F495507

General Info

Members Datasets Scaffolds Average Seq Length
1731 460 1731 204

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10239052|Ga0157372_102390523
Length 228
Sequence MKGNAARKPIATTPKFGETMARYKGPVCRLCRREGMKLFLKGTKCFSDKCPVEKRNFAPGQHGKDRKAKIVGYGLQLREKQKAKRIYFTLEKQFRNYFEKAARAKGVTGAKLLEQLERRLDNVVYRLGFAISRRQARQLVRHGHVAVNGRKVNIPSYQVAVGEEIVVRDNSKKMTVLEIAKEFTSHQPAVNWLEVDRDNYKGRVTALPKREDINLPVNEQLIVELYSK

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
146 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
149 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
150 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
153 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
222 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
238 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
239 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
240 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
241 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
242 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
243 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
244 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
245 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
248 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
249 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
250 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
251 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
252 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
253 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
254 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
255 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
256 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
257 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
264 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
267 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
268 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
269 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
270 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
271 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
272 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
273 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
275 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
277 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
278 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
279 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
280 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
281 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
282 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
283 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
284 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
285 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
286 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
287 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
288 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
291 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
293 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
294 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
295 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
296 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
298 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
299 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
306 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
307 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
308 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
309 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
310 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
311 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
312 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
313 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
314 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
315 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
320 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
321 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
325 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
326 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
327 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
328 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
332 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
333 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
334 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
335 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
336 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
337 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
338 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
339 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
340 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
341 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
342 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
343 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
344 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
345 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
349 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
350 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
351 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
357 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
358 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
359 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
360 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
361 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
362 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
363 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
364 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
365 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
366 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
367 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
368 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
369 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
386 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
387 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
388 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
389 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
390 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
395 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
396 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
397 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
398 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
401 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
402 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
406 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
407 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
408 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
411 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
412 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
413 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
414 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
415 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
460 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.76
Metatranscriptomes 9.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 4.91
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1006565 3300001976 Bacteria 1520
2 Ga0007429J51699_1127926 3300003579 Bacteria 851
3 Ga0058859_11329556 3300004798 Bacteria 2153
4 Ga0058859_11779288 3300004798 Bacteria 1322
5 Ga0058863_10026251 3300004799 Bacteria 4666
6 Ga0058863_10037759 3300004799 Bacteria 1933
7 Ga0058863_10136436 3300004799 Bacteria 3029
8 Ga0058863_11884672 3300004799 Bacteria 1059
9 Ga0058861_10156011 3300004800 Bacteria 3029
10 Ga0058861_11876811 3300004800 Bacteria 774
11 Ga0058860_11957815 3300004801 Bacteria 1667
12 Ga0058860_12198664 3300004801 Bacteria 5509
13 Ga0058862_10043223 3300004803 Bacteria 1650
14 Ga0058862_10234844 3300004803 Bacteria 2529
15 Ga0058862_12696583 3300004803 Bacteria 1458
16 Ga0065712_10079443 3300005290 Bacteria 3217
17 Ga0065715_10109115 3300005293 Bacteria 2683
18 Ga0065715_10145303 3300005293 Bacteria 1797
19 Ga0065715_10280885 3300005293 Bacteria 1086
20 Ga0070658_10507017 3300005327 Bacteria 1043
21 Ga0070676_10464982 3300005328 Bacteria 892
22 Ga0070683_100009168 3300005329 Bacteria 8447
23 Ga0070683_100175744 3300005329 Bacteria 2032
24 Ga0070683_100255121 3300005329 Bacteria 1668
25 Ga0070683_100273793 3300005329 Bacteria 1606
26 Ga0070683_100383417 3300005329 Bacteria 1339
27 Ga0070683_100504504 3300005329 Bacteria 1156
28 Ga0070683_100592877 3300005329 Bacteria 1060
29 Ga0070690_100000550 3300005330 Bacteria 18744
30 Ga0070670_100025892 3300005331 Bacteria 5047
31 Ga0070670_100051413 3300005331 Bacteria 3539
32 Ga0070670_100090897 3300005331 Bacteria 2624
33 Ga0070670_101051226 3300005331 Bacteria 741
34 Ga0070677_10018326 3300005333 Bacteria 2520
35 Ga0068869_100000786 3300005334 Bacteria 18094
36 Ga0068869_100001846 3300005334 Bacteria 12731
37 Ga0068869_100029277 3300005334 Bacteria 3857
38 Ga0068869_100234042 3300005334 Bacteria 1461
39 Ga0068869_100578706 3300005334 Bacteria 946
40 Ga0068869_100669477 3300005334 Bacteria 883
41 Ga0070666_10014850 3300005335 Bacteria 4962
42 Ga0070666_10043461 3300005335 Bacteria 3009
43 Ga0070666_10415003 3300005335 Bacteria 969
44 Ga0070680_100062302 3300005336 Bacteria 3054
45 Ga0070680_100102236 3300005336 Bacteria 2380
46 Ga0070680_100206481 3300005336 Bacteria 1657
47 Ga0070680_100276198 3300005336 Bacteria 1423
48 Ga0070680_100487016 3300005336 Bacteria 1054
49 Ga0070682_100291596 3300005337 Bacteria 1193
50 Ga0070682_100311796 3300005337 Bacteria 1158
51 Ga0070682_100463268 3300005337 Bacteria 974
52 Ga0068868_100001851 3300005338 Bacteria 14530
53 Ga0068868_100006530 3300005338 Bacteria 8259
54 Ga0068868_100011852 3300005338 Bacteria 6357
55 Ga0068868_100018268 3300005338 Bacteria 5239
56 Ga0068868_100024752 3300005338 Bacteria 4557
57 Ga0068868_100034989 3300005338 Bacteria 3881
58 Ga0068868_100039004 3300005338 Bacteria 3688
59 Ga0068868_100111181 3300005338 Bacteria 2227
60 Ga0068868_100227716 3300005338 Bacteria 1563
61 Ga0070660_100002901 3300005339 Bacteria 11803
62 Ga0070660_100007894 3300005339 Bacteria 7425
63 Ga0070660_100014239 3300005339 Bacteria 5727
64 Ga0070660_100033980 3300005339 Bacteria 3849
65 Ga0070691_10280292 3300005341 Bacteria 904
66 Ga0070687_100000493 3300005343 Bacteria 13161
67 Ga0070661_100008885 3300005344 Bacteria 6954
68 Ga0070661_100095173 3300005344 Bacteria 2209
69 Ga0070661_100183186 3300005344 Bacteria 1594
70 Ga0070661_100268471 3300005344 Bacteria 1321
71 Ga0070668_100048006 3300005347 Bacteria 3283
72 Ga0070668_100114484 3300005347 Bacteria 2149
73 Ga0070668_100321191 3300005347 Bacteria 1303
74 Ga0070668_101073417 3300005347 Bacteria 726
75 Ga0070669_100028539 3300005353 Bacteria 4019
76 Ga0070669_100167037 3300005353 Bacteria 1713
77 Ga0070675_100004817 3300005354 Bacteria 10298
78 Ga0070671_100000878 3300005355 Bacteria 21966
79 Ga0070671_100041355 3300005355 Bacteria 3831
80 Ga0070671_100081485 3300005355 Bacteria 2706
81 Ga0070671_100085807 3300005355 Bacteria 2634
82 Ga0070671_100416676 3300005355 Bacteria 1150
83 Ga0070674_100202196 3300005356 Bacteria 1535
84 Ga0070673_100012689 3300005364 Bacteria 5795
85 Ga0070673_100045709 3300005364 Bacteria 3397
86 Ga0070673_100056666 3300005364 Bacteria 3093
