10507752 3300028381 Bacteria 1177
944 Ga0307517_10000042 3300028786 Bacteria 166943
945 Ga0307515_10199424 3300028794 Bacteria 1882
946 Ga0307513_10317679 3300031456 Bacteria 1317
947 Ga0307509_10038044 3300031507 Bacteria 5253
948 Ga0307509_10259194 3300031507 Bacteria 1516
949 Ga0307508_10126111 3300031616 Bacteria 2162
950 Ga0307508_10369267 3300031616 Bacteria 1026
951 Ga0307405_10075299 3300031731 Bacteria 2186
952 Ga0307409_100033031 3300031995 Bacteria 3760
953 Ga0307416_100100689 3300032002 Bacteria 2514
954 Ga0307416_100204516 3300032002 Bacteria 1877
955 Ga0307411_10104106 3300032005 Bacteria 2015
956 Ga0307411_10227001 3300032005 Bacteria 1453
957 Ga0307415_100107416 3300032126 Bacteria 2062
958 Ga0307507_10006711 3300033179 Bacteria 17340
959 Ga0307510_10055050 3300033180 Bacteria 4158
960 Ga0307510_10064401 3300033180 Bacteria 3724
961 Ga0307510_10070879 3300033180 Bacteria 3477
962 Ga0373930_0001111 3300034816 Bacteria 3906
963 Ga0373950_0000414 3300034818 Bacteria 5209
964 Ga0373958_0009146 3300034819 Bacteria 1624
965 Ga0373959_0000642 3300034820 Bacteria 6030
966 Ga0373938_0000362 3300034957 Bacteria 7261
967 Ga0373938_0000372 3300034957 Bacteria 7194
968 Ga0373926_0018416 3300035083 Bacteria 2402
969 Ga0373928_0000432 3300035084 Bacteria 8340
970 Ga0373928_0001567 3300035084 Bacteria 4436
971 Ga0373929_0000900 3300035085 Bacteria 5793
972 Ga0373934_0016875 3300035086 Bacteria 2780
973 Ga0373940_0000189 3300035088 Bacteria 8450
974 Ga0373944_0011803 3300035089 Bacteria 2399
975 Ga0373949_0001804 3300035090 Bacteria 5856
976 Ga0373951_0001845 3300035091 Bacteria 5483
977 Ga0373951_0016491 3300035091 Bacteria 1666
978 Ga0373952_0000165 3300035092 Bacteria 10020
979 Ga0373952_0006835 3300035092 Bacteria 2122
980 Ga0373923_0096799 3300035111 Bacteria 1297
981 Ga0373923_0135312 3300035111 Bacteria 1111
982 Ga0373932_0000306 3300035112 Bacteria 14831
983 Ga0373932_0062626 3300035112 Bacteria 1135
984 Ga0373936_0007125 3300035113 Bacteria 4207
985 Ga0373936_0008124 3300035113 Bacteria 3947
986 Ga0373936_0044560 3300035113 Bacteria 1785
987 Ga0373936_0079988 3300035113 Bacteria 1359
988 Ga0373936_0089216 3300035113 Bacteria 1291
989 Ga0373936_0118899 3300035113 Bacteria 1127
990 Ga0373939_0000725 3300035114 Bacteria 8164
991 Ga0373939_0047992 3300035114 Bacteria 1313
992 Ga0373941_0000289 3300035115 Bacteria 9687
993 Ga0373941_0031664 3300035115 Bacteria 1577
994 Ga0373945_0002251 3300035116 Bacteria 6031
995 Ga0373945_0004137 3300035116 Bacteria 4600
996 Ga0373945_0014838 3300035116 Bacteria 2615
997 Ga0373945_0018828 3300035116 Bacteria 2352
998 Ga0373945_0024681 3300035116 Bacteria 2085
999 Ga0373954_0035626 3300035118 Bacteria 2309
1000 Ga0373956_0017350 3300035119 Bacteria 3034
1001 Ga0373957_0009790 3300035120 Bacteria 3145
1002 Ga0373957_0025014 3300035120 Bacteria 2148
1003 Ga0373957_0093733 3300035120 Bacteria 1196
1004 Ga0373960_0000721 3300035121 Bacteria 6875
1005 Ga0373960_0009227 3300035121 Bacteria 2383
1006 Ga0373943_0075644 3300035170 Bacteria 1716
1007 Ga0373943_0084329 3300035170 Bacteria 1635
1008 Ga0373943_0198768 3300035170 Bacteria 1109
1009 Ga0373946_0004607 3300035171 Bacteria 4943
1010 Ga0373946_0028586 3300035171 Bacteria 2212
1011 Ga0373946_0031171 3300035171 Bacteria 2133
1012 Ga0373955_0000686 3300035172 Bacteria 14495
1013 Ga0373955_0004765 3300035172 Bacteria 6035
1014 Ga0373955_0008210 3300035172 Bacteria 4838
1015 Ga0373955_0043994 3300035172 Bacteria 2403
1016 Ga0373942_0000912 3300035207 Bacteria 8086
1017 Ga0373961_0001143 3300035241 Bacteria 8325
1018 Ga0373962_0000674 3300035242 Bacteria 7747
1019 Ga0373962_0000871 3300035242 Bacteria 6885
1020 Ga0373962_0010494 3300035242 Bacteria 2311
1021 Ga0373924_0004324 3300035410 Bacteria 4957
1022 Ga0373924_0008715 3300035410 Bacteria 3696
1023 Ga0373924_0073092 3300035410 Bacteria 1449
1024 Ga0373931_0000191 3300035691 Bacteria 26349
1025 Ga0373931_0009635 3300035691 Bacteria 4624
1026 Ga0373931_0163921 3300035691 Bacteria 1305
1027 Ga0373935_0000422 3300035692 Bacteria 22063
1028 Ga0373935_0014013 3300035692 Bacteria 4841
1029 Ga0373935_0014771 3300035692 Bacteria 4713
1030 Ga0373935_0061011 3300035692 Bacteria 2413
1031 Ga0373935_0153145 3300035692 Bacteria 1566
1032 Ga0373927_0012779 3300035695 Bacteria 5586
1033 Ga0373927_0012848 3300035695 Bacteria 5567
1034 Ga0373927_0049857 3300035695 Bacteria 2706
1035 Ga0373927_0200148 3300035695 Bacteria 1311
1036 Ga0373927_0205791 3300035695 Bacteria 1292
1037 Ga0373933_0005797 3300035724 Bacteria 6719
1038 Ga0373933_0011312 3300035724 Bacteria 4914
1039 Ga0373933_0035442 3300035724 Bacteria 2914
1040 Ga0373933_0093206 3300035724 Bacteria 1861
1041 Ga0373933_0126167 3300035724 Bacteria 1606
1042 Ga0373933_0219096 3300035724 Unclassified 1220
1043 Ga0373947_0000418 3300035725 Bacteria 24149
1044 Ga0373947_0000805 3300035725 Bacteria 18923
1045 Ga0373947_0015050 3300035725 Bacteria 4440
1046 Ga0373947_0028123 3300035725 Bacteria 3293
1047 Ga0373947_0033196 3300035725 Bacteria 3045
1048 Ga0373947_0078049 3300035725 Bacteria 2043
1049 Ga0373947_0080849 3300035725 Bacteria 2011
1050 Ga0373947_0314404 3300035725 Bacteria 1046
1051 Ga0373937_0000028 3300036401 Bacteria 123801
1052 Ga0373937_0015828 3300036401 Bacteria 6683
1053 Ga0373937_0031753 3300036401 Bacteria 4787
1054 Ga0373937_0036933 3300036401 Bacteria 4452
1055 Ga0373937_0054222 3300036401 Bacteria 3678
1056 Ga0373937_0079303 3300036401 Bacteria 3035
1057 Ga0373937_0243248 3300036401 Bacteria 1695
1058 Ga0373925_0000733 3300037068 Bacteria 30434
1059 Ga0373925_0019242 3300037068 Bacteria 4966
1060 Ga0373925_0059476 3300037068 Bacteria 2867
1061 Ga0373925_0197288 3300037068 Bacteria 1599
1062 Ga0373925_0206792 3300037068 Bacteria 1563
1063 Ga0373925_0290315 3300037068 Bacteria 1319
1064 Ga0395905_0061434 3300037471 Bacteria 3515
1065 Ga0395901_0455992 3300038443 Bacteria 1307
1066 Ga0242420_009415 3300038996 Bacteria 1601
1067 Ga0451807_1836870 3300041486 Bacteria 1720
1068 Ga0451849_1347307 3300041505 Bacteria 1546
1069 Ga0451853_2960746 3300041512 Bacteria 996
1070 Ga0439448_0035809 3300042005 Bacteria 1591
1071 Ga0451577_0059726 3300042876 Bacteria 3400
1072 Ga0466963_0062073 3300044694 Bacteria 2500
1073 Ga0453684_0101550 3300044712 Bacteria 3519
1074 Ga0451576_0036584 3300045051 Bacteria 5202
1075 Ga0495627_022874 3300046453 Bacteria 2053
1076 Ga0495592_0000032 3300046454 Bacteria 128274
1077 Ga0495592_0028127 3300046454 Bacteria 4259
1078 Ga0495592_0064199 3300046454 Bacteria 2692
1079 Ga0495592_0082863 3300046454 Bacteria 2317
1080 Ga0495592_0113721 3300046454 Bacteria 1912
1081 Ga0495603_0002383 3300046455 Bacteria 11047
1082 Ga0495603_0106721 3300046455 Bacteria 1634
1083 Ga0495603_0148623 3300046455 Bacteria 1361
1084 Ga0495591_028026 3300046458 Bacteria 1728
1085 Ga0495629_0002166 3300046459 Bacteria 15175
1086 Ga0495629_0004435 3300046459 Bacteria 10516
1087 Ga0495629_0011571 3300046459 Bacteria 6410
1088 Ga0495629_0031343 3300046459 Bacteria 3765
1089 Ga0495629_0142170 3300046459 Bacteria 1669
1090 Ga0495629_0179833 3300046459 Bacteria 1466
1091 Ga0495629_0191048 3300046459 Bacteria 1417
1092 Ga0495629_0197380 3300046459 Bacteria 1392
1093 Ga0495638_0006115 3300046460 Bacteria 8811
1094 Ga0495638_0014560 3300046460 Bacteria 5310
1095 Ga0495638_0099171 3300046460 Bacteria 1744
1096 Ga0495641_0031640 3300046461 Bacteria 2526
1097 Ga0495641_0050817 3300046461 Bacteria 1894
1098 Ga0495641_0089876 3300046461 Bacteria 1372
1099 Ga0495651_0001777 3300046462 Bacteria 16627
1100 Ga0495651_0001967 3300046462 Bacteria 15902
1101 Ga0495651_0002281 3300046462 Bacteria 14802
1102 Ga0495651_0003817 3300046462 Bacteria 11523
1103 Ga0495651_0025049 3300046462 Bacteria 4641
1104 Ga0495651_0040754 3300046462 Bacteria 3609
1105 Ga0495651_0248143 3300046462 Bacteria 1217
1106 Ga0495653_0000012 3300046463 Bacteria 266880
1107 Ga0495653_0001953 3300046463 Bacteria 16230
1108 Ga0495653_0034799 3300046463 Bacteria 3979
1109 Ga0495653_0320741 3300046463 Bacteria 1004
1110 Ga0495650_0031643 3300046471 Bacteria 2377
1111 Ga0495580_0017727 3300046472 Bacteria 5316
1112 Ga0495580_0025126 3300046472 Bacteria 4353
1113 Ga0495580_0041357 3300046472 Bacteria 3287
1114 Ga0495580_0106448 3300046472 Bacteria 1948
1115 Ga0495580_0168811 3300046472 Bacteria 1513
1116 Ga0495582_0034392 3300046473 Bacteria 2785
1117 Ga0495582_0055206 3300046473 Bacteria 2190
1118 Ga0495582_0067075 3300046473 Bacteria 1982
1119 Ga0495582_0078055 3300046473 Bacteria 1836
1120 Ga0495605_0051268 3300046474 Bacteria 2010
1121 Ga0495639_0000895 3300046475 Bacteria 13464
1122 Ga0495639_0028529 3300046475 Bacteria 2473
1123 Ga0495639_0073211 3300046475 Bacteria 1585
1124 Ga0495639_0081799 3300046475 Bacteria 1505
1125 Ga0495662_0005897 3300046476 Bacteria 6127
1126 Ga0495662_0018554 3300046476 Bacteria 3367
1127 Ga0495662_0100798 3300046476 Bacteria 1413
1128 Ga0495664_0000004 3300046477 Bacteria 489411
1129 Ga0495664_0002121 3300046477 Bacteria 10590
1130 Ga0495664_0017866 3300046477 Bacteria 4056
1131 Ga0495664_0020519 3300046477 Bacteria 3811
1132 Ga0495664_0047750 3300046477 Bacteria 2541
1133 Ga0495664_0065850 3300046477 Bacteria 2160
1134 Ga0495664_0071055 3300046477 Bacteria 2079
1135 Ga0495584_0187150 3300046491 Bacteria 1052
1136 Ga0495594_0002041 3300046499 Bacteria 10519
1137 Ga0495594_0043104 3300046499 Bacteria 2473
1138 Ga0495594_0113526 3300046499 Bacteria 1528
1139 Ga0495594_0146243 3300046499 Bacteria 1341
1140 Ga0495607_0088897 3300046501 Bacteria 1678
1141 Ga0495606_0030415 3300046507 Bacteria 3773
1142 Ga0495608_0000005 3300046511 Bacteria 350726
1143 Ga0495608_0002561 3300046511 Bacteria 13056
1144 Ga0495608_0061119 3300046511 Bacteria 2478
1145 Ga0495616_0066516 3300046513 Bacteria 1753
1146 Ga0495618_0000006 3300046514 Bacteria 229906
1147 Ga0495628_0000001 3300046516 Bacteria 917742
1148 Ga0495628_0043344 3300046516 Bacteria 3585
1149 Ga0495628_0057279 3300046516 Bacteria 3065
1150 Ga0495628_0064807 3300046516 Bacteria 2860
1151 Ga0495628_0088643 3300046516 Bacteria 2397
1152 Ga0495628_0100241 3300046516 Bacteria 2236
1153 Ga0495628_0218410 3300046516 Bacteria 1432
1154 Ga0495630_0008324 3300046517 Bacteria 7445
1155 Ga0495630_0010147 3300046517 Bacteria 6789
1156 Ga0495630_0080460 3300046517 Bacteria 2458
1157 Ga0495630_0213036 3300046517 Bacteria 1474
1158 Ga0495630_0327792 3300046517 Unclassified 1171
1159 Ga0495632_0043900 3300046519 Bacteria 2233
1160 Ga0495643_0200633 3300046522 Bacteria 958
1161 Ga0495644_0065197 3300046523 Bacteria 1368
1162 Ga0495663_0081821 3300046525 Bacteria 1041
1163 Ga0495666_0062926 3300046526 Bacteria 1771
1164 Ga0495666_0113792 3300046526 Bacteria 1270
1165 Ga0495666_0180722 3300046526 Bacteria 974
1166 Ga0495652_0000002 3300046529 Bacteria 946606
1167 Ga0495652_0002279 3300046529 Bacteria 20017
1168 Ga0495652_0011312 3300046529 Bacteria 8074
1169 Ga0495652_0016480 3300046529 Bacteria 6611
1170 Ga0495652_0063527 3300046529 Bacteria 3108
1171 Ga0495652_0094173 3300046529 Bacteria 2443
1172 Ga0495652_0143720 3300046529 Bacteria 1873
1173 Ga0495654_0073565 3300046530 Bacteria 1616
1174 Ga0495665_0005346 3300046531 Bacteria 6921
1175 Ga0495665_0021159 3300046531 Bacteria 3494
1176 Ga0495640_0000001 3300046533 Bacteria 853827
1177 Ga0495640_0007696 3300046533 Bacteria 8474
1178 Ga0495640_0012879 3300046533 Bacteria 6378
1179 Ga0495640_0015221 3300046533 Bacteria 5792
1180 Ga0495640_0023503 3300046533 Bacteria 4488
1181 Ga0495640_0035632 3300046533 Bacteria 3521
1182 Ga0495640_0037881 3300046533 Bacteria 3397
1183 Ga0495586_0049150 3300046535 Bacteria 2280
1184 Ga0495587_0000008 3300046536 Bacteria 271097
1185 Ga0495587_0001243 3300046536 Bacteria 16921
1186 Ga0495587_0004574 3300046536 Bacteria 9087
1187 Ga0495587_0045538 3300046536 Bacteria 2607
1188 Ga0495587_0054394 3300046536 Bacteria 2359
1189 Ga0495609_0080620 3300046538 Bacteria 1423
1190 Ga0495621_0047191 3300046539 Bacteria 1530
1191 Ga0495621_0084623 3300046539 Bacteria 1188
1192 Ga0495597_0077869 3300046542 Bacteria 1421
1193 Ga0495645_0000002 3300046543 Bacteria 651644
1194 Ga0495645_0005676 3300046543 Bacteria 8590
1195 Ga0495645_0011949 3300046543 Bacteria 6119
1196 Ga0495645_0033665 3300046543 Bacteria 3738
1197 Ga0495645_0052304 3300046543 Bacteria 2972
1198 Ga0495645_0074602 3300046543 Bacteria 2442
1199 Ga0495622_0011601 3300046557 Bacteria 4072
1200 Ga0495622_0104897 3300046557 Bacteria 1294
1201 Ga0495633_0042522 3300046558 Bacteria 2157
1202 Ga0495667_0000007 3300046559 Bacteria 234736
1203 Ga0495667_0013067 3300046559 Bacteria 5623
1204 Ga0495667_0023999 3300046559 Bacteria 4107
1205 Ga0495667_0024794 3300046559 Bacteria 4040
1206 Ga0495667_0027396 3300046559 Bacteria 3841
1207 Ga0495667_0106508 3300046559 Unclassified 1812
1208 Ga0495667_0234251 3300046559 Bacteria 1170
1209 Ga0495668_0014830 3300046616 Bacteria 4562
1210 Ga0495668_0043257 3300046616 Bacteria 2506
1211 Ga0495668_0095664 3300046616 Bacteria 1625
1212 Ga0495668_0250050 3300046616 Bacteria 971
1213 Ga0495634_0000003 3300046642 Bacteria 206222
1214 Ga0495634_0008591 3300046642 Bacteria 7584
1215 Ga0495634_0009022 3300046642 Bacteria 7378
1216 Ga0495634_0013285 3300046642 Bacteria 5953
1217 Ga0495634_0071156 3300046642 Bacteria 2291
1218 Ga0495634_0114771 3300046642 Bacteria 1729
1219 Ga0495634_0293286 3300046642 Bacteria 985
1220 Ga0495611_0031681 3300046648 Bacteria 2328
1221 Ga0495635_0000002 3300046663 Bacteria 490490
1222 Ga0495635_0001594 3300046663 Bacteria 15272
1223 Ga0495635_0003265 3300046663 Bacteria 11188
1224 Ga0495635_0006165 3300046663 Bacteria 8358
1225 Ga0495635_0007876 3300046663 Bacteria 7441
1226 Ga0495635_0034136 3300046663 Bacteria 3529
1227 Ga0495635_0068078 3300046663 Bacteria 2442
1228 Ga0495635_0073556 3300046663 Bacteria 2341
1229 Ga0495635_0215831 3300046663 Bacteria 1299
1230 Ga0495659_0064493 3300046664 Bacteria 1360
1231 Ga0495588_0001317 3300046674 Bacteria 10602
1232 Ga0495588_0090967 3300046674 Bacteria 1598
1233 Ga0495657_0000637 3300046675 Bacteria 31781
1234 Ga0495657_0001501 3300046675 Bacteria 20104
1235 Ga0495657_0001975 3300046675 Bacteria 17474
1236 Ga0495657_0017083 3300046675 Bacteria 5274
1237 Ga0495657_0064454 3300046675 Bacteria 2414
1238 Ga0495657_0118738 3300046675 Bacteria 1668
1239 Ga0495599_0000005 3300046678 Bacteria 300169
1240 Ga0495599_0021736 3300046678 Bacteria 4004
1241 Ga0495599_0025418 3300046678 Bacteria 3706
1242 Ga0495599_0100659 3300046678 Bacteria 1801
1243 Ga0495599_0168336 3300046678 Bacteria 1353
1244 Ga0495599_0181779 3300046678 Unclassified 1296
1245 Ga0495623_0000034 3300046679 Bacteria 84368
1246 Ga0495623_0002789 3300046679 Bacteria 11529
1247 Ga0495623_0008412 3300046679 Bacteria 6705
1248 Ga0495623_0032975 3300046679 Bacteria 3325
1249 Ga0495623_0094934 3300046679 Bacteria 1823
1250 Ga0495623_0139957 3300046679 Bacteria 1441
1251 Ga0495646_0000002 3300046680 Bacteria 310568
1252 Ga0495646_0014081 3300046680 Bacteria 5086
1253 Ga0495646_0045638 3300046680 Bacteria 2676
1254 Ga0495646_0122524 3300046680 Bacteria 1470
1255 Ga0495646_0147652 3300046680 Unclassified 1310
1256 Ga0495647_0004753 3300046681 Bacteria 4432
1257 Ga0495647_0022130 3300046681 Bacteria 2295
1258 Ga0495658_0003420 3300046683 Bacteria 7855
1259 Ga0495658_0008345 3300046683 Bacteria 5130
1260 Ga0495658_0020153 3300046683 Bacteria 3495
1261 Ga0495658_0036045 3300046683 Bacteria 2726
1262 Ga0495669_0022896 3300046684 Bacteria 2715
1263 Ga0495613_0016113 3300046689 Bacteria 5565
1264 Ga0495613_0055887 3300046689 Bacteria 2899
1265 Ga0495613_0065810 3300046689 Bacteria 2648
1266 Ga0495613_0082604 3300046689 Bacteria 2333
1267 Ga0495613_0163671 3300046689 Bacteria 1581
1268 Ga0495624_0001247 3300046690 Bacteria 20087
1269 Ga0495624_0012143 3300046690 Bacteria 5899
1270 Ga0495624_0024233 3300046690 Bacteria 3995
1271 Ga0495624_0106860 3300046690 Bacteria 1722
1272 Ga0495624_0134371 3300046690 Bacteria 1516
1273 Ga0495624_0198779 3300046690 Bacteria 1218
1274 Ga0495670_0075003 3300046691 Bacteria 1716
1275 Ga0495671_0084994 3300046692 Bacteria 1550
1276 Ga0495600_0000012 3300046809 Bacteria 119798
1277 Ga0495600_0000157 3300046809 Bacteria 39158
1278 Ga0495600_0002441 3300046809 Bacteria 10663
1279 Ga0495600_0003701 3300046809 Bacteria 9037
1280 Ga0495600_0007081 3300046809 Bacteria 6854
1281 Ga0495600_0018632 3300046809 Bacteria 4424
1282 Ga0495600_0065275 3300046809 Bacteria 2380
1283 Ga0495660_0086248 3300046810 Bacteria 1639
1284 Ga0495581_0002392 3300047315 Bacteria 10602
1285 Ga0495581_0004792 3300047315 Bacteria 7820
1286 Ga0495581_0015123 3300047315 Bacteria 4481
1287 Ga0495581_0015422 3300047315 Bacteria 4436
1288 Ga0495581_0022590 3300047315 Bacteria 3644
1289 Ga0495581_0086158 3300047315 Bacteria 1821
1290 Ga0495604_0000009 3300047317 Bacteria 326341
1291 Ga0495604_0002433 3300047317 Bacteria 14892
1292 Ga0495604_0004975 3300047317 Bacteria 10531
1293 Ga0495604_0010822 3300047317 Bacteria 7244
1294 Ga0495604_0034094 3300047317 Bacteria 4028
1295 Ga0495604_0061295 3300047317 Bacteria 2878
1296 Ga0495604_0342282 3300047317 Bacteria 995
1297 Ga0495604_0399855 3300047317 Bacteria 905
1298 Ga0495636_0112402 3300047318 Bacteria 1199
1299 Ga0495674_0000002 3300047319 Bacteria 642785
1300 Ga0495674_0001593 3300047319 Bacteria 22251
1301 Ga0495674_0014137 3300047319 Bacteria 7477
1302 Ga0495674_0020333 3300047319 Bacteria 6147
1303 Ga0495674_0036555 3300047319 Bacteria 4419
1304 Ga0495674_0037752 3300047319 Bacteria 4339
1305 Ga0495674_0038164 3300047319 Bacteria 4313
1306 Ga0495674_0065501 3300047319 Bacteria 3156
1307 Ga0495674_0086033 3300047319 Bacteria 2692
1308 Ga0495674_0259748 3300047319 Bacteria 1427
1309 Ga0495672_0005908 3300047320 Bacteria 9591
1310 Ga0495676_0022777 3300047321 Bacteria 5445
1311 Ga0495676_0037885 3300047321 Bacteria 4009
1312 Ga0495676_0042702 3300047321 Bacteria 3719
1313 Ga0495676_0070107 3300047321 Bacteria 2702
1314 Ga0495676_0217095 3300047321 Bacteria 1320
1315 Ga0495680_0002928 3300047322 Bacteria 17140
1316 Ga0495680_0004897 3300047322 Bacteria 12680
1317 Ga0495680_0005385 3300047322 Bacteria 12064
1318 Ga0495680_0008908 3300047322 Bacteria 9074
1319 Ga0495680_0015305 3300047322 Bacteria 6619
1320 Ga0495680_0019623 3300047322 Bacteria 5703
1321 Ga0495680_0020035 3300047322 Bacteria 5637
1322 Ga0495680_0220308 3300047322 Bacteria 1355
1323 Ga0495675_0000117 3300047444 Bacteria 57179
1324 Ga0495675_0002621 3300047444 Bacteria 10776
1325 Ga0495675_0004738 3300047444 Bacteria 8259
1326 Ga0495675_0012499 3300047444 Bacteria 5343
1327 Ga0495675_0036282 3300047444 Bacteria 3144
1328 Ga0495675_0351423 3300047444 Bacteria 867
1329 Ga0495677_0117274 3300047445 Bacteria 1014
1330 Ga0495673_0027778 3300047469 Bacteria 2688
1331 Ga0495684_0000017 3300047471 Bacteria 160663
1332 Ga0495684_0003949 3300047471 Bacteria 11556
1333 Ga0495684_0004907 3300047471 Bacteria 10436