87 Ga0070673_100113817 3300005364 Bacteria 2247
88 Ga0070688_100072267 3300005365 Bacteria 2210
89 Ga0070688_100147391 3300005365 Bacteria 1605
90 Ga0070688_100315254 3300005365 Bacteria 1135
91 Ga0070659_100050026 3300005366 Bacteria 3287
92 Ga0070659_100141282 3300005366 Bacteria 1960
93 Ga0070667_100001517 3300005367 Bacteria 20776
94 Ga0070667_100024269 3300005367 Bacteria 5036
95 Ga0070667_100042414 3300005367 Bacteria 3818
96 Ga0070667_100597629 3300005367 Bacteria 1016
97 Ga0070709_10000423 3300005434 Bacteria 25611
98 Ga0070709_10004335 3300005434 Bacteria 7645
99 Ga0070709_10010621 3300005434 Bacteria 5106
100 Ga0070709_10043831 3300005434 Bacteria 2768
101 Ga0070709_10066848 3300005434 Bacteria 2307
102 Ga0070709_10088709 3300005434 Bacteria 2035
103 Ga0070709_10141470 3300005434 Bacteria 1654
104 Ga0070709_10146282 3300005434 Bacteria 1628
105 Ga0070709_10219018 3300005434 Bacteria 1356
106 Ga0070709_10345193 3300005434 Unclassified 1098
107 Ga0070709_10846071 3300005434 Bacteria 721
108 Ga0070714_100000096 3300005435 Bacteria 74616
109 Ga0070714_100014828 3300005435 Bacteria 6265
110 Ga0070714_100021848 3300005435 Bacteria 5239
111 Ga0070714_100037410 3300005435 Bacteria 4078
112 Ga0070714_100057752 3300005435 Bacteria 3322
113 Ga0070714_100080554 3300005435 Bacteria 2833
114 Ga0070714_100081313 3300005435 Bacteria 2820
115 Ga0070714_100148852 3300005435 Bacteria 2107
116 Ga0070714_100179139 3300005435 Bacteria 1928
117 Ga0070714_100198705 3300005435 Bacteria 1833
118 Ga0070714_100224679 3300005435 Bacteria 1727
119 Ga0070714_100243208 3300005435 Bacteria 1661
120 Ga0070714_100289683 3300005435 Bacteria 1523
121 Ga0070714_100588419 3300005435 Bacteria 1068
122 Ga0070714_100767837 3300005435 Bacteria 932
123 Ga0070713_100000364 3300005436 Bacteria 29177
124 Ga0070713_100002249 3300005436 Bacteria 12530
125 Ga0070713_100005638 3300005436 Bacteria 8584
126 Ga0070713_100051909 3300005436 Bacteria 3393
127 Ga0070713_100076328 3300005436 Bacteria 2845
128 Ga0070713_100158569 3300005436 Bacteria 2018
129 Ga0070713_100176499 3300005436 Bacteria 1917
130 Ga0070713_100210876 3300005436 Bacteria 1758
131 Ga0070713_100348849 3300005436 Bacteria 1373
132 Ga0070713_100363676 3300005436 Bacteria 1345
133 Ga0070713_100419504 3300005436 Bacteria 1252
134 Ga0070713_100456638 3300005436 Bacteria 1201
135 Ga0070713_100607376 3300005436 Bacteria 1039
136 Ga0070713_100666515 3300005436 Bacteria 992
137 Ga0070713_100776000 3300005436 Unclassified 918
138 Ga0070713_101159265 3300005436 Bacteria 748
139 Ga0070713_101395016 3300005436 Bacteria 679
140 Ga0070710_10014281 3300005437 Bacteria 3996
141 Ga0070710_10025351 3300005437 Bacteria 3140
142 Ga0070710_10054554 3300005437 Bacteria 2255
143 Ga0070710_10054593 3300005437 Bacteria 2255
144 Ga0070710_10062762 3300005437 Bacteria 2121
145 Ga0070710_10164129 3300005437 Bacteria 1380
146 Ga0070710_10237332 3300005437 Bacteria 1167
147 Ga0070710_10432680 3300005437 Unclassified 888
148 Ga0070710_10467446 3300005437 Bacteria 858
149 Ga0070711_100000191 3300005439 Bacteria 32562
150 Ga0070711_100033538 3300005439 Bacteria 3418
151 Ga0070711_100037919 3300005439 Bacteria 3236
152 Ga0070711_100141157 3300005439 Bacteria 1806
153 Ga0070711_100141287 3300005439 Bacteria 1806
154 Ga0070711_100202033 3300005439 Bacteria 1534
155 Ga0070711_100234078 3300005439 Bacteria 1433
156 Ga0070711_100295255 3300005439 Bacteria 1287
157 Ga0070711_100304852 3300005439 Bacteria 1268
158 Ga0070711_100419208 3300005439 Bacteria 1090
159 Ga0070694_100032066 3300005444 Bacteria 3448
160 Ga0070694_100353900 3300005444 Bacteria 1138
161 Ga0070708_100000356 3300005445 Bacteria 34664
162 Ga0070708_100000459 3300005445 Bacteria 30632
163 Ga0070708_100005339 3300005445 Bacteria 10189
164 Ga0070708_100007485 3300005445 Bacteria 8742
165 Ga0070708_100019745 3300005445 Bacteria 5668
166 Ga0070708_100054805 3300005445 Bacteria 3543
167 Ga0070708_100127716 3300005445 Bacteria 2351
168 Ga0070708_100222333 3300005445 Bacteria 1771
169 Ga0070663_100017453 3300005455 Bacteria 4684
170 Ga0070663_100051468 3300005455 Bacteria 2934
171 Ga0070663_100072676 3300005455 Bacteria 2507
172 Ga0070678_100096152 3300005456 Bacteria 2284
173 Ga0070678_100476332 3300005456 Bacteria 1098
174 Ga0070662_100038232 3300005457 Bacteria 3408
175 Ga0070662_100098473 3300005457 Bacteria 2209
176 Ga0070662_100133595 3300005457 Bacteria 1916
177 Ga0070662_100145549 3300005457 Bacteria 1840
178 Ga0070681_10006468 3300005458 Bacteria 11407
179 Ga0070681_10008803 3300005458 Bacteria 9908
180 Ga0070681_10065771 3300005458 Bacteria 3594
181 Ga0070681_10139914 3300005458 Bacteria 2350
182 Ga0070681_10435284 3300005458 Bacteria 1223
183 Ga0070681_10484651 3300005458 Bacteria 1149
184 Ga0068867_100094506 3300005459 Bacteria 2273
185 Ga0068867_100187487 3300005459 Bacteria 1648
186 Ga0068867_100364879 3300005459 Bacteria 1209
187 Ga0068867_101074233 3300005459 Bacteria 733
188 Ga0070685_10001292 3300005466 Bacteria 13193
189 Ga0070706_100000278 3300005467 Bacteria 62365
190 Ga0070706_100000514 3300005467 Bacteria 45375
191 Ga0070706_100033341 3300005467 Bacteria 4753
192 Ga0070706_100036494 3300005467 Bacteria 4540
193 Ga0070706_100411726 3300005467 Bacteria 1259
194 Ga0070706_100421077 3300005467 Bacteria 1243
195 Ga0070707_100000662 3300005468 Bacteria 34318
196 Ga0070707_100025509 3300005468 Bacteria 5607
197 Ga0070707_100061516 3300005468 Bacteria 3601
198 Ga0070707_100086842 3300005468 Bacteria 3025
199 Ga0070707_100092839 3300005468 Bacteria 2922
200 Ga0070707_100147415 3300005468 Bacteria 2290
201 Ga0070707_100255822 3300005468 Bacteria 1704
202 Ga0070707_100258396 3300005468 Bacteria 1695
203 Ga0070707_100267256 3300005468 Bacteria 1663
204 Ga0070707_100329921 3300005468 Bacteria 1482
205 Ga0070698_100002449 3300005471 Bacteria 20472
206 Ga0070698_100004533 3300005471 Bacteria 15264
207 Ga0070698_100149049 3300005471 Bacteria 2288
208 Ga0070699_100000441 3300005518 Bacteria 39851
209 Ga0070699_100001725 3300005518 Bacteria 19935
210 Ga0070699_100003886 3300005518 Bacteria 13210
211 Ga0070699_100066299 3300005518 Bacteria 3134
212 Ga0070699_100142072 3300005518 Bacteria 2120
213 Ga0070699_100192358 3300005518 Bacteria 1813
214 Ga0070679_100022709 3300005530 Bacteria 6134
215 Ga0070679_100030101 3300005530 Bacteria 5358
216 Ga0070679_100059099 3300005530 Bacteria 3821
217 Ga0070679_100076758 3300005530 Bacteria 3329
218 Ga0070679_100077741 3300005530 Bacteria 3308
219 Ga0070679_100114378 3300005530 Bacteria 2684
220 Ga0070679_100114508 3300005530 Bacteria 2682
221 Ga0070679_100219362 3300005530 Bacteria 1863
222 Ga0070679_100316152 3300005530 Bacteria 1511
223 Ga0070679_100416649 3300005530 Bacteria 1289
224 Ga0070679_100629907 3300005530 Bacteria 1015
225 Ga0070684_100001423 3300005535 Bacteria 17232
226 Ga0070684_100014412 3300005535 Bacteria 6405
227 Ga0070684_100030620 3300005535 Bacteria 4573
228 Ga0070684_100098787 3300005535 Bacteria 2605
229 Ga0070684_100126487 3300005535 Bacteria 2302
230 Ga0070684_100134212 3300005535 Bacteria 2235
231 Ga0070684_100221867 3300005535 Bacteria 1724
232 Ga0070684_100280465 3300005535 Bacteria 1527
233 Ga0070684_100561092 3300005535 Bacteria 1060
234 Ga0070684_101046066 3300005535 Bacteria 767
235 Ga0070684_101083870 3300005535 Bacteria 752
236 Ga0070697_100000975 3300005536 Bacteria 21592
237 Ga0070697_100000993 3300005536 Bacteria 21455
238 Ga0070697_100001451 3300005536 Bacteria 18044
239 Ga0070697_100003489 3300005536 Bacteria 12085
240 Ga0070697_100061836 3300005536 Bacteria 3054
241 Ga0070697_100062370 3300005536 Bacteria 3042
242 Ga0070697_100074825 3300005536 Bacteria 2783
243 Ga0070697_100081447 3300005536 Bacteria 2667
244 Ga0070697_100271127 3300005536 Bacteria 1455
245 Ga0070697_100357892 3300005536 Unclassified 1261
246 Ga0070697_100709895 3300005536 Bacteria 887
247 Ga0070697_101174357 3300005536 Bacteria 684
248 Ga0068853_100001096 3300005539 Bacteria 19171
249 Ga0068853_100138867 3300005539 Bacteria 2181
250 Ga0068853_100190031 3300005539 Bacteria 1865
251 Ga0068853_100271338 3300005539 Bacteria 1562
252 Ga0068853_100393457 3300005539 Bacteria 1296
253 Ga0068853_101172338 3300005539 Bacteria 741
254 Ga0068853_101193933 3300005539 Bacteria 734
255 Ga0068853_101271405 3300005539 Bacteria 711
256 Ga0070672_100008157 3300005543 Bacteria 7159
257 Ga0070672_100008480 3300005543 Bacteria 7034
258 Ga0070686_100082005 3300005544 Bacteria 2138
259 Ga0070686_100306801 3300005544 Bacteria 1179
260 Ga0070695_100065143 3300005545 Bacteria 2372
261 Ga0070695_100338990 3300005545 Bacteria 1123
262 Ga0070696_100046425 3300005546 Bacteria 3012
263 Ga0070696_100068936 3300005546 Bacteria 2484
264 Ga0070696_100315666 3300005546 Bacteria 1201
265 Ga0070696_100386570 3300005546 Bacteria 1092
266 Ga0070696_100489663 3300005546 Bacteria 976
267 Ga0070693_100060801 3300005547 Bacteria 2194
268 Ga0070693_100068524 3300005547 Bacteria 2083
269 Ga0070693_100219415 3300005547 Bacteria 1245
270 Ga0070693_100265393 3300005547 Bacteria 1144
271 Ga0070693_100274365 3300005547 Bacteria 1127
272 Ga0070693_100274903 3300005547 Bacteria 1126
273 Ga0070693_100525745 3300005547 Bacteria 843
274 Ga0070665_100013944 3300005548 Bacteria 8083
275 Ga0070665_100046727 3300005548 Bacteria 4347
276 Ga0070665_100116012 3300005548 Bacteria 2680
277 Ga0070665_100376988 3300005548 Bacteria 1426
278 Ga0070665_101320812 3300005548 Bacteria 731
279 Ga0070704_100085415 3300005549 Bacteria 2336
280 Ga0070704_100275399 3300005549 Bacteria 1392
281 Ga0068855_100000642 3300005563 Bacteria 42759
282 Ga0068855_100005786 3300005563 Bacteria 15090
283 Ga0068855_100029511 3300005563 Bacteria 6555
284 Ga0068855_100066606 3300005563 Bacteria 4199
285 Ga0068855_100086489 3300005563 Bacteria 3625
286 Ga0068855_100094033 3300005563 Bacteria 3457
287 Ga0068855_100095343 3300005563 Bacteria 3429
288 Ga0068855_100516497 3300005563 Bacteria 1296
289 Ga0068855_101374420 3300005563 Bacteria 729
290 Ga0070664_100000277 3300005564 Bacteria 36913
291 Ga0070664_100249745 3300005564 Bacteria 1594
292 Ga0070664_100821593 3300005564 Bacteria 870
293 Ga0070664_100919153 3300005564 Bacteria 821
294 Ga0068857_100001133 3300005577 Bacteria 20806
295 Ga0068857_100011854 3300005577 Bacteria 7583
296 Ga0068857_100034150 3300005577 Bacteria 4500
297 Ga0068857_100249031 3300005577 Bacteria 1628
298 Ga0068857_100310024 3300005577 Bacteria 1456
299 Ga0068857_100326003 3300005577 Bacteria 1419
300 Ga0068854_100008133 3300005578 Bacteria 6729
301 Ga0068854_100017433 3300005578 Bacteria 4805
302 Ga0068854_100028405 3300005578 Bacteria 3865
303 Ga0068854_100133495 3300005578 Bacteria 1898
304 Ga0068854_100218517 3300005578 Bacteria 1507
305 Ga0068856_100005788 3300005614 Bacteria 12182
306 Ga0068856_100007334 3300005614 Bacteria 10763
307 Ga0068856_100010756 3300005614 Bacteria 8887
308 Ga0068856_100011162 3300005614 Bacteria 8722
309 Ga0068856_100018752 3300005614 Bacteria 6708
310 Ga0068856_100020373 3300005614 Bacteria 6441
311 Ga0068856_100025039 3300005614 Bacteria 5816
312 Ga0068856_100025115 3300005614 Bacteria 5806
313 Ga0068856_100033208 3300005614 Bacteria 5052
314 Ga0068856_100033324 3300005614 Bacteria 5043
315 Ga0068856_100034006 3300005614 Bacteria 4992
316 Ga0068856_100087027 3300005614 Bacteria 3105
317 Ga0068856_100182596 3300005614 Bacteria 2111
318 Ga0068856_100464533 3300005614 Bacteria 1286
319 Ga0070702_100265378 3300005615 Bacteria 1171
320 Ga0068852_100001223 3300005616 Bacteria 17089
321 Ga0068852_100002255 3300005616 Bacteria 13232
322 Ga0068852_100041582 3300005616 Bacteria 3885
323 Ga0068852_100053384 3300005616 Bacteria 3478
324 Ga0068852_100075268 3300005616 Bacteria 2977
325 Ga0068852_100135848 3300005616 Bacteria 2270
326 Ga0068852_100239401 3300005616 Bacteria 1733
327 Ga0068852_100314255 3300005616 Bacteria 1520
328 Ga0068859_100010766 3300005617 Bacteria 9204
329 Ga0068859_100013371 3300005617 Bacteria 8230
330 Ga0068859_100017062 3300005617 Bacteria 7289
331 Ga0068859_100187418 3300005617 Bacteria 2153
332 Ga0068859_100337051 3300005617 Bacteria 1602
333 Ga0068864_100011128 3300005618 Bacteria 7437
334 Ga0068864_100022766 3300005618 Bacteria 5254
335 Ga0068864_100026700 3300005618 Bacteria 4870
336 Ga0068864_100062310 3300005618 Bacteria 3231
337 Ga0068864_100260077 3300005618 Bacteria 1614
338 Ga0068866_10001380 3300005718 Bacteria 10468
339 Ga0068866_10180162 3300005718 Bacteria 1247
340 Ga0068861_100029913 3300005719 Bacteria 3988
341 Ga0068861_100248552 3300005719 Bacteria 1516
342 Ga0068851_10013389 3300005834 Bacteria 3882
343 Ga0068851_10031925 3300005834 Bacteria 2619
344 Ga0068851_10055900 3300005834 Bacteria 2012
345 Ga0068851_10147786 3300005834 Bacteria 1282
346 Ga0068851_10299313 3300005834 Bacteria 924
347 Ga0068851_10503421 3300005834 Bacteria 727
348 Ga0068870_10011259 3300005840 Bacteria 4140
349 Ga0068863_100044079 3300005841 Bacteria 4235
350 Ga0068863_100065291 3300005841 Bacteria 3443
351 Ga0068863_100168315 3300005841 Bacteria 2102
352 Ga0068863_100173415 3300005841 Bacteria 2069
353 Ga0068863_100400114 3300005841 Bacteria 1343
354 Ga0068863_100991680 3300005841 Bacteria 842
355 Ga0068858_100004747 3300005842 Bacteria 13308
356 Ga0068858_100020862 3300005842 Bacteria 6124
357 Ga0068858_100031378 3300005842 Bacteria 4935
358 Ga0068858_100047535 3300005842 Bacteria 3977
359 Ga0068858_100099222 3300005842 Bacteria 2715
360 Ga0068858_100129796 3300005842 Bacteria 2362
361 Ga0068858_100212871 3300005842 Bacteria 1829
362 Ga0068858_100375689 3300005842 Bacteria 1363
363 Ga0068858_100423949 3300005842 Bacteria 1280
364 Ga0068858_100462159 3300005842 Bacteria 1224
365 Ga0068860_100000786 3300005843 Bacteria 35473
366 Ga0068860_100025252 3300005843 Bacteria 5734
367 Ga0068860_100052099 3300005843 Bacteria 3893
368 Ga0068860_100056753 3300005843 Bacteria 3721
369 Ga0068860_100342535 3300005843 Bacteria 1470
370 Ga0068860_100713800 3300005843 Bacteria 1013
371 Ga0068860_100956822 3300005843 Bacteria 873
372 Ga0068862_100013382 3300005844 Bacteria 6789
373 Ga0068862_100136758 3300005844 Bacteria 2172
374 Ga0081455_10171735 3300005937 Bacteria 1651
375 Ga0070717_10002614 3300006028 Bacteria 12700
376 Ga0070717_10006374 3300006028 Bacteria 8673
377 Ga0070717_10012892 3300006028 Bacteria 6384
378 Ga0070717_10022846 3300006028 Bacteria 4948
379 Ga0070717_10028717 3300006028 Bacteria 4455
380 Ga0070717_10068777 3300006028 Bacteria 2947
381 Ga0070717_10091046 3300006028 Bacteria 2575
382 Ga0070717_10093917 3300006028 Bacteria 2537
383 Ga0070717_10111819 3300006028 Bacteria 2331
384 Ga0070717_10115860 3300006028 Bacteria 2290
385 Ga0070717_10191253 3300006028 Bacteria 1788
386 Ga0070717_10196565 3300006028 Bacteria 1764
387 Ga0070717_10210607 3300006028 Bacteria 1706
388 Ga0070717_10236166 3300006028 Bacteria 1611
389 Ga0070717_10319884 3300006028 Bacteria 1382
390 Ga0070717_10413574 3300006028 Bacteria 1213
391 Ga0070717_10435272 3300006028 Bacteria 1181
392 Ga0070717_10520629 3300006028 Bacteria 1076
393 Ga0070717_10536022 3300006028 Bacteria 1060
394 Ga0070717_10550464 3300006028 Bacteria 1045
395 Ga0075432_10027314 3300006058 Bacteria 1964
396 Ga0070715_10036552 3300006163 Bacteria 2027
397 Ga0070715_10093903 3300006163 Bacteria 1386
398 Ga0070715_10348626 3300006163 Bacteria 808
399 Ga0070716_100005801 3300006173 Bacteria 5997
400 Ga0070716_100005841 3300006173 Bacteria 5980
401 Ga0070716_100007139 3300006173 Bacteria 5488
402 Ga0070716_100016153 3300006173 Bacteria 3848
403 Ga0070716_100023979 3300006173 Bacteria 3243
404 Ga0070716_100040702 3300006173 Bacteria 2586
405 Ga0070716_100134745 3300006173 Bacteria 1566
406 Ga0070716_100175840 3300006173 Bacteria 1401
407 Ga0070716_100185500 3300006173 Bacteria 1370
408 Ga0070716_100377264 3300006173 Unclassified 1012
409 Ga0070712_100000593 3300006175 Bacteria 21160
410 Ga0070712_100001135 3300006175 Bacteria 16046
411 Ga0070712_100003022 3300006175 Bacteria 10410
412 Ga0070712_100004622 3300006175 Bacteria 8508
413 Ga0070712_100008275 3300006175 Bacteria 6534
414 Ga0070712_100042553 3300006175 Bacteria 3124
415 Ga0070712_100068183 3300006175 Bacteria 2534
416 Ga0070712_100291745 3300006175 Bacteria 1317
417 Ga0070712_100359724 3300006175 Bacteria 1193
418 Ga0070712_100617380 3300006175 Bacteria 919
419 Ga0070712_100693817 3300006175 Bacteria 867
420 Ga0070712_100872571 3300006175 Bacteria 775
421 Ga0097621_100003318 3300006237 Bacteria 11074
422 Ga0097621_100017658 3300006237 Bacteria 5425
423 Ga0097621_100046566 3300006237 Bacteria 3510
424 Ga0097621_100061733 3300006237 Bacteria 3074
425 Ga0097621_100092213 3300006237 Bacteria 2537
426 Ga0097621_100108499 3300006237 Bacteria 2343
427 Ga0097621_100140476 3300006237 Bacteria 2063
428 Ga0097621_100309240 3300006237 Bacteria 1398
429 Ga0068871_100001396 3300006358 Bacteria 16168
430 Ga0068871_100015915 3300006358 Bacteria 5648
431 Ga0068871_100022802 3300006358 Bacteria 4833
432 Ga0068871_100026575 3300006358 Bacteria 4518
433 Ga0068871_100126504 3300006358 Bacteria 2163
434 Ga0068871_100256717 3300006358 Bacteria 1524
435 Ga0068871_100527541 3300006358 Bacteria 1067
436 Ga0068871_101034499 3300006358 Bacteria 766
437 Ga0075428_100009444 3300006844 Bacteria 10826
438 Ga0075428_100253498 3300006844 Bacteria 1896
439 Ga0075430_100001741 3300006846 Bacteria 17785
440 Ga0075430_100008055 3300006846 Bacteria 8907
441 Ga0075430_100197694 3300006846 Bacteria 1670
442 Ga0075431_100012805 3300006847 Bacteria 8468
443 Ga0075431_100037006 3300006847 Bacteria 5027
444 Ga0075431_100576231 3300006847 Bacteria 1111
445 Ga0075433_10002887 3300006852 Bacteria 13175
446 Ga0075433_10019501 3300006852 Bacteria 5653
447 Ga0075433_10030331 3300006852 Bacteria 4613
448 Ga0075433_10339870 3300006852 Bacteria 1327
449 Ga0075434_100000230 3300006871 Bacteria 38508
450 Ga0075434_100005131 3300006871 Bacteria 11896
451 Ga0075434_100024374 3300006871 Bacteria 5914
452 Ga0075434_100068934 3300006871 Bacteria 3525
453 Ga0075429_100002293 3300006880 Bacteria 16053
454 Ga0075429_100012040 3300006880 Bacteria 7496
455 Ga0075429_100031807 3300006880 Bacteria 4586
456 Ga0068865_100006206 3300006881 Bacteria 7284
457 Ga0068865_100050410 3300006881 Bacteria 2875
458 Ga0068865_100092303 3300006881 Bacteria 2199
459 Ga0068865_100093232 3300006881 Bacteria 2189
460 Ga0068865_100477967 3300006881 Bacteria 1035
461 Ga0068865_100647073 3300006881 Bacteria 898
462 Ga0075436_100000510 3300006914 Bacteria 25141
463 Ga0075436_100002324 3300006914 Bacteria 13122
464 Ga0075436_100012852 3300006914 Bacteria 5738
465 Ga0075436_100013001 3300006914 Bacteria 5707
466 Ga0075436_100524003 3300006914 Bacteria 868
467 Ga0097620_100010766 3300006931 Bacteria 9204
468 Ga0097620_100013371 3300006931 Bacteria 8230
469 Ga0097620_100017062 3300006931 Bacteria 7289
470 Ga0097620_100187419 3300006931 Bacteria 2153
471 Ga0097620_100337066 3300006931 Bacteria 1602
472 Ga0075435_100000389 3300007076 Bacteria 26853
473 Ga0075435_100083489 3300007076 Bacteria 2627
474 Ga0075435_100150546 3300007076 Bacteria 1956
475 Ga0075435_100218018 3300007076 Bacteria 1620
476 Ga0075435_100228678 3300007076 Unclassified 1580
477 Ga0099794_10041745 3300007265 Bacteria 2185
478 Ga0099794_10053309 3300007265 Bacteria 1950
479 Ga0099794_10369028 3300007265 Bacteria 748
480 Ga0099795_10060382 3300007788 Bacteria 1405
481 Ga0105240_10000267 3300009093 Bacteria 103103
482 Ga0105240_10001326 3300009093 Bacteria 42653
483 Ga0105240_10029138 3300009093 Bacteria 7199
484 Ga0105240_10030655 3300009093 Bacteria 6986
485 Ga0105240_10032052 3300009093 Bacteria 6806
486 Ga0105240_10035826 3300009093 Bacteria 6391
487 Ga0105240_10037261 3300009093 Bacteria 6251
488 Ga0105240_10044876 3300009093 Bacteria 5611
489 Ga0105240_10108134 3300009093 Bacteria 3370
490 Ga0105240_10110548 3300009093 Bacteria 3326
491 Ga0105240_10186196 3300009093 Bacteria 2445
492 Ga0105240_10193853 3300009093 Bacteria 2387
493 Ga0105240_10228278 3300009093 Bacteria 2165
494 Ga0105240_10274537 3300009093 Bacteria 1940
495 Ga0105240_10286869 3300009093 Bacteria 1889
496 Ga0105240_10535919 3300009093 Bacteria 1297
497 Ga0105240_10809886 3300009093 Unclassified 1014
498 Ga0105240_10906619 3300009093 Bacteria 948
499 Ga0105240_10982463 3300009093 Bacteria 904
500 Ga0105245_10005029 3300009098 Bacteria 11625
501 Ga0105245_10005238 3300009098 Bacteria 11396
502 Ga0105245_10006634 3300009098 Bacteria 10163
503 Ga0105245_10082389 3300009098 Bacteria 2943
504 Ga0105245_10123823 3300009098 Bacteria 2417
505 Ga0105245_10127154 3300009098 Bacteria 2387
506 Ga0105245_10202184 3300009098 Bacteria 1908
507 Ga0105245_10275536 3300009098 Bacteria 1642
508 Ga0105245_10608389 3300009098 Bacteria 1120
509 Ga0105245_11513123 3300009098 Bacteria 722
510 Ga0105247_10002611 3300009101 Bacteria 12168
511 Ga0105247_10099547 3300009101 Bacteria 1857
512 Ga0105247_10229429 3300009101 Bacteria 1260
513 Ga0105247_10469254 3300009101 Bacteria 911
514 Ga0114129_10003653 3300009147 Bacteria 21641
515 Ga0114129_10030197 3300009147 Bacteria 7676
516 Ga0114129_10095676 3300009147 Bacteria 4113
517 Ga0114129_10115757 3300009147 Bacteria 3695
518 Ga0114129_10208126 3300009147 Bacteria 2646
519 Ga0114129_10549684 3300009147 Bacteria 1502
520 Ga0114129_10656566 3300009147 Bacteria 1353
521 Ga0105243_10017394 3300009148 Bacteria 5435
522 Ga0105243_10496459 3300009148 Bacteria 1155
523 Ga0105243_10702039 3300009148 Bacteria 986
524 Ga0105241_10000142 3300009174 Bacteria 50927
525 Ga0105241_10002253 3300009174 Bacteria 14494
526 Ga0105241_10050555 3300009174 Bacteria 3169
527 Ga0105241_10063724 3300009174 Bacteria 2845
528 Ga0105241_10071880 3300009174 Bacteria 2687
529 Ga0105241_10088787 3300009174 Bacteria 2435
530 Ga0105241_10169237 3300009174 Bacteria 1803
531 Ga0105241_10294305 3300009174 Bacteria 1391
532 Ga0105241_10548892 3300009174 Bacteria 1037
533 Ga0105242_10021257 3300009176 Bacteria 5092
534 Ga0105242_10133023 3300009176 Bacteria 2149
535 Ga0105248_10011815 3300009177 Bacteria 9632
536 Ga0105248_10013851 3300009177 Bacteria 8872
537 Ga0105248_10036545 3300009177 Bacteria 5494
538 Ga0105248_10092108 3300009177 Bacteria 3413
539 Ga0105248_10103405 3300009177 Bacteria 3211
540 Ga0105248_10252963 3300009177 Bacteria 1983
541 Ga0105248_10577948 3300009177 Bacteria 1268
542 Ga0105237_10017228 3300009545 Bacteria 7494
543 Ga0105237_10040500 3300009545 Bacteria 4698
544 Ga0105237_10047915 3300009545 Bacteria 4297
545 Ga0105237_10048898 3300009545 Bacteria 4251
546 Ga0105237_10055094 3300009545 Bacteria 3983
547 Ga0105237_10105889 3300009545 Bacteria 2804
548 Ga0105237_10174065 3300009545 Bacteria 2153
549 Ga0105237_10248723 3300009545 Bacteria 1780
550 Ga0105237_10325463 3300009545 Bacteria 1541
551 Ga0105237_10361985 3300009545 Bacteria 1455
552 Ga0105237_10558148 3300009545 Unclassified 1152
553 Ga0105237_10777535 3300009545 Unclassified 964
554 Ga0105238_10000504 3300009551 Bacteria 41099
555 Ga0105238_10000635 3300009551 Bacteria 37013
556 Ga0105238_10004639 3300009551 Bacteria 13603
557 Ga0105238_10005646 3300009551 Bacteria 12367