1334 Ga0495684_0013081 3300047471 Bacteria 6405
1335 Ga0495684_0013703 3300047471 Bacteria 6243
1336 Ga0495684_0047137 3300047471 Bacteria 3297
1337 Ga0495684_0108506 3300047471 Bacteria 2096
1338 Ga0495684_0127177 3300047471 Bacteria 1916
1339 Ga0495684_0180715 3300047471 Bacteria 1564
1340 Ga0495593_0002032 3300047673 Bacteria 12071
1341 Ga0495593_0002743 3300047673 Bacteria 10600
1342 Ga0495593_0018904 3300047673 Bacteria 3866
1343 Ga0495593_0029614 3300047673 Bacteria 3000
1344 Ga0495593_0145760 3300047673 Bacteria 1198
1345 Ga0495593_0164233 3300047673 Unclassified 1120
1346 Ga0495593_0195520 3300047673 Bacteria 1017
1347 Ga0495602_0000005 3300048088 Bacteria 325957
1348 Ga0495602_0009211 3300048088 Bacteria 10276
1349 Ga0495602_0020612 3300048088 Bacteria 6511
1350 Ga0495602_0034885 3300048088 Bacteria 4697
1351 Ga0495602_0106259 3300048088 Bacteria 2292
1352 Ga0495602_0159930 3300048088 Bacteria 1760
1353 Ga0495614_0004882 3300048089 Bacteria 6048
1354 Ga0495615_0026977 3300048090 Bacteria 1345
1355 Ga0496100_0004754 3300048903 Bacteria 7243
1356 Ga0496100_0007028 3300048903 Bacteria 6175
1357 Ga0496100_0009577 3300048903 Bacteria 5444
1358 Ga0496100_0027323 3300048903 Bacteria 3509
1359 Ga0496100_0140219 3300048903 Bacteria 1713
1360 Ga0496100_0277315 3300048903 Bacteria 1248
1361 Ga0496101_0000562 3300048904 Bacteria 22702
1362 Ga0496101_0046965 3300048904 Bacteria 3098
1363 Ga0496101_0062749 3300048904 Bacteria 2702
1364 Ga0496101_0078408 3300048904 Bacteria 2436
1365 Ga0496101_0104360 3300048904 Bacteria 2126
1366 Ga0496101_0135860 3300048904 Bacteria 1871
1367 Ga0496101_0165931 3300048904 Bacteria 1695
1368 Ga0496101_0175645 3300048904 Bacteria 1647
1369 Ga0496101_0201736 3300048904 Bacteria 1538
1370 Ga0496102_0000859 3300048905 Bacteria 29147
1371 Ga0496102_0001763 3300048905 Bacteria 18847
1372 Ga0496102_0003311 3300048905 Bacteria 13655
1373 Ga0496102_0069396 3300048905 Bacteria 3235
1374 Ga0496102_0118224 3300048905 Bacteria 2474
1375 Ga0496102_0125115 3300048905 Bacteria 2403
1376 Ga0496102_0168531 3300048905 Bacteria 2061
1377 Ga0496102_0210956 3300048905 Bacteria 1831
1378 Ga0496102_0219775 3300048905 Bacteria 1791
1379 Ga0496102_0248609 3300048905 Bacteria 1676
1380 Ga0496102_0437576 3300048905 Bacteria 1227
1381 Ga0496102_0448975 3300048905 Bacteria 1210
1382 Ga0496102_0690856 3300048905 Bacteria 943
1383 Ga0496103_0000449 3300048906 Bacteria 35218
1384 Ga0496103_0004452 3300048906 Bacteria 8493
1385 Ga0496103_0009614 3300048906 Bacteria 5725
1386 Ga0496103_0017923 3300048906 Bacteria 4243
1387 Ga0496103_0065758 3300048906 Bacteria 2262
1388 Ga0496104_0000641 3300048907 Bacteria 29948
1389 Ga0496104_0000892 3300048907 Bacteria 25671
1390 Ga0496104_0001517 3300048907 Bacteria 20027
1391 Ga0496104_0002774 3300048907 Bacteria 15090
1392 Ga0496104_0014793 3300048907 Bacteria 7052
1393 Ga0496104_0023319 3300048907 Bacteria 5689
1394 Ga0496104_0036347 3300048907 Bacteria 4604
1395 Ga0496104_0076513 3300048907 Bacteria 3188
1396 Ga0496104_0079304 3300048907 Bacteria 3129
1397 Ga0496104_0116245 3300048907 Bacteria 2567
1398 Ga0496104_0192356 3300048907 Bacteria 1952
1399 Ga0496105_0000053 3300048908 Bacteria 89666
1400 Ga0496105_0005122 3300048908 Bacteria 9937
1401 Ga0496105_0018111 3300048908 Bacteria 5653
1402 Ga0496105_0023363 3300048908 Bacteria 5013
1403 Ga0496105_0035434 3300048908 Bacteria 4106
1404 Ga0496105_0068004 3300048908 Bacteria 2942
1405 Ga0496105_0137452 3300048908 Bacteria 2012
1406 Ga0496105_0148900 3300048908 Bacteria 1924
1407 Ga0496105_0162915 3300048908 Bacteria 1830
1408 Ga0496105_0220237 3300048908 Bacteria 1545
1409 Ga0496105_0398930 3300048908 Bacteria 1092
1410 Ga0496106_0002507 3300048909 Bacteria 13672
1411 Ga0496106_0005212 3300048909 Bacteria 9627
1412 Ga0496106_0015113 3300048909 Bacteria 5714
1413 Ga0496106_0050295 3300048909 Bacteria 3141
1414 Ga0496106_0051468 3300048909 Bacteria 3106
1415 Ga0496106_0065602 3300048909 Bacteria 2764
1416 Ga0496106_0081739 3300048909 Bacteria 2482
1417 Ga0496106_0083597 3300048909 Bacteria 2455
1418 Ga0496106_0148129 3300048909 Bacteria 1850
1419 Ga0496106_0157840 3300048909 Bacteria 1792
1420 Ga0496106_0320089 3300048909 Bacteria 1245
1421 Ga0496106_0373863 3300048909 Bacteria 1145
1422 Ga0496106_0591776 3300048909 Bacteria 889
1423 Ga0496107_0006018 3300048910 Bacteria 8317
1424 Ga0496107_0008583 3300048910 Bacteria 7073
1425 Ga0496107_0011131 3300048910 Bacteria 6258
1426 Ga0496107_0015216 3300048910 Bacteria 5390
1427 Ga0496107_0024532 3300048910 Bacteria 4266
1428 Ga0496107_0045604 3300048910 Bacteria 3154
1429 Ga0496107_0050905 3300048910 Bacteria 2986
1430 Ga0496107_0073873 3300048910 Bacteria 2481
1431 Ga0496107_0163131 3300048910 Bacteria 1652
1432 Ga0496108_0002055 3300048911 Bacteria 16126
1433 Ga0496108_0007560 3300048911 Bacteria 8806
1434 Ga0496108_0031485 3300048911 Bacteria 4402
1435 Ga0496108_0047392 3300048911 Bacteria 3592
1436 Ga0496108_0064117 3300048911 Bacteria 3095
1437 Ga0496108_0116146 3300048911 Bacteria 2292
1438 Ga0496108_0159378 3300048911 Bacteria 1949
1439 Ga0496108_0420047 3300048911 Bacteria 1168
1440 Ga0496108_0435962 3300048911 Bacteria 1144
1441 Ga0496109_0001001 3300048912 Bacteria 23342
1442 Ga0496109_0002191 3300048912 Bacteria 16218
1443 Ga0496109_0018818 3300048912 Bacteria 6075
1444 Ga0496109_0018847 3300048912 Bacteria 6072
1445 Ga0496109_0072449 3300048912 Bacteria 3165
1446 Ga0496109_0076158 3300048912 Bacteria 3085
1447 Ga0496109_0153955 3300048912 Bacteria 2153
1448 Ga0496109_0155508 3300048912 Bacteria 2142
1449 Ga0496109_0178975 3300048912 Bacteria 1991
1450 Ga0496109_0180330 3300048912 Bacteria 1983
1451 Ga0496109_0322658 3300048912 Bacteria 1458
1452 Ga0496110_0006377 3300048913 Bacteria 9328
1453 Ga0496110_0007998 3300048913 Bacteria 8473
1454 Ga0496110_0020194 3300048913 Bacteria 5622
1455 Ga0496110_0052811 3300048913 Bacteria 3571
1456 Ga0496110_0097475 3300048913 Bacteria 2635
1457 Ga0496110_0157762 3300048913 Bacteria 2056
1458 Ga0496110_0201334 3300048913 Bacteria 1809
1459 Ga0496110_0249910 3300048913 Bacteria 1614
1460 Ga0496110_0368415 3300048913 Bacteria 1309
1461 Ga0496110_0418388 3300048913 Bacteria 1222
1462 Ga0496111_0013520 3300048914 Bacteria 5558
1463 Ga0496111_0028627 3300048914 Bacteria 3949
1464 Ga0496111_0054190 3300048914 Bacteria 2898
1465 Ga0496111_0094362 3300048914 Bacteria 2194
1466 Ga0496111_0126592 3300048914 Bacteria 1889
1467 Ga0496111_0210579 3300048914 Bacteria 1444
1468 Ga0496111_0248663 3300048914 Bacteria 1320
1469 Ga0496112_0037572 3300048915 Bacteria 4726
1470 Ga0496112_0046306 3300048915 Bacteria 4265
1471 Ga0496112_0054969 3300048915 Bacteria 3912
1472 Ga0496112_0057849 3300048915 Bacteria 3818
1473 Ga0496112_0068889 3300048915 Bacteria 3495
1474 Ga0496112_0079514 3300048915 Bacteria 3243
1475 Ga0496112_0080954 3300048915 Bacteria 3211
1476 Ga0496112_0114550 3300048915 Bacteria 2666
1477 Ga0496112_0228769 3300048915 Bacteria 1814
1478 Ga0496112_0268720 3300048915 Bacteria 1654
1479 Ga0496112_0347917 3300048915 Bacteria 1425
1480 Ga0496112_0407917 3300048915 Bacteria 1298
1481 Ga0496112_0690333 3300048915 Bacteria 949
1482 Ga0496113_0007772 3300048916 Bacteria 6926
1483 Ga0496113_0015565 3300048916 Bacteria 5233
1484 Ga0496113_0111310 3300048916 Bacteria 2132
1485 Ga0496113_0172597 3300048916 Bacteria 1713
1486 Ga0496113_0215183 3300048916 Bacteria 1530
1487 Ga0496113_0246397 3300048916 Bacteria 1426
1488 Ga0496113_0280516 3300048916 Bacteria 1332
1489 Ga0496113_0313169 3300048916 Bacteria 1258
1490 Ga0496113_0353833 3300048916 Bacteria 1178
1491 Ga0496114_0044430 3300048917 Bacteria 3686
1492 Ga0496114_0075781 3300048917 Bacteria 2834
1493 Ga0496114_0085950 3300048917 Bacteria 2664
1494 Ga0496114_0119662 3300048917 Bacteria 2264
1495 Ga0496114_0243111 3300048917 Bacteria 1583
1496 Ga0496114_0380569 3300048917 Bacteria 1249
1497 Ga0496114_0384007 3300048917 Bacteria 1243
1498 Ga0496115_0029648 3300048918 Bacteria 4298
1499 Ga0496115_0034435 3300048918 Bacteria 4002
1500 Ga0496115_0038962 3300048918 Bacteria 3774
1501 Ga0496115_0053358 3300048918 Bacteria 3244
1502 Ga0496115_0098732 3300048918 Bacteria 2392
1503 Ga0496115_0126095 3300048918 Bacteria 2109
1504 Ga0496115_0308712 3300048918 Bacteria 1295
1505 Ga0496116_0001851 3300048919 Bacteria 22897
1506 Ga0496117_0025880 3300048920 Bacteria 4601
1507 Ga0496117_0142393 3300048920 Bacteria 1433
1508 Ga0496117_0164175 3300048920 Bacteria 1297
1509 Ga0496118_0004903 3300048921 Bacteria 15556
1510 Ga0496118_0008719 3300048921 Bacteria 10420
1511 Ga0496118_0080744 3300048921 Bacteria 2287
1512 Ga0496119_0207823 3300048922 Bacteria 1009
1513 Ga0496121_0000218 3300048924 Bacteria 126175
1514 Ga0496121_0000285 3300048924 Bacteria 104880
1515 Ga0496121_0001057 3300048924 Bacteria 48772
1516 Ga0496121_0017989 3300048924 Bacteria 7162
1517 Ga0496121_0026436 3300048924 Bacteria 5470
1518 Ga0496121_0057185 3300048924 Bacteria 3234
1519 Ga0496121_0084520 3300048924 Bacteria 2502
1520 Ga0496121_0235410 3300048924 Bacteria 1280
1521 Ga0496121_0237825 3300048924 Bacteria 1271
1522 Ga0496121_0250584 3300048924 Bacteria 1228
1523 Ga0496123_0016130 3300048926 Bacteria 6084
1524 Ga0496124_0002080 3300048927 Bacteria 27048
1525 Ga0496124_0012217 3300048927 Bacteria 8495
1526 Ga0496124_0046891 3300048927 Bacteria 3699
1527 Ga0496124_0065513 3300048927 Bacteria 3029
1528 Ga0496124_0076269 3300048927 Bacteria 2768
1529 Ga0496125_0003395 3300048928 Bacteria 19365
1530 Ga0496125_0005571 3300048928 Bacteria 13924
1531 Ga0496125_0071864 3300048928 Bacteria 2700
1532 Ga0496125_0076511 3300048928 Bacteria 2584
1533 Ga0496125_0080915 3300048928 Bacteria 2484
1534 Ga0496126_0001598 3300048929 Bacteria 34515
1535 Ga0496126_0001827 3300048929 Bacteria 31077
1536 Ga0496126_0008869 3300048929 Bacteria 10776
1537 Ga0496126_0033867 3300048929 Bacteria 4805
1538 Ga0496126_0066063 3300048929 Bacteria 3235
1539 Ga0496126_0070228 3300048929 Bacteria 3121
1540 Ga0496126_0105595 3300048929 Bacteria 2459
1541 Ga0496126_0108662 3300048929 Bacteria 2418
1542 Ga0496126_0196738 3300048929 Bacteria 1704
1543 Ga0496126_0249526 3300048929 Bacteria 1479
1544 Ga0496126_0344965 3300048929 Bacteria 1219
1545 Ga0501031_0009529 3300049568 Bacteria 6320
1546 Ga0501032_0005337 3300049569 Bacteria 9563
1547 Ga0501033_0000839 3300049570 Bacteria 28060
1548 Ga0501033_0252079 3300049570 Bacteria 1250
1549 Ga0501036_0052515 3300049572 Bacteria 3452
1550 Ga0501037_0000228 3300049573 Bacteria 49067
1551 Ga0501037_0021636 3300049573 Bacteria 4754
1552 Ga0501038_0033758 3300049574 Bacteria 4503
1553 Ga0501039_0007392 3300049575 Bacteria 8376
1554 Ga0501040_0245773 3300049576 Bacteria 1276
1555 Ga0501042_0022234 3300049578 Bacteria 4430
1556 Ga0501042_0036026 3300049578 Bacteria 3510
1557 Ga0501046_0011344 3300049580 Bacteria 7625
1558 Ga0501048_0088098 3300049582 Bacteria 2189
1559 Ga0501067_0086840 3300049583 Bacteria 1735
1560 Ga0501068_0042057 3300049584 Bacteria 2747
1561 Ga0501071_0223114 3300049587 Bacteria 1419
1562 Ga0501071_0398713 3300049587 Bacteria 1050
1563 Ga0501074_0021507 3300049590 Bacteria 4683
1564 Ga0501076_0038118 3300049592 Bacteria 3773
1565 Ga0501076_0314133 3300049592 Bacteria 1285
1566 Ga0501076_0426177 3300049592 Bacteria 1092
1567 Ga0501079_0318265 3300049741 Bacteria 1218
1568 Ga0501080_0096584 3300049742 Bacteria 2743
1569 Ga0501083_0135981 3300049744 Bacteria 1610
1570 Ga0501035_0001120 3300049822 Bacteria 28018
1571 Ga0501044_0016887 3300049823 Bacteria 7831
1572 nmdc:mga03683_1015_c1 3300050489 Bacteria 8206
1573 nmdc:mga03683_135587_c1 3300050489 Bacteria 1104
1574 nmdc:mga03683_209087_c1 3300050489 Bacteria 897
1575 nmdc:mga03n38_185640_c1 3300050490 Bacteria 1068
1576 nmdc:mga03n38_32096_c1 3300050490 Bacteria 2222
1577 nmdc:mga00v17_16253_c1 3300050491 Bacteria 4194
1578 nmdc:mga00v17_72091_c1 3300050491 Bacteria 2143
1579 nmdc:mga00v17_97752_c1 3300050491 Bacteria 1851
1580 nmdc:mga0yw44_105912_c1 3300050492 Bacteria 1797
1581 nmdc:mga0yw44_14867_c1 3300050492 Bacteria 4150
1582 nmdc:mga0yw44_167451_c1 3300050492 Bacteria 1442
1583 nmdc:mga0yw44_194015_c1 3300050492 Bacteria 1340
1584 nmdc:mga0yw44_259272_c1 3300050492 Bacteria 1158
1585 nmdc:mga0yw44_4572_c1 3300050492 Bacteria 6374
1586 nmdc:mga0yw44_5649_c1 3300050492 Bacteria 5949
1587 nmdc:mga0yw44_63300_c1 3300050492 Bacteria 2274
1588 nmdc:mga0k408_268923_c1 3300050493 Bacteria 1018
1589 nmdc:mga0k408_64690_c1 3300050493 Bacteria 2128
1590 nmdc:mga0k408_7541_c1 3300050493 Bacteria 5812
1591 nmdc:mga0k408_8212_c1 3300050493 Bacteria 5595
1592 nmdc:mga06z11_106374_c1 3300050494 Unclassified 1547
1593 nmdc:mga06z11_300852_c1 3300050494 Bacteria 954
1594 nmdc:mga06z11_52830_c1 3300050494 Bacteria 2087
1595 nmdc:mga06z11_7657_c1 3300050494 Bacteria 4458
1596 nmdc:mga06z11_83755_c1 3300050494 Bacteria 1717
1597 nmdc:mga06z11_98501_c1 3300050494 Bacteria 1600
1598 nmdc:mga04h51_32389_c1 3300050495 Bacteria 1658
1599 nmdc:mga04h51_7948_c1 3300050495 Bacteria 2822
1600 nmdc:mga07m45_210112_c1 3300050496 Bacteria 1132
1601 nmdc:mga07m45_25757_c1 3300050496 Bacteria 2683
1602 nmdc:mga07m45_36540_c1 3300050496 Bacteria 2736
1603 nmdc:mga07m45_3783_c1 3300050496 Bacteria 7321
1604 nmdc:mga07m45_4727_c1 3300050496 Bacteria 6687
1605 nmdc:mga07m45_57187_c1 3300050496 Bacteria 2205
1606 nmdc:mga05p37_164286_c1 3300050507 Bacteria 2710
1607 nmdc:mga05p37_2263_c1 3300050507 Bacteria 22436
1608 nmdc:mga05p37_3065_c1 3300050507 Bacteria 19411
1609 nmdc:mga05p37_32472_c1 3300050507 Bacteria 6384
1610 nmdc:mga05p37_623331_c1 3300050507 Bacteria 1213
1611 nmdc:mga05p37_85508_c1 3300050507 Bacteria 3886
1612 nmdc:mga09592_12705_c1 3300050508 Bacteria 6863
1613 nmdc:mga09592_13129_c1 3300050508 Bacteria 6760
1614 nmdc:mga09592_77772_c1 3300050508 Bacteria 2823
1615 nmdc:mga0qj67_63811_c1 3300050509 Bacteria 2929
1616 nmdc:mga0qj67_677_c1 3300050509 Bacteria 23246
1617 nmdc:mga06r32_24506_c1 3300050510 Bacteria 5602
1618 nmdc:mga06r32_25255_c1 3300050510 Bacteria 5526
1619 nmdc:mga08y16_101295_c1 3300050511 Bacteria 2998
1620 nmdc:mga08y16_13846_c1 3300050511 Bacteria 8491
1621 nmdc:mga08y16_16169_c1 3300050511 Bacteria 7844
1622 nmdc:mga08y16_167625_c1 3300050511 Bacteria 2282
1623 nmdc:mga08y16_31703_c1 3300050511 Bacteria 5558
1624 nmdc:mga08y16_410170_c1 3300050511 Bacteria 1385
1625 nmdc:mga08y16_515502_c1 3300050511 Bacteria 1213
1626 nmdc:mga08y16_7832_c1 3300050511 Bacteria 11191
1627 nmdc:mga0n895_160864_c1 3300050512 Bacteria 2277
1628 nmdc:mga0n895_168468_c1 3300050512 Bacteria 2222
1629 nmdc:mga0n895_19426_c1 3300050512 Bacteria 6317
1630 nmdc:mga0n895_2078_c1 3300050512 Bacteria 15421
1631 nmdc:mga0n895_219118_c1 3300050512 Bacteria 1932
1632 nmdc:mga0n895_459512_c1 3300050512 Bacteria 1285
1633 nmdc:mga0n895_80379_c1 3300050512 Bacteria 3248
1634 nmdc:mga0n895_80795_c1 3300050512 Bacteria 3239
1635 nmdc:mga0rr50_27234_c1 3300050513 Bacteria 3998
1636 nmdc:mga0rr50_357570_c1 3300050513 Bacteria 1229
1637 nmdc:mga0rr50_4593_c1 3300050513 Bacteria 8133
1638 nmdc:mga08x19_236705_c1 3300050514 Unclassified 1258
1639 nmdc:mga08x19_53884_c1 3300050514 Bacteria 2588
1640 nmdc:mga08x19_56416_c1 3300050514 Bacteria 2535
1641 nmdc:mga0a205_1227_c1 3300050515 Bacteria 21496
1642 nmdc:mga0a205_403355_c1 3300050515 Bacteria 1231
1643 nmdc:mga0a205_4997_c1 3300050515 Bacteria 11936
1644 nmdc:mga0a205_5496_c1 3300050515 Bacteria 11414
1645 nmdc:mga0a205_8704_c1 3300050515 Bacteria 9242
1646 nmdc:mga0sz30_3228_c1 3300050516 Bacteria 5503
1647 nmdc:mga0sz30_7137_c1 3300050516 Bacteria 2182
1648 Ga0495601_0000002 3300053077 Bacteria 528704
1649 Ga0495601_0000354 3300053077 Bacteria 24072
1650 Ga0495601_0003060 3300053077 Bacteria 9540
1651 Ga0495601_0014974 3300053077 Bacteria 4682
1652 Ga0495601_0067560 3300053077 Bacteria 2278
1653 Ga0495601_0304163 3300053077 Unclassified 1038
1654 Ga0495612_0000011 3300053078 Bacteria 224729
1655 Ga0495612_0002235 3300053078 Bacteria 7959
1656 Ga0495612_0012264 3300053078 Bacteria 3456
1657 Ga0495612_0034895 3300053078 Bacteria 2037
1658 Ga0495612_0106110 3300053078 Bacteria 1199
1659 Ga0500635_0090220 3300053080 Bacteria 1114
1660 Ga0495655_0044174 3300053083 Bacteria 1152
1661 Ga0495595_0000026 3300053084 Bacteria 99949
1662 Ga0495595_0002847 3300053084 Bacteria 6811
1663 Ga0495595_0030995 3300053084 Bacteria 2401
1664 Ga0495595_0031080 3300053084 Bacteria 2398
1665 Ga0495595_0074369 3300053084 Bacteria 1610
1666 Ga0495595_0099825 3300053084 Bacteria 1400
1667 Ga0495595_0130448 3300053084 Bacteria 1228
1668 Ga0495619_0000019 3300053085 Bacteria 209518
1669 Ga0495619_0000138 3300053085 Bacteria 54413
1670 Ga0495619_0001878 3300053085 Bacteria 13998
1671 Ga0495619_0007284 3300053085 Bacteria 7005
1672 Ga0495619_0020048 3300053085 Bacteria 4255
1673 Ga0495619_0039069 3300053085 Bacteria 3097
1674 Ga0495619_0069057 3300053085 Bacteria 2361
1675 Ga0495619_0078329 3300053085 Bacteria 2222
1676 Ga0495619_0134691 3300053085 Bacteria 1699
1677 Ga0495619_0175193 3300053085 Bacteria 1484
1678 Ga0495619_0201477 3300053085 Bacteria 1378
1679 Ga0500643_026362 3300053087 Bacteria 1821
1680 Ga0500643_031544 3300053087 Bacteria 1615
1681 Ga0500644_0079814 3300053088 Bacteria 1200
1682 Ga0500651_0066868 3300053093 Bacteria 2238
1683 Ga0500566_0002103 3300053094 Bacteria 11747
1684 Ga0500566_0024790 3300053094 Bacteria 3518
1685 Ga0500641_0003335 3300053096 Bacteria 5686
1686 Ga0500641_0003589 3300053096 Bacteria 5478
1687 Ga0500650_0000137 3300053098 Bacteria 19102
1688 Ga0500554_001944 3300053102 Bacteria 4007
1689 Ga0500555_050567 3300053103 Bacteria 1138
1690 Ga0500556_0000004 3300053104 Bacteria 666287
1691 Ga0500595_000131 3300053119 Bacteria 49217
1692 Ga0500595_001300 3300053119 Bacteria 13578
1693 Ga0500595_011098 3300053119 Bacteria 3545
1694 Ga0500595_011612 3300053119 Bacteria 3437
1695 Ga0500595_016775 3300053119 Bacteria 2721
1696 Ga0500652_001024 3300053131 Bacteria 9124
1697 Ga0500561_0013105 3300053137 Bacteria 1786
1698 Ga0500568_0002788 3300053139 Bacteria 10105
1699 Ga0500568_0066451 3300053139 Bacteria 1387
1700 Ga0500603_006939 3300053150 Bacteria 2472
1701 Ga0500603_018659 3300053150 Bacteria 1674
1702 Ga0500604_0032400 3300053151 Bacteria 1540
1703 Ga0500616_0022745 3300053153 Bacteria 3498
1704 Ga0500622_0000246 3300053156 Bacteria 55782
1705 Ga0500627_0008607 3300053158 Bacteria 3635
1706 Ga0500627_0119785 3300053158 Bacteria 1187
1707 Ga0500638_000960 3300053162 Bacteria 8254
1708 Ga0500636_0065109 3300053177 Bacteria 2122
1709 Ga0500636_0102341 3300053177 Bacteria 1626
1710 Ga0500636_0136788 3300053177 Bacteria 1360
1711 Ga0500637_0010663 3300053178 Bacteria 4718
1712 Ga0500645_021933 3300053730 Bacteria 1968
1713 Ga0500609_010095 3300053731 Bacteria 1271
1714 Ga0500661_001000 3300055283 Bacteria 5309
1715 Ga0501082_0448074 3300060353 Bacteria 1128
1716 Ga0530510_0039833 3300061734 Bacteria 3391