558 Ga0105238_10022135 3300009551 Bacteria 6482
559 Ga0105238_10046166 3300009551 Bacteria 4397
560 Ga0105238_10108840 3300009551 Bacteria 2752
561 Ga0105238_10118790 3300009551 Bacteria 2624
562 Ga0105238_10178796 3300009551 Bacteria 2098
563 Ga0105238_10265310 3300009551 Bacteria 1697
564 Ga0105238_10355278 3300009551 Bacteria 1454
565 Ga0105249_10104557 3300009553 Bacteria 2668
566 Ga0105239_10002713 3300010375 Bacteria 22271
567 Ga0105239_10015584 3300010375 Bacteria 8418
568 Ga0105239_10058062 3300010375 Bacteria 4245
569 Ga0105239_10063760 3300010375 Bacteria 4045
570 Ga0105239_10069658 3300010375 Bacteria 3864
571 Ga0105239_10094486 3300010375 Bacteria 3302
572 Ga0105239_10103049 3300010375 Bacteria 3158
573 Ga0105239_10142903 3300010375 Bacteria 2668
574 Ga0105239_10234246 3300010375 Bacteria 2060
575 Ga0105239_10381887 3300010375 Bacteria 1593
576 Ga0105239_10681055 3300010375 Bacteria 1175
577 Ga0105239_11744843 3300010375 Unclassified 721
578 Ga0105246_10032679 3300011119 Bacteria 3452
579 Ga0105246_10146659 3300011119 Bacteria 1781
580 Ga0105246_10366230 3300011119 Bacteria 1186
581 Ga0157373_10001758 3300013100 Bacteria 16488
582 Ga0157373_10001852 3300013100 Bacteria 16057
583 Ga0157373_10034685 3300013100 Bacteria 3624
584 Ga0157373_10060289 3300013100 Bacteria 2689
585 Ga0157373_10689093 3300013100 Bacteria 748
586 Ga0157371_10002134 3300013102 Bacteria 19252
587 Ga0157371_10016410 3300013102 Bacteria 5528
588 Ga0157371_10185418 3300013102 Bacteria 1489
589 Ga0157371_10192378 3300013102 Bacteria 1461
590 Ga0157370_10511649 3300013104 Bacteria 1102
591 Ga0157370_10566708 3300013104 Bacteria 1041
592 Ga0157369_10020480 3300013105 Bacteria 7394
593 Ga0157369_10024038 3300013105 Bacteria 6781
594 Ga0157369_10030317 3300013105 Bacteria 5966
595 Ga0157369_10046224 3300013105 Bacteria 4732
596 Ga0157369_10050004 3300013105 Bacteria 4530
597 Ga0157369_10082161 3300013105 Bacteria 3447
598 Ga0157369_10089388 3300013105 Bacteria 3288
599 Ga0157369_10213461 3300013105 Bacteria 2022
600 Ga0157369_10248395 3300013105 Bacteria 1857
601 Ga0157369_10252078 3300013105 Bacteria 1842
602 Ga0157369_10286053 3300013105 Bacteria 1717
603 Ga0157369_10316132 3300013105 Bacteria 1624
604 Ga0157369_10530669 3300013105 Bacteria 1217
605 Ga0157369_10574087 3300013105 Bacteria 1165
606 Ga0157369_11375361 3300013105 Bacteria 719
607 Ga0157374_10000588 3300013296 Bacteria 32111
608 Ga0157374_10013096 3300013296 Bacteria 7233
609 Ga0157374_10014284 3300013296 Bacteria 6947
610 Ga0157374_10016183 3300013296 Bacteria 6553
611 Ga0157374_10039283 3300013296 Bacteria 4356
612 Ga0157374_10053416 3300013296 Bacteria 3767
613 Ga0157374_10077388 3300013296 Bacteria 3148
614 Ga0157374_10153758 3300013296 Bacteria 2238
615 Ga0157374_10158462 3300013296 Bacteria 2204
616 Ga0157374_10161972 3300013296 Bacteria 2179
617 Ga0157374_10211641 3300013296 Bacteria 1901
618 Ga0157374_10763682 3300013296 Bacteria 982
619 Ga0157374_10795954 3300013296 Bacteria 961
620 Ga0157378_10000411 3300013297 Bacteria 42281
621 Ga0157378_10000516 3300013297 Bacteria 36737
622 Ga0157378_10000641 3300013297 Bacteria 32867
623 Ga0157378_10011996 3300013297 Bacteria 7587
624 Ga0157378_10023476 3300013297 Bacteria 5427
625 Ga0157378_10026937 3300013297 Bacteria 5070
626 Ga0157378_10044668 3300013297 Bacteria 3935
627 Ga0157378_10110687 3300013297 Bacteria 2517
628 Ga0157378_10116780 3300013297 Bacteria 2454
629 Ga0157378_10181281 3300013297 Bacteria 1981
630 Ga0157378_10569332 3300013297 Bacteria 1141
631 Ga0157378_10746532 3300013297 Bacteria 1001
632 Ga0163162_10010248 3300013306 Bacteria 9105
633 Ga0163162_10020357 3300013306 Bacteria 6517
634 Ga0163162_10065584 3300013306 Bacteria 3678
635 Ga0163162_10068979 3300013306 Bacteria 3587
636 Ga0163162_10082691 3300013306 Bacteria 3283
637 Ga0163162_10093076 3300013306 Bacteria 3098
638 Ga0163162_10298543 3300013306 Bacteria 1743
639 Ga0163162_10507438 3300013306 Bacteria 1336
640 Ga0163162_11072695 3300013306 Bacteria 912
641 Ga0163162_11682594 3300013306 Bacteria 724
642 Ga0157372_10002154 3300013307 Bacteria 21421
643 Ga0157372_10007931 3300013307 Bacteria 11286
644 Ga0157372_10009293 3300013307 Bacteria 10457
645 Ga0157372_10014586 3300013307 Bacteria 8406
646 Ga0157372_10016043 3300013307 Bacteria 8034
647 Ga0157372_10029430 3300013307 Bacteria 5997
648 Ga0157372_10040143 3300013307 Bacteria 5167
649 Ga0157372_10087746 3300013307 Bacteria 3530
650 Ga0157372_10089943 3300013307 Bacteria 3489
651 Ga0157372_10099232 3300013307 Bacteria 3322
652 Ga0157372_10115083 3300013307 Bacteria 3083
653 Ga0157372_10116657 3300013307 Bacteria 3061
654 Ga0157372_10145131 3300013307 Bacteria 2737
655 Ga0157372_10176626 3300013307 Bacteria 2472
656 Ga0157372_10179706 3300013307 Bacteria 2449
657 Ga0157372_10187665 3300013307 Bacteria 2394
658 Ga0157372_10197066 3300013307 Bacteria 2333
659 Ga0157372_10213851 3300013307 Bacteria 2234
660 Ga0157372_10236271 3300013307 Bacteria 2120
661 Ga0157372_10239052 3300013307 Bacteria 2107
662 Ga0157372_10281682 3300013307 Bacteria 1933
663 Ga0157372_10303131 3300013307 Bacteria 1859
664 Ga0157375_10012757 3300013308 Bacteria 7460
665 Ga0157375_10118645 3300013308 Bacteria 2752
666 Ga0157375_10466818 3300013308 Bacteria 1428
667 Ga0163163_10000795 3300014325 Bacteria 26725
668 Ga0163163_10001073 3300014325 Bacteria 23224
669 Ga0163163_10016389 3300014325 Bacteria 6885
670 Ga0163163_10027872 3300014325 Bacteria 5416
671 Ga0163163_10038186 3300014325 Bacteria 4677
672 Ga0163163_10063924 3300014325 Bacteria 3651
673 Ga0163163_10238385 3300014325 Bacteria 1868
674 Ga0163163_10586403 3300014325 Bacteria 1178
675 Ga0163163_11362196 3300014325 Bacteria 771
676 Ga0157380_10081804 3300014326 Bacteria 2642
677 Ga0157380_11435351 3300014326 Bacteria 741
678 Ga0182008_10004904 3300014497 Bacteria 7714
679 Ga0182008_10009078 3300014497 Bacteria 5384
680 Ga0182008_10213325 3300014497 Bacteria 986
681 Ga0157377_10025960 3300014745 Bacteria 3129
682 Ga0157377_10107059 3300014745 Bacteria 1675
683 Ga0157377_10293428 3300014745 Bacteria 1070
684 Ga0157379_10000770 3300014968 Bacteria 26006
685 Ga0157379_10005366 3300014968 Bacteria 11017
686 Ga0157379_10033657 3300014968 Bacteria 4570
687 Ga0157379_10320419 3300014968 Bacteria 1415
688 Ga0157379_10787096 3300014968 Bacteria 897
689 Ga0157376_10103085 3300014969 Bacteria 2497
690 Ga0157376_10103087 3300014969 Bacteria 2497
691 Ga0157376_10166124 3300014969 Bacteria 2005
692 Ga0157376_10327637 3300014969 Bacteria 1458
693 Ga0157376_10528204 3300014969 Bacteria 1164
694 Ga0157376_10595023 3300014969 Bacteria 1100
695 Ga0182007_10006522 3300015262 Bacteria 5005
696 Ga0182007_10012624 3300015262 Bacteria 3243
697 Ga0182007_10020865 3300015262 Bacteria 2334
698 Ga0182005_1024393 3300015265 Bacteria 1652
699 Ga0163161_10005915 3300017792 Bacteria 8481
700 Ga0163161_10059520 3300017792 Bacteria 2778
701 Ga0184602_126656 3300019161 Bacteria 1312
702 Ga0184593_104762 3300019179 Bacteria 689
703 Ga0184598_110756 3300019182 Bacteria 1812
704 Ga0184598_116461 3300019182 Bacteria 1226
705 Ga0184598_118549 3300019182 Bacteria 1673
706 Ga0184598_124195 3300019182 Bacteria 1186
707 Ga0184601_100499 3300019183 Bacteria 1208
708 Ga0184601_114868 3300019183 Bacteria 2285
709 Ga0184601_129479 3300019183 Bacteria 1964
710 Ga0184601_131050 3300019183 Bacteria 2552
711 Ga0184599_124137 3300019188 Bacteria 4861
712 Ga0184600_109839 3300019190 Bacteria 3312
713 Ga0197907_10507665 3300020069 Bacteria 3938
714 Ga0197907_11019727 3300020069 Bacteria 847
715 Ga0206356_10566607 3300020070 Bacteria 1367
716 Ga0206356_10871175 3300020070 Bacteria 978
717 Ga0206356_11407138 3300020070 Bacteria 1433
718 Ga0206356_11492308 3300020070 Bacteria 981
719 Ga0206351_10077883 3300020077 Bacteria 2631
720 Ga0206352_10151154 3300020078 Bacteria 1311
721 Ga0206352_10944950 3300020078 Bacteria 1707
722 Ga0206350_10413921 3300020080 Bacteria 3301
723 Ga0206350_11158700 3300020080 Bacteria 3752
724 Ga0206354_11048501 3300020081 Bacteria 1374
725 Ga0206353_11628862 3300020082 Bacteria 1108
726 Ga0213873_10034791 3300021358 Bacteria 1271
727 Ga0213872_10002420 3300021361 Bacteria 10996
728 Ga0213872_10002663 3300021361 Bacteria 10341
729 Ga0213872_10010393 3300021361 Bacteria 4433
730 Ga0213872_10155277 3300021361 Bacteria 998
731 Ga0213874_10006467 3300021377 Bacteria 2773
732 Ga0213874_10013462 3300021377 Bacteria 2120
733 Ga0213871_10000310 3300021441 Bacteria 6178
734 Ga0224712_10007954 3300022467 Bacteria 3111
735 Ga0224712_10013443 3300022467 Bacteria 2607
736 Ga0224712_10091314 3300022467 Bacteria 1276
737 Ga0224712_10133673 3300022467 Bacteria 1085
738 Ga0224569_102106 3300022732 Bacteria 1645
739 Ga0224571_100071 3300022734 Bacteria 3739
740 Ga0247554_100866 3300023547 Bacteria 958
741 Ga0247553_100035 3300023672 Bacteria 3273
742 Ga0247553_101154 3300023672 Bacteria 1095
743 Ga0224572_1001037 3300024225 Bacteria 3865
744 Ga0224572_1016073 3300024225 Bacteria 1434
745 Ga0224572_1058653 3300024225 Unclassified 714
746 Ga0228598_1000213 3300024227 Bacteria 10848
747 Ga0228598_1001862 3300024227 Bacteria 4590
748 Ga0228598_1011503 3300024227 Bacteria 1761
749 Ga0207697_10002087 3300025315 Bacteria 10514
750 Ga0207656_10007877 3300025321 Bacteria 3901
751 Ga0207656_10016605 3300025321 Bacteria 2869
752 Ga0207656_10074907 3300025321 Bacteria 1511
753 Ga0207682_10040680 3300025893 Bacteria 1895
754 Ga0207682_10365728 3300025893 Bacteria 680
755 Ga0207692_10005801 3300025898 Bacteria 4973
756 Ga0207692_10006388 3300025898 Bacteria 4778
757 Ga0207692_10038102 3300025898 Bacteria 2356
758 Ga0207692_10067935 3300025898 Bacteria 1867
759 Ga0207692_10223862 3300025898 Bacteria 1116
760 Ga0207692_10233067 3300025898 Bacteria 1096
761 Ga0207692_10236339 3300025898 Bacteria 1090
762 Ga0207692_10346364 3300025898 Bacteria 915
763 Ga0207642_10011302 3300025899 Bacteria 3178
764 Ga0207710_10004826 3300025900 Bacteria 5849
765 Ga0207710_10224442 3300025900 Bacteria 934
766 Ga0207688_10005204 3300025901 Bacteria 7069
767 Ga0207680_10154851 3300025903 Bacteria 1531
768 Ga0207680_10557613 3300025903 Bacteria 818
769 Ga0207647_10005658 3300025904 Bacteria 9129
770 Ga0207647_10006875 3300025904 Bacteria 8248
771 Ga0207647_10012233 3300025904 Bacteria 5980
772 Ga0207647_10019145 3300025904 Bacteria 4608
773 Ga0207647_10255127 3300025904 Bacteria 1005
774 Ga0207685_10111598 3300025905 Bacteria 1186
775 Ga0207685_10242992 3300025905 Bacteria 867
776 Ga0207699_10002321 3300025906 Bacteria 8995
777 Ga0207699_10005640 3300025906 Bacteria 6007
778 Ga0207699_10032560 3300025906 Bacteria 2938
779 Ga0207699_10086087 3300025906 Bacteria 1962
780 Ga0207699_10090641 3300025906 Bacteria 1918
781 Ga0207699_10147272 3300025906 Bacteria 1554
782 Ga0207699_10185910 3300025906 Bacteria 1399
783 Ga0207699_10219035 3300025906 Bacteria 1298
784 Ga0207699_10426609 3300025906 Bacteria 948
785 Ga0207699_10430005 3300025906 Bacteria 944
786 Ga0207699_10568172 3300025906 Bacteria 824
787 Ga0207645_10001180 3300025907 Bacteria 21585
788 Ga0207645_10004038 3300025907 Bacteria 10936
789 Ga0207645_10049336 3300025907 Bacteria 2688
790 Ga0207645_10297681 3300025907 Bacteria 1074
791 Ga0207643_10001067 3300025908 Bacteria 16207
792 Ga0207705_10072541 3300025909 Bacteria 2497
793 Ga0207705_10074091 3300025909 Bacteria 2471
794 Ga0207705_10115147 3300025909 Bacteria 1989
795 Ga0207705_10187860 3300025909 Bacteria 1561
796 Ga0207684_10000614 3300025910 Bacteria 42486
797 Ga0207684_10001048 3300025910 Bacteria 30878