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006880 Ga0075429_100032991 Ga0075429_1000329912 253
2 3300009147 Ga0114129_10236000 Ga0114129_102360002 253
3 3300050508 nmdc:mga09592_77772_c1 nmdc:mga09592_77772_c1_106_936 253
4 3300053083 Ga0495655_0044174 Ga0495655_0044174_177_950 257
5 3300035170 Ga0373943_0198768 Ga0373943_0198768_298_1077 259
6 3300035410 Ga0373924_0008715 Ga0373924_0008715_2892_3671 259
7 3300046499 Ga0495594_0146243 Ga0495594_0146243_538_1317 259
8 3300046809 Ga0495600_0065275 Ga0495600_0065275_20_799 259
9 3300047317 Ga0495604_0399855 Ga0495604_0399855_29_808 259
10 3300047318 Ga0495636_0112402 Ga0495636_0112402_384_1163 259
11 3300048913 Ga0496110_0157762 Ga0496110_0157762_576_1355 259
12 3300049592 Ga0501076_0426177 Ga0501076_0426177_186_1016 259
13 3300050493 nmdc:mga0k408_64690_c1 nmdc:mga0k408_64690_c1_32_811 259
14 3300050494 nmdc:mga06z11_300852_c1 nmdc:mga06z11_300852_c1_70_849 259
15 3300050512 nmdc:mga0n895_168468_c1 nmdc:mga0n895_168468_c1_20_799 259
16 3300005467 Ga0070706_100029910 Ga0070706_1000299101 261
17 3300025986 Ga0207658_10380132 Ga0207658_103801322 262
18 3300046491 Ga0495584_0187150 Ga0495584_0187150_15_803 262
19 3300053085 Ga0495619_0175193 Ga0495619_0175193_668_1456 262
20 3300009148 Ga0105243_10060204 Ga0105243_100602042 264
21 3300025935 Ga0207709_10035469 Ga0207709_100354692 264
22 3300005327 Ga0070658_10251602 Ga0070658_102516022 266
23 3300005983 Ga0081540_1006127 Ga0081540_10061273 266
24 3300046616 Ga0495668_0250050 Ga0495668_0250050_117_944 267
25 3300013308 Ga0157375_10132182 Ga0157375_101321822 268
26 3300048918 Ga0496115_0308712 Ga0496115_0308712_388_1194 268
27 3300035171 Ga0373946_0031171 Ga0373946_0031171_712_1542 269
28 3300035725 Ga0373947_0078049 Ga0373947_0078049_502_1332 269
29 3300037068 Ga0373925_0197288 Ga0373925_0197288_407_1237 269
30 3300046459 Ga0495629_0031343 Ga0495629_0031343_753_1583 269
31 3300046473 Ga0495582_0067075 Ga0495582_0067075_420_1250 269
32 3300046475 Ga0495639_0028529 Ga0495639_0028529_418_1248 269
33 3300046477 Ga0495664_0071055 Ga0495664_0071055_683_1513 269
34 3300046517 Ga0495630_0008324 Ga0495630_0008324_6282_7112 269
35 3300046526 Ga0495666_0113792 Ga0495666_0113792_183_1013 269
36 3300046559 Ga0495667_0234251 Ga0495667_0234251_186_1016 269
37 3300046663 Ga0495635_0034136 Ga0495635_0034136_834_1664 269
38 3300046674 Ga0495588_0001317 Ga0495588_0001317_6668_7498 269
39 3300046683 Ga0495658_0036045 Ga0495658_0036045_1430_2260 269
40 3300046689 Ga0495613_0055887 Ga0495613_0055887_507_1337 269
41 3300046809 Ga0495600_0007081 Ga0495600_0007081_1325_2155 269
42 3300047315 Ga0495581_0015422 Ga0495581_0015422_3207_4037 269
43 3300047321 Ga0495676_0037885 Ga0495676_0037885_229_1059 269
44 3300047471 Ga0495684_0003949 Ga0495684_0003949_514_1344 269
45 3300048089 Ga0495614_0004882 Ga0495614_0004882_835_1665 269
46 3300053078 Ga0495612_0034895 Ga0495612_0034895_39_869 269
47 3300005354 Ga0070675_100518179 Ga0070675_1005181791 270
48 3300009545 Ga0105237_10297253 Ga0105237_102972532 270
49 3300026121 Ga0207683_10058072 Ga0207683_100580722 270
50 3300050514 nmdc:mga08x19_236705_c1 nmdc:mga08x19_236705_c1_433_1245 270
51 iso_pu_bacteria 2524023210 2524471458 271
52 iso_pu_bacteria 2602042107 2603859153 271
53 iso_pu_bacteria 2721755755 2723846683 271
54 iso_pu_bacteria 2728368998 2728753163 271
55 iso_pu_bacteria 2791355199 2793082828 271
56 iso_pu_bacteria 2874604998 2874611302 271
57 iso_pu_bacteria 2885409591 2885416720 271
58 iso_pu_bacteria 2888419890 2888425126 271
59 iso_pu_bacteria 2889033259 2889040862 271
60 iso_pu_bacteria 8006984368 8006991385 271
61 iso_pu_bacteria 8016603502 8016608971 271
62 iso_pu_bacteria 8016613128 8016615926 271
63 iso_pu_bacteria 8016622563 8016625287 271
64 iso_pu_bacteria 8019547302 8019552334 271
65 3300025925 Ga0207650_10305692 Ga0207650_103056921 272
66 3300048924 Ga0496121_0250584 Ga0496121_0250584_352_1170 272
67 3300048909 Ga0496106_0591776 Ga0496106_0591776_55_876 273
68 iso_pu_bacteria 2935984226 2935991492 273
69 3300005436 Ga0070713_100237163 Ga0070713_1002371632 274
70 3300005842 Ga0068858_100349732 Ga0068858_1003497322 274
71 3300006195 Ga0075366_10039136 Ga0075366_100391362 274
72 3300013297 Ga0157378_10096103 Ga0157378_100961031 274
73 3300013306 Ga0163162_10597636 Ga0163162_105976362 274
74 3300014325 Ga0163163_10507661 Ga0163163_105076612 274
75 3300014969 Ga0157376_10412373 Ga0157376_104123732 274
76 3300026035 Ga0207703_10255084 Ga0207703_102550842 274
77 3300035725 Ga0373947_0314404 Ga0373947_0314404_184_1011 274
78 3300037068 Ga0373925_0290315 Ga0373925_0290315_298_1125 274
79 3300038443 Ga0395901_0455992 Ga0395901_0455992_33_860 274
80 3300046533 Ga0495640_0035632 Ga0495640_0035632_272_1099 274
81 3300046642 Ga0495634_0293286 Ga0495634_0293286_75_902 274
82 3300047319 Ga0495674_0259748 Ga0495674_0259748_248_1075 274
83 3300048088 Ga0495602_0159930 Ga0495602_0159930_658_1485 274
84 3300048909 Ga0496106_0051468 Ga0496106_0051468_1186_2013 274
85 3300048917 Ga0496114_0119662 Ga0496114_0119662_158_982 274
86 3300050493 nmdc:mga0k408_8212_c1 nmdc:mga0k408_8212_c1_4243_5070 274
87 3300001989 JGI24739J22299_10005255 JGI24739J22299_100052552 275
88 3300001990 JGI24737J22298_10003482 JGI24737J22298_100034822 275
89 3300002067 JGI24735J21928_10007734 JGI24735J21928_100077342 275
90 3300003323 rootH1_10154409 rootH1_101544092 275
91 3300003323 rootH1_10353167 rootH1_103531672 275
92 3300003659 JGI25404J52841_10000680 JGI25404J52841_100006802 275
93 3300003659 JGI25404J52841_10002384 JGI25404J52841_100023841 275
94 3300003659 JGI25404J52841_10002856 JGI25404J52841_100028562 275
95 3300003659 JGI25404J52841_10010925 JGI25404J52841_100109252 275
96 3300003659 JGI25404J52841_10030387 JGI25404J52841_100303872 275
97 3300004801 Ga0058860_12238834 Ga0058860_122388342 275
98 3300005327 Ga0070658_10001973 Ga0070658_1000197312 275
99 3300005327 Ga0070658_10014461 Ga0070658_100144611 275
100 3300005327 Ga0070658_10342445 Ga0070658_103424452 275
101 3300005334 Ga0068869_100009191 Ga0068869_1000091912 275
102 3300005334 Ga0068869_100055624 Ga0068869_1000556242 275
103 3300005334 Ga0068869_100089538 Ga0068869_1000895382 275
104 3300005338 Ga0068868_100026836 Ga0068868_1000268365 275
105 3300005338 Ga0068868_100059128 Ga0068868_1000591282 275
106 3300005338 Ga0068868_100147290 Ga0068868_1001472902 275
107 3300005338 Ga0068868_100401761 Ga0068868_1004017611 275
108 3300005339 Ga0070660_100130071 Ga0070660_1001300712 275
109 3300005340 Ga0070689_100001188 Ga0070689_10000118815 275
110 3300005340 Ga0070689_100498174 Ga0070689_1004981742 275
111 3300005341 Ga0070691_10141366 Ga0070691_101413661 275
112 3300005343 Ga0070687_100154889 Ga0070687_1001548892 275
113 3300005344 Ga0070661_100406522 Ga0070661_1004065222 275
114 3300005347 Ga0070668_100006143 Ga0070668_1000061437 275
115 3300005347 Ga0070668_100009054 Ga0070668_1000090542 275
116 3300005347 Ga0070668_100331341 Ga0070668_1003313411 275
117 3300005347 Ga0070668_100657489 Ga0070668_1006574891 275
118 3300005353 Ga0070669_100321500 Ga0070669_1003215002 275
119 3300005354 Ga0070675_100193430 Ga0070675_1001934302 275
120 3300005356 Ga0070674_100011339 Ga0070674_1000113392 275
121 3300005356 Ga0070674_100358998 Ga0070674_1003589982 275
122 3300005364 Ga0070673_100094191 Ga0070673_1000941912 275
123 3300005365 Ga0070688_100000671 Ga0070688_1000006712 275
124 3300005365 Ga0070688_100106012 Ga0070688_1001060122 275
125 3300005365 Ga0070688_100170906 Ga0070688_1001709062 275
126 3300005365 Ga0070688_100185424 Ga0070688_1001854241 275
127 3300005366 Ga0070659_100126931 Ga0070659_1001269312 275
128 3300005367 Ga0070667_100044976 Ga0070667_1000449762 275
129 3300005367 Ga0070667_100282944 Ga0070667_1002829442 275
130 3300005367 Ga0070667_100490067 Ga0070667_1004900671 275
131 3300005434 Ga0070709_10010540 Ga0070709_100105402 275
132 3300005435 Ga0070714_100005014 Ga0070714_1000050144 275
133 3300005435 Ga0070714_100314989 Ga0070714_1003149892 275
134 3300005436 Ga0070713_100071029 Ga0070713_1000710292 275
135 3300005436 Ga0070713_100112582 Ga0070713_1001125822 275
136 3300005437 Ga0070710_10026587 Ga0070710_100265872 275
137 3300005437 Ga0070710_10243970 Ga0070710_102439702 275
138 3300005438 Ga0070701_10142288 Ga0070701_101422882 275
139 3300005439 Ga0070711_100019842 Ga0070711_1000198422 275
140 3300005441 Ga0070700_100145831 Ga0070700_1001458312 275
141 3300005441 Ga0070700_100220675 Ga0070700_1002206751 275
142 3300005455 Ga0070663_100007153 Ga0070663_1000071534 275
143 3300005455 Ga0070663_100029267 Ga0070663_1000292673 275
144 3300005455 Ga0070663_100121094 Ga0070663_1001210941 275
145 3300005455 Ga0070663_100152090 Ga0070663_1001520901 275
146 3300005455 Ga0070663_100164620 Ga0070663_1001646202 275
147 3300005455 Ga0070663_100541959 Ga0070663_1005419591 275
148 3300005456 Ga0070678_100008372 Ga0070678_1000083722 275
149 3300005456 Ga0070678_100040022 Ga0070678_1000400222 275
150 3300005456 Ga0070678_100153067 Ga0070678_1001530671 275
151 3300005456 Ga0070678_100437577 Ga0070678_1004375771 275
152 3300005457 Ga0070662_100053784 Ga0070662_1000537843 275
153 3300005457 Ga0070662_100508056 Ga0070662_1005080561 275
154 3300005459 Ga0068867_100140150 Ga0068867_1001401501 275
155 3300005466 Ga0070685_10108511 Ga0070685_101085112 275
156 3300005466 Ga0070685_10187159 Ga0070685_101871592 275
157 3300005466 Ga0070685_10325582 Ga0070685_103255821 275
158 3300005471 Ga0070698_100075300 Ga0070698_1000753003 275
159 3300005518 Ga0070699_100071679 Ga0070699_1000716792 275
160 3300005539 Ga0068853_100001830 Ga0068853_1000018309 275
161 3300005539 Ga0068853_100028494 Ga0068853_1000284942 275
162 3300005543 Ga0070672_100050128 Ga0070672_1000501282 275
163 3300005544 Ga0070686_100013648 Ga0070686_1000136483 275
164 3300005545 Ga0070695_100134316 Ga0070695_1001343162 275
165 3300005545 Ga0070695_100140770 Ga0070695_1001407702 275
166 3300005545 Ga0070695_100335855 Ga0070695_1003358552 275
167 3300005548 Ga0070665_100001310 Ga0070665_1000013107 275
168 3300005548 Ga0070665_100085361 Ga0070665_1000853612 275
169 3300005548 Ga0070665_100125836 Ga0070665_1001258362 275
170 3300005548 Ga0070665_100183136 Ga0070665_1001831362 275
171 3300005563 Ga0068855_100020591 Ga0068855_1000205912 275
172 3300005563 Ga0068855_100338171 Ga0068855_1003381711 275
173 3300005564 Ga0070664_100438640 Ga0070664_1004386402 275
174 3300005577 Ga0068857_100017290 Ga0068857_1000172901 275
175 3300005577 Ga0068857_100047256 Ga0068857_1000472562 275
176 3300005577 Ga0068857_100681276 Ga0068857_1006812761 275
177 3300005578 Ga0068854_100002442 Ga0068854_1000024426 275
178 3300005614 Ga0068856_100007499 Ga0068856_10000749910 275
179 3300005615 Ga0070702_100076230 Ga0070702_1000762302 275
180 3300005615 Ga0070702_100138527 Ga0070702_1001385271 275
181 3300005616 Ga0068852_100039958 Ga0068852_1000399583 275
182 3300005616 Ga0068852_100509117 Ga0068852_1005091172 275
183 3300005617 Ga0068859_100153635 Ga0068859_1001536352 275
184 3300005618 Ga0068864_100014618 Ga0068864_1000146186 275
185 3300005618 Ga0068864_100015657 Ga0068864_1000156572 275
186 3300005618 Ga0068864_100025060 Ga0068864_1000250604 275
187 3300005718 Ga0068866_10173861 Ga0068866_101738612 275
188 3300005719 Ga0068861_100057714 Ga0068861_1000577142 275
189 3300005719 Ga0068861_100168651 Ga0068861_1001686512 275
190 3300005719 Ga0068861_100462214 Ga0068861_1004622142 275
191 3300005719 Ga0068861_100539379 Ga0068861_1005393792 275
192 3300005834 Ga0068851_10012441 Ga0068851_100124412 275
193 3300005841 Ga0068863_100238099 Ga0068863_1002380991 275
194 3300005842 Ga0068858_100017864 Ga0068858_1000178643 275
195 3300005842 Ga0068858_100283765 Ga0068858_1002837652 275
196 3300005842 Ga0068858_100327573 Ga0068858_1003275731 275
197 3300005842 Ga0068858_100573284 Ga0068858_1005732842 275
198 3300005843 Ga0068860_100000223 Ga0068860_10000022318 275
199 3300005843 Ga0068860_100048218 Ga0068860_1000482182 275
200 3300005843 Ga0068860_100073195 Ga0068860_1000731952 275
201 3300005843 Ga0068860_100074089 Ga0068860_1000740893 275
202 3300005844 Ga0068862_100075170 Ga0068862_1000751702 275
203 3300005844 Ga0068862_100317805 Ga0068862_1003178052 275
204 3300005844 Ga0068862_100379910 Ga0068862_1003799102 275
205 3300005844 Ga0068862_100529112 Ga0068862_1005291122 275
206 3300005844 Ga0068862_100533538 Ga0068862_1005335381 275
207 3300005937 Ga0081455_10000855 Ga0081455_1000085520 275
208 3300005937 Ga0081455_10010613 Ga0081455_100106138 275
209 3300005937 Ga0081455_10012279 Ga0081455_100122794 275
210 3300005937 Ga0081455_10023973 Ga0081455_100239734 275
211 3300005937 Ga0081455_10061057 Ga0081455_100610572 275
212 3300005937 Ga0081455_10094668 Ga0081455_100946682 275
213 3300005937 Ga0081455_10370276 Ga0081455_103702761 275
214 3300005981 Ga0081538_10004294 Ga0081538_100042948 275
215 3300005981 Ga0081538_10095192 Ga0081538_100951922 275
216 3300005983 Ga0081540_1000729 Ga0081540_100072928 275
217 3300005983 Ga0081540_1001212 Ga0081540_10012128 275
218 3300005983 Ga0081540_1001375 Ga0081540_100137513 275
219 3300005983 Ga0081540_1002044 Ga0081540_10020442 275
220 3300005983 Ga0081540_1002180 Ga0081540_10021802 275
221 3300005983 Ga0081540_1004468 Ga0081540_10044686 275
222 3300005983 Ga0081540_1006813 Ga0081540_100681314 275
223 3300005983 Ga0081540_1020177 Ga0081540_10201774 275
224 3300005983 Ga0081540_1076508 Ga0081540_10765082 275
225 3300005983 Ga0081540_1081093 Ga0081540_10810932 275
226 3300005983 Ga0081540_1092726 Ga0081540_10927261 275
227 3300005985 Ga0081539_10032404 Ga0081539_100324042 275
228 3300006028 Ga0070717_10004651 Ga0070717_100046519 275
229 3300006028 Ga0070717_10129420 Ga0070717_101294202 275
230 3300006038 Ga0075365_10004934 Ga0075365_100049342 275
231 3300006038 Ga0075365_10015976 Ga0075365_100159762 275
232 3300006038 Ga0075365_10026778 Ga0075365_100267782 275
233 3300006038 Ga0075365_10036867 Ga0075365_100368672 275
234 3300006038 Ga0075365_10041243 Ga0075365_100412432 275
235 3300006038 Ga0075365_10073187 Ga0075365_100731872 275
236 3300006038 Ga0075365_10125811 Ga0075365_101258112 275
237 3300006042 Ga0075368_10031028 Ga0075368_100310282 275
238 3300006048 Ga0075363_100013624 Ga0075363_1000136243 275
239 3300006048 Ga0075363_100073387 Ga0075363_1000733872 275
240 3300006051 Ga0075364_10023135 Ga0075364_100231352 275
241 3300006051 Ga0075364_10040388 Ga0075364_100403882 275
242 3300006173 Ga0070716_100034667 Ga0070716_1000346672 275
243 3300006175 Ga0070712_100031362 Ga0070712_1000313622 275
244 3300006175 Ga0070712_100034084 Ga0070712_1000340842 275
245 3300006175 Ga0070712_100296345 Ga0070712_1002963452 275
246 3300006177 Ga0075362_10047899 Ga0075362_100478992 275
247 3300006177 Ga0075362_10098889 Ga0075362_100988892 275
248 3300006178 Ga0075367_10005687 Ga0075367_100056875 275
249 3300006178 Ga0075367_10030436 Ga0075367_100304362 275
250 3300006178 Ga0075367_10107883 Ga0075367_101078831 275
251 3300006186 Ga0075369_10072123 Ga0075369_100721232 275
252 3300006186 Ga0075369_10159450 Ga0075369_101594502 275
253 3300006195 Ga0075366_10117339 Ga0075366_101173392 275
254 3300006237 Ga0097621_100110647 Ga0097621_1001106472 275
255 3300006237 Ga0097621_100205457 Ga0097621_1002054571 275
256 3300006353 Ga0075370_10009612 Ga0075370_100096125 275
257 3300006353 Ga0075370_10011205 Ga0075370_100112052 275
258 3300006353 Ga0075370_10057235 Ga0075370_100572352 275
259 3300006353 Ga0075370_10163023 Ga0075370_101630232 275
260 3300006358 Ga0068871_100058133 Ga0068871_1000581332 275
261 3300006358 Ga0068871_100640437 Ga0068871_1006404371 275
262 3300006844 Ga0075428_100306955 Ga0075428_1003069552 275
263 3300006871 Ga0075434_100058672 Ga0075434_1000586723 275
264 3300006871 Ga0075434_100626768 Ga0075434_1006267682 275
265 3300006931 Ga0097620_100153626 Ga0097620_1001536262 275
266 3300006931 Ga0097620_100791696 Ga0097620_1007916961 275
267 3300007076 Ga0075435_100342655 Ga0075435_1003426552 275
268 3300007076 Ga0075435_100399339 Ga0075435_1003993391 275
269 3300007265 Ga0099794_10010283 Ga0099794_100102832 275
270 3300007788 Ga0099795_10021447 Ga0099795_100214472 275
271 3300009092 Ga0105250_10058301 Ga0105250_100583012 275
272 3300009093 Ga0105240_10001508 Ga0105240_1000150837 275
273 3300009093 Ga0105240_10016402 Ga0105240_100164024 275
274 3300009094 Ga0111539_10455780 Ga0111539_104557802 275
275 3300009094 Ga0111539_11050001 Ga0111539_110500011 275
276 3300009098 Ga0105245_10000584 Ga0105245_1000058426 275
277 3300009098 Ga0105245_10008764 Ga0105245_100087643 275
278 3300009098 Ga0105245_10041279 Ga0105245_100412792 275
279 3300009098 Ga0105245_10059785 Ga0105245_100597852 275
280 3300009098 Ga0105245_10212787 Ga0105245_102127871 275
281 3300009098 Ga0105245_10538141 Ga0105245_105381411 275
282 3300009147 Ga0114129_10047381 Ga0114129_100473812 275
283 3300009148 Ga0105243_10263773 Ga0105243_102637731 275
284 3300009148 Ga0105243_10304348 Ga0105243_103043482 275
285 3300009148 Ga0105243_10732485 Ga0105243_107324852 275
286 3300009174 Ga0105241_10027441 Ga0105241_100274412 275
287 3300009176 Ga0105242_10025641 Ga0105242_100256413 275
288 3300009176 Ga0105242_10851755 Ga0105242_108517551 275
289 3300009177 Ga0105248_10022512 Ga0105248_100225128 275
290 3300009177 Ga0105248_10052816 Ga0105248_100528162 275
291 3300009177 Ga0105248_10087456 Ga0105248_100874562 275
292 3300009177 Ga0105248_10107321 Ga0105248_101073212 275
293 3300009177 Ga0105248_10818590 Ga0105248_108185901 275
294 3300009545 Ga0105237_10002883 Ga0105237_100028832 275
295 3300009545 Ga0105237_10018059 Ga0105237_100180598 275
296 3300009545 Ga0105237_10863208 Ga0105237_108632081 275
297 3300009551 Ga0105238_10048186 Ga0105238_100481862 275
298 3300009551 Ga0105238_10165683 Ga0105238_101656832 275
299 3300009551 Ga0105238_10227000 Ga0105238_102270002 275
300 3300009551 Ga0105238_10287032 Ga0105238_102870322 275
301 3300009553 Ga0105249_10045111 Ga0105249_100451112 275
302 3300009553 Ga0105249_10121130 Ga0105249_101211302 275
303 3300009553 Ga0105249_10287365 Ga0105249_102873652 275
304 3300009553 Ga0105249_10633648 Ga0105249_106336482 275
305 3300010159 Ga0099796_10043899 Ga0099796_100438992 275
306 3300010375 Ga0105239_10001903 Ga0105239_1000190312 275
307 3300010375 Ga0105239_10010296 Ga0105239_1001029611 275
308 3300010375 Ga0105239_10090518 Ga0105239_100905183 275
309 3300010375 Ga0105239_10093335 Ga0105239_100933352 275
310 3300010375 Ga0105239_10378496 Ga0105239_103784961 275
311 3300010375 Ga0105239_10759239 Ga0105239_107592392 275
312 3300010375 Ga0105239_10772597 Ga0105239_107725972 275
313 3300011119 Ga0105246_10031816 Ga0105246_100318162 275
314 3300011119 Ga0105246_10064311 Ga0105246_100643112 275
315 3300011119 Ga0105246_10101517 Ga0105246_101015172 275
316 3300011119 Ga0105246_10182458 Ga0105246_101824582 275
317 3300013104 Ga0157370_10008846 Ga0157370_100088466 275
318 3300013296 Ga0157374_10033805 Ga0157374_100338052 275
319 3300013296 Ga0157374_10050064 Ga0157374_100500642 275
320 3300013296 Ga0157374_10072012 Ga0157374_100720123 275
321 3300013297 Ga0157378_10071696 Ga0157378_100716962 275
322 3300013297 Ga0157378_10121208 Ga0157378_101212082 275
323 3300013306 Ga0163162_10011192 Ga0163162_100111923 275
324 3300013306 Ga0163162_10089592 Ga0163162_100895922 275
325 3300013306 Ga0163162_10257981 Ga0163162_102579812 275
326 3300013306 Ga0163162_10306243 Ga0163162_103062431 275
327 3300013306 Ga0163162_10924461 Ga0163162_109244611 275
328 3300013308 Ga0157375_10030351 Ga0157375_100303512 275
329 3300013308 Ga0157375_10087809 Ga0157375_100878092 275
330 3300013308 Ga0157375_10406296 Ga0157375_104062962 275
331 3300013308 Ga0157375_10424568 Ga0157375_104245682 275
332 3300014325 Ga0163163_10025356 Ga0163163_100253562 275
333 3300014325 Ga0163163_10154555 Ga0163163_101545552 275
334 3300014325 Ga0163163_10167275 Ga0163163_101672752 275
335 3300014325 Ga0163163_10192347 Ga0163163_101923472 275
336 3300014325 Ga0163163_10429650 Ga0163163_104296502 275
337 3300014326 Ga0157380_10257533 Ga0157380_102575332 275
338 3300014326 Ga0157380_10571427 Ga0157380_105714272 275
339 3300014745 Ga0157377_10031900 Ga0157377_100319002 275
340 3300014745 Ga0157377_10075338 Ga0157377_100753381 275
341 3300014968 Ga0157379_10079784 Ga0157379_100797842 275
342 3300014968 Ga0157379_10092212 Ga0157379_100922122 275
343 3300014969 Ga0157376_10005970 Ga0157376_100059707 275
344 3300014969 Ga0157376_10417464 Ga0157376_104174642 275
345 3300017792 Ga0163161_10073324 Ga0163161_100733242 275
346 3300017792 Ga0163161_10205476 Ga0163161_102054762 275
347 3300025297 Ga0209758_1012599 Ga0209758_10125992 275
348 3300025893 Ga0207682_10025806 Ga0207682_100258062 275
349 3300025898 Ga0207692_10000441 Ga0207692_1000044111 275
350 3300025899 Ga0207642_10030099 Ga0207642_100300992 275
351 3300025899 Ga0207642_10057294 Ga0207642_100572942 275
352 3300025900 Ga0207710_10002823 Ga0207710_100028235 275
353 3300025900 Ga0207710_10008445 Ga0207710_100084453 275
354 3300025901 Ga0207688_10023789 Ga0207688_100237892 275
355 3300025901 Ga0207688_10098777 Ga0207688_100987772 275
356 3300025904 Ga0207647_10004068 Ga0207647_100040688 275
357 3300025906 Ga0207699_10015147 Ga0207699_100151473 275
358 3300025906 Ga0207699_10115517 Ga0207699_101155172 275
359 3300025906 Ga0207699_10196373 Ga0207699_101963732 275
360 3300025906 Ga0207699_10321424 Ga0207699_103214242 275
361 3300025907 Ga0207645_10121244 Ga0207645_101212442 275
362 3300025908 Ga0207643_10254756 Ga0207643_102547562 275
363 3300025909 Ga0207705_10013593 Ga0207705_100135936 275
364 3300025909 Ga0207705_10260091 Ga0207705_102600912 275
365 3300025910 Ga0207684_10018577 Ga0207684_100185771 275
366 3300025911 Ga0207654_10014951 Ga0207654_100149512 275
367 3300025913 Ga0207695_10018200 Ga0207695_100182003 275
368 3300025914 Ga0207671_10040763 Ga0207671_100407632 275
369 3300025914 Ga0207671_10222316 Ga0207671_102223162 275
370 3300025915 Ga0207693_10008660 Ga0207693_1000866012 275
371 3300025915 Ga0207693_10014415 Ga0207693_100144152 275
372 3300025915 Ga0207693_10021977 Ga0207693_100219774 275
373 3300025915 Ga0207693_10043862 Ga0207693_100438622 275
374 3300025916 Ga0207663_10003995 Ga0207663_100039952 275
375 3300025916 Ga0207663_10020015 Ga0207663_100200152 275
376 3300025916 Ga0207663_10021501 Ga0207663_100215013 275
377 3300025918 Ga0207662_10021293 Ga0207662_100212933 275
378 3300025918 Ga0207662_10093217 Ga0207662_100932172 275
379 3300025919 Ga0207657_10063215 Ga0207657_100632152 275
380 3300025920 Ga0207649_10018737 Ga0207649_100187372 275
381 3300025923 Ga0207681_10104427 Ga0207681_101044272 275
382 3300025923 Ga0207681_10228457 Ga0207681_102284572 275
383 3300025924 Ga0207694_10120683 Ga0207694_101206832 275
384 3300025925 Ga0207650_10312510 Ga0207650_103125101 275
385 3300025926 Ga0207659_10201344 Ga0207659_102013442 275
386 3300025926 Ga0207659_10331050 Ga0207659_103310501 275
387 3300025926 Ga0207659_10559024 Ga0207659_105590242 275
388 3300025927 Ga0207687_10002258 Ga0207687_1000225810 275
389 3300025927 Ga0207687_10007594 Ga0207687_100075942 275
390 3300025927 Ga0207687_10019268 Ga0207687_100192684 275
391 3300025928 Ga0207700_10018345 Ga0207700_100183453 275
392 3300025928 Ga0207700_10081649 Ga0207700_100816492 275
393 3300025929 Ga0207664_10205704 Ga0207664_102057042 275
394 3300025931 Ga0207644_10054232 Ga0207644_100542322 275
395 3300025931 Ga0207644_10117504 Ga0207644_101175042 275
396 3300025931 Ga0207644_10273027 Ga0207644_102730272 275
397 3300025932 Ga0207690_10055171 Ga0207690_100551712 275
398 3300025933 Ga0207706_10012362 Ga0207706_100123627 275
399 3300025933 Ga0207706_10331345 Ga0207706_103313452 275
400 3300025933 Ga0207706_10346251 Ga0207706_103462512 275
401 3300025933 Ga0207706_10422071 Ga0207706_104220712 275
402 3300025934 Ga0207686_10155153 Ga0207686_101551532 275
403 3300025935 Ga0207709_10023146 Ga0207709_100231462 275
404 3300025935 Ga0207709_10208191 Ga0207709_102081912 275
405 3300025936 Ga0207670_10000575 Ga0207670_1000057516 275
406 3300025936 Ga0207670_10122966 Ga0207670_101229662 275
407 3300025936 Ga0207670_10169569 Ga0207670_101695691 275
408 3300025937 Ga0207669_10051847 Ga0207669_100518472 275
409 3300025938 Ga0207704_10220628 Ga0207704_102206281 275
410 3300025938 Ga0207704_10350445 Ga0207704_103504452 275
411 3300025939 Ga0207665_10003165 Ga0207665_100031655 275
412 3300025939 Ga0207665_10056669 Ga0207665_100566692 275
413 3300025940 Ga0207691_10042634 Ga0207691_100426342 275
414 3300025940 Ga0207691_10050485 Ga0207691_100504852 275
415 3300025940 Ga0207691_10061056 Ga0207691_100610562 275
416 3300025941 Ga0207711_10023879 Ga0207711_100238792 275
417 3300025941 Ga0207711_10087124 Ga0207711_100871242 275
418 3300025941 Ga0207711_10094875 Ga0207711_100948752 275
419 3300025941 Ga0207711_10096066 Ga0207711_100960662 275
420 3300025941 Ga0207711_10133716 Ga0207711_101337162 275
421 3300025942 Ga0207689_10013317 Ga0207689_100133176 275
422 3300025942 Ga0207689_10013921 Ga0207689_100139212 275
423 3300025942 Ga0207689_10026475 Ga0207689_100264754 275
424 3300025942 Ga0207689_10028214 Ga0207689_100282143 275
425 3300025942 Ga0207689_10249926 Ga0207689_102499262 275
426 3300025944 Ga0207661_10066184 Ga0207661_100661842 275
427 3300025945 Ga0207679_10066621 Ga0207679_100666212 275
428 3300025945 Ga0207679_10310565 Ga0207679_103105652 275
429 3300025949 Ga0207667_10182821 Ga0207667_101828211 275
430 3300025961 Ga0207712_10076548 Ga0207712_100765482 275
431 3300025961 Ga0207712_10081532 Ga0207712_100815322 275
432 3300025961 Ga0207712_10099705 Ga0207712_100997052 275
433 3300025972 Ga0207668_10004361 Ga0207668_100043613 275
434 3300025972 Ga0207668_10005404 Ga0207668_100054042 275
435 3300025972 Ga0207668_10070085 Ga0207668_100700852 275
436 3300025972 Ga0207668_10106747 Ga0207668_101067472 275
437 3300025981 Ga0207640_10058427 Ga0207640_100584272 275
438 3300025986 Ga0207658_10129286 Ga0207658_101292862 275
439 3300026023 Ga0207677_10009359 Ga0207677_100093592 275
440 3300026023 Ga0207677_10120635 Ga0207677_101206352 275
441 3300026023 Ga0207677_10134194 Ga0207677_101341942 275
442 3300026023 Ga0207677_10335750 Ga0207677_103357502 275
443 3300026023 Ga0207677_10356013 Ga0207677_103560132 275
444 3300026035 Ga0207703_10013268 Ga0207703_100132683 275
445 3300026035 Ga0207703_10232477 Ga0207703_102324772 275
446 3300026041 Ga0207639_10010542 Ga0207639_100105422 275
447 3300026041 Ga0207639_10029044 Ga0207639_100290443 275
448 3300026041 Ga0207639_10103896 Ga0207639_101038962 275
449 3300026041 Ga0207639_10562396 Ga0207639_105623962 275
450 3300026067 Ga0207678_10006492 Ga0207678_100064926 275
451 3300026067 Ga0207678_10014686 Ga0207678_100146864 275
452 3300026067 Ga0207678_10018097 Ga0207678_100180972 275
453 3300026067 Ga0207678_10143562 Ga0207678_101435622 275
454 3300026067 Ga0207678_10381161 Ga0207678_103811611 275
455 3300026078 Ga0207702_10021392 Ga0207702_100213922 275
456 3300026078 Ga0207702_10064960 Ga0207702_100649602 275
457 3300026088 Ga0207641_10496943 Ga0207641_104969432 275
458 3300026088 Ga0207641_10706548 Ga0207641_107065482 275
459 3300026089 Ga0207648_10053092 Ga0207648_100530922 275
460 3300026089 Ga0207648_10406251 Ga0207648_104062512 275
461 3300026095 Ga0207676_10014197 Ga0207676_100141972 275
462 3300026095 Ga0207676_10429261 Ga0207676_104292612 275
463 3300026116 Ga0207674_10001282 Ga0207674_1000128223 275
464 3300026116 Ga0207674_10059748 Ga0207674_100597482 275
465 3300026118 Ga0207675_100002277 Ga0207675_1000022772 275
466 3300026118 Ga0207675_100183803 Ga0207675_1001838031 275
467 3300026118 Ga0207675_100336930 Ga0207675_1003369302 275
468 3300026121 Ga0207683_10017246 Ga0207683_100172467 275
469 3300026121 Ga0207683_10128497 Ga0207683_101284971 275
470 3300026121 Ga0207683_10167093 Ga0207683_101670932 275
471 3300026121 Ga0207683_10355222 Ga0207683_103552222 275
472 3300026142 Ga0207698_10139166 Ga0207698_101391662 275
473 3300026142 Ga0207698_10185031 Ga0207698_101850312 275
474 3300026142 Ga0207698_10190742 Ga0207698_101907422 275
475 3300026142 Ga0207698_10205200 Ga0207698_102052002 275
476 3300026142 Ga0207698_10260413 Ga0207698_102604132 275
477 3300027671 Ga0209588_1011822 Ga0209588_10118222 275
478 3300027866 Ga0209813_10031965 Ga0209813_100319652 275
479 3300028379 Ga0268266_10001382 Ga0268266_1000138227 275
480 3300028379 Ga0268266_10001560 Ga0268266_100015602 275
481 3300028379 Ga0268266_10013183 Ga0268266_100131832 275
482 3300028379 Ga0268266_10021857 Ga0268266_100218572 275
483 3300028379 Ga0268266_10137383 Ga0268266_101373832 275
484 3300028380 Ga0268265_10027436 Ga0268265_100274363 275
485 3300028380 Ga0268265_10088685 Ga0268265_100886851 275
486 3300028380 Ga0268265_10220685 Ga0268265_102206852 275
487 3300028380 Ga0268265_10385949 Ga0268265_103859491 275
488 3300028381 Ga0268264_10000119 Ga0268264_10000119100 275
489 3300028381 Ga0268264_10041023 Ga0268264_100410232 275
490 3300028786 Ga0307517_10000042 Ga0307517_1000004217 275
491 3300028794 Ga0307515_10199424 Ga0307515_101994242 275
492 3300031456 Ga0307513_10317679 Ga0307513_103176792 275
493 3300031507 Ga0307509_10038044 Ga0307509_100380442 275
494 3300031507 Ga0307509_10259194 Ga0307509_102591941 275
495 3300031616 Ga0307508_10126111 Ga0307508_101261112 275
496 3300031616 Ga0307508_10369267 Ga0307508_103692671 275
497 3300031731 Ga0307405_10075299 Ga0307405_100752992 275
498 3300031995 Ga0307409_100033031 Ga0307409_1000330312 275
499 3300032002 Ga0307416_100100689 Ga0307416_1001006892 275
500 3300032002 Ga0307416_100204516 Ga0307416_1002045162 275
501 3300032005 Ga0307411_10104106 Ga0307411_101041062 275
502 3300032005 Ga0307411_10227001 Ga0307411_102270012 275
503 3300032126 Ga0307415_100107416 Ga0307415_1001074162 275
504 3300033179 Ga0307507_10006711 Ga0307507_100067115 275
505 3300033180 Ga0307510_10055050 Ga0307510_100550503 275
506 3300033180 Ga0307510_10064401 Ga0307510_100644012 275
507 3300033180 Ga0307510_10070879 Ga0307510_100708792 275
508 3300035083 Ga0373926_0018416 Ga0373926_0018416_1274_2101 275
509 3300035111 Ga0373923_0135312 Ga0373923_0135312_233_1060 275
510 3300035113 Ga0373936_0007125 Ga0373936_0007125_2055_2882 275
511 3300035113 Ga0373936_0008124 Ga0373936_0008124_3034_3861 275
512 3300035113 Ga0373936_0079988 Ga0373936_0079988_493_1320 275
513 3300035116 Ga0373945_0014838 Ga0373945_0014838_1304_2131 275
514 3300035116 Ga0373945_0018828 Ga0373945_0018828_1177_2004 275
515 3300035116 Ga0373945_0024681 Ga0373945_0024681_1212_2039 275
516 3300035118 Ga0373954_0035626 Ga0373954_0035626_1091_1918 275
517 3300035119 Ga0373956_0017350 Ga0373956_0017350_1662_2489 275
518 3300035120 Ga0373957_0009790 Ga0373957_0009790_1058_1885 275
519 3300035120 Ga0373957_0093733 Ga0373957_0093733_308_1135 275
520 3300035172 Ga0373955_0004765 Ga0373955_0004765_3085_3912 275
521 3300035172 Ga0373955_0043994 Ga0373955_0043994_1276_2103 275
522 3300035242 Ga0373962_0010494 Ga0373962_0010494_1350_2177 275
523 3300035410 Ga0373924_0073092 Ga0373924_0073092_291_1118 275
524 3300035692 Ga0373935_0014771 Ga0373935_0014771_1243_2070 275
525 3300035695 Ga0373927_0012779 Ga0373927_0012779_1527_2354 275
526 3300035695 Ga0373927_0012848 Ga0373927_0012848_4335_5162 275
527 3300035695 Ga0373927_0200148 Ga0373927_0200148_279_1106 275
528 3300035695 Ga0373927_0205791 Ga0373927_0205791_109_936 275
529 3300035724 Ga0373933_0011312 Ga0373933_0011312_2731_3558 275
530 3300035724 Ga0373933_0093206 Ga0373933_0093206_590_1417 275
531 3300035724 Ga0373933_0126167 Ga0373933_0126167_516_1343 275
532 3300035724 Ga0373933_0219096 Ga0373933_0219096_131_958 275
533 3300035725 Ga0373947_0015050 Ga0373947_0015050_648_1475 275
534 3300035725 Ga0373947_0028123 Ga0373947_0028123_2378_3205 275
535 3300036401 Ga0373937_0015828 Ga0373937_0015828_4354_5181 275
536 3300036401 Ga0373937_0031753 Ga0373937_0031753_1104_1931 275
537 3300036401 Ga0373937_0079303 Ga0373937_0079303_1054_1881 275
538 3300036401 Ga0373937_0243248 Ga0373937_0243248_562_1389 275
539 3300037068 Ga0373925_0019242 Ga0373925_0019242_3662_4489 275
540 3300037068 Ga0373925_0059476 Ga0373925_0059476_1189_2016 275
541 3300037068 Ga0373925_0206792 Ga0373925_0206792_323_1150 275
542 3300037471 Ga0395905_0061434 Ga0395905_0061434_1514_2341 275
543 3300041486 Ga0451807_1836870 Ga0451807_1836870_505_1332 275
544 3300041505 Ga0451849_1347307 Ga0451849_1347307_216_1067 275
545 3300046453 Ga0495627_022874 Ga0495627_022874_970_1797 275
546 3300046454 Ga0495592_0028127 Ga0495592_0028127_1806_2633 275
547 3300046454 Ga0495592_0064199 Ga0495592_0064199_1596_2423 275
548 3300046454 Ga0495592_0082863 Ga0495592_0082863_1139_1966 275
549 3300046454 Ga0495592_0113721 Ga0495592_0113721_875_1702 275
550 3300046455 Ga0495603_0002383 Ga0495603_0002383_6093_6920 275
551 3300046455 Ga0495603_0148623 Ga0495603_0148623_474_1301 275
552 3300046459 Ga0495629_0002166 Ga0495629_0002166_10015_10842 275
553 3300046459 Ga0495629_0179833 Ga0495629_0179833_530_1357 275
554 3300046459 Ga0495629_0191048 Ga0495629_0191048_139_966 275
555 3300046460 Ga0495638_0006115 Ga0495638_0006115_5024_5851 275
556 3300046460 Ga0495638_0014560 Ga0495638_0014560_2982_3809 275
557 3300046460 Ga0495638_0099171 Ga0495638_0099171_745_1572 275
558 3300046461 Ga0495641_0050817 Ga0495641_0050817_758_1585 275
559 3300046461 Ga0495641_0089876 Ga0495641_0089876_213_1040 275
560 3300046462 Ga0495651_0001967 Ga0495651_0001967_5441_6268 275
561 3300046462 Ga0495651_0002281 Ga0495651_0002281_6089_6916 275
562 3300046462 Ga0495651_0025049 Ga0495651_0025049_642_1469 275
563 3300046462 Ga0495651_0248143 Ga0495651_0248143_196_1023 275
564 3300046463 Ga0495653_0034799 Ga0495653_0034799_2673_3500 275
565 3300046463 Ga0495653_0320741 Ga0495653_0320741_52_879 275
566 3300046471 Ga0495650_0031643 Ga0495650_0031643_987_1814 275
567 3300046472 Ga0495580_0025126 Ga0495580_0025126_62_889 275
568 3300046472 Ga0495580_0041357 Ga0495580_0041357_198_1025 275
569 3300046472 Ga0495580_0106448 Ga0495580_0106448_229_1056 275
570 3300046475 Ga0495639_0000895 Ga0495639_0000895_3379_4206 275
571 3300046475 Ga0495639_0073211 Ga0495639_0073211_571_1398 275
572 3300046475 Ga0495639_0081799 Ga0495639_0081799_80_907 275
573 3300046476 Ga0495662_0018554 Ga0495662_0018554_161_988 275
574 3300046477 Ga0495664_0017866 Ga0495664_0017866_2444_3271 275
575 3300046477 Ga0495664_0020519 Ga0495664_0020519_272_1099 275
576 3300046477 Ga0495664_0047750 Ga0495664_0047750_378_1205 275
577 3300046499 Ga0495594_0002041 Ga0495594_0002041_1851_2678 275
578 3300046499 Ga0495594_0043104 Ga0495594_0043104_827_1654 275
579 3300046507 Ga0495606_0030415 Ga0495606_0030415_2854_3681 275
580 3300046511 Ga0495608_0061119 Ga0495608_0061119_569_1396 275
581 3300046513 Ga0495616_0066516 Ga0495616_0066516_768_1595 275
582 3300046516 Ga0495628_0043344 Ga0495628_0043344_438_1265 275
583 3300046516 Ga0495628_0064807 Ga0495628_0064807_389_1216 275
584 3300046516 Ga0495628_0088643 Ga0495628_0088643_705_1532 275
585 3300046516 Ga0495628_0100241 Ga0495628_0100241_1370_2197 275
586 3300046516 Ga0495628_0218410 Ga0495628_0218410_399_1226 275
587 3300046522 Ga0495643_0200633 Ga0495643_0200633_36_863 275
588 3300046523 Ga0495644_0065197 Ga0495644_0065197_475_1302 275
589 3300046526 Ga0495666_0180722 Ga0495666_0180722_39_866 275
590 3300046529 Ga0495652_0002279 Ga0495652_0002279_13408_14235 275
591 3300046529 Ga0495652_0011312 Ga0495652_0011312_3625_4452 275
592 3300046529 Ga0495652_0063527 Ga0495652_0063527_2198_3025 275
593 3300046529 Ga0495652_0094173 Ga0495652_0094173_1279_2106 275
594 3300046530 Ga0495654_0073565 Ga0495654_0073565_238_1065 275
595 3300046531 Ga0495665_0005346 Ga0495665_0005346_842_1669 275
596 3300046533 Ga0495640_0012879 Ga0495640_0012879_1496_2323 275
597 3300046533 Ga0495640_0015221 Ga0495640_0015221_1922_2749 275
598 3300046533 Ga0495640_0023503 Ga0495640_0023503_145_972 275
599 3300046533 Ga0495640_0037881 Ga0495640_0037881_1105_1932 275
600 3300046536 Ga0495587_0001243 Ga0495587_0001243_4171_4998 275
601 3300046536 Ga0495587_0045538 Ga0495587_0045538_1651_2478 275
602 3300046536 Ga0495587_0054394 Ga0495587_0054394_1317_2144 275
603 3300046539 Ga0495621_0047191 Ga0495621_0047191_212_1039 275
604 3300046543 Ga0495645_0011949 Ga0495645_0011949_1209_2036 275
605 3300046543 Ga0495645_0074602 Ga0495645_0074602_1299_2126 275
606 3300046557 Ga0495622_0011601 Ga0495622_0011601_444_1271 275
607 3300046557 Ga0495622_0104897 Ga0495622_0104897_381_1208 275
608 3300046558 Ga0495633_0042522 Ga0495633_0042522_432_1259 275
609 3300046559 Ga0495667_0023999 Ga0495667_0023999_3044_3871 275
610 3300046559 Ga0495667_0024794 Ga0495667_0024794_3073_3900 275
611 3300046559 Ga0495667_0027396 Ga0495667_0027396_45_872 275
612 3300046616 Ga0495668_0014830 Ga0495668_0014830_1620_2447 275
613 3300046616 Ga0495668_0043257 Ga0495668_0043257_96_923 275
614 3300046616 Ga0495668_0095664 Ga0495668_0095664_652_1479 275
615 3300046642 Ga0495634_0008591 Ga0495634_0008591_4378_5205 275
616 3300046642 Ga0495634_0013285 Ga0495634_0013285_1764_2591 275
617 3300046642 Ga0495634_0071156 Ga0495634_0071156_1310_2137 275
618 3300046642 Ga0495634_0114771 Ga0495634_0114771_681_1508 275
619 3300046648 Ga0495611_0031681 Ga0495611_0031681_450_1277 275
620 3300046663 Ga0495635_0003265 Ga0495635_0003265_6462_7289 275
621 3300046663 Ga0495635_0007876 Ga0495635_0007876_1138_1965 275
622 3300046663 Ga0495635_0068078 Ga0495635_0068078_802_1629 275
623 3300046663 Ga0495635_0215831 Ga0495635_0215831_127_954 275
624 3300046664 Ga0495659_0064493 Ga0495659_0064493_290_1117 275
625 3300046674 Ga0495588_0090967 Ga0495588_0090967_298_1125 275
626 3300046675 Ga0495657_0000637 Ga0495657_0000637_1243_2070 275
627 3300046675 Ga0495657_0001501 Ga0495657_0001501_6732_7559 275
628 3300046675 Ga0495657_0064454 Ga0495657_0064454_513_1340 275
629 3300046678 Ga0495599_0021736 Ga0495599_0021736_180_1007 275
630 3300046678 Ga0495599_0100659 Ga0495599_0100659_440_1267 275
631 3300046678 Ga0495599_0168336 Ga0495599_0168336_252_1079 275
632 3300046679 Ga0495623_0008412 Ga0495623_0008412_4008_4835 275
633 3300046679 Ga0495623_0032975 Ga0495623_0032975_114_941 275
634 3300046679 Ga0495623_0094934 Ga0495623_0094934_239_1066 275
635 3300046679 Ga0495623_0139957 Ga0495623_0139957_588_1415 275
636 3300046680 Ga0495646_0045638 Ga0495646_0045638_1485_2312 275
637 3300046680 Ga0495646_0122524 Ga0495646_0122524_35_862 275
638 3300046681 Ga0495647_0004753 Ga0495647_0004753_959_1786 275
639 3300046681 Ga0495647_0022130 Ga0495647_0022130_985_1812 275
640 3300046683 Ga0495658_0003420 Ga0495658_0003420_6254_7081 275
641 3300046683 Ga0495658_0008345 Ga0495658_0008345_1261_2088 275
642 3300046683 Ga0495658_0020153 Ga0495658_0020153_2622_3449 275
643 3300046684 Ga0495669_0022896 Ga0495669_0022896_1303_2130 275
644 3300046689 Ga0495613_0016113 Ga0495613_0016113_611_1438 275
645 3300046689 Ga0495613_0163671 Ga0495613_0163671_490_1317 275
646 3300046690 Ga0495624_0012143 Ga0495624_0012143_3773_4600 275
647 3300046690 Ga0495624_0024233 Ga0495624_0024233_288_1115 275
648 3300046690 Ga0495624_0134371 Ga0495624_0134371_580_1407 275
649 3300046691 Ga0495670_0075003 Ga0495670_0075003_396_1223 275
650 3300046692 Ga0495671_0084994 Ga0495671_0084994_113_940 275
651 3300046809 Ga0495600_0000157 Ga0495600_0000157_24617_25444 275
652 3300046809 Ga0495600_0002441 Ga0495600_0002441_7827_8654 275
653 3300046809 Ga0495600_0018632 Ga0495600_0018632_875_1702 275
654 3300046810 Ga0495660_0086248 Ga0495660_0086248_126_953 275
655 3300047315 Ga0495581_0002392 Ga0495581_0002392_8820_9647 275
656 3300047315 Ga0495581_0022590 Ga0495581_0022590_1614_2441 275
657 3300047315 Ga0495581_0086158 Ga0495581_0086158_980_1807 275
658 3300047317 Ga0495604_0002433 Ga0495604_0002433_7911_8738 275
659 3300047317 Ga0495604_0010822 Ga0495604_0010822_2277_3104 275
660 3300047317 Ga0495604_0061295 Ga0495604_0061295_69_896 275
661 3300047317 Ga0495604_0342282 Ga0495604_0342282_57_884 275
662 3300047319 Ga0495674_0001593 Ga0495674_0001593_3841_4668 275
663 3300047319 Ga0495674_0020333 Ga0495674_0020333_1239_2066 275
664 3300047319 Ga0495674_0037752 Ga0495674_0037752_2287_3114 275
665 3300047319 Ga0495674_0065501 Ga0495674_0065501_1024_1851 275
666 3300047319 Ga0495674_0086033 Ga0495674_0086033_1638_2465 275
667 3300047320 Ga0495672_0005908 Ga0495672_0005908_4356_5183 275
668 3300047321 Ga0495676_0070107 Ga0495676_0070107_945_1772 275
669 3300047321 Ga0495676_0217095 Ga0495676_0217095_481_1308 275
670 3300047322 Ga0495680_0002928 Ga0495680_0002928_3799_4626 275
671 3300047322 Ga0495680_0004897 Ga0495680_0004897_5290_6117 275
672 3300047322 Ga0495680_0008908 Ga0495680_0008908_6953_7780 275
673 3300047322 Ga0495680_0019623 Ga0495680_0019623_43_870 275
674 3300047444 Ga0495675_0004738 Ga0495675_0004738_6763_7590 275
675 3300047444 Ga0495675_0012499 Ga0495675_0012499_332_1159 275
676 3300047444 Ga0495675_0036282 Ga0495675_0036282_729_1556 275
677 3300047444 Ga0495675_0351423 Ga0495675_0351423_19_846 275
678 3300047445 Ga0495677_0117274 Ga0495677_0117274_85_912 275
679 3300047469 Ga0495673_0027778 Ga0495673_0027778_485_1312 275
680 3300047471 Ga0495684_0004907 Ga0495684_0004907_1959_2786 275
681 3300047471 Ga0495684_0013081 Ga0495684_0013081_3538_4365 275
682 3300047471 Ga0495684_0013703 Ga0495684_0013703_1785_2612 275
683 3300047673 Ga0495593_0002743 Ga0495593_0002743_4122_4949 275
684 3300047673 Ga0495593_0029614 Ga0495593_0029614_484_1311 275
685 3300047673 Ga0495593_0145760 Ga0495593_0145760_338_1165 275
686 3300047673 Ga0495593_0195520 Ga0495593_0195520_83_910 275
687 3300048088 Ga0495602_0009211 Ga0495602_0009211_2466_3293 275
688 3300048088 Ga0495602_0020612 Ga0495602_0020612_515_1342 275
689 3300048088 Ga0495602_0106259 Ga0495602_0106259_452_1279 275
690 3300048903 Ga0496100_0009577 Ga0496100_0009577_4456_5283 275
691 3300048903 Ga0496100_0027323 Ga0496100_0027323_1374_2201 275
692 3300048903 Ga0496100_0140219 Ga0496100_0140219_712_1539 275
693 3300048903 Ga0496100_0277315 Ga0496100_0277315_292_1119 275
694 3300048904 Ga0496101_0046965 Ga0496101_0046965_122_949 275
695 3300048904 Ga0496101_0135860 Ga0496101_0135860_742_1569 275
696 3300048904 Ga0496101_0201736 Ga0496101_0201736_136_963 275
697 3300048905 Ga0496102_0001763 Ga0496102_0001763_13666_14493 275
698 3300048905 Ga0496102_0210956 Ga0496102_0210956_366_1193 275
699 3300048905 Ga0496102_0219775 Ga0496102_0219775_818_1645 275
700 3300048905 Ga0496102_0437576 Ga0496102_0437576_64_891 275
701 3300048905 Ga0496102_0448975 Ga0496102_0448975_237_1064 275
702 3300048905 Ga0496102_0690856 Ga0496102_0690856_58_885 275
703 3300048906 Ga0496103_0009614 Ga0496103_0009614_4780_5607 275
704 3300048907 Ga0496104_0076513 Ga0496104_0076513_292_1119 275
705 3300048907 Ga0496104_0192356 Ga0496104_0192356_953_1780 275
706 3300048908 Ga0496105_0005122 Ga0496105_0005122_5213_6040 275
707 3300048908 Ga0496105_0220237 Ga0496105_0220237_532_1359 275
708 3300048909 Ga0496106_0005212 Ga0496106_0005212_5131_5958 275
709 3300048909 Ga0496106_0081739 Ga0496106_0081739_1438_2265 275
710 3300048909 Ga0496106_0320089 Ga0496106_0320089_395_1222 275
711 3300048909 Ga0496106_0373863 Ga0496106_0373863_115_942 275
712 3300048910 Ga0496107_0015216 Ga0496107_0015216_3773_4600 275
713 3300048910 Ga0496107_0045604 Ga0496107_0045604_238_1065 275