798 Ga0207684_10011624 3300025910 Bacteria 7688
799 Ga0207684_10044528 3300025910 Bacteria 3764
800 Ga0207684_10182766 3300025910 Bacteria 1808
801 Ga0207684_10193252 3300025910 Bacteria 1755
802 Ga0207684_10265248 3300025910 Bacteria 1482
803 Ga0207684_10282072 3300025910 Bacteria 1432
804 Ga0207654_10000027 3300025911 Bacteria 132519
805 Ga0207654_10000457 3300025911 Bacteria 23301
806 Ga0207654_10021637 3300025911 Bacteria 3422
807 Ga0207654_10078455 3300025911 Bacteria 1981
808 Ga0207654_10231921 3300025911 Bacteria 1230
809 Ga0207654_10379643 3300025911 Bacteria 979
810 Ga0207707_10003361 3300025912 Bacteria 14208
811 Ga0207707_10007456 3300025912 Bacteria 9532
812 Ga0207707_10088061 3300025912 Bacteria 2712
813 Ga0207707_10361838 3300025912 Bacteria 1249
814 Ga0207707_10670877 3300025912 Bacteria 872
815 Ga0207695_10000379 3300025913 Bacteria 101331
816 Ga0207695_10001178 3300025913 Bacteria 45089
817 Ga0207695_10003215 3300025913 Bacteria 23264
818 Ga0207695_10003457 3300025913 Bacteria 22260
819 Ga0207695_10007039 3300025913 Bacteria 14431
820 Ga0207695_10008453 3300025913 Bacteria 12891
821 Ga0207695_10132896 3300025913 Bacteria 2444
822 Ga0207695_10133436 3300025913 Bacteria 2438
823 Ga0207695_10144827 3300025913 Bacteria 2321
824 Ga0207695_10198512 3300025913 Bacteria 1921
825 Ga0207695_10388409 3300025913 Bacteria 1281
826 Ga0207671_10000071 3300025914 Bacteria 159699
827 Ga0207671_10000503 3300025914 Bacteria 53115
828 Ga0207671_10073333 3300025914 Bacteria 2556
829 Ga0207671_10310899 3300025914 Bacteria 1246
830 Ga0207693_10000026 3300025915 Bacteria 122717
831 Ga0207693_10000922 3300025915 Bacteria 26418
832 Ga0207693_10001260 3300025915 Bacteria 22561
833 Ga0207693_10004232 3300025915 Bacteria 12174
834 Ga0207693_10011801 3300025915 Bacteria 7061
835 Ga0207693_10017084 3300025915 Bacteria 5790
836 Ga0207693_10076512 3300025915 Bacteria 2621
837 Ga0207693_10076545 3300025915 Bacteria 2620
838 Ga0207693_10214442 3300025915 Bacteria 1513
839 Ga0207693_10217433 3300025915 Bacteria 1501
840 Ga0207693_10287539 3300025915 Bacteria 1288
841 Ga0207693_10316434 3300025915 Bacteria 1222
842 Ga0207693_10365097 3300025915 Bacteria 1130
843 Ga0207693_10513609 3300025915 Bacteria 935
844 Ga0207693_10580807 3300025915 Bacteria 873
845 Ga0207693_10590609 3300025915 Bacteria 865
846 Ga0207663_10006104 3300025916 Bacteria 6133
847 Ga0207663_10040067 3300025916 Bacteria 2844
848 Ga0207663_10058540 3300025916 Bacteria 2432
849 Ga0207663_10099304 3300025916 Bacteria 1951
850 Ga0207663_10122489 3300025916 Bacteria 1783
851 Ga0207663_10143190 3300025916 Bacteria 1668
852 Ga0207660_10071681 3300025917 Bacteria 2521
853 Ga0207660_10090148 3300025917 Bacteria 2271
854 Ga0207660_10127659 3300025917 Bacteria 1932
855 Ga0207660_10145741 3300025917 Bacteria 1815
856 Ga0207660_10256966 3300025917 Bacteria 1380
857 Ga0207660_10261820 3300025917 Bacteria 1368
858 Ga0207662_10001544 3300025918 Bacteria 11236
859 Ga0207657_10003185 3300025919 Bacteria 17559
860 Ga0207657_10009917 3300025919 Bacteria 9532
861 Ga0207657_10081973 3300025919 Bacteria 2708
862 Ga0207657_10212312 3300025919 Bacteria 1553
863 Ga0207649_10001087 3300025920 Bacteria 16517
864 Ga0207649_10038778 3300025920 Bacteria 2886
865 Ga0207649_10112473 3300025920 Bacteria 1822
866 Ga0207649_10129360 3300025920 Bacteria 1713
867 Ga0207649_10248484 3300025920 Bacteria 1280
868 Ga0207652_10007763 3300025921 Bacteria 8618
869 Ga0207652_10032833 3300025921 Bacteria 4367
870 Ga0207652_10043118 3300025921 Bacteria 3842
871 Ga0207652_10051244 3300025921 Bacteria 3539
872 Ga0207652_10061950 3300025921 Bacteria 3232
873 Ga0207652_10062982 3300025921 Bacteria 3206
874 Ga0207652_10428362 3300025921 Bacteria 1193
875 Ga0207652_10575319 3300025921 Bacteria 1011
876 Ga0207646_10001230 3300025922 Bacteria 32163
877 Ga0207646_10004899 3300025922 Bacteria 14334
878 Ga0207646_10017066 3300025922 Bacteria 6802
879 Ga0207646_10092911 3300025922 Bacteria 2701
880 Ga0207646_10108061 3300025922 Bacteria 2496
881 Ga0207646_10213799 3300025922 Bacteria 1741
882 Ga0207646_10270842 3300025922 Bacteria 1535
883 Ga0207646_10306158 3300025922 Bacteria 1436
884 Ga0207646_10501424 3300025922 Unclassified 1094
885 Ga0207646_11060523 3300025922 Unclassified 714
886 Ga0207681_10312184 3300025923 Bacteria 1247
887 Ga0207681_10533825 3300025923 Bacteria 964
888 Ga0207694_10000247 3300025924 Bacteria 51633
889 Ga0207694_10000580 3300025924 Bacteria 33080
890 Ga0207694_10000718 3300025924 Bacteria 29747
891 Ga0207694_10001290 3300025924 Bacteria 21610
892 Ga0207694_10023728 3300025924 Bacteria 4657
893 Ga0207694_10045546 3300025924 Bacteria 3388
894 Ga0207694_10080494 3300025924 Bacteria 2556
895 Ga0207694_10198429 3300025924 Bacteria 1632
896 Ga0207694_10407321 3300025924 Bacteria 1131
897 Ga0207650_10000152 3300025925 Bacteria 83134
898 Ga0207650_10017448 3300025925 Bacteria 5028
899 Ga0207650_10117795 3300025925 Bacteria 2064
900 Ga0207650_10199647 3300025925 Bacteria 1601
901 Ga0207650_10497671 3300025925 Bacteria 1018
902 Ga0207687_10007797 3300025927 Bacteria 7021
903 Ga0207687_10010750 3300025927 Bacteria 5980
904 Ga0207687_10079919 3300025927 Bacteria 2359
905 Ga0207687_10093489 3300025927 Bacteria 2198
906 Ga0207687_10661885 3300025927 Bacteria 884
907 Ga0207687_10680753 3300025927 Bacteria 872
908 Ga0207687_10990669 3300025927 Bacteria 721
909 Ga0207700_10010311 3300025928 Bacteria 5888
910 Ga0207700_10014066 3300025928 Bacteria 5230
911 Ga0207700_10040547 3300025928 Bacteria 3400
912 Ga0207700_10048859 3300025928 Bacteria 3144
913 Ga0207700_10063404 3300025928 Bacteria 2811
914 Ga0207700_10077528 3300025928 Bacteria 2582
915 Ga0207700_10086619 3300025928 Bacteria 2462
916 Ga0207700_10174220 3300025928 Bacteria 1797
917 Ga0207700_10188567 3300025928 Bacteria 1731
918 Ga0207700_10211319 3300025928 Bacteria 1640
919 Ga0207700_10231086 3300025928 Bacteria 1573
920 Ga0207700_10318586 3300025928 Bacteria 1347
921 Ga0207700_10327994 3300025928 Bacteria 1328
922 Ga0207700_10479131 3300025928 Bacteria 1099
923 Ga0207700_10808877 3300025928 Bacteria 838
924 Ga0207700_10894995 3300025928 Unclassified 794
925 Ga0207664_10000087 3300025929 Bacteria 88607
926 Ga0207664_10030225 3300025929 Bacteria 4136
927 Ga0207664_10032913 3300025929 Bacteria 3978
928 Ga0207664_10039554 3300025929 Bacteria 3661
929 Ga0207664_10068430 3300025929 Bacteria 2852
930 Ga0207664_10103097 3300025929 Bacteria 2360
931 Ga0207664_10108154 3300025929 Bacteria 2308
932 Ga0207664_10137959 3300025929 Bacteria 2060
933 Ga0207664_10199406 3300025929 Bacteria 1727
934 Ga0207664_10204228 3300025929 Bacteria 1707
935 Ga0207664_10548264 3300025929 Bacteria 1037
936 Ga0207664_10800142 3300025929 Unclassified 848
937 Ga0207644_10003318 3300025931 Bacteria 10388
938 Ga0207644_10008126 3300025931 Bacteria 6873
939 Ga0207644_10036649 3300025931 Bacteria 3445
940 Ga0207644_10377620 3300025931 Bacteria 1155
941 Ga0207690_10097091 3300025932 Bacteria 2096
942 Ga0207706_10000740 3300025933 Bacteria 34067
943 Ga0207706_10002545 3300025933 Bacteria 17768
944 Ga0207706_10029663 3300025933 Bacteria 4882
945 Ga0207706_10264348 3300025933 Bacteria 1502
946 Ga0207686_10066767 3300025934 Bacteria 2298
947 Ga0207686_10067063 3300025934 Bacteria 2294
948 Ga0207686_10094040 3300025934 Bacteria 1986
949 Ga0207709_10014728 3300025935 Bacteria 4322
950 Ga0207670_10521157 3300025936 Bacteria 968
951 Ga0207704_10039378 3300025938 Bacteria 2752
952 Ga0207704_10054864 3300025938 Bacteria 2432
953 Ga0207704_10191407 3300025938 Bacteria 1488
954 Ga0207704_10414483 3300025938 Bacteria 1066
955 Ga0207665_10000981 3300025939 Bacteria 19321
956 Ga0207665_10001798 3300025939 Bacteria 14443
957 Ga0207665_10011698 3300025939 Bacteria 5766
958 Ga0207665_10012641 3300025939 Bacteria 5549
959 Ga0207665_10013825 3300025939 Bacteria 5307
960 Ga0207665_10017747 3300025939 Bacteria 4677
961 Ga0207665_10026437 3300025939 Bacteria 3830
962 Ga0207665_10067172 3300025939 Bacteria 2441
963 Ga0207665_10083989 3300025939 Bacteria 2197
964 Ga0207665_10096503 3300025939 Bacteria 2056
965 Ga0207665_10112780 3300025939 Bacteria 1912
966 Ga0207665_10134727 3300025939 Bacteria 1756
967 Ga0207665_10262347 3300025939 Bacteria 1280
968 Ga0207665_10360785 3300025939 Bacteria 1099
969 Ga0207691_10000308 3300025940 Bacteria 48637
970 Ga0207691_10020023 3300025940 Bacteria 6330
971 Ga0207691_10523155 3300025940 Bacteria 1006
972 Ga0207711_10003068 3300025941 Bacteria 14584
973 Ga0207711_10005581 3300025941 Bacteria 10635
974 Ga0207711_10052780 3300025941 Bacteria 3485
975 Ga0207711_10059457 3300025941 Bacteria 3291
976 Ga0207711_10712045 3300025941 Bacteria 936
977 Ga0207689_10000502 3300025942 Bacteria 36903
978 Ga0207689_10000542 3300025942 Bacteria 35861
979 Ga0207689_10000618 3300025942 Bacteria 33979
980 Ga0207689_10027283 3300025942 Bacteria 4782
981 Ga0207661_10007082 3300025944 Bacteria 7965
982 Ga0207661_10022412 3300025944 Bacteria 4757
983 Ga0207661_10080823 3300025944 Bacteria 2683
984 Ga0207661_10281865 3300025944 Bacteria 1486
985 Ga0207661_10441935 3300025944 Unclassified 1184
986 Ga0207661_10452492 3300025944 Bacteria 1170
987 Ga0207661_10524643 3300025944 Bacteria 1083
988 Ga0207661_10525623 3300025944 Bacteria 1082
989 Ga0207661_10589096 3300025944 Bacteria 1020
990 Ga0207661_10677990 3300025944 Bacteria 948
991 Ga0207679_10000298 3300025945 Bacteria 37205
992 Ga0207679_10058332 3300025945 Bacteria 2860
993 Ga0207679_10192628 3300025945 Bacteria 1696
994 Ga0207679_10413860 3300025945 Bacteria 1188
995 Ga0207679_10436368 3300025945 Bacteria 1159
996 Ga0207679_10501753 3300025945 Bacteria 1083
997 Ga0207679_11324682 3300025945 Bacteria 661
998 Ga0207667_10000245 3300025949 Bacteria 76423
999 Ga0207667_10002261 3300025949 Bacteria 24195
1000 Ga0207667_10004201 3300025949 Bacteria 17682
1001 Ga0207667_10007074 3300025949 Bacteria 13558
1002 Ga0207667_10008140 3300025949 Bacteria 12487
1003 Ga0207667_10010370 3300025949 Bacteria 10889
1004 Ga0207667_10010808 3300025949 Bacteria 10648
1005 Ga0207667_10024417 3300025949 Bacteria 6636
1006 Ga0207667_10027091 3300025949 Bacteria 6248
1007 Ga0207667_10046387 3300025949 Bacteria 4600
1008 Ga0207667_10132903 3300025949 Bacteria 2563
1009 Ga0207667_10215988 3300025949 Bacteria 1965
1010 Ga0207667_10232241 3300025949 Bacteria 1888
1011 Ga0207667_10327623 3300025949 Bacteria 1564
1012 Ga0207667_10364698 3300025949 Bacteria 1473
1013 Ga0207667_10403647 3300025949 Bacteria 1391
1014 Ga0207667_10528451 3300025949 Bacteria 1195
1015 Ga0207651_10083698 3300025960 Bacteria 2308
1016 Ga0207651_10102556 3300025960 Bacteria 2127
1017 Ga0207712_10624912 3300025961 Bacteria 934
1018 Ga0207668_10079642 3300025972 Bacteria 2370
1019 Ga0207668_10158330 3300025972 Bacteria 1761
1020 Ga0207668_10363073 3300025972 Bacteria 1214
1021 Ga0207640_10008195 3300025981 Bacteria 5791
1022 Ga0207640_10008701 3300025981 Bacteria 5646
1023 Ga0207640_10038889 3300025981 Bacteria 3006
1024 Ga0207640_10041360 3300025981 Bacteria 2931
1025 Ga0207640_10065766 3300025981 Bacteria 2420
1026 Ga0207640_10125894 3300025981 Bacteria 1845
1027 Ga0207658_10000267 3300025986 Bacteria 55017
1028 Ga0207658_10003391 3300025986 Bacteria 11277
1029 Ga0207658_10813687 3300025986 Bacteria 848
1030 Ga0207677_10000115 3300026023 Bacteria 65569
1031 Ga0207677_10004546 3300026023 Bacteria 7461
1032 Ga0207677_10008537 3300026023 Bacteria 5730
1033 Ga0207677_10010267 3300026023 Bacteria 5295
1034 Ga0207677_10030053 3300026023 Bacteria 3462
1035 Ga0207677_10031264 3300026023 Bacteria 3408
1036 Ga0207677_10087038 3300026023 Bacteria 2260
1037 Ga0207677_10144638 3300026023 Bacteria 1825
1038 Ga0207677_10160264 3300026023 Bacteria 1747
1039 Ga0207677_10306146 3300026023 Bacteria 1315
1040 Ga0207677_10410561 3300026023 Bacteria 1151
1041 Ga0207703_10013683 3300026035 Bacteria 6323
1042 Ga0207703_10032840 3300026035 Bacteria 4111
1043 Ga0207703_10041811 3300026035 Bacteria 3674
1044 Ga0207703_10050418 3300026035 Bacteria 3369
1045 Ga0207703_10081849 3300026035 Bacteria 2693
1046 Ga0207703_10098364 3300026035 Bacteria 2474
1047 Ga0207703_10158019 3300026035 Bacteria 1983
1048 Ga0207703_10199995 3300026035 Bacteria 1775
1049 Ga0207639_10000868 3300026041 Bacteria 20542
1050 Ga0207639_10077326 3300026041 Bacteria 2623
1051 Ga0207639_10100059 3300026041 Bacteria 2341
1052 Ga0207639_10162155 3300026041 Bacteria 1885
1053 Ga0207639_10361624 3300026041 Bacteria 1299
1054 Ga0207639_10433644 3300026041 Bacteria 1190
1055 Ga0207639_10447872 3300026041 Bacteria 1172
1056 Ga0207639_11112597 3300026041 Bacteria 741
1057 Ga0207678_10001612 3300026067 Bacteria 20753
1058 Ga0207678_10053979 3300026067 Bacteria 3462
1059 Ga0207678_10119637 3300026067 Bacteria 2248
1060 Ga0207708_10364448 3300026075 Bacteria 1188
1061 Ga0207708_10519098 3300026075 Bacteria 1001
1062 Ga0207702_10000775 3300026078 Bacteria 33843
1063 Ga0207702_10001276 3300026078 Bacteria 25273
1064 Ga0207702_10001425 3300026078 Bacteria 23875
1065 Ga0207702_10001589 3300026078 Bacteria 22475
1066 Ga0207702_10003851 3300026078 Bacteria 13535
1067 Ga0207702_10013988 3300026078 Bacteria 6666
1068 Ga0207702_10041975 3300026078 Bacteria 3836
1069 Ga0207702_10058657 3300026078 Bacteria 3276
1070 Ga0207702_10114333 3300026078 Bacteria 2405
1071 Ga0207702_10279249 3300026078 Bacteria 1578
1072 Ga0207702_10666626 3300026078 Bacteria 1024
1073 Ga0207702_10684072 3300026078 Bacteria 1010
1074 Ga0207702_10684771 3300026078 Bacteria 1010
1075 Ga0207702_10718188 3300026078 Bacteria 985
1076 Ga0207641_10000052 3300026088 Bacteria 173672
1077 Ga0207641_10001519 3300026088 Bacteria 22714
1078 Ga0207641_10008139 3300026088 Bacteria 8681
1079 Ga0207641_10035449 3300026088 Bacteria 4157
1080 Ga0207641_10076646 3300026088 Bacteria 2891
1081 Ga0207641_10698630 3300026088 Bacteria 999
1082 Ga0207641_10799232 3300026088 Bacteria 933
1083 Ga0207648_10030836 3300026089 Bacteria 4744
1084 Ga0207648_10108581 3300026089 Bacteria 2436
1085 Ga0207648_10164500 3300026089 Bacteria 1960
1086 Ga0207648_10194351 3300026089 Bacteria 1799
1087 Ga0207648_10213457 3300026089 Bacteria 1714
1088 Ga0207648_10226952 3300026089 Bacteria 1661
1089 Ga0207648_10525679 3300026089 Bacteria 1084
1090 Ga0207676_10000176 3300026095 Bacteria 56110
1091 Ga0207676_10013418 3300026095 Bacteria 5885
1092 Ga0207676_10019798 3300026095 Bacteria 4915
1093 Ga0207676_10028706 3300026095 Bacteria 4158
1094 Ga0207676_10049309 3300026095 Bacteria 3275
1095 Ga0207676_10290649 3300026095 Bacteria 1488
1096 Ga0207676_10709036 3300026095 Bacteria 976
1097 Ga0207676_11021450 3300026095 Bacteria 815
1098 Ga0207674_10000864 3300026116 Bacteria 39645
1099 Ga0207674_10035733 3300026116 Bacteria 5185
1100 Ga0207674_10037656 3300026116 Bacteria 5028
1101 Ga0207674_10079166 3300026116 Bacteria 3291
1102 Ga0207674_10268226 3300026116 Bacteria 1654
1103 Ga0207674_10529493 3300026116 Bacteria 1138
1104 Ga0207675_100005443 3300026118 Bacteria 12201
1105 Ga0207675_100109928 3300026118 Bacteria 2601
1106 Ga0207675_100645130 3300026118 Bacteria 1065
1107 Ga0207683_10001978 3300026121 Bacteria 18120
1108 Ga0207683_10003988 3300026121 Bacteria 12801
1109 Ga0207683_10384501 3300026121 Bacteria 1290
1110 Ga0207683_10575389 3300026121 Bacteria 1042
1111 Ga0207698_10000039 3300026142 Bacteria 101073
1112 Ga0207698_10018540 3300026142 Bacteria 4745
1113 Ga0207698_10057598 3300026142 Bacteria 3007
1114 Ga0207698_10061165 3300026142 Bacteria 2933
1115 Ga0207698_10125714 3300026142 Bacteria 2180
1116 Ga0207698_10334050 3300026142 Bacteria 1425
1117 Ga0207698_10434246 3300026142 Bacteria 1263
1118 Ga0207698_10448723 3300026142 Bacteria 1244
1119 Ga0207698_10558773 3300026142 Bacteria 1123
1120 Ga0207698_10831010 3300026142 Bacteria 928
1121 Ga0207698_11377525 3300026142 Bacteria 720
1122 Ga0209966_1032404 3300027695 Bacteria 1064
1123 Ga0209998_10021159 3300027717 Bacteria 1395
1124 Ga0265354_1001832 3300028016 Bacteria 2868
1125 Ga0265354_1008544 3300028016 Bacteria 988
1126 Ga0265356_1001750 3300028017 Bacteria 3083
1127 Ga0268266_10001266 3300028379 Bacteria 30870
1128 Ga0268266_10007476 3300028379 Bacteria 9850
1129 Ga0268266_10093413 3300028379 Bacteria 2640
1130 Ga0268266_11103983 3300028379 Bacteria 767
1131 Ga0268265_10215468 3300028380 Bacteria 1676
1132 Ga0268265_10645325 3300028380 Bacteria 1017
1133 Ga0268264_10000863 3300028381 Bacteria 32143
1134 Ga0268264_10005269 3300028381 Bacteria 10950
1135 Ga0268264_10017321 3300028381 Bacteria 5903
1136 Ga0268264_10020090 3300028381 Bacteria 5457
1137 Ga0268264_10083427 3300028381 Bacteria 2738
1138 Ga0268264_10142703 3300028381 Bacteria 2137
1139 Ga0268264_10221861 3300028381 Bacteria 1740
1140 Ga0268264_10439518 3300028381 Bacteria 1262
1141 Ga0268264_10833678 3300028381 Bacteria 923
1142 Ga0265336_10040710 3300028666 Bacteria 1422
1143 Ga0265338_10002857 3300028800 Bacteria 25250
1144 Ga0265338_10012332 3300028800 Bacteria 9749
1145 Ga0265338_10066539 3300028800 Bacteria 3118
1146 Ga0265338_10097304 3300028800 Bacteria 2411
1147 Ga0265338_10100116 3300028800 Bacteria 2364
1148 Ga0265338_10134881 3300028800 Bacteria 1942
1149 Ga0265338_10184937 3300028800 Bacteria 1585
1150 Ga0265338_10256917 3300028800 Unclassified 1286
1151 Ga0265338_10297858 3300028800 Bacteria 1173
1152 Ga0265762_1000268 3300030760 Bacteria 8677
1153 Ga0265762_1001658 3300030760 Bacteria 4063
1154 Ga0265762_1021727 3300030760 Bacteria 1185
1155 Ga0265775_100102 3300030762 Bacteria 2714
1156 Ga0265767_100139 3300030836 Bacteria 2577
1157 Ga0265767_102289 3300030836 Bacteria 1014
1158 Ga0265777_102633 3300030877 Bacteria 1052
1159 Ga0265770_1064017 3300030878 Bacteria 689
1160 Ga0265765_1002819 3300030879 Bacteria 1709
1161 Ga0265772_100406 3300030886 Bacteria 1262
1162 Ga0265769_104373 3300030888 Bacteria 823
1163 Ga0265760_10000814 3300031090 Bacteria 8988
1164 Ga0265760_10021220 3300031090 Bacteria 1879
1165 Ga0265760_10021826 3300031090 Bacteria 1854
1166 Ga0265760_10035655 3300031090 Bacteria 1473
1167 Ga0265760_10125191 3300031090 Bacteria 828
1168 Ga0265330_10000477 3300031235 Bacteria 26910
1169 Ga0265330_10006604 3300031235 Bacteria 5727
1170 Ga0265330_10079036 3300031235 Unclassified 1418
1171 Ga0265330_10215121 3300031235 Bacteria 811
1172 Ga0265332_10062587 3300031238 Bacteria 1590
1173 Ga0265328_10030997 3300031239 Bacteria 1990
1174 Ga0265325_10003007 3300031241 Bacteria 11190
1175 Ga0265325_10015826 3300031241 Bacteria 4231
1176 Ga0265325_10023797 3300031241 Bacteria 3338
1177 Ga0265325_10026100 3300031241 Bacteria 3167
1178 Ga0265340_10007516 3300031247 Bacteria 5915
1179 Ga0265340_10009745 3300031247 Bacteria 5148
1180 Ga0265340_10056803 3300031247 Bacteria 1882
1181 Ga0265340_10095665 3300031247 Bacteria 1384
1182 Ga0265340_10113642 3300031247 Bacteria 1250
1183 Ga0265339_10012597 3300031249 Bacteria 5155
1184 Ga0265339_10012679 3300031249 Bacteria 5131
1185 Ga0265339_10026466 3300031249 Bacteria 3322
1186 Ga0265339_10044450 3300031249 Bacteria 2450
1187 Ga0265339_10110105 3300031249 Bacteria 1425
1188 Ga0265339_10129874 3300031249 Bacteria 1289
1189 Ga0265339_10172958 3300031249 Bacteria 1080
1190 Ga0265339_10185948 3300031249 Bacteria 1032
1191 Ga0265331_10012160 3300031250 Bacteria 4675
1192 Ga0265331_10060079 3300031250 Bacteria 1796
1193 Ga0265331_10071318 3300031250 Bacteria 1625
1194 Ga0265331_10115722 3300031250 Bacteria 1228
1195 Ga0265331_10126261 3300031250 Bacteria 1169
1196 Ga0265331_10186645 3300031250 Bacteria 936
1197 Ga0265331_10306024 3300031250 Unclassified 712
1198 Ga0265327_10085096 3300031251 Bacteria 1553
1199 Ga0265316_10000447 3300031344 Bacteria 46965
1200 Ga0265316_10012698 3300031344 Bacteria 7537
1201 Ga0265316_10024062 3300031344 Bacteria 5113
1202 Ga0265316_10088489 3300031344 Bacteria 2364
1203 Ga0265316_10093686 3300031344 Bacteria 2288
1204 Ga0265316_10134898 3300031344 Bacteria 1857
1205 Ga0265316_10230653 3300031344 Bacteria 1363
1206 Ga0265316_10234227 3300031344 Bacteria 1351
1207 Ga0265316_10330089 3300031344 Bacteria 1107
1208 Ga0265316_10607160 3300031344 Bacteria 775
1209 Ga0307408_100038203 3300031548 Bacteria 3386
1210 Ga0307408_100579105 3300031548 Bacteria 994
1211 Ga0265313_10002067 3300031595 Bacteria 17973
1212 Ga0265313_10002540 3300031595 Bacteria 15638
1213 Ga0265313_10031853 3300031595 Bacteria 2699
1214 Ga0265313_10034363 3300031595 Bacteria 2565
1215 Ga0265313_10047032 3300031595 Bacteria 2091
1216 Ga0265313_10087416 3300031595 Bacteria 1405
1217 Ga0316575_10019726 3300031665 Bacteria 2581
1218 Ga0316579_10115099 3300031691 Bacteria 1291
1219 Ga0265314_10000195 3300031711 Bacteria 90391
1220 Ga0265314_10006372 3300031711 Bacteria 10460
1221 Ga0265314_10019611 3300031711 Bacteria 5236
1222 Ga0265314_10138873 3300031711 Bacteria 1505
1223 Ga0265314_10279939 3300031711 Bacteria 944
1224 Ga0265342_10008369 3300031712 Bacteria 7424
1225 Ga0265342_10009887 3300031712 Bacteria 6671
1226 Ga0265342_10023824 3300031712 Bacteria 3868
1227 Ga0265342_10116136 3300031712 Bacteria 1510
1228 Ga0265342_10146411 3300031712 Bacteria 1315
1229 Ga0265342_10264151 3300031712 Bacteria 915
1230 Ga0316576_10010133 3300031727 Bacteria 6109
1231 Ga0307405_10015156 3300031731 Bacteria 4166
1232 Ga0307405_10128624 3300031731 Bacteria 1746
1233 Ga0307413_10126764 3300031824 Bacteria 1740
1234 Ga0307410_10003818 3300031852 Bacteria 7657
1235 Ga0307410_10138300 3300031852 Bacteria 1798
1236 Ga0307406_10334823 3300031901 Bacteria 1176
1237 Ga0307407_10372992 3300031903 Unclassified 1017
1238 Ga0307412_10316289 3300031911 Bacteria 1240
1239 Ga0307409_100081033 3300031995 Bacteria 2622
1240 Ga0307409_100310441 3300031995 Bacteria 1471
1241 Ga0307416_101004170 3300032002 Bacteria 937
1242 Ga0316053_101376 3300032120 Bacteria 1282
1243 Ga0307415_100013588 3300032126 Bacteria 4756
1244 Ga0307415_100144010 3300032126 Bacteria 1824
1245 Ga0307415_101232857 3300032126 Bacteria 706
1246 Ga0316583_10001999 3300032133 Bacteria 6976
1247 Ga0316583_10021356 3300032133 Bacteria 2321
1248 Ga0316593_10002310 3300032168 Bacteria 4482
1249 Ga0316596_1010400 3300033541 Bacteria 2250
1250 Ga0316212_1011384 3300033547 Bacteria 1272
1251 Ga0373930_0059074 3300034816 Bacteria 852
1252 Ga0373926_0001605 3300035083 Bacteria 6965
1253 Ga0373926_0003574 3300035083 Bacteria 5040
1254 Ga0373929_0050219 3300035085 Bacteria 952
1255 Ga0373934_0054968 3300035086 Bacteria 1581
1256 Ga0373934_0102134 3300035086 Unclassified 1159
1257 Ga0373934_0300413 3300035086 Bacteria 666
1258 Ga0373940_0124714 3300035088 Bacteria 802
1259 Ga0373951_0011910 3300035091 Bacteria 1956
1260 Ga0373923_0057443 3300035111 Bacteria 1645
1261 Ga0373923_0125188 3300035111 Bacteria 1151
1262 Ga0373923_0353723 3300035111 Unclassified 702
1263 Ga0373932_0033795 3300035112 Bacteria 1438
1264 Ga0373932_0044220 3300035112 Bacteria 1298
1265 Ga0373936_0002697 3300035113 Bacteria 6629
1266 Ga0373936_0004182 3300035113 Bacteria 5440
1267 Ga0373936_0039861 3300035113 Bacteria 1880
1268 Ga0373936_0201330 3300035113 Bacteria 879
1269 Ga0373939_0026421 3300035114 Bacteria 1637