714 3300048910 Ga0496107_0073873 Ga0496107_0073873_1529_2356 275
715 3300048911 Ga0496108_0007560 Ga0496108_0007560_7809_8636 275
716 3300048911 Ga0496108_0435962 Ga0496108_0435962_281_1108 275
717 3300048912 Ga0496109_0018847 Ga0496109_0018847_703_1530 275
718 3300048912 Ga0496109_0155508 Ga0496109_0155508_368_1195 275
719 3300048912 Ga0496109_0180330 Ga0496109_0180330_670_1497 275
720 3300048913 Ga0496110_0020194 Ga0496110_0020194_23_850 275
721 3300048913 Ga0496110_0097475 Ga0496110_0097475_1036_1863 275
722 3300048913 Ga0496110_0249910 Ga0496110_0249910_387_1214 275
723 3300048913 Ga0496110_0368415 Ga0496110_0368415_316_1143 275
724 3300048914 Ga0496111_0094362 Ga0496111_0094362_1224_2051 275
725 3300048914 Ga0496111_0126592 Ga0496111_0126592_642_1469 275
726 3300048914 Ga0496111_0210579 Ga0496111_0210579_356_1183 275
727 3300048914 Ga0496111_0248663 Ga0496111_0248663_259_1086 275
728 3300048915 Ga0496112_0037572 Ga0496112_0037572_3041_3868 275
729 3300048915 Ga0496112_0054969 Ga0496112_0054969_1668_2495 275
730 3300048915 Ga0496112_0057849 Ga0496112_0057849_550_1377 275
731 3300048915 Ga0496112_0079514 Ga0496112_0079514_331_1158 275
732 3300048915 Ga0496112_0228769 Ga0496112_0228769_66_893 275
733 3300048915 Ga0496112_0690333 Ga0496112_0690333_14_841 275
734 3300048916 Ga0496113_0111310 Ga0496113_0111310_740_1567 275
735 3300048916 Ga0496113_0215183 Ga0496113_0215183_227_1054 275
736 3300048916 Ga0496113_0246397 Ga0496113_0246397_153_980 275
737 3300048916 Ga0496113_0353833 Ga0496113_0353833_23_850 275
738 3300048917 Ga0496114_0044430 Ga0496114_0044430_1667_2494 275
739 3300048918 Ga0496115_0098732 Ga0496115_0098732_336_1163 275
740 3300048919 Ga0496116_0001851 Ga0496116_0001851_2810_3637 275
741 3300048920 Ga0496117_0025880 Ga0496117_0025880_1856_2683 275
742 3300048920 Ga0496117_0142393 Ga0496117_0142393_533_1360 275
743 3300048920 Ga0496117_0164175 Ga0496117_0164175_435_1262 275
744 3300048921 Ga0496118_0004903 Ga0496118_0004903_2244_3071 275
745 3300048921 Ga0496118_0008719 Ga0496118_0008719_3448_4275 275
746 3300048921 Ga0496118_0080744 Ga0496118_0080744_682_1509 275
747 3300048922 Ga0496119_0207823 Ga0496119_0207823_166_993 275
748 3300048924 Ga0496121_0000218 Ga0496121_0000218_87761_88588 275
749 3300048924 Ga0496121_0000285 Ga0496121_0000285_101095_101922 275
750 3300048924 Ga0496121_0001057 Ga0496121_0001057_13096_13923 275
751 3300048924 Ga0496121_0017989 Ga0496121_0017989_3478_4305 275
752 3300048924 Ga0496121_0026436 Ga0496121_0026436_840_1667 275
753 3300048924 Ga0496121_0057185 Ga0496121_0057185_2113_2940 275
754 3300048924 Ga0496121_0084520 Ga0496121_0084520_1205_2032 275
755 3300048924 Ga0496121_0235410 Ga0496121_0235410_364_1191 275
756 3300048924 Ga0496121_0237825 Ga0496121_0237825_153_980 275
757 3300048926 Ga0496123_0016130 Ga0496123_0016130_563_1390 275
758 3300048927 Ga0496124_0002080 Ga0496124_0002080_19536_20363 275
759 3300048927 Ga0496124_0012217 Ga0496124_0012217_6338_7165 275
760 3300048927 Ga0496124_0046891 Ga0496124_0046891_1354_2181 275
761 3300048927 Ga0496124_0065513 Ga0496124_0065513_233_1060 275
762 3300048927 Ga0496124_0076269 Ga0496124_0076269_1675_2502 275
763 3300048928 Ga0496125_0003395 Ga0496125_0003395_12481_13308 275
764 3300048928 Ga0496125_0005571 Ga0496125_0005571_3915_4742 275
765 3300048928 Ga0496125_0071864 Ga0496125_0071864_1705_2532 275
766 3300048928 Ga0496125_0076511 Ga0496125_0076511_301_1128 275
767 3300048928 Ga0496125_0080915 Ga0496125_0080915_826_1653 275
768 3300048929 Ga0496126_0001598 Ga0496126_0001598_18264_19091 275
769 3300048929 Ga0496126_0001827 Ga0496126_0001827_21219_22046 275
770 3300048929 Ga0496126_0008869 Ga0496126_0008869_728_1555 275
771 3300048929 Ga0496126_0033867 Ga0496126_0033867_3498_4325 275
772 3300048929 Ga0496126_0066063 Ga0496126_0066063_2110_2937 275
773 3300048929 Ga0496126_0070228 Ga0496126_0070228_1311_2159 275
774 3300048929 Ga0496126_0105595 Ga0496126_0105595_822_1649 275
775 3300048929 Ga0496126_0108662 Ga0496126_0108662_1213_2040 275
776 3300048929 Ga0496126_0196738 Ga0496126_0196738_843_1670 275
777 3300048929 Ga0496126_0249526 Ga0496126_0249526_594_1421 275
778 3300049568 Ga0501031_0009529 Ga0501031_0009529_3206_4033 275
779 3300049569 Ga0501032_0005337 Ga0501032_0005337_2994_3821 275
780 3300049570 Ga0501033_0000839 Ga0501033_0000839_13284_14111 275
781 3300049570 Ga0501033_0252079 Ga0501033_0252079_303_1130 275
782 3300049572 Ga0501036_0052515 Ga0501036_0052515_64_891 275
783 3300049573 Ga0501037_0000228 Ga0501037_0000228_13072_13899 275
784 3300049573 Ga0501037_0021636 Ga0501037_0021636_3381_4208 275
785 3300049574 Ga0501038_0033758 Ga0501038_0033758_3308_4135 275
786 3300049575 Ga0501039_0007392 Ga0501039_0007392_880_1707 275
787 3300049576 Ga0501040_0245773 Ga0501040_0245773_262_1089 275
788 3300049578 Ga0501042_0022234 Ga0501042_0022234_927_1754 275
789 3300049578 Ga0501042_0036026 Ga0501042_0036026_1835_2662 275
790 3300049580 Ga0501046_0011344 Ga0501046_0011344_4616_5443 275
791 3300049582 Ga0501048_0088098 Ga0501048_0088098_273_1100 275
792 3300049583 Ga0501067_0086840 Ga0501067_0086840_163_990 275
793 3300049584 Ga0501068_0042057 Ga0501068_0042057_1631_2458 275
794 3300049587 Ga0501071_0223114 Ga0501071_0223114_104_931 275
795 3300049587 Ga0501071_0398713 Ga0501071_0398713_190_1017 275
796 3300049590 Ga0501074_0021507 Ga0501074_0021507_2561_3388 275
797 3300049592 Ga0501076_0038118 Ga0501076_0038118_1888_2715 275
798 3300049592 Ga0501076_0314133 Ga0501076_0314133_171_998 275
799 3300049741 Ga0501079_0318265 Ga0501079_0318265_273_1100 275
800 3300049742 Ga0501080_0096584 Ga0501080_0096584_1816_2643 275
801 3300049744 Ga0501083_0135981 Ga0501083_0135981_348_1175 275
802 3300049822 Ga0501035_0001120 Ga0501035_0001120_7025_7852 275
803 3300049823 Ga0501044_0016887 Ga0501044_0016887_6645_7472 275
804 3300050489 nmdc:mga03683_135587_c1 nmdc:mga03683_135587_c1_77_904 275
805 3300050489 nmdc:mga03683_209087_c1 nmdc:mga03683_209087_c1_35_862 275
806 3300050490 nmdc:mga03n38_185640_c1 nmdc:mga03n38_185640_c1_83_910 275
807 3300050490 nmdc:mga03n38_32096_c1 nmdc:mga03n38_32096_c1_104_931 275
808 3300050492 nmdc:mga0yw44_14867_c1 nmdc:mga0yw44_14867_c1_1574_2401 275
809 3300050492 nmdc:mga0yw44_259272_c1 nmdc:mga0yw44_259272_c1_274_1101 275
810 3300050492 nmdc:mga0yw44_5649_c1 nmdc:mga0yw44_5649_c1_456_1283 275
811 3300050492 nmdc:mga0yw44_63300_c1 nmdc:mga0yw44_63300_c1_605_1432 275
812 3300050493 nmdc:mga0k408_268923_c1 nmdc:mga0k408_268923_c1_35_862 275
813 3300050494 nmdc:mga06z11_83755_c1 nmdc:mga06z11_83755_c1_192_1019 275
814 3300050494 nmdc:mga06z11_98501_c1 nmdc:mga06z11_98501_c1_650_1477 275
815 3300050496 nmdc:mga07m45_210112_c1 nmdc:mga07m45_210112_c1_20_847 275
816 3300050496 nmdc:mga07m45_25757_c1 nmdc:mga07m45_25757_c1_815_1642 275
817 3300050496 nmdc:mga07m45_3783_c1 nmdc:mga07m45_3783_c1_5029_5856 275
818 3300050496 nmdc:mga07m45_4727_c1 nmdc:mga07m45_4727_c1_4672_5499 275
819 3300050496 nmdc:mga07m45_57187_c1 nmdc:mga07m45_57187_c1_273_1100 275
820 3300050511 nmdc:mga08y16_167625_c1 nmdc:mga08y16_167625_c1_1387_2214 275
821 3300050511 nmdc:mga08y16_515502_c1 nmdc:mga08y16_515502_c1_14_841 275
822 3300050512 nmdc:mga0n895_160864_c1 nmdc:mga0n895_160864_c1_1093_1920 275
823 3300050512 nmdc:mga0n895_219118_c1 nmdc:mga0n895_219118_c1_598_1425 275
824 3300050513 nmdc:mga0rr50_357570_c1 nmdc:mga0rr50_357570_c1_355_1182 275
825 3300050516 nmdc:mga0sz30_3228_c1 nmdc:mga0sz30_3228_c1_166_993 275
826 3300050516 nmdc:mga0sz30_7137_c1 nmdc:mga0sz30_7137_c1_670_1497 275
827 3300053077 Ga0495601_0003060 Ga0495601_0003060_2075_2902 275
828 3300053077 Ga0495601_0067560 Ga0495601_0067560_816_1643 275
829 3300053078 Ga0495612_0012264 Ga0495612_0012264_725_1552 275
830 3300053078 Ga0495612_0106110 Ga0495612_0106110_43_870 275
831 3300053080 Ga0500635_0090220 Ga0500635_0090220_224_1051 275
832 3300053084 Ga0495595_0002847 Ga0495595_0002847_4758_5585 275
833 3300053084 Ga0495595_0031080 Ga0495595_0031080_1042_1869 275
834 3300053084 Ga0495595_0130448 Ga0495595_0130448_117_944 275
835 3300053085 Ga0495619_0000138 Ga0495619_0000138_31975_32802 275
836 3300053085 Ga0495619_0007284 Ga0495619_0007284_3758_4585 275
837 3300053085 Ga0495619_0069057 Ga0495619_0069057_533_1360 275
838 3300053085 Ga0495619_0201477 Ga0495619_0201477_416_1243 275
839 3300053087 Ga0500643_026362 Ga0500643_026362_980_1807 275
840 3300053087 Ga0500643_031544 Ga0500643_031544_320_1147 275
841 3300053088 Ga0500644_0079814 Ga0500644_0079814_167_994 275
842 3300053093 Ga0500651_0066868 Ga0500651_0066868_33_860 275
843 3300053094 Ga0500566_0002103 Ga0500566_0002103_4682_5509 275
844 3300053094 Ga0500566_0024790 Ga0500566_0024790_585_1412 275
845 3300053096 Ga0500641_0003335 Ga0500641_0003335_2072_2899 275
846 3300053098 Ga0500650_0000137 Ga0500650_0000137_11129_11956 275
847 3300053102 Ga0500554_001944 Ga0500554_001944_209_1036 275
848 3300053103 Ga0500555_050567 Ga0500555_050567_218_1045 275
849 3300053104 Ga0500556_0000004 Ga0500556_0000004_188277_189104 275
850 3300053119 Ga0500595_000131 Ga0500595_000131_33974_34801 275
851 3300053119 Ga0500595_001300 Ga0500595_001300_5374_6201 275
852 3300053119 Ga0500595_011098 Ga0500595_011098_1760_2587 275
853 3300053119 Ga0500595_011612 Ga0500595_011612_948_1775 275
854 3300053131 Ga0500652_001024 Ga0500652_001024_4781_5608 275
855 3300053137 Ga0500561_0013105 Ga0500561_0013105_659_1486 275
856 3300053139 Ga0500568_0002788 Ga0500568_0002788_5986_6813 275
857 3300053150 Ga0500603_006939 Ga0500603_006939_116_943 275
858 3300053150 Ga0500603_018659 Ga0500603_018659_215_1042 275
859 3300053151 Ga0500604_0032400 Ga0500604_0032400_687_1514 275
860 3300053156 Ga0500622_0000246 Ga0500622_0000246_42659_43486 275
861 3300053158 Ga0500627_0008607 Ga0500627_0008607_2378_3205 275
862 3300053158 Ga0500627_0119785 Ga0500627_0119785_239_1066 275
863 3300053162 Ga0500638_000960 Ga0500638_000960_1296_2123 275
864 3300053177 Ga0500636_0065109 Ga0500636_0065109_1106_1933 275
865 3300053177 Ga0500636_0102341 Ga0500636_0102341_750_1577 275
866 3300053177 Ga0500636_0136788 Ga0500636_0136788_106_933 275
867 3300053178 Ga0500637_0010663 Ga0500637_0010663_527_1354 275
868 3300053730 Ga0500645_021933 Ga0500645_021933_551_1378 275
869 3300053731 Ga0500609_010095 Ga0500609_010095_35_862 275
870 3300055283 Ga0500661_001000 Ga0500661_001000_1715_2542 275
871 3300060353 Ga0501082_0448074 Ga0501082_0448074_30_857 275
872 3300061734 Ga0530510_0039833 Ga0530510_0039833_1581_2408 275
873 iso_pu_bacteria 2935638405 2935647382 275
874 iso_pu_bacteria 2935665750 2935672947 275
875 iso_pu_bacteria 2935801545 2935809768 275
876 iso_pu_bacteria 2935810662 2935812690 275
877 iso_pu_bacteria 2935827899 2935836856 275
878 iso_pu_bacteria 2936037263 2936039283 275
879 2209111006 2214828546 2213866918 276
880 3300000041 ARcpr5oldR_c000066 ARcpr5oldR_0000669 276
881 3300000042 ARSoilYngRDRAFT_c00024 ARSoilYngRDRAFT_0002417 276
882 3300000043 ARcpr5yngRDRAFT_c000287 ARcpr5yngRDRAFT_0002876 276
883 3300000044 ARSoilOldRDRAFT_c000018 ARSoilOldRDRAFT_00001820 276
884 3300000652 ARCol0yngRDRAFT_1000070 ARCol0yngRDRAFT_100007017 276
885 3300001976 JGI24752J21851_1000498 JGI24752J21851_10004983 276
886 3300001989 JGI24739J22299_10001019 JGI24739J22299_100010195 276
887 3300001990 JGI24737J22298_10000089 JGI24737J22298_100000898 276
888 3300001991 JGI24743J22301_10008556 JGI24743J22301_100085562 276
889 3300002070 JGI24750J21931_1000015 JGI24750J21931_100001517 276
890 3300002075 JGI24738J21930_10000622 JGI24738J21930_100006225 276
891 3300002076 JGI24749J21850_1000310 JGI24749J21850_10003105 276
892 3300002126 JGI24035J26624_1000078 JGI24035J26624_10000784 276
893 3300002155 JGI24033J26618_1003298 JGI24033J26618_10032982 276
894 3300002239 JGI24034J26672_10000183 JGI24034J26672_100001836 276
895 3300002244 JGI24742J22300_10001638 JGI24742J22300_100016382 276
896 3300002459 JGI24751J29686_10040699 JGI24751J29686_100406991 276
897 3300003215 JGI25153J46596_10001175 JGI25153J46596_1000117510 276
898 3300005277 Ga0065716_1001769 Ga0065716_10017693 276
899 3300005290 Ga0065712_10002621 Ga0065712_100026212 276
900 3300005290 Ga0065712_10005537 Ga0065712_100055372 276
901 3300005293 Ga0065715_10001265 Ga0065715_100012656 276
902 3300005293 Ga0065715_10004852 Ga0065715_100048522 276
903 3300005293 Ga0065715_10100520 Ga0065715_101005202 276
904 3300005295 Ga0065707_10125803 Ga0065707_101258032 276
905 3300005328 Ga0070676_10000050 Ga0070676_1000005019 276
906 3300005329 Ga0070683_100000159 Ga0070683_10000015911 276
907 3300005330 Ga0070690_100002858 Ga0070690_1000028585 276
908 3300005330 Ga0070690_100005723 Ga0070690_1000057233 276
909 3300005331 Ga0070670_100004244 Ga0070670_1000042445 276
910 3300005331 Ga0070670_100020718 Ga0070670_1000207182 276
911 3300005331 Ga0070670_100155384 Ga0070670_1001553842 276
912 3300005331 Ga0070670_100236344 Ga0070670_1002363442 276
913 3300005333 Ga0070677_10000902 Ga0070677_100009026 276
914 3300005334 Ga0068869_100000171 Ga0068869_10000017111 276
915 3300005334 Ga0068869_100080355 Ga0068869_1000803552 276
916 3300005335 Ga0070666_10021770 Ga0070666_100217704 276
917 3300005335 Ga0070666_10031042 Ga0070666_100310422 276
918 3300005336 Ga0070680_100004647 Ga0070680_1000046475 276
919 3300005336 Ga0070680_100035382 Ga0070680_1000353822 276
920 3300005336 Ga0070680_100229389 Ga0070680_1002293892 276
921 3300005337 Ga0070682_100000572 Ga0070682_10000057215 276
922 3300005337 Ga0070682_100006064 Ga0070682_1000060643 276
923 3300005337 Ga0070682_100018988 Ga0070682_1000189882 276
924 3300005338 Ga0068868_100001791 Ga0068868_1000017917 276
925 3300005339 Ga0070660_100000375 Ga0070660_10000037523 276
926 3300005339 Ga0070660_100011917 Ga0070660_1000119174 276
927 3300005339 Ga0070660_100072708 Ga0070660_1000727082 276
928 3300005340 Ga0070689_100002253 Ga0070689_1000022537 276
929 3300005340 Ga0070689_100012317 Ga0070689_1000123171 276
930 3300005340 Ga0070689_100029736 Ga0070689_1000297362 276
931 3300005341 Ga0070691_10001969 Ga0070691_100019692 276
932 3300005341 Ga0070691_10023318 Ga0070691_100233182 276
933 3300005343 Ga0070687_100000165 Ga0070687_1000001655 276
934 3300005343 Ga0070687_100010913 Ga0070687_1000109132 276
935 3300005343 Ga0070687_100073849 Ga0070687_1000738492 276
936 3300005344 Ga0070661_100001486 Ga0070661_10000148611 276
937 3300005344 Ga0070661_100027428 Ga0070661_1000274284 276
938 3300005345 Ga0070692_10093741 Ga0070692_100937412 276
939 3300005347 Ga0070668_100000296 Ga0070668_1000002967 276
940 3300005347 Ga0070668_100035472 Ga0070668_1000354722 276
941 3300005353 Ga0070669_100016776 Ga0070669_1000167763 276
942 3300005353 Ga0070669_100023899 Ga0070669_1000238992 276
943 3300005353 Ga0070669_100026981 Ga0070669_1000269812 276
944 3300005354 Ga0070675_100000479 Ga0070675_1000004794 276
945 3300005355 Ga0070671_100000222 Ga0070671_10000022216 276
946 3300005355 Ga0070671_100024782 Ga0070671_1000247822 276
947 3300005355 Ga0070671_100025750 Ga0070671_1000257503 276
948 3300005355 Ga0070671_100033801 Ga0070671_1000338014 276
949 3300005355 Ga0070671_100073665 Ga0070671_1000736651 276
950 3300005355 Ga0070671_100430129 Ga0070671_1004301291 276
951 3300005356 Ga0070674_100262458 Ga0070674_1002624582 276
952 3300005364 Ga0070673_100000081 Ga0070673_10000008125 276
953 3300005365 Ga0070688_100029898 Ga0070688_1000298982 276
954 3300005365 Ga0070688_100084118 Ga0070688_1000841182 276
955 3300005365 Ga0070688_100107330 Ga0070688_1001073302 276
956 3300005366 Ga0070659_100007084 Ga0070659_1000070844 276
957 3300005366 Ga0070659_100009215 Ga0070659_1000092153 276
958 3300005367 Ga0070667_100001020 Ga0070667_1000010207 276
959 3300005367 Ga0070667_100124077 Ga0070667_1001240772 276
960 3300005367 Ga0070667_100139331 Ga0070667_1001393312 276
961 3300005406 Ga0070703_10001476 Ga0070703_100014762 276
962 3300005406 Ga0070703_10005749 Ga0070703_100057492 276
963 3300005434 Ga0070709_10009892 Ga0070709_100098922 276
964 3300005435 Ga0070714_100108266 Ga0070714_1001082662 276
965 3300005435 Ga0070714_100135367 Ga0070714_1001353672 276
966 3300005435 Ga0070714_100148382 Ga0070714_1001483822 276
967 3300005435 Ga0070714_100218213 Ga0070714_1002182132 276
968 3300005436 Ga0070713_100006817 Ga0070713_1000068175 276
969 3300005436 Ga0070713_100025196 Ga0070713_1000251962 276
970 3300005436 Ga0070713_100071691 Ga0070713_1000716912 276
971 3300005437 Ga0070710_10008119 Ga0070710_100081196 276
972 3300005437 Ga0070710_10017902 Ga0070710_100179023 276
973 3300005438 Ga0070701_10000519 Ga0070701_100005194 276
974 3300005438 Ga0070701_10022423 Ga0070701_100224232 276
975 3300005440 Ga0070705_100000592 Ga0070705_1000005923 276
976 3300005440 Ga0070705_100043727 Ga0070705_1000437272 276
977 3300005440 Ga0070705_100060819 Ga0070705_1000608192 276
978 3300005440 Ga0070705_100300773 Ga0070705_1003007731 276
979 3300005441 Ga0070700_100003391 Ga0070700_1000033914 276
980 3300005441 Ga0070700_100033577 Ga0070700_1000335772 276
981 3300005444 Ga0070694_100006159 Ga0070694_1000061594 276
982 3300005444 Ga0070694_100021576 Ga0070694_1000215762 276
983 3300005445 Ga0070708_100005035 Ga0070708_10000503511 276
984 3300005445 Ga0070708_100286318 Ga0070708_1002863182 276
985 3300005455 Ga0070663_100019665 Ga0070663_1000196652 276
986 3300005455 Ga0070663_100022020 Ga0070663_1000220202 276
987 3300005455 Ga0070663_100038056 Ga0070663_1000380561 276
988 3300005455 Ga0070663_100219648 Ga0070663_1002196482 276
989 3300005456 Ga0070678_100000464 Ga0070678_10000046417 276
990 3300005456 Ga0070678_100002919 Ga0070678_1000029194 276
991 3300005456 Ga0070678_100104206 Ga0070678_1001042062 276
992 3300005457 Ga0070662_100012986 Ga0070662_1000129864 276
993 3300005457 Ga0070662_100017117 Ga0070662_1000171172 276
994 3300005457 Ga0070662_100173977 Ga0070662_1001739772 276
995 3300005458 Ga0070681_10020065 Ga0070681_100200652 276
996 3300005458 Ga0070681_10043199 Ga0070681_100431992 276
997 3300005458 Ga0070681_10211221 Ga0070681_102112212 276
998 3300005466 Ga0070685_10019717 Ga0070685_100197172 276
999 3300005468 Ga0070707_100103447 Ga0070707_1001034472 276
1000 3300005530 Ga0070679_100083520 Ga0070679_1000835201 276
1001 3300005530 Ga0070679_100093507 Ga0070679_1000935072 276
1002 3300005530 Ga0070679_100212647 Ga0070679_1002126472 276
1003 3300005535 Ga0070684_100000239 Ga0070684_10000023918 276
1004 3300005535 Ga0070684_100037174 Ga0070684_1000371743 276
1005 3300005535 Ga0070684_100476423 Ga0070684_1004764231 276
1006 3300005536 Ga0070697_100080480 Ga0070697_1000804802 276
1007 3300005539 Ga0068853_100004035 Ga0068853_1000040356 276
1008 3300005539 Ga0068853_100058467 Ga0068853_1000584672 276
1009 3300005539 Ga0068853_100129873 Ga0068853_1001298732 276
1010 3300005543 Ga0070672_100000156 Ga0070672_10000015617 276
1011 3300005543 Ga0070672_100011572 Ga0070672_1000115726 276
1012 3300005544 Ga0070686_100000241 Ga0070686_10000024118 276
1013 3300005544 Ga0070686_100023938 Ga0070686_1000239382 276
1014 3300005544 Ga0070686_100128705 Ga0070686_1001287052 276
1015 3300005544 Ga0070686_100302779 Ga0070686_1003027792 276
1016 3300005545 Ga0070695_100008015 Ga0070695_1000080154 276
1017 3300005546 Ga0070696_100029010 Ga0070696_1000290102 276
1018 3300005546 Ga0070696_100064133 Ga0070696_1000641332 276
1019 3300005546 Ga0070696_100113127 Ga0070696_1001131272 276
1020 3300005547 Ga0070693_100014360 Ga0070693_1000143602 276
1021 3300005547 Ga0070693_100033077 Ga0070693_1000330773 276
1022 3300005547 Ga0070693_100095074 Ga0070693_1000950742 276
1023 3300005548 Ga0070665_100017922 Ga0070665_1000179221 276
1024 3300005548 Ga0070665_100127338 Ga0070665_1001273382 276
1025 3300005549 Ga0070704_100002509 Ga0070704_1000025094 276
1026 3300005549 Ga0070704_100012828 Ga0070704_1000128282 276
1027 3300005564 Ga0070664_100013448 Ga0070664_1000134483 276
1028 3300005564 Ga0070664_100051609 Ga0070664_1000516092 276
1029 3300005564 Ga0070664_100077687 Ga0070664_1000776872 276
1030 3300005564 Ga0070664_100308227 Ga0070664_1003082272 276
1031 3300005577 Ga0068857_100000480 Ga0068857_1000004804 276
1032 3300005577 Ga0068857_100391458 Ga0068857_1003914581 276
1033 3300005578 Ga0068854_100243971 Ga0068854_1002439712 276
1034 3300005578 Ga0068854_100269249 Ga0068854_1002692492 276
1035 3300005614 Ga0068856_100002369 Ga0068856_1000023694 276
1036 3300005614 Ga0068856_100228379 Ga0068856_1002283792 276
1037 3300005615 Ga0070702_100000553 Ga0070702_1000005534 276
1038 3300005615 Ga0070702_100203893 Ga0070702_1002038932 276
1039 3300005615 Ga0070702_100293468 Ga0070702_1002934681 276
1040 3300005617 Ga0068859_100001516 Ga0068859_1000015164 276
1041 3300005617 Ga0068859_100101409 Ga0068859_1001014091 276
1042 3300005617 Ga0068859_100435354 Ga0068859_1004353542 276
1043 3300005617 Ga0068859_100551037 Ga0068859_1005510372 276
1044 3300005618 Ga0068864_100001359 Ga0068864_10000135916 276
1045 3300005618 Ga0068864_100013076 Ga0068864_1000130765 276
1046 3300005718 Ga0068866_10000422 Ga0068866_100004222 276
1047 3300005719 Ga0068861_100013756 Ga0068861_1000137565 276
1048 3300005834 Ga0068851_10313886 Ga0068851_103138861 276
1049 3300005840 Ga0068870_10000043 Ga0068870_1000004331 276
1050 3300005841 Ga0068863_100053978 Ga0068863_1000539782 276
1051 3300005842 Ga0068858_100055921 Ga0068858_1000559212 276
1052 3300005842 Ga0068858_100073264 Ga0068858_1000732642 276
1053 3300005842 Ga0068858_100089444 Ga0068858_1000894442 276
1054 3300005842 Ga0068858_100091453 Ga0068858_1000914532 276
1055 3300005842 Ga0068858_100248414 Ga0068858_1002484142 276
1056 3300005843 Ga0068860_100013205 Ga0068860_1000132054 276