1270 Ga0373939_0042332 3300035114 Bacteria 1377
1271 Ga0373941_0063619 3300035115 Bacteria 1207
1272 Ga0373941_0095216 3300035115 Bacteria 1028
1273 Ga0373945_0076153 3300035116 Bacteria 1278
1274 Ga0373945_0211146 3300035116 Bacteria 809
1275 Ga0373945_0244323 3300035116 Bacteria 756
1276 Ga0373953_0108341 3300035117 Bacteria 1173
1277 Ga0373954_0081901 3300035118 Bacteria 1542
1278 Ga0373956_0008775 3300035119 Bacteria 4095
1279 Ga0373956_0121721 3300035119 Bacteria 1219
1280 Ga0373957_0103483 3300035120 Bacteria 1141
1281 Ga0373960_0005438 3300035121 Bacteria 2952
1282 Ga0373960_0028473 3300035121 Bacteria 1542
1283 Ga0373943_0000594 3300035170 Bacteria 15714
1284 Ga0373943_0094669 3300035170 Bacteria 1552
1285 Ga0373943_0122694 3300035170 Bacteria 1382
1286 Ga0373943_0138576 3300035170 Bacteria 1309
1287 Ga0373943_0332593 3300035170 Bacteria 868
1288 Ga0373946_0011730 3300035171 Bacteria 3276
1289 Ga0373955_0090667 3300035172 Bacteria 1742
1290 Ga0373955_0098421 3300035172 Bacteria 1676
1291 Ga0373955_0369090 3300035172 Bacteria 870
1292 Ga0373955_0403489 3300035172 Unclassified 831
1293 Ga0373955_0516715 3300035172 Unclassified 730
1294 Ga0373955_0656555 3300035172 Bacteria 643
1295 Ga0373961_0023934 3300035241 Bacteria 1648
1296 Ga0316574_0059501 3300035398 Bacteria 2396
1297 Ga0316574_0231056 3300035398 Bacteria 1184
1298 Ga0373924_0265450 3300035410 Bacteria 761
1299 Ga0373924_0272396 3300035410 Bacteria 750
1300 Ga0373931_0025357 3300035691 Bacteria 3011
1301 Ga0373931_0029341 3300035691 Bacteria 2823
1302 Ga0373931_0043624 3300035691 Bacteria 2363
1303 Ga0373931_0238784 3300035691 Bacteria 1101
1304 Ga0373931_0337178 3300035691 Bacteria 941
1305 Ga0373931_0463015 3300035691 Bacteria 813
1306 Ga0373935_0001675 3300035692 Bacteria 12390
1307 Ga0373935_0190175 3300035692 Bacteria 1413
1308 Ga0373935_0425978 3300035692 Bacteria 956
1309 Ga0373935_0449172 3300035692 Bacteria 931
1310 Ga0373927_0000747 3300035695 Bacteria 24845
1311 Ga0373927_0440199 3300035695 Bacteria 861
1312 Ga0373927_0447087 3300035695 Bacteria 853
1313 Ga0373927_0530360 3300035695 Bacteria 778
1314 Ga0373933_0336351 3300035724 Bacteria 980
1315 Ga0373933_0372896 3300035724 Bacteria 929
1316 Ga0373947_0000971 3300035725 Bacteria 17501
1317 Ga0373947_0001211 3300035725 Bacteria 15877
1318 Ga0373947_0020444 3300035725 Bacteria 3822
1319 Ga0373947_0084341 3300035725 Bacteria 1972
1320 Ga0373937_0054915 3300036401 Bacteria 3656
1321 Ga0373937_0126516 3300036401 Bacteria 2384
1322 Ga0373937_0151139 3300036401 Bacteria 2175
1323 Ga0373937_0231089 3300036401 Bacteria 1742
1324 Ga0373937_0345213 3300036401 Bacteria 1410
1325 Ga0373937_0577078 3300036401 Bacteria 1068
1326 Ga0373937_0865205 3300036401 Bacteria 852
1327 Ga0265778_000492 3300036457 Bacteria 3118
1328 Ga0265778_012606 3300036457 Bacteria 984
1329 Ga0316582_0004900 3300036647 Bacteria 6839
1330 Ga0316584_0072077 3300036712 Bacteria 2589
1331 Ga0316584_0073536 3300036712 Bacteria 2562
1332 Ga0373925_0021559 3300037068 Bacteria 4696
1333 Ga0373925_0033272 3300037068 Bacteria 3799
1334 Ga0373925_0059866 3300037068 Bacteria 2858
1335 Ga0373925_0162989 3300037068 Bacteria 1757
1336 Ga0373925_0260673 3300037068 Bacteria 1392
1337 Ga0395899_0080728 3300037312 Bacteria 2367
1338 Ga0395898_0077092 3300037466 Bacteria 3218
1339 Ga0395898_0080688 3300037466 Bacteria 3137
1340 Ga0395905_0078625 3300037471 Bacteria 3091
1341 Ga0436364_1031963 3300037853 Bacteria 2927
1342 Ga0395901_0270701 3300038443 Bacteria 1767
1343 Ga0395901_0453925 3300038443 Bacteria 1310
1344 Ga0395901_0681495 3300038443 Bacteria 1028
1345 Ga0395901_0716095 3300038443 Bacteria 997
1346 Ga0436365_1271434 3300039437 Bacteria 988
1347 Ga0436365_1777663 3300039437 Bacteria 1083
1348 Ga0436365_1790709 3300039437 Bacteria 3293
1349 Ga0436360_0624708 3300039438 Bacteria 889
1350 Ga0436360_0855749 3300039438 Bacteria 1847
1351 Ga0436360_1207783 3300039438 Bacteria 2008
1352 Ga0436361_0209675 3300039447 Bacteria 5997
1353 Ga0436361_0382600 3300039447 Bacteria 1823
1354 Ga0436361_0689088 3300039447 Bacteria 8570
1355 Ga0436361_0938053 3300039447 Bacteria 8083
1356 Ga0436363_0314896 3300039450 Bacteria 3969
1357 Ga0436363_0821922 3300039450 Bacteria 2633
1358 Ga0436363_0852547 3300039450 Bacteria 3582
1359 Ga0436363_1142140 3300039450 Bacteria 1482
1360 Ga0436363_1380006 3300039450 Bacteria 1066
1361 Ga0436363_1692139 3300039450 Bacteria 1147
1362 Ga0436362_0535191 3300039453 Bacteria 775
1363 Ga0451837_0208259 3300041494 Bacteria 2451
1364 Ga0451839_1143755 3300041496 Bacteria 747
1365 Ga0451853_0430726 3300041512 Bacteria 1897
1366 Ga0451577_0000523 3300042876 Bacteria 63915
1367 Ga0451577_0163564 3300042876 Bacteria 2005
1368 Ga0451577_0694484 3300042876 Bacteria 922
1369 Ga0453683_0063100 3300044673 Bacteria 2316
1370 Ga0453683_0099584 3300044673 Bacteria 1825
1371 Ga0453683_0262508 3300044673 Bacteria 1102
1372 Ga0466965_0266526 3300044683 Bacteria 922
1373 Ga0466966_0047128 3300044684 Bacteria 2750
1374 Ga0466966_0152134 3300044684 Bacteria 1411
1375 Ga0466961_0089241 3300044693 Bacteria 1947
1376 Ga0466961_0156584 3300044693 Bacteria 1421
1377 Ga0466961_0293117 3300044693 Bacteria 995
1378 Ga0466963_0000986 3300044694 Bacteria 14660
1379 Ga0466963_0017000 3300044694 Bacteria 4531
1380 Ga0466963_0092431 3300044694 Bacteria 2061
1381 Ga0466963_0173612 3300044694 Bacteria 1503
1382 Ga0466963_0544574 3300044694 Bacteria 820
1383 Ga0466964_0403458 3300044706 Bacteria 715
1384 Ga0466964_0407546 3300044706 Bacteria 712
1385 Ga0453684_0000375 3300044712 Bacteria 183706
1386 Ga0453684_0000951 3300044712 Bacteria 95417
1387 Ga0453684_0010967 3300044712 Bacteria 15319
1388 Ga0453684_0028486 3300044712 Bacteria 7966
1389 Ga0453684_0829514 3300044712 Bacteria 995
1390 Ga0466957_0346492 3300044842 Bacteria 1007
1391 Ga0466957_0473955 3300044842 Bacteria 865
1392 Ga0466957_0795093 3300044842 Bacteria 672
1393 Ga0466959_0328204 3300045049 Bacteria 1045
1394 Ga0466959_0524886 3300045049 Bacteria 799
1395 Ga0451576_0054948 3300045051 Bacteria 4167
1396 Ga0451576_0108377 3300045051 Bacteria 2890
1397 Ga0451576_0395444 3300045051 Bacteria 1449
1398 Ga0451576_0432832 3300045051 Bacteria 1380
1399 Ga0466958_0016862 3300045836 Bacteria 4215
1400 Ga0466958_0575564 3300045836 Bacteria 732
1401 Ga0466967_0001212 3300045976 Bacteria 14529
1402 Ga0466967_0008372 3300045976 Bacteria 7569
1403 Ga0466967_0075749 3300045976 Bacteria 3025
1404 Ga0466967_0128251 3300045976 Bacteria 2352
1405 Ga0466967_0259472 3300045976 Bacteria 1662
1406 Ga0466967_0283528 3300045976 Bacteria 1590
1407 Ga0495603_0046154 3300046455 Bacteria 2597
1408 Ga0495603_0316569 3300046455 Bacteria 896
1409 Ga0495590_0087060 3300046457 Bacteria 1104
1410 Ga0495629_0111252 3300046459 Bacteria 1909
1411 Ga0495629_0164610 3300046459 Bacteria 1540
1412 Ga0495651_0165048 3300046462 Bacteria 1583
1413 Ga0495653_0406401 3300046463 Bacteria 864
1414 Ga0495580_0001673 3300046472 Bacteria 19470
1415 Ga0495580_0001845 3300046472 Bacteria 18638
1416 Ga0495580_0004834 3300046472 Bacteria 11276
1417 Ga0495580_0005699 3300046472 Bacteria 10245
1418 Ga0495580_0005942 3300046472 Bacteria 10013
1419 Ga0495580_0014792 3300046472 Bacteria 5913
1420 Ga0495580_0018154 3300046472 Bacteria 5242
1421 Ga0495580_0031674 3300046472 Bacteria 3820
1422 Ga0495580_0055771 3300046472 Bacteria 2783
1423 Ga0495580_0072826 3300046472 Bacteria 2399
1424 Ga0495580_0095688 3300046472 Bacteria 2065
1425 Ga0495580_0161799 3300046472 Bacteria 1549
1426 Ga0495580_0395723 3300046472 Bacteria 932
1427 Ga0495580_0417060 3300046472 Bacteria 904
1428 Ga0495580_0478560 3300046472 Bacteria 833
1429 Ga0495582_0000596 3300046473 Bacteria 19949
1430 Ga0495582_0037043 3300046473 Bacteria 2683
1431 Ga0495582_0078987 3300046473 Bacteria 1826
1432 Ga0495605_0040069 3300046474 Bacteria 2343
1433 Ga0495639_0175929 3300046475 Bacteria 1040
1434 Ga0495664_0041085 3300046477 Bacteria 2735
1435 Ga0495664_0254302 3300046477 Bacteria 1062
1436 Ga0495594_0097967 3300046499 Bacteria 1648
1437 Ga0495606_0120784 3300046507 Bacteria 1569
1438 Ga0495628_0317387 3300046516 Bacteria 1150
1439 Ga0495630_0097944 3300046517 Bacteria 2218
1440 Ga0495630_0498970 3300046517 Bacteria 933
1441 Ga0495631_0132767 3300046518 Bacteria 1070
1442 Ga0495666_0034520 3300046526 Bacteria 2468
1443 Ga0495652_0042775 3300046529 Bacteria 3906
1444 Ga0495652_0127181 3300046529 Bacteria 2023
1445 Ga0495652_0210409 3300046529 Bacteria 1469
1446 Ga0495665_0019981 3300046531 Bacteria 3601
1447 Ga0495665_0040708 3300046531 Bacteria 2474
1448 Ga0495665_0079884 3300046531 Bacteria 1721
1449 Ga0495586_0057650 3300046535 Bacteria 2108
1450 Ga0495587_0089827 3300046536 Bacteria 1775
1451 Ga0495587_0491001 3300046536 Bacteria 679
1452 Ga0495645_0043216 3300046543 Bacteria 3287
1453 Ga0495645_0160096 3300046543 Bacteria 1557
1454 Ga0495667_0162033 3300046559 Bacteria 1439
1455 Ga0495634_0374163 3300046642 Bacteria 850
1456 Ga0495588_0072095 3300046674 Bacteria 1797
1457 Ga0495588_0184362 3300046674 Bacteria 1103
1458 Ga0495657_0101426 3300046675 Bacteria 1834
1459 Ga0495623_0061023 3300046679 Bacteria 2365
1460 Ga0495623_0215479 3300046679 Bacteria 1097
1461 Ga0495647_0259766 3300046681 Bacteria 775
1462 Ga0495669_0017600 3300046684 Bacteria 3068
1463 Ga0495669_0068720 3300046684 Bacteria 1612
1464 Ga0495669_0071269 3300046684 Bacteria 1584
1465 Ga0495669_0134815 3300046684 Bacteria 1164
1466 Ga0495613_0099825 3300046689 Bacteria 2097
1467 Ga0495624_0135893 3300046690 Bacteria 1507
1468 Ga0495624_0325832 3300046690 Bacteria 925
1469 Ga0495670_0060245 3300046691 Bacteria 1907
1470 Ga0495670_0108176 3300046691 Bacteria 1437
1471 Ga0495649_0077651 3300046694 Bacteria 1777
1472 Ga0495589_0376778 3300046794 Bacteria 652
1473 Ga0495581_0101105 3300047315 Bacteria 1675
1474 Ga0495581_0310403 3300047315 Bacteria 922
1475 Ga0495604_0040276 3300047317 Bacteria 3669
1476 Ga0495636_0280047 3300047318 Bacteria 777
1477 Ga0495674_0180903 3300047319 Bacteria 1756
1478 Ga0495674_0323002 3300047319 Bacteria 1257
1479 Ga0495674_0596391 3300047319 Bacteria 875
1480 Ga0495683_0232989 3300047323 Bacteria 816
1481 Ga0495687_104264 3300047443 Bacteria 1057
1482 Ga0495675_0118019 3300047444 Bacteria 1653
1483 Ga0495675_0243636 3300047444 Bacteria 1081
1484 Ga0495675_0468254 3300047444 Bacteria 727
1485 Ga0495677_0015676 3300047445 Bacteria 2752
1486 Ga0495684_0695282 3300047471 Bacteria 675
1487 Ga0495684_0714570 3300047471 Bacteria 663
1488 Ga0495602_0030031 3300048088 Bacteria 5164
1489 Ga0495602_0052250 3300048088 Bacteria 3632
1490 Ga0495602_0363205 3300048088 Bacteria 1042
1491 Ga0495602_0501001 3300048088 Bacteria 849
1492 Ga0495614_0225108 3300048089 Bacteria 853
1493 Ga0496100_0045986 3300048903 Bacteria 2804
1494 Ga0496100_0268251 3300048903 Bacteria 1268
1495 Ga0496100_0352937 3300048903 Bacteria 1111
1496 Ga0496101_0093399 3300048904 Bacteria 2241
1497 Ga0496101_0220663 3300048904 Bacteria 1471
1498 Ga0496101_0387805 3300048904 Bacteria 1099
1499 Ga0496101_0427794 3300048904 Bacteria 1044
1500 Ga0496102_0003212 3300048905 Bacteria 13867
1501 Ga0496102_0016554 3300048905 Bacteria 6444
1502 Ga0496102_0081622 3300048905 Bacteria 2981
1503 Ga0496102_0391639 3300048905 Bacteria 1307
1504 Ga0496102_0456557 3300048905 Bacteria 1198
1505 Ga0496102_0476208 3300048905 Bacteria 1170
1506 Ga0496103_0002380 3300048906 Bacteria 11861
1507 Ga0496103_0042709 3300048906 Bacteria 2791
1508 Ga0496103_0129820 3300048906 Bacteria 1609