1057 3300005843 Ga0068860_100039560 Ga0068860_1000395602 276
1058 3300005843 Ga0068860_100142147 Ga0068860_1001421472 276
1059 3300005843 Ga0068860_100176919 Ga0068860_1001769192 276
1060 3300005843 Ga0068860_100820123 Ga0068860_1008201231 276
1061 3300005844 Ga0068862_100001098 Ga0068862_1000010984 276
1062 3300005844 Ga0068862_100386348 Ga0068862_1003863482 276
1063 3300005937 Ga0081455_10001692 Ga0081455_1000169214 276
1064 3300005937 Ga0081455_10028392 Ga0081455_100283925 276
1065 3300005937 Ga0081455_10041587 Ga0081455_100415872 276
1066 3300005937 Ga0081455_10207173 Ga0081455_102071732 276
1067 3300005981 Ga0081538_10035690 Ga0081538_100356903 276
1068 3300005983 Ga0081540_1000022 Ga0081540_1000022129 276
1069 3300005985 Ga0081539_10002071 Ga0081539_1000207117 276
1070 3300005985 Ga0081539_10010540 Ga0081539_100105402 276
1071 3300006028 Ga0070717_10019867 Ga0070717_100198672 276
1072 3300006028 Ga0070717_10060308 Ga0070717_100603082 276
1073 3300006028 Ga0070717_10090625 Ga0070717_100906252 276
1074 3300006028 Ga0070717_10273316 Ga0070717_102733162 276
1075 3300006028 Ga0070717_10333163 Ga0070717_103331632 276
1076 3300006028 Ga0070717_10510769 Ga0070717_105107691 276
1077 3300006028 Ga0070717_10791493 Ga0070717_107914931 276
1078 3300006038 Ga0075365_10001751 Ga0075365_100017517 276
1079 3300006038 Ga0075365_10028292 Ga0075365_100282923 276
1080 3300006038 Ga0075365_10187428 Ga0075365_101874282 276
1081 3300006038 Ga0075365_10276027 Ga0075365_102760271 276
1082 3300006038 Ga0075365_10278663 Ga0075365_102786632 276
1083 3300006042 Ga0075368_10007766 Ga0075368_100077662 276
1084 3300006048 Ga0075363_100015046 Ga0075363_1000150462 276
1085 3300006048 Ga0075363_100160599 Ga0075363_1001605992 276
1086 3300006051 Ga0075364_10017953 Ga0075364_100179534 276
1087 3300006051 Ga0075364_10052397 Ga0075364_100523972 276
1088 3300006163 Ga0070715_10030381 Ga0070715_100303812 276
1089 3300006163 Ga0070715_10058951 Ga0070715_100589512 276
1090 3300006173 Ga0070716_100273374 Ga0070716_1002733742 276
1091 3300006175 Ga0070712_100188588 Ga0070712_1001885882 276
1092 3300006177 Ga0075362_10045762 Ga0075362_100457622 276
1093 3300006178 Ga0075367_10014843 Ga0075367_100148434 276
1094 3300006178 Ga0075367_10043684 Ga0075367_100436842 276
1095 3300006178 Ga0075367_10058029 Ga0075367_100580292 276
1096 3300006186 Ga0075369_10024658 Ga0075369_100246582 276
1097 3300006195 Ga0075366_10266237 Ga0075366_102662372 276
1098 3300006237 Ga0097621_100000253 Ga0097621_1000002538 276
1099 3300006237 Ga0097621_100185405 Ga0097621_1001854052 276
1100 3300006353 Ga0075370_10050819 Ga0075370_100508192 276
1101 3300006358 Ga0068871_100008626 Ga0068871_1000086265 276
1102 3300006358 Ga0068871_100332767 Ga0068871_1003327672 276
1103 3300006844 Ga0075428_100025586 Ga0075428_1000255865 276
1104 3300006844 Ga0075428_100034340 Ga0075428_1000343404 276
1105 3300006844 Ga0075428_100049879 Ga0075428_1000498794 276
1106 3300006844 Ga0075428_100357872 Ga0075428_1003578722 276
1107 3300006844 Ga0075428_100473746 Ga0075428_1004737462 276
1108 3300006844 Ga0075428_100792039 Ga0075428_1007920392 276
1109 3300006846 Ga0075430_100004687 Ga0075430_1000046872 276
1110 3300006847 Ga0075431_100030055 Ga0075431_1000300554 276
1111 3300006847 Ga0075431_100030955 Ga0075431_1000309554 276
1112 3300006852 Ga0075433_10003735 Ga0075433_100037352 276
1113 3300006852 Ga0075433_10008502 Ga0075433_100085024 276
1114 3300006852 Ga0075433_10021781 Ga0075433_100217814 276
1115 3300006852 Ga0075433_10033995 Ga0075433_100339953 276
1116 3300006852 Ga0075433_10051355 Ga0075433_100513553 276
1117 3300006871 Ga0075434_100000333 Ga0075434_10000033325 276
1118 3300006871 Ga0075434_100010867 Ga0075434_1000108673 276
1119 3300006871 Ga0075434_100023442 Ga0075434_1000234424 276
1120 3300006871 Ga0075434_100086715 Ga0075434_1000867152 276
1121 3300006871 Ga0075434_100582067 Ga0075434_1005820672 276
1122 3300006880 Ga0075429_100021807 Ga0075429_1000218072 276
1123 3300006880 Ga0075429_100027479 Ga0075429_1000274793 276
1124 3300006881 Ga0068865_100000166 Ga0068865_10000016633 276
1125 3300006881 Ga0068865_100092534 Ga0068865_1000925342 276
1126 3300006914 Ga0075436_100021961 Ga0075436_1000219612 276
1127 3300006914 Ga0075436_100201764 Ga0075436_1002017642 276
1128 3300006931 Ga0097620_100001517 Ga0097620_1000015174 276
1129 3300006931 Ga0097620_100101402 Ga0097620_1001014022 276
1130 3300006931 Ga0097620_100435359 Ga0097620_1004353592 276
1131 3300006931 Ga0097620_100551037 Ga0097620_1005510372 276
1132 3300007076 Ga0075435_100075206 Ga0075435_1000752062 276
1133 3300007076 Ga0075435_100076229 Ga0075435_1000762292 276
1134 3300007076 Ga0075435_100088336 Ga0075435_1000883362 276
1135 3300007076 Ga0075435_100383730 Ga0075435_1003837302 276
1136 3300009092 Ga0105250_10026689 Ga0105250_100266892 276
1137 3300009093 Ga0105240_10213454 Ga0105240_102134542 276
1138 3300009093 Ga0105240_10379352 Ga0105240_103793522 276
1139 3300009094 Ga0111539_10003204 Ga0111539_1000320415 276
1140 3300009094 Ga0111539_10008321 Ga0111539_100083217 276
1141 3300009094 Ga0111539_10041026 Ga0111539_100410262 276
1142 3300009094 Ga0111539_10041126 Ga0111539_100411262 276
1143 3300009094 Ga0111539_10068066 Ga0111539_100680662 276
1144 3300009094 Ga0111539_10512185 Ga0111539_105121852 276
1145 3300009098 Ga0105245_10000403 Ga0105245_100004037 276
1146 3300009098 Ga0105245_10015400 Ga0105245_100154004 276
1147 3300009098 Ga0105245_10047106 Ga0105245_100471062 276
1148 3300009098 Ga0105245_10076655 Ga0105245_100766552 276
1149 3300009101 Ga0105247_10001853 Ga0105247_100018536 276
1150 3300009101 Ga0105247_10010137 Ga0105247_100101373 276
1151 3300009101 Ga0105247_10032886 Ga0105247_100328863 276
1152 3300009147 Ga0114129_10003291 Ga0114129_100032916 276
1153 3300009147 Ga0114129_10055220 Ga0114129_100552202 276
1154 3300009147 Ga0114129_10055350 Ga0114129_100553502 276
1155 3300009147 Ga0114129_10086378 Ga0114129_100863782 276
1156 3300009147 Ga0114129_10328929 Ga0114129_103289292 276
1157 3300009148 Ga0105243_10010307 Ga0105243_100103072 276
1158 3300009148 Ga0105243_10023764 Ga0105243_100237642 276
1159 3300009148 Ga0105243_10153299 Ga0105243_101532992 276
1160 3300009148 Ga0105243_10633856 Ga0105243_106338562 276
1161 3300009174 Ga0105241_10000943 Ga0105241_1000094316 276
1162 3300009174 Ga0105241_10106125 Ga0105241_101061252 276
1163 3300009176 Ga0105242_10001911 Ga0105242_100019115 276
1164 3300009176 Ga0105242_10013524 Ga0105242_100135242 276
1165 3300009176 Ga0105242_10099273 Ga0105242_100992732 276
1166 3300009177 Ga0105248_10001400 Ga0105248_100014005 276
1167 3300009177 Ga0105248_10099978 Ga0105248_100999782 276
1168 3300009177 Ga0105248_10134748 Ga0105248_101347482 276
1169 3300009177 Ga0105248_10142034 Ga0105248_101420342 276
1170 3300009545 Ga0105237_10002392 Ga0105237_1000239219 276
1171 3300009545 Ga0105237_10203788 Ga0105237_102037882 276
1172 3300009545 Ga0105237_10280928 Ga0105237_102809282 276
1173 3300009551 Ga0105238_10011718 Ga0105238_100117182 276
1174 3300009553 Ga0105249_10001241 Ga0105249_100012414 276
1175 3300009553 Ga0105249_10024700 Ga0105249_100247003 276
1176 3300009553 Ga0105249_10037905 Ga0105249_100379052 276
1177 3300009553 Ga0105249_10513508 Ga0105249_105135082 276
1178 3300010159 Ga0099796_10015395 Ga0099796_100153952 276
1179 3300010375 Ga0105239_10006882 Ga0105239_100068825 276
1180 3300010375 Ga0105239_10043808 Ga0105239_100438081 276
1181 3300010375 Ga0105239_10194691 Ga0105239_101946912 276
1182 3300011119 Ga0105246_10000253 Ga0105246_1000025318 276
1183 3300011119 Ga0105246_10099060 Ga0105246_100990602 276
1184 3300011119 Ga0105246_10291499 Ga0105246_102914992 276
1185 3300013100 Ga0157373_10010937 Ga0157373_100109373 276
1186 3300013100 Ga0157373_10228921 Ga0157373_102289212 276
1187 3300013102 Ga0157371_10005968 Ga0157371_100059683 276
1188 3300013102 Ga0157371_10048371 Ga0157371_100483712 276
1189 3300013296 Ga0157374_10001693 Ga0157374_100016933 276
1190 3300013296 Ga0157374_10006637 Ga0157374_100066379 276
1191 3300013296 Ga0157374_10100625 Ga0157374_101006252 276
1192 3300013296 Ga0157374_10542465 Ga0157374_105424651 276
1193 3300013296 Ga0157374_10757056 Ga0157374_107570561 276
1194 3300013297 Ga0157378_10000526 Ga0157378_1000052612 276
1195 3300013297 Ga0157378_10012102 Ga0157378_100121022 276
1196 3300013297 Ga0157378_10037158 Ga0157378_100371582 276
1197 3300013297 Ga0157378_10037216 Ga0157378_100372164 276
1198 3300013297 Ga0157378_10090563 Ga0157378_100905632 276
1199 3300013306 Ga0163162_10007789 Ga0163162_100077894 276
1200 3300013306 Ga0163162_10023684 Ga0163162_100236842 276
1201 3300013306 Ga0163162_10791926 Ga0163162_107919262 276
1202 3300013307 Ga0157372_10135961 Ga0157372_101359612 276
1203 3300013307 Ga0157372_10300984 Ga0157372_103009842 276
1204 3300013308 Ga0157375_10002585 Ga0157375_100025853 276
1205 3300013308 Ga0157375_10009105 Ga0157375_100091054 276
1206 3300014325 Ga0163163_10001510 Ga0163163_1000151012 276
1207 3300014325 Ga0163163_10008344 Ga0163163_100083445 276
1208 3300014325 Ga0163163_10050386 Ga0163163_100503864 276
1209 3300014325 Ga0163163_10237208 Ga0163163_102372082 276
1210 3300014325 Ga0163163_10349533 Ga0163163_103495332 276
1211 3300014325 Ga0163163_10471953 Ga0163163_104719532 276
1212 3300014325 Ga0163163_10532930 Ga0163163_105329302 276
1213 3300014326 Ga0157380_10004267 Ga0157380_100042675 276
1214 3300014326 Ga0157380_10169253 Ga0157380_101692532 276
1215 3300014745 Ga0157377_10000292 Ga0157377_1000029213 276
1216 3300014745 Ga0157377_10073797 Ga0157377_100737972 276
1217 3300014968 Ga0157379_10019280 Ga0157379_100192802 276
1218 3300014968 Ga0157379_10141654 Ga0157379_101416542 276
1219 3300014968 Ga0157379_10240989 Ga0157379_102409892 276
1220 3300014968 Ga0157379_10281921 Ga0157379_102819212 276
1221 3300014968 Ga0157379_10628880 Ga0157379_106288801 276
1222 3300014969 Ga0157376_10103122 Ga0157376_101031222 276
1223 3300014969 Ga0157376_10300652 Ga0157376_103006522 276
1224 3300017792 Ga0163161_10000399 Ga0163161_1000039917 276
1225 3300024227 Ga0228598_1000457 Ga0228598_10004577 276
1226 3300025271 Ga0207666_1000041 Ga0207666_100004119 276
1227 3300025271 Ga0207666_1000259 Ga0207666_10002594 276
1228 3300025290 Ga0207673_1001337 Ga0207673_10013372 276
1229 3300025297 Ga0209758_1000240 Ga0209758_100024042 276
1230 3300025297 Ga0209758_1001774 Ga0209758_100177425 276
1231 3300025315 Ga0207697_10000016 Ga0207697_1000001632 276
1232 3300025321 Ga0207656_10107487 Ga0207656_101074872 276
1233 3300025885 Ga0207653_10004182 Ga0207653_100041823 276
1234 3300025893 Ga0207682_10002011 Ga0207682_100020117 276
1235 3300025899 Ga0207642_10002271 Ga0207642_100022715 276
1236 3300025900 Ga0207710_10004825 Ga0207710_100048252 276
1237 3300025901 Ga0207688_10000124 Ga0207688_1000012425 276
1238 3300025901 Ga0207688_10010933 Ga0207688_100109333 276
1239 3300025901 Ga0207688_10062180 Ga0207688_100621802 276
1240 3300025903 Ga0207680_10006141 Ga0207680_100061412 276
1241 3300025904 Ga0207647_10000853 Ga0207647_1000085316 276
1242 3300025904 Ga0207647_10009329 Ga0207647_100093294 276
1243 3300025905 Ga0207685_10048086 Ga0207685_100480862 276
1244 3300025907 Ga0207645_10000119 Ga0207645_1000011934 276
1245 3300025907 Ga0207645_10018243 Ga0207645_100182434 276
1246 3300025907 Ga0207645_10059039 Ga0207645_100590392 276
1247 3300025908 Ga0207643_10000050 Ga0207643_1000005032 276
1248 3300025908 Ga0207643_10004145 Ga0207643_100041456 276
1249 3300025911 Ga0207654_10007924 Ga0207654_100079244 276
1250 3300025912 Ga0207707_10013286 Ga0207707_100132862 276
1251 3300025912 Ga0207707_10043045 Ga0207707_100430452 276
1252 3300025912 Ga0207707_10053839 Ga0207707_100538392 276
1253 3300025912 Ga0207707_10171500 Ga0207707_101715002 276
1254 3300025913 Ga0207695_10186410 Ga0207695_101864102 276
1255 3300025913 Ga0207695_10483178 Ga0207695_104831782 276
1256 3300025914 Ga0207671_10004877 Ga0207671_100048772 276
1257 3300025914 Ga0207671_10362818 Ga0207671_103628181 276
1258 3300025914 Ga0207671_10417019 Ga0207671_104170191 276
1259 3300025915 Ga0207693_10019341 Ga0207693_100193413 276
1260 3300025915 Ga0207693_10022758 Ga0207693_100227582 276
1261 3300025916 Ga0207663_10041071 Ga0207663_100410712 276
1262 3300025917 Ga0207660_10002304 Ga0207660_1000230410 276
1263 3300025917 Ga0207660_10012722 Ga0207660_100127223 276
1264 3300025917 Ga0207660_10075012 Ga0207660_100750122 276
1265 3300025918 Ga0207662_10000072 Ga0207662_100000727 276
1266 3300025918 Ga0207662_10007121 Ga0207662_100071212 276
1267 3300025918 Ga0207662_10025136 Ga0207662_100251363 276
1268 3300025918 Ga0207662_10035052 Ga0207662_100350522 276
1269 3300025919 Ga0207657_10000518 Ga0207657_1000051832 276
1270 3300025919 Ga0207657_10152966 Ga0207657_101529662 276
1271 3300025920 Ga0207649_10000341 Ga0207649_1000034115 276
1272 3300025921 Ga0207652_10001108 Ga0207652_1000110810 276
1273 3300025921 Ga0207652_10138217 Ga0207652_101382172 276
1274 3300025921 Ga0207652_10339798 Ga0207652_103397982 276
1275 3300025923 Ga0207681_10044801 Ga0207681_100448012 276
1276 3300025924 Ga0207694_10022220 Ga0207694_100222205 276
1277 3300025925 Ga0207650_10002975 Ga0207650_100029754 276
1278 3300025925 Ga0207650_10012242 Ga0207650_100122425 276
1279 3300025925 Ga0207650_10166878 Ga0207650_101668781 276
1280 3300025925 Ga0207650_10213692 Ga0207650_102136921 276
1281 3300025926 Ga0207659_10000057 Ga0207659_1000005731 276
1282 3300025926 Ga0207659_10026919 Ga0207659_100269192 276
1283 3300025926 Ga0207659_10189738 Ga0207659_101897382 276
1284 3300025927 Ga0207687_10001969 Ga0207687_100019697 276
1285 3300025927 Ga0207687_10068746 Ga0207687_100687462 276
1286 3300025927 Ga0207687_10075823 Ga0207687_100758232 276
1287 3300025927 Ga0207687_10184188 Ga0207687_101841882 276
1288 3300025928 Ga0207700_10018082 Ga0207700_100180822 276
1289 3300025928 Ga0207700_10026769 Ga0207700_100267692 276
1290 3300025928 Ga0207700_10052266 Ga0207700_100522662 276
1291 3300025928 Ga0207700_10428364 Ga0207700_104283641 276
1292 3300025929 Ga0207664_10243278 Ga0207664_102432782 276
1293 3300025929 Ga0207664_10330768 Ga0207664_103307682 276
1294 3300025931 Ga0207644_10000959 Ga0207644_1000095917 276
1295 3300025931 Ga0207644_10040827 Ga0207644_100408273 276
1296 3300025931 Ga0207644_10074922 Ga0207644_100749222 276
1297 3300025931 Ga0207644_10098733 Ga0207644_100987332 276
1298 3300025932 Ga0207690_10000349 Ga0207690_1000034911 276
1299 3300025933 Ga0207706_10004379 Ga0207706_100043797 276
1300 3300025933 Ga0207706_10006777 Ga0207706_1000677711 276
1301 3300025933 Ga0207706_10027334 Ga0207706_100273343 276
1302 3300025933 Ga0207706_10029532 Ga0207706_100295323 276
1303 3300025933 Ga0207706_10075230 Ga0207706_100752302 276
1304 3300025934 Ga0207686_10002370 Ga0207686_100023707 276
1305 3300025934 Ga0207686_10009181 Ga0207686_100091816 276
1306 3300025934 Ga0207686_10307554 Ga0207686_103075542 276
1307 3300025934 Ga0207686_10338581 Ga0207686_103385812 276
1308 3300025935 Ga0207709_10000232 Ga0207709_1000023235 276
1309 3300025935 Ga0207709_10037639 Ga0207709_100376392 276
1310 3300025936 Ga0207670_10003325 Ga0207670_100033257 276
1311 3300025936 Ga0207670_10012519 Ga0207670_100125194 276
1312 3300025936 Ga0207670_10030603 Ga0207670_100306032 276
1313 3300025936 Ga0207670_10092199 Ga0207670_100921992 276
1314 3300025938 Ga0207704_10000295 Ga0207704_1000029511 276
1315 3300025938 Ga0207704_10140097 Ga0207704_101400972 276
1316 3300025939 Ga0207665_10039647 Ga0207665_100396473 276
1317 3300025939 Ga0207665_10190139 Ga0207665_101901392 276
1318 3300025940 Ga0207691_10000139 Ga0207691_1000013925 276
1319 3300025940 Ga0207691_10003960 Ga0207691_100039606 276
1320 3300025940 Ga0207691_10030240 Ga0207691_100302404 276
1321 3300025941 Ga0207711_10001724 Ga0207711_1000172413 276
1322 3300025941 Ga0207711_10154111 Ga0207711_101541112 276
1323 3300025941 Ga0207711_10271820 Ga0207711_102718202 276
1324 3300025942 Ga0207689_10000085 Ga0207689_1000008519 276
1325 3300025942 Ga0207689_10005371 Ga0207689_100053717 276
1326 3300025942 Ga0207689_10077338 Ga0207689_100773382 276
1327 3300025942 Ga0207689_10097997 Ga0207689_100979972 276
1328 3300025944 Ga0207661_10000520 Ga0207661_1000052013 276
1329 3300025944 Ga0207661_10198950 Ga0207661_101989502 276
1330 3300025944 Ga0207661_10714816 Ga0207661_107148161 276
1331 3300025945 Ga0207679_10000130 Ga0207679_1000013027 276
1332 3300025945 Ga0207679_10121437 Ga0207679_101214372 276
1333 3300025949 Ga0207667_10003769 Ga0207667_1000376914 276
1334 3300025960 Ga0207651_10001543 Ga0207651_100015432 276
1335 3300025961 Ga0207712_10000235 Ga0207712_1000023519 276
1336 3300025972 Ga0207668_10001986 Ga0207668_100019863 276
1337 3300025972 Ga0207668_10051199 Ga0207668_100511992 276
1338 3300025972 Ga0207668_10267530 Ga0207668_102675302 276
1339 3300025981 Ga0207640_10000141 Ga0207640_100001417 276
1340 3300025981 Ga0207640_10515713 Ga0207640_105157131 276
1341 3300025981 Ga0207640_10534263 Ga0207640_105342631 276
1342 3300025986 Ga0207658_10006961 Ga0207658_100069617 276
1343 3300025986 Ga0207658_10159593 Ga0207658_101595932 276
1344 3300025986 Ga0207658_10209871 Ga0207658_102098712 276
1345 3300026023 Ga0207677_10002848 Ga0207677_100028483 276
1346 3300026023 Ga0207677_10023633 Ga0207677_100236333 276
1347 3300026035 Ga0207703_10033559 Ga0207703_100335593 276
1348 3300026035 Ga0207703_10083374 Ga0207703_100833742 276
1349 3300026035 Ga0207703_10087653 Ga0207703_100876532 276
1350 3300026035 Ga0207703_10177954 Ga0207703_101779542 276
1351 3300026041 Ga0207639_10033896 Ga0207639_100338962 276
1352 3300026067 Ga0207678_10003515 Ga0207678_100035152 276
1353 3300026067 Ga0207678_10004014 Ga0207678_100040147 276
1354 3300026067 Ga0207678_10011918 Ga0207678_100119183 276
1355 3300026067 Ga0207678_10015871 Ga0207678_100158712 276
1356 3300026067 Ga0207678_10091821 Ga0207678_100918212 276
1357 3300026075 Ga0207708_10002604 Ga0207708_100026047 276
1358 3300026075 Ga0207708_10003656 Ga0207708_100036566 276
1359 3300026075 Ga0207708_10015788 Ga0207708_100157882 276
1360 3300026078 Ga0207702_10002285 Ga0207702_100022852 276
1361 3300026088 Ga0207641_10000741 Ga0207641_100007412 276
1362 3300026088 Ga0207641_10032281 Ga0207641_100322812 276
1363 3300026089 Ga0207648_10000593 Ga0207648_100005937 276
1364 3300026095 Ga0207676_10001818 Ga0207676_100018182 276
1365 3300026095 Ga0207676_10146630 Ga0207676_101466302 276
1366 3300026095 Ga0207676_10696248 Ga0207676_106962481 276
1367 3300026116 Ga0207674_10001199 Ga0207674_100011994 276
1368 3300026116 Ga0207674_10289941 Ga0207674_102899411 276
1369 3300026118 Ga0207675_100004644 Ga0207675_1000046444 276
1370 3300026118 Ga0207675_100010520 Ga0207675_1000105202 276
1371 3300026118 Ga0207675_100040749 Ga0207675_1000407492 276
1372 3300026121 Ga0207683_10000014 Ga0207683_1000001493 276
1373 3300026121 Ga0207683_10010652 Ga0207683_100106522 276
1374 3300026121 Ga0207683_10019811 Ga0207683_100198112 276
1375 3300026121 Ga0207683_10031441 Ga0207683_100314413 276
1376 3300026121 Ga0207683_10248351 Ga0207683_102483512 276
1377 3300026142 Ga0207698_10001182 Ga0207698_100011824 276
1378 3300026142 Ga0207698_10515263 Ga0207698_105152631 276
1379 3300027552 Ga0209982_1016806 Ga0209982_10168062 276
1380 3300027695 Ga0209966_1001359 Ga0209966_10013593 276
1381 3300027717 Ga0209998_10000773 Ga0209998_100007734 276
1382 3300027717 Ga0209998_10000956 Ga0209998_100009564 276
1383 3300027717 Ga0209998_10020563 Ga0209998_100205632 276
1384 3300027866 Ga0209813_10009307 Ga0209813_100093072 276
1385 3300027876 Ga0209974_10001409 Ga0209974_100014094 276
1386 3300027876 Ga0209974_10021636 Ga0209974_100216362 276
1387 3300027907 Ga0207428_10000064 Ga0207428_10000064113 276
1388 3300027907 Ga0207428_10000720 Ga0207428_1000072030 276
1389 3300027907 Ga0207428_10002050 Ga0207428_1000205016 276
1390 3300027907 Ga0207428_10002399 Ga0207428_1000239913 276
1391 3300028379 Ga0268266_10070951 Ga0268266_100709513 276
1392 3300028380 Ga0268265_10000709 Ga0268265_1000070931 276
1393 3300028380 Ga0268265_10150282 Ga0268265_101502822 276
1394 3300028381 Ga0268264_10000908 Ga0268264_1000090829 276
1395 3300028381 Ga0268264_10030274 Ga0268264_100302742 276
1396 3300028381 Ga0268264_10507752 Ga0268264_105077522 276
1397 3300034816 Ga0373930_0001111 Ga0373930_0001111_1770_2600 276
1398 3300034818 Ga0373950_0000414 Ga0373950_0000414_1537_2367 276
1399 3300034819 Ga0373958_0009146 Ga0373958_0009146_218_1048 276
1400 3300034820 Ga0373959_0000642 Ga0373959_0000642_4770_5600 276
1401 3300034957 Ga0373938_0000362 Ga0373938_0000362_5305_6135 276
1402 3300034957 Ga0373938_0000372 Ga0373938_0000372_4728_5558 276
1403 3300035084 Ga0373928_0000432 Ga0373928_0000432_4731_5561 276
1404 3300035084 Ga0373928_0001567 Ga0373928_0001567_3032_3862 276
1405 3300035085 Ga0373929_0000900 Ga0373929_0000900_224_1054 276
1406 3300035086 Ga0373934_0016875 Ga0373934_0016875_1177_2007 276
1407 3300035088 Ga0373940_0000189 Ga0373940_0000189_1348_2178 276
1408 3300035089 Ga0373944_0011803 Ga0373944_0011803_1347_2177 276
1409 3300035090 Ga0373949_0001804 Ga0373949_0001804_2811_3641 276
1410 3300035091 Ga0373951_0001845 Ga0373951_0001845_3279_4109 276
1411 3300035091 Ga0373951_0016491 Ga0373951_0016491_450_1280 276
1412 3300035092 Ga0373952_0000165 Ga0373952_0000165_3930_4760 276
1413 3300035092 Ga0373952_0006835 Ga0373952_0006835_618_1448 276
1414 3300035111 Ga0373923_0096799 Ga0373923_0096799_240_1070 276
1415 3300035112 Ga0373932_0000306 Ga0373932_0000306_4644_5474 276
1416 3300035112 Ga0373932_0062626 Ga0373932_0062626_68_898 276
1417 3300035113 Ga0373936_0044560 Ga0373936_0044560_780_1610 276
1418 3300035113 Ga0373936_0089216 Ga0373936_0089216_46_876 276
1419 3300035113 Ga0373936_0118899 Ga0373936_0118899_256_1086 276
1420 3300035114 Ga0373939_0000725 Ga0373939_0000725_551_1381 276
1421 3300035114 Ga0373939_0047992 Ga0373939_0047992_283_1113 276
1422 3300035115 Ga0373941_0000289 Ga0373941_0000289_1375_2205 276
1423 3300035115 Ga0373941_0031664 Ga0373941_0031664_141_971 276
1424 3300035116 Ga0373945_0002251 Ga0373945_0002251_4071_4901 276
1425 3300035116 Ga0373945_0004137 Ga0373945_0004137_2970_3800 276
1426 3300035120 Ga0373957_0025014 Ga0373957_0025014_292_1122 276
1427 3300035121 Ga0373960_0000721 Ga0373960_0000721_4716_5546 276
1428 3300035121 Ga0373960_0009227 Ga0373960_0009227_1344_2174 276
1429 3300035170 Ga0373943_0075644 Ga0373943_0075644_121_951 276
1430 3300035170 Ga0373943_0084329 Ga0373943_0084329_751_1581 276
1431 3300035171 Ga0373946_0004607 Ga0373946_0004607_652_1482 276
1432 3300035171 Ga0373946_0028586 Ga0373946_0028586_520_1350 276
1433 3300035172 Ga0373955_0000686 Ga0373955_0000686_41_871 276
1434 3300035172 Ga0373955_0008210 Ga0373955_0008210_1140_1970 276
1435 3300035207 Ga0373942_0000912 Ga0373942_0000912_6107_6937 276
1436 3300035241 Ga0373961_0001143 Ga0373961_0001143_5538_6368 276
1437 3300035242 Ga0373962_0000674 Ga0373962_0000674_4884_5714 276
1438 3300035242 Ga0373962_0000871 Ga0373962_0000871_1482_2312 276
1439 3300035410 Ga0373924_0004324 Ga0373924_0004324_3422_4252 276
1440 3300035691 Ga0373931_0000191 Ga0373931_0000191_14305_15135 276
1441 3300035691 Ga0373931_0009635 Ga0373931_0009635_984_1814 276
1442 3300035691 Ga0373931_0163921 Ga0373931_0163921_233_1063 276
1443 3300035692 Ga0373935_0000422 Ga0373935_0000422_18081_18911 276
1444 3300035692 Ga0373935_0014013 Ga0373935_0014013_515_1345 276
1445 3300035692 Ga0373935_0061011 Ga0373935_0061011_104_934 276
1446 3300035692 Ga0373935_0153145 Ga0373935_0153145_533_1363 276
1447 3300035695 Ga0373927_0049857 Ga0373927_0049857_633_1463 276
1448 3300035724 Ga0373933_0005797 Ga0373933_0005797_3061_3891 276
1449 3300035724 Ga0373933_0035442 Ga0373933_0035442_1433_2263 276
1450 3300035725 Ga0373947_0000418 Ga0373947_0000418_9745_10575 276
1451 3300035725 Ga0373947_0000805 Ga0373947_0000805_3365_4195 276
1452 3300035725 Ga0373947_0033196 Ga0373947_0033196_1175_2005 276
1453 3300035725 Ga0373947_0080849 Ga0373947_0080849_561_1391 276
1454 3300036401 Ga0373937_0000028 Ga0373937_0000028_22155_22985 276
1455 3300036401 Ga0373937_0036933 Ga0373937_0036933_134_964 276
1456 3300036401 Ga0373937_0054222 Ga0373937_0054222_448_1278 276
1457 3300037068 Ga0373925_0000733 Ga0373925_0000733_8102_8932 276
1458 3300038996 Ga0242420_009415 Ga0242420_009415_412_1242 276
1459 3300041512 Ga0451853_2960746 Ga0451853_2960746_56_886 276
1460 3300042005 Ga0439448_0035809 Ga0439448_0035809_622_1452 276
1461 3300042876 Ga0451577_0059726 Ga0451577_0059726_1048_1878 276
1462 3300044694 Ga0466963_0062073 Ga0466963_0062073_1127_1957 276
1463 3300044712 Ga0453684_0101550 Ga0453684_0101550_33_863 276
1464 3300045051 Ga0451576_0036584 Ga0451576_0036584_2688_3518 276
1465 3300046454 Ga0495592_0000032 Ga0495592_0000032_40169_40999 276
1466 3300046455 Ga0495603_0106721 Ga0495603_0106721_598_1428 276
1467 3300046458 Ga0495591_028026 Ga0495591_028026_719_1549 276
1468 3300046459 Ga0495629_0004435 Ga0495629_0004435_6888_7718 276
1469 3300046459 Ga0495629_0011571 Ga0495629_0011571_5046_5876 276
1470 3300046459 Ga0495629_0142170 Ga0495629_0142170_239_1069 276
1471 3300046459 Ga0495629_0197380 Ga0495629_0197380_397_1227 276
1472 3300046461 Ga0495641_0031640 Ga0495641_0031640_203_1033 276
1473 3300046462 Ga0495651_0001777 Ga0495651_0001777_6465_7295 276
1474 3300046462 Ga0495651_0003817 Ga0495651_0003817_567_1397 276
1475 3300046462 Ga0495651_0040754 Ga0495651_0040754_2181_3011 276
1476 3300046463 Ga0495653_0000012 Ga0495653_0000012_114797_115627 276
1477 3300046463 Ga0495653_0001953 Ga0495653_0001953_11969_12799 276
1478 3300046472 Ga0495580_0017727 Ga0495580_0017727_625_1455 276
1479 3300046472 Ga0495580_0168811 Ga0495580_0168811_63_893 276
1480 3300046473 Ga0495582_0034392 Ga0495582_0034392_866_1696 276
1481 3300046473 Ga0495582_0055206 Ga0495582_0055206_879_1709 276
1482 3300046473 Ga0495582_0078055 Ga0495582_0078055_799_1629 276
1483 3300046474 Ga0495605_0051268 Ga0495605_0051268_590_1420 276
1484 3300046476 Ga0495662_0005897 Ga0495662_0005897_1373_2203 276
1485 3300046476 Ga0495662_0100798 Ga0495662_0100798_328_1158 276
1486 3300046477 Ga0495664_0000004 Ga0495664_0000004_266690_267520 276
1487 3300046477 Ga0495664_0002121 Ga0495664_0002121_798_1628 276
1488 3300046477 Ga0495664_0065850 Ga0495664_0065850_689_1519 276
1489 3300046499 Ga0495594_0113526 Ga0495594_0113526_685_1515 276
1490 3300046501 Ga0495607_0088897 Ga0495607_0088897_834_1664 276
1491 3300046511 Ga0495608_0000005 Ga0495608_0000005_276016_276846 276
1492 3300046511 Ga0495608_0002561 Ga0495608_0002561_8780_9610 276
1493 3300046514 Ga0495618_0000006 Ga0495618_0000006_225783_226613 276
1494 3300046516 Ga0495628_0000001 Ga0495628_0000001_266679_267509 276
1495 3300046516 Ga0495628_0057279 Ga0495628_0057279_2150_2980 276
1496 3300046517 Ga0495630_0010147 Ga0495630_0010147_2738_3568 276
1497 3300046517 Ga0495630_0080460 Ga0495630_0080460_1167_1997 276
1498 3300046517 Ga0495630_0213036 Ga0495630_0213036_380_1210 276
1499 3300046517 Ga0495630_0327792 Ga0495630_0327792_316_1146 276
1500 3300046519 Ga0495632_0043900 Ga0495632_0043900_411_1241 276
1501 3300046525 Ga0495663_0081821 Ga0495663_0081821_53_883 276
1502 3300046526 Ga0495666_0062926 Ga0495666_0062926_56_886 276
1503 3300046529 Ga0495652_0000002 Ga0495652_0000002_481213_482043 276
1504 3300046529 Ga0495652_0016480 Ga0495652_0016480_1871_2701 276
1505 3300046529 Ga0495652_0143720 Ga0495652_0143720_553_1383 276
1506 3300046531 Ga0495665_0021159 Ga0495665_0021159_1086_1916 276
1507 3300046533 Ga0495640_0000001 Ga0495640_0000001_575217_576047 276
1508 3300046533 Ga0495640_0007696 Ga0495640_0007696_218_1048 276
1509 3300046535 Ga0495586_0049150 Ga0495586_0049150_748_1578 276
1510 3300046536 Ga0495587_0000008 Ga0495587_0000008_266897_267727 276
1511 3300046536 Ga0495587_0004574 Ga0495587_0004574_4795_5625 276
1512 3300046538 Ga0495609_0080620 Ga0495609_0080620_202_1032 276
1513 3300046539 Ga0495621_0084623 Ga0495621_0084623_267_1097 276
1514 3300046542 Ga0495597_0077869 Ga0495597_0077869_507_1337 276
1515 3300046543 Ga0495645_0000002 Ga0495645_0000002_266692_267522 276
1516 3300046543 Ga0495645_0005676 Ga0495645_0005676_2565_3395 276
1517 3300046543 Ga0495645_0033665 Ga0495645_0033665_2436_3266 276
1518 3300046543 Ga0495645_0052304 Ga0495645_0052304_1898_2728 276
1519 3300046559 Ga0495667_0000007 Ga0495667_0000007_59427_60257 276
1520 3300046559 Ga0495667_0013067 Ga0495667_0013067_293_1123 276
1521 3300046559 Ga0495667_0106508 Ga0495667_0106508_71_901 276
1522 3300046642 Ga0495634_0000003 Ga0495634_0000003_90260_91090 276
1523 3300046642 Ga0495634_0009022 Ga0495634_0009022_4887_5717 276
1524 3300046663 Ga0495635_0000002 Ga0495635_0000002_219415_220245 276
1525 3300046663 Ga0495635_0001594 Ga0495635_0001594_2873_3703 276
1526 3300046663 Ga0495635_0006165 Ga0495635_0006165_5853_6683 276
1527 3300046663 Ga0495635_0073556 Ga0495635_0073556_646_1476 276
1528 3300046675 Ga0495657_0001975 Ga0495657_0001975_13470_14300 276
1529 3300046675 Ga0495657_0017083 Ga0495657_0017083_1706_2536 276
1530 3300046675 Ga0495657_0118738 Ga0495657_0118738_45_875 276
1531 3300046678 Ga0495599_0000005 Ga0495599_0000005_94914_95744 276
1532 3300046678 Ga0495599_0025418 Ga0495599_0025418_2555_3385 276
1533 3300046678 Ga0495599_0181779 Ga0495599_0181779_111_941 276
1534 3300046679 Ga0495623_0000034 Ga0495623_0000034_58003_58833 276
1535 3300046679 Ga0495623_0002789 Ga0495623_0002789_7385_8215 276
1536 3300046680 Ga0495646_0000002 Ga0495646_0000002_204367_205197 276
1537 3300046680 Ga0495646_0014081 Ga0495646_0014081_86_916 276
1538 3300046680 Ga0495646_0147652 Ga0495646_0147652_367_1197 276
1539 3300046689 Ga0495613_0065810 Ga0495613_0065810_397_1227 276
1540 3300046689 Ga0495613_0082604 Ga0495613_0082604_346_1176 276
1541 3300046690 Ga0495624_0001247 Ga0495624_0001247_13504_14334 276
1542 3300046690 Ga0495624_0106860 Ga0495624_0106860_259_1089 276
1543 3300046690 Ga0495624_0198779 Ga0495624_0198779_325_1155 276
1544 3300046809 Ga0495600_0000012 Ga0495600_0000012_117822_118652 276
1545 3300046809 Ga0495600_0003701 Ga0495600_0003701_6803_7633 276
1546 3300047315 Ga0495581_0004792 Ga0495581_0004792_2906_3736 276
1547 3300047315 Ga0495581_0015123 Ga0495581_0015123_898_1728 276
1548 3300047317 Ga0495604_0000009 Ga0495604_0000009_58783_59613 276
1549 3300047317 Ga0495604_0004975 Ga0495604_0004975_1823_2653 276
1550 3300047317 Ga0495604_0034094 Ga0495604_0034094_1366_2196 276
1551 3300047319 Ga0495674_0000002 Ga0495674_0000002_266680_267510 276
1552 3300047319 Ga0495674_0014137 Ga0495674_0014137_1695_2525 276
1553 3300047319 Ga0495674_0036555 Ga0495674_0036555_2105_2935 276
1554 3300047319 Ga0495674_0038164 Ga0495674_0038164_1914_2744 276
1555 3300047321 Ga0495676_0022777 Ga0495676_0022777_1885_2715 276
1556 3300047321 Ga0495676_0042702 Ga0495676_0042702_835_1665 276
1557 3300047322 Ga0495680_0005385 Ga0495680_0005385_7974_8804 276
1558 3300047322 Ga0495680_0015305 Ga0495680_0015305_3193_4023 276
1559 3300047322 Ga0495680_0020035 Ga0495680_0020035_1829_2659 276
1560 3300047322 Ga0495680_0220308 Ga0495680_0220308_240_1070 276
1561 3300047444 Ga0495675_0000117 Ga0495675_0000117_28710_29540 276
1562 3300047444 Ga0495675_0002621 Ga0495675_0002621_4495_5325 276
1563 3300047471 Ga0495684_0000017 Ga0495684_0000017_19053_19883 276
1564 3300047471 Ga0495684_0047137 Ga0495684_0047137_624_1454 276
1565 3300047471 Ga0495684_0108506 Ga0495684_0108506_1150_1980 276
1566 3300047471 Ga0495684_0127177 Ga0495684_0127177_798_1628 276
1567 3300047471 Ga0495684_0180715 Ga0495684_0180715_169_999 276
1568 3300047673 Ga0495593_0002032 Ga0495593_0002032_4686_5516 276
1569 3300047673 Ga0495593_0018904 Ga0495593_0018904_849_1679 276
1570 3300047673 Ga0495593_0164233 Ga0495593_0164233_150_980 276
1571 3300048088 Ga0495602_0000005 Ga0495602_0000005_78164_78994 276
1572 3300048088 Ga0495602_0034885 Ga0495602_0034885_123_953 276
1573 3300048090 Ga0495615_0026977 Ga0495615_0026977_32_862 276
1574 3300048903 Ga0496100_0004754 Ga0496100_0004754_5058_5888 276
1575 3300048903 Ga0496100_0007028 Ga0496100_0007028_326_1156 276
1576 3300048904 Ga0496101_0000562 Ga0496101_0000562_10955_11785 276
1577 3300048904 Ga0496101_0062749 Ga0496101_0062749_1376_2206 276
1578 3300048904 Ga0496101_0078408 Ga0496101_0078408_594_1424 276
1579 3300048904 Ga0496101_0104360 Ga0496101_0104360_100_930 276
1580 3300048904 Ga0496101_0165931 Ga0496101_0165931_609_1439 276
1581 3300048904 Ga0496101_0175645 Ga0496101_0175645_569_1399 276
1582 3300048905 Ga0496102_0000859 Ga0496102_0000859_9953_10783 276
1583 3300048905 Ga0496102_0003311 Ga0496102_0003311_8223_9053 276
1584 3300048905 Ga0496102_0069396 Ga0496102_0069396_59_889 276
1585 3300048905 Ga0496102_0118224 Ga0496102_0118224_820_1650 276
1586 3300048905 Ga0496102_0125115 Ga0496102_0125115_160_990 276
1587 3300048905 Ga0496102_0168531 Ga0496102_0168531_197_1027 276
1588 3300048905 Ga0496102_0248609 Ga0496102_0248609_350_1180 276
1589 3300048906 Ga0496103_0000449 Ga0496103_0000449_30182_31012 276
1590 3300048906 Ga0496103_0004452 Ga0496103_0004452_1605_2435 276
1591 3300048906 Ga0496103_0017923 Ga0496103_0017923_2607_3437 276
1592 3300048906 Ga0496103_0065758 Ga0496103_0065758_176_1006 276
1593 3300048907 Ga0496104_0000641 Ga0496104_0000641_9987_10817 276
1594 3300048907 Ga0496104_0000892 Ga0496104_0000892_8745_9575 276
1595 3300048907 Ga0496104_0001517 Ga0496104_0001517_2876_3706 276
1596 3300048907 Ga0496104_0002774 Ga0496104_0002774_2338_3168 276
1597 3300048907 Ga0496104_0014793 Ga0496104_0014793_560_1390 276
1598 3300048907 Ga0496104_0023319 Ga0496104_0023319_2213_3043 276
1599 3300048907 Ga0496104_0036347 Ga0496104_0036347_1163_1993 276
1600 3300048907 Ga0496104_0079304 Ga0496104_0079304_1265_2095 276
1601 3300048907 Ga0496104_0116245 Ga0496104_0116245_402_1232 276
1602 3300048908 Ga0496105_0000053 Ga0496105_0000053_78850_79680 276
1603 3300048908 Ga0496105_0018111 Ga0496105_0018111_2555_3385 276
1604 3300048908 Ga0496105_0023363 Ga0496105_0023363_1698_2528 276
1605 3300048908 Ga0496105_0035434 Ga0496105_0035434_749_1579 276
1606 3300048908 Ga0496105_0068004 Ga0496105_0068004_1837_2667 276
1607 3300048908 Ga0496105_0137452 Ga0496105_0137452_914_1744 276
1608 3300048908 Ga0496105_0148900 Ga0496105_0148900_166_996 276
1609 3300048908 Ga0496105_0162915 Ga0496105_0162915_407_1237 276
1610 3300048908 Ga0496105_0398930 Ga0496105_0398930_105_935 276
1611 3300048909 Ga0496106_0002507 Ga0496106_0002507_2015_2845 276
1612 3300048909 Ga0496106_0015113 Ga0496106_0015113_1013_1843 276
1613 3300048909 Ga0496106_0050295 Ga0496106_0050295_1087_1917 276
1614 3300048909 Ga0496106_0065602 Ga0496106_0065602_419_1249 276
1615 3300048909 Ga0496106_0083597 Ga0496106_0083597_1041_1871 276
1616 3300048909 Ga0496106_0148129 Ga0496106_0148129_559_1389 276
1617 3300048909 Ga0496106_0157840 Ga0496106_0157840_722_1552 276
1618 3300048910 Ga0496107_0006018 Ga0496107_0006018_2313_3143 276
1619 3300048910 Ga0496107_0008583 Ga0496107_0008583_399_1229 276
1620 3300048910 Ga0496107_0011131 Ga0496107_0011131_4335_5165 276
1621 3300048910 Ga0496107_0024532 Ga0496107_0024532_1850_2680 276
1622 3300048910 Ga0496107_0050905 Ga0496107_0050905_1936_2766 276
1623 3300048910 Ga0496107_0163131 Ga0496107_0163131_85_915 276
1624 3300048911 Ga0496108_0002055 Ga0496108_0002055_15144_15974 276
1625 3300048911 Ga0496108_0031485 Ga0496108_0031485_2977_3807 276
1626 3300048911 Ga0496108_0047392 Ga0496108_0047392_166_996 276
1627 3300048911 Ga0496108_0064117 Ga0496108_0064117_190_1020 276
1628 3300048911 Ga0496108_0116146 Ga0496108_0116146_1303_2133 276
1629 3300048911 Ga0496108_0159378 Ga0496108_0159378_170_1000 276
1630 3300048911 Ga0496108_0420047 Ga0496108_0420047_198_1028 276
1631 3300048912 Ga0496109_0001001 Ga0496109_0001001_5854_6684 276
1632 3300048912 Ga0496109_0002191 Ga0496109_0002191_15132_15962 276
1633 3300048912 Ga0496109_0018818 Ga0496109_0018818_1743_2573 276
1634 3300048912 Ga0496109_0072449 Ga0496109_0072449_1252_2082 276
1635 3300048912 Ga0496109_0076158 Ga0496109_0076158_1316_2146 276
1636 3300048912 Ga0496109_0153955 Ga0496109_0153955_685_1515 276
1637 3300048912 Ga0496109_0178975 Ga0496109_0178975_64_894 276
1638 3300048912 Ga0496109_0322658 Ga0496109_0322658_538_1368 276
1639 3300048913 Ga0496110_0006377 Ga0496110_0006377_6766_7596 276
1640 3300048913 Ga0496110_0007998 Ga0496110_0007998_4920_5750 276
1641 3300048913 Ga0496110_0052811 Ga0496110_0052811_2395_3225 276
1642 3300048913 Ga0496110_0201334 Ga0496110_0201334_833_1663 276
1643 3300048913 Ga0496110_0418388 Ga0496110_0418388_299_1129 276
1644 3300048914 Ga0496111_0013520 Ga0496111_0013520_3309_4139 276
1645 3300048914 Ga0496111_0028627 Ga0496111_0028627_1724_2554 276
1646 3300048914 Ga0496111_0054190 Ga0496111_0054190_175_1005 276
1647 3300048915 Ga0496112_0046306 Ga0496112_0046306_1511_2341 276
1648 3300048915 Ga0496112_0068889 Ga0496112_0068889_2492_3322 276
1649 3300048915 Ga0496112_0080954 Ga0496112_0080954_62_892 276
1650 3300048915 Ga0496112_0114550 Ga0496112_0114550_746_1576 276
1651 3300048915 Ga0496112_0268720 Ga0496112_0268720_232_1086 276
1652 3300048915 Ga0496112_0347917 Ga0496112_0347917_376_1206 276
1653 3300048915 Ga0496112_0407917 Ga0496112_0407917_355_1185 276
1654 3300048916 Ga0496113_0007772 Ga0496113_0007772_1393_2223 276
1655 3300048916 Ga0496113_0015565 Ga0496113_0015565_3236_4066 276
1656 3300048916 Ga0496113_0172597 Ga0496113_0172597_459_1289 276
1657 3300048916 Ga0496113_0280516 Ga0496113_0280516_289_1119 276
1658 3300048916 Ga0496113_0313169 Ga0496113_0313169_93_923 276
1659 3300048917 Ga0496114_0075781 Ga0496114_0075781_358_1188 276
1660 3300048917 Ga0496114_0085950 Ga0496114_0085950_1657_2487 276
1661 3300048917 Ga0496114_0243111 Ga0496114_0243111_137_1009 276
1662 3300048917 Ga0496114_0380569 Ga0496114_0380569_133_963 276
1663 3300048917 Ga0496114_0384007 Ga0496114_0384007_131_961 276
1664 3300048918 Ga0496115_0029648 Ga0496115_0029648_2263_3093 276
1665 3300048918 Ga0496115_0034435 Ga0496115_0034435_1616_2446 276
1666 3300048918 Ga0496115_0038962 Ga0496115_0038962_480_1310 276
1667 3300048918 Ga0496115_0053358 Ga0496115_0053358_2159_2989 276
1668 3300048918 Ga0496115_0126095 Ga0496115_0126095_1164_1994 276
1669 3300048929 Ga0496126_0344965 Ga0496126_0344965_53_883 276
1670 3300050489 nmdc:mga03683_1015_c1 nmdc:mga03683_1015_c1_4072_4902 276
1671 3300050491 nmdc:mga00v17_16253_c1 nmdc:mga00v17_16253_c1_2763_3593 276
1672 3300050491 nmdc:mga00v17_72091_c1 nmdc:mga00v17_72091_c1_907_1737 276
1673 3300050491 nmdc:mga00v17_97752_c1 nmdc:mga00v17_97752_c1_826_1656 276
1674 3300050492 nmdc:mga0yw44_105912_c1 nmdc:mga0yw44_105912_c1_294_1124 276
1675 3300050492 nmdc:mga0yw44_167451_c1 nmdc:mga0yw44_167451_c1_377_1207 276
1676 3300050492 nmdc:mga0yw44_194015_c1 nmdc:mga0yw44_194015_c1_448_1278 276
1677 3300050492 nmdc:mga0yw44_4572_c1 nmdc:mga0yw44_4572_c1_2442_3272 276
1678 3300050493 nmdc:mga0k408_7541_c1 nmdc:mga0k408_7541_c1_4941_5771 276
1679 3300050494 nmdc:mga06z11_106374_c1 nmdc:mga06z11_106374_c1_280_1116 276
1680 3300050494 nmdc:mga06z11_52830_c1 nmdc:mga06z11_52830_c1_627_1457 276
1681 3300050494 nmdc:mga06z11_7657_c1 nmdc:mga06z11_7657_c1_174_1004 276
1682 3300050495 nmdc:mga04h51_32389_c1 nmdc:mga04h51_32389_c1_802_1632 276
1683 3300050495 nmdc:mga04h51_7948_c1 nmdc:mga04h51_7948_c1_1251_2081 276
1684 3300050496 nmdc:mga07m45_36540_c1 nmdc:mga07m45_36540_c1_1231_2061 276
1685 3300050507 nmdc:mga05p37_164286_c1 nmdc:mga05p37_164286_c1_195_1025 276
1686 3300050507 nmdc:mga05p37_2263_c1 nmdc:mga05p37_2263_c1_4224_5054 276
1687 3300050507 nmdc:mga05p37_3065_c1 nmdc:mga05p37_3065_c1_15955_16785 276
1688 3300050507 nmdc:mga05p37_32472_c1 nmdc:mga05p37_32472_c1_41_880 276
1689 3300050507 nmdc:mga05p37_623331_c1 nmdc:mga05p37_623331_c1_247_1077 276
1690 3300050507 nmdc:mga05p37_85508_c1 nmdc:mga05p37_85508_c1_2098_2928 276
1691 3300050508 nmdc:mga09592_12705_c1 nmdc:mga09592_12705_c1_4219_5049 276
1692 3300050508 nmdc:mga09592_13129_c1 nmdc:mga09592_13129_c1_3478_4317 276
1693 3300050509 nmdc:mga0qj67_63811_c1 nmdc:mga0qj67_63811_c1_1607_2437 276
1694 3300050509 nmdc:mga0qj67_677_c1 nmdc:mga0qj67_677_c1_6064_6903 276
1695 3300050510 nmdc:mga06r32_24506_c1 nmdc:mga06r32_24506_c1_4208_5047 276
1696 3300050510 nmdc:mga06r32_25255_c1 nmdc:mga06r32_25255_c1_4225_5055 276
1697 3300050511 nmdc:mga08y16_101295_c1 nmdc:mga08y16_101295_c1_1176_2006 276
1698 3300050511 nmdc:mga08y16_13846_c1 nmdc:mga08y16_13846_c1_5020_5850 276
1699 3300050511 nmdc:mga08y16_16169_c1 nmdc:mga08y16_16169_c1_521_1360 276
1700 3300050511 nmdc:mga08y16_31703_c1 nmdc:mga08y16_31703_c1_4208_5038 276
1701 3300050511 nmdc:mga08y16_410170_c1 nmdc:mga08y16_410170_c1_505_1335 276
1702 3300050511 nmdc:mga08y16_7832_c1 nmdc:mga08y16_7832_c1_7710_8540 276
1703 3300050512 nmdc:mga0n895_19426_c1 nmdc:mga0n895_19426_c1_4208_5047 276
1704 3300050512 nmdc:mga0n895_2078_c1 nmdc:mga0n895_2078_c1_8303_9133 276
1705 3300050512 nmdc:mga0n895_459512_c1 nmdc:mga0n895_459512_c1_347_1177 276
1706 3300050512 nmdc:mga0n895_80379_c1 nmdc:mga0n895_80379_c1_924_1754 276
1707 3300050512 nmdc:mga0n895_80795_c1 nmdc:mga0n895_80795_c1_1394_2224 276
1708 3300050513 nmdc:mga0rr50_27234_c1 nmdc:mga0rr50_27234_c1_315_1145 276
1709 3300050513 nmdc:mga0rr50_4593_c1 nmdc:mga0rr50_4593_c1_2365_3195 276
1710 3300050514 nmdc:mga08x19_53884_c1 nmdc:mga08x19_53884_c1_1011_1841 276
1711 3300050514 nmdc:mga08x19_56416_c1 nmdc:mga08x19_56416_c1_267_1097 276
1712 3300050515 nmdc:mga0a205_1227_c1 nmdc:mga0a205_1227_c1_18652_19482 276
1713 3300050515 nmdc:mga0a205_403355_c1 nmdc:mga0a205_403355_c1_104_934 276
1714 3300050515 nmdc:mga0a205_4997_c1 nmdc:mga0a205_4997_c1_746_1576 276
1715 3300050515 nmdc:mga0a205_5496_c1 nmdc:mga0a205_5496_c1_4441_5280 276
1716 3300050515 nmdc:mga0a205_8704_c1 nmdc:mga0a205_8704_c1_4047_4877 276
1717 3300053077 Ga0495601_0000002 Ga0495601_0000002_43952_44782 276
1718 3300053077 Ga0495601_0000354 Ga0495601_0000354_18617_19447 276
1719 3300053077 Ga0495601_0014974 Ga0495601_0014974_3730_4560 276
1720 3300053077 Ga0495601_0304163 Ga0495601_0304163_16_846 276
1721 3300053078 Ga0495612_0000011 Ga0495612_0000011_19359_20189 276
1722 3300053078 Ga0495612_0002235 Ga0495612_0002235_2635_3465 276
1723 3300053084 Ga0495595_0000026 Ga0495595_0000026_92787_93617 276
1724 3300053084 Ga0495595_0030995 Ga0495595_0030995_744_1574 276
1725 3300053084 Ga0495595_0074369 Ga0495595_0074369_82_912 276
1726 3300053084 Ga0495595_0099825 Ga0495595_0099825_36_866 276
1727 3300053085 Ga0495619_0000019 Ga0495619_0000019_3288_4118 276
1728 3300053085 Ga0495619_0001878 Ga0495619_0001878_3965_4795 276
1729 3300053085 Ga0495619_0020048 Ga0495619_0020048_3261_4091 276
1730 3300053085 Ga0495619_0039069 Ga0495619_0039069_824_1654 276
1731 3300053085 Ga0495619_0078329 Ga0495619_0078329_1334_2164 276
1732 3300053085 Ga0495619_0134691 Ga0495619_0134691_135_965 276
1733 3300053096 Ga0500641_0003589 Ga0500641_0003589_4305_5141 276
1734 3300053119 Ga0500595_016775 Ga0500595_016775_1663_2493 276
1735 3300053139 Ga0500568_0066451 Ga0500568_0066451_301_1131 276
1736 3300053153 Ga0500616_0022745 Ga0500616_0022745_1084_1914 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23493

264

312

0.96

PF04055

Radical_SAM

Radical SAM superfamily

56

211

0.91

PF13353

Fer4_12

4Fe-4S single cluster domain

48

175

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cb8-assembly1.cif.gz_A 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate 0.932 37 276
8fsi-assembly1.cif.gz_A the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam 0.9293 37 275
3cb8-assembly1.cif.gz_A 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate 0.9136 37 276
8fsi-assembly1.cif.gz_A the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam 0.9036 37 275
3can-assembly1.cif.gz_A-2 crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 0.8829 105 276
ID Description Score Start End Superfamily
af_P0A9N4_2_246_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9605 37 276 3.20.20.70
af_P0A9N4_2_246_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9376 37 276 3.20.20.70
af_Q2G1D7_1_246_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9376 36 269 3.20.20.70
af_P75794_7_292_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9203 49 272 3.20.20.70
af_P32675_21_290_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9042 38 276 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A5B8AWN2-F1-model_v4 deleted 0.9835 34 276
AF-A0A2R4TDJ9-F1-model_v4 Pyruvate formate-lyase-activating enzyme (EC 1.97.1.4) 0.9832 38 276 GO:0005737
GO:0016829
GO:0043365
GO:0046872
GO:0051539
AF-A0A1U9P5P0-F1-model_v4 Pyruvate formate-lyase-activating enzyme (EC 1.97.1.4) 0.9827 37 276 GO:0005737
GO:0016829
GO:0043365
GO:0046872
GO:0051539
AF-B5JLT8-F1-model_v4 Radical SAM core domain-containing protein 0.9793 117 276 GO:0003824
GO:0046872
GO:0051539
AF-A0A433FB05-F1-model_v4 deleted 0.9791 34 276

Feature Viewer

pLDDT pTM Quality
95.26 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map