1509 Ga0496104_0075835 3300048907 Bacteria 3202
1510 Ga0496104_0078899 3300048907 Bacteria 3137
1511 Ga0496104_0083424 3300048907 Bacteria 3048
1512 Ga0496104_0124754 3300048907 Bacteria 2472
1513 Ga0496104_0142669 3300048907 Bacteria 2301
1514 Ga0496104_0345845 3300048907 Bacteria 1400
1515 Ga0496104_0624684 3300048907 Bacteria 987
1516 Ga0496104_0902491 3300048907 Bacteria 789
1517 Ga0496104_1157341 3300048907 Bacteria 677
1518 Ga0496105_0023235 3300048908 Bacteria 5027
1519 Ga0496105_0308346 3300048908 Bacteria 1271
1520 Ga0496105_0532248 3300048908 Bacteria 919
1521 Ga0496106_0108392 3300048909 Bacteria 2160
1522 Ga0496106_0187507 3300048909 Bacteria 1643
1523 Ga0496106_0519942 3300048909 Bacteria 956
1524 Ga0496106_0537697 3300048909 Bacteria 938
1525 Ga0496106_0556673 3300048909 Bacteria 920
1526 Ga0496107_0158253 3300048910 Bacteria 1678
1527 Ga0496107_0226631 3300048910 Bacteria 1390
1528 Ga0496107_0857144 3300048910 Bacteria 663
1529 Ga0496108_0000242 3300048911 Bacteria 48793
1530 Ga0496108_0022698 3300048911 Bacteria 5162
1531 Ga0496108_0057994 3300048911 Bacteria 3253
1532 Ga0496108_0727150 3300048911 Bacteria 860
1533 Ga0496109_0000120 3300048912 Bacteria 81828
1534 Ga0496109_0047729 3300048912 Bacteria 3894
1535 Ga0496109_0059551 3300048912 Bacteria 3489
1536 Ga0496109_0083291 3300048912 Bacteria 2949
1537 Ga0496109_0989319 3300048912 Bacteria 779
1538 Ga0496110_0000795 3300048913 Bacteria 22036
1539 Ga0496110_0062633 3300048913 Bacteria 3286
1540 Ga0496110_0304919 3300048913 Bacteria 1450
1541 Ga0496110_0325077 3300048913 Bacteria 1401
1542 Ga0496110_0362898 3300048913 Bacteria 1320
1543 Ga0496110_0618221 3300048913 Bacteria 982
1544 Ga0496111_0072224 3300048914 Bacteria 2512
1545 Ga0496111_0124599 3300048914 Bacteria 1904
1546 Ga0496111_0891659 3300048914 Bacteria 641
1547 Ga0496112_0000198 3300048915 Bacteria 39413
1548 Ga0496112_0003360 3300048915 Bacteria 13207
1549 Ga0496112_0023788 3300048915 Bacteria 5860
1550 Ga0496112_0027473 3300048915 Bacteria 5486
1551 Ga0496112_0045265 3300048915 Bacteria 4314
1552 Ga0496112_0080868 3300048915 Bacteria 3213
1553 Ga0496112_0082350 3300048915 Bacteria 3183
1554 Ga0496112_0099271 3300048915 Bacteria 2881
1555 Ga0496112_0157945 3300048915 Bacteria 2234
1556 Ga0496112_0171068 3300048915 Bacteria 2137
1557 Ga0496112_0330085 3300048915 Bacteria 1469
1558 Ga0496112_0427765 3300048915 Bacteria 1262
1559 Ga0496112_0447852 3300048915 Bacteria 1229
1560 Ga0496112_0872889 3300048915 Bacteria 822
1561 Ga0496113_0000111 3300048916 Bacteria 35094
1562 Ga0496113_0049168 3300048916 Bacteria 3139
1563 Ga0496113_0092343 3300048916 Bacteria 2335
1564 Ga0496113_0164340 3300048916 Bacteria 1756
1565 Ga0496113_0269042 3300048916 Bacteria 1362
1566 Ga0496113_0352579 3300048916 Bacteria 1180
1567 Ga0496113_0596932 3300048916 Bacteria 884
1568 Ga0496113_0637164 3300048916 Bacteria 853
1569 Ga0496113_0637604 3300048916 Bacteria 852
1570 Ga0496114_0018472 3300048917 Bacteria 5637
1571 Ga0496114_0916500 3300048917 Bacteria 758
1572 Ga0496115_0004694 3300048918 Bacteria 9905
1573 Ga0496115_0097755 3300048918 Bacteria 2404
1574 Ga0496115_0289000 3300048918 Bacteria 1345
1575 Ga0496115_0344739 3300048918 Bacteria 1215
1576 Ga0496115_0641457 3300048918 Bacteria 840
1577 Ga0496115_0860945 3300048918 Bacteria 701
1578 Ga0496118_0337769 3300048921 Bacteria 809
1579 Ga0496121_0004571 3300048924 Bacteria 18454
1580 Ga0495682_0181155 3300049460 Bacteria 749
1581 Ga0501299_077580 3300049522 Bacteria 732
1582 Ga0501039_0381689 3300049575 Bacteria 1107
1583 Ga0501048_0362754 3300049582 Bacteria 1034
1584 Ga0501067_0145557 3300049583 Bacteria 1320
1585 Ga0501069_0419246 3300049585 Bacteria 793
1586 Ga0501071_0056652 3300049587 Bacteria 2832
1587 Ga0501072_0402934 3300049588 Bacteria 1085
1588 Ga0501075_0304697 3300049591 Bacteria 1214
1589 Ga0501077_0209336 3300049593 Bacteria 1239
1590 Ga0501249_005219 3300049679 Bacteria 2654
1591 Ga0501080_0047083 3300049742 Bacteria 4014
1592 Ga0501080_0390994 3300049742 Bacteria 1252
1593 Ga0501083_0076594 3300049744 Bacteria 2220
1594 Ga0501274_011428 3300049771 Bacteria 829
1595 nmdc:mga03n38_488740_c1 3300050490 Bacteria 689
1596 nmdc:mga0k408_89190_c1 3300050493 Bacteria 1811
1597 nmdc:mga05p37_18551_c1 3300050507 Bacteria 8407
1598 nmdc:mga05p37_49715_c1 3300050507 Bacteria 5158
1599 nmdc:mga05p37_6288_c1 3300050507 Bacteria 13971
1600 nmdc:mga05p37_89014_c1 3300050507 Bacteria 3804
1601 nmdc:mga09592_10768_c1 3300050508 Bacteria 7435
1602 nmdc:mga09592_12635_c1 3300050508 Bacteria 6883
1603 nmdc:mga09592_3850_c1 3300050508 Bacteria 12083
1604 nmdc:mga0qj67_134910_c1 3300050509 Bacteria 2000
1605 nmdc:mga0qj67_298104_c1 3300050509 Bacteria 1306
1606 nmdc:mga0qj67_5215_c1 3300050509 Bacteria 9486
1607 nmdc:mga0qj67_5582_c1 3300050509 Bacteria 9190
1608 nmdc:mga06r32_1321_c1 3300050510 Bacteria 22359
1609 nmdc:mga06r32_24817_c1 3300050510 Bacteria 5572
1610 nmdc:mga06r32_554166_c1 3300050510 Bacteria 1123
1611 nmdc:mga0n895_1436792_c1 3300050512 Bacteria 657
1612 nmdc:mga0n895_231102_c1 3300050512 Bacteria 1877
1613 nmdc:mga0n895_267034_c1 3300050512 Bacteria 1736
1614 nmdc:mga0n895_344_c1 3300050512 Bacteria 31117
1615 nmdc:mga0n895_538070_c1 3300050512 Bacteria 1175
1616 nmdc:mga0n895_8394_c1 3300050512 Bacteria 8944
1617 nmdc:mga0rr50_198174_c1 3300050513 Bacteria 1649
1618 nmdc:mga0rr50_42278_c1 3300050513 Bacteria 3327
1619 nmdc:mga0rr50_872_c1 3300050513 Bacteria 16295
1620 nmdc:mga08x19_1302_c1 3300050514 Bacteria 15495
1621 nmdc:mga08x19_16597_c1 3300050514 Bacteria 4493
1622 nmdc:mga08x19_3391_c1 3300050514 Bacteria 9503
1623 nmdc:mga08x19_3614_c1 3300050514 Bacteria 9212
1624 nmdc:mga08x19_54609_c1 3300050514 Bacteria 2572
1625 nmdc:mga0a205_13358_c2 3300050515 Bacteria 5680
1626 nmdc:mga0a205_27065_c1 3300050515 Bacteria 5474
1627 nmdc:mga0a205_896_c2 3300050515 Bacteria 13200
1628 Ga0495601_0081121 3300053077 Bacteria 2082
1629 Ga0495601_0289232 3300053077 Bacteria 1068
1630 Ga0495601_0528441 3300053077 Bacteria 760
1631 Ga0495612_0301436 3300053078 Bacteria 719
1632 Ga0495619_0066799 3300053085 Bacteria 2400
1633 Ga0495619_0067973 3300053085 Bacteria 2380
1634 Ga0495619_0200847 3300053085 Bacteria 1380
1635 Ga0495619_0320700 3300053085 Bacteria 1073
1636 Ga0587084_022376 3300059477 Bacteria 956
1637 Ga0587084_038166 3300059477 Bacteria 804
1638 Ga0587093_001799 3300059478 Bacteria 1887
1639 Ga0587066_000041 3300059490 Bacteria 5943
1640 Ga0587066_003966 3300059490 Bacteria 1784
1641 Ga0587066_024849 3300059490 Bacteria 1022
1642 Ga0587066_064211 3300059490 Bacteria 757
1643 Ga0587070_000114 3300059491 Bacteria 4759
1644 Ga0587070_005006 3300059491 Bacteria 1713
1645 Ga0587070_009437 3300059491 Bacteria 1409
1646 Ga0587073_0000512 3300059492 Bacteria 3629
1647 Ga0587073_0010183 3300059492 Bacteria 1571
1648 Ga0587073_0027533 3300059492 Bacteria 1147
1649 Ga0587073_0067380 3300059492 Bacteria 856
1650 Ga0587077_000059 3300059493 Bacteria 5517
1651 Ga0587077_020358 3300059493 Bacteria 1166
1652 Ga0587080_023497 3300059503 Bacteria 1029
1653 Ga0587082_000041 3300059504 Bacteria 6191
1654 Ga0587082_001045 3300059504 Bacteria 2690
1655 Ga0587082_015966 3300059504 Bacteria 1166
1656 Ga0587082_026978 3300059504 Bacteria 976
1657 Ga0587083_0000140 3300059505 Bacteria 4785
1658 Ga0587083_0008317 3300059505 Bacteria 1619
1659 Ga0587083_0042069 3300059505 Bacteria 961
1660 Ga0587085_000049 3300059506 Bacteria 5074
1661 Ga0587085_013465 3300059506 Bacteria 1139
1662 Ga0587086_001807 3300059507 Bacteria 1918
1663 Ga0587086_002117 3300059507 Bacteria 1824
1664 Ga0587088_018587 3300059508 Bacteria 1134
1665 Ga0587088_020342 3300059508 Bacteria 1100
1666 Ga0587088_022059 3300059508 Bacteria 1070
1667 Ga0587088_062885 3300059508 Bacteria 756
1668 Ga0587089_011038 3300059509 Bacteria 1133
1669 Ga0587090_002124 3300059510 Bacteria 2135
1670 Ga0587090_004530 3300059510 Bacteria 1691
1671 Ga0587090_028725 3300059510 Bacteria 918
1672 Ga0587091_000037 3300059511 Bacteria 6401
1673 Ga0587092_017130 3300059512 Bacteria 1080
1674 Ga0587094_015140 3300059513 Unclassified 1062
1675 Ga0587094_030635 3300059513 Bacteria 832
1676 Ga0587095_013868 3300059514 Bacteria 715
1677 Ga0587121_03790 3300059606 Bacteria 838
1678 Ga0587125_002360 3300059607 Bacteria 1506
1679 Ga0587099_001742 3300059622 Bacteria 1614
1680 Ga0587099_010779 3300059622 Bacteria 918
1681 Ga0587101_000464 3300059623 Bacteria 2880
1682 Ga0587101_011958 3300059623 Bacteria 1120
1683 Ga0587101_020116 3300059623 Bacteria 952
1684 Ga0587101_026206 3300059623 Bacteria 878
1685 Ga0587109_018150 3300059624 Bacteria 1226
1686 Ga0587113_000202 3300059625 Bacteria 2719
1687 Ga0587113_001661 3300059625 Bacteria 1505
1688 Ga0587115_000395 3300059626 Bacteria 3114
1689 Ga0587115_006541 3300059626 Bacteria 1348
1690 Ga0587117_031479 3300059627 Bacteria 802
1691 Ga0587122_000120 3300059628 Bacteria 3133
1692 Ga0587128_000097 3300059630 Bacteria 4428
1693 Ga0587128_012200 3300059630 Bacteria 1190
1694 Ga0587128_013692 3300059630 Bacteria 1149
1695 Ga0587130_007888 3300059631 Bacteria 999
1696 Ga0587062_005838 3300059639 Bacteria 1376
1697 Ga0587062_021903 3300059639 Bacteria 913
1698 Ga0587067_022361 3300059640 Bacteria 1100
1699 Ga0587067_023152 3300059640 Bacteria 1087
1700 Ga0587067_031560 3300059640 Bacteria 980
1701 Ga0587068_001605 3300059641 Bacteria 2581
1702 Ga0587068_014836 3300059641 Bacteria 1218
1703 Ga0587068_018769 3300059641 Bacteria 1116
1704 Ga0587069_000319 3300059642 Bacteria 3415
1705 Ga0587072_002593 3300059643 Bacteria 2439
1706 Ga0587072_011607 3300059643 Bacteria 1443
1707 Ga0587072_033771 3300059643 Bacteria 967
1708 Ga0587075_000131 3300059644 Bacteria 4321
1709 Ga0587076_000182 3300059645 Bacteria 4244
1710 Ga0587076_005031 3300059645 Bacteria 1689
1711 Ga0587078_004534 3300059646 Bacteria 1454
1712 Ga0587078_005238 3300059646 Bacteria 1378
1713 Ga0587079_000058 3300059647 Bacteria 6141
1714 Ga0587079_008309 3300059647 Bacteria 1583
1715 Ga0587079_017504 3300059647 Bacteria 1245
1716 Ga0587079_055528 3300059647 Bacteria 844
1717 Ga0587102_002667 3300059649 Bacteria 1400
1718 Ga0587105_004925 3300059651 Bacteria 872
1719 Ga0587107_005010 3300059652 Bacteria 1379
1720 Ga0587114_002308 3300059655 Bacteria 1756
1721 Ga0587114_006193 3300059655 Bacteria 1328
1722 Ga0587114_039900 3300059655 Bacteria 756
1723 Ga0587081_02740 3300060246 Bacteria 1082
1724 Ga0587071_000028 3300060344 Bacteria 7821
1725 Ga0587071_008428 3300060344 Bacteria 1671
1726 Ga0587071_017121 3300060344 Bacteria 1290
1727 Ga0587071_040607 3300060344 Bacteria 931
1728 Ga0587071_073893 3300060344 Bacteria 748
1729 Ga0466962_0315455 3300061719 Bacteria 775
1730 Ga0530510_0008715 3300061734 Bacteria 7091
1731 Ga0530510_0164995 3300061734 Bacteria 1639

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046794 Ga0495589_0376778 Ga0495589_0376778_12_554 169
2 3300009147 Ga0114129_10656566 Ga0114129_106565662 188
3 3300005547 Ga0070693_100274365 Ga0070693_1002743652 190
4 3300009098 Ga0105245_10275536 Ga0105245_102755362 190
5 3300009147 Ga0114129_10095676 Ga0114129_100956765 190
6 3300037466 Ga0395898_0080688 Ga0395898_0080688_2235_2807 190
7 3300037471 Ga0395905_0078625 Ga0395905_0078625_1601_2173 190
8 3300039437 Ga0436365_1777663 Ga0436365_1777663_470_1042 190
9 3300048913 Ga0496110_0325077 Ga0496110_0325077_413_985 190
10 3300048914 Ga0496111_0891659 Ga0496111_0891659_43_615 190
11 3300048916 Ga0496113_0092343 Ga0496113_0092343_1248_1820 190
12 3300048921 Ga0496118_0337769 Ga0496118_0337769_169_789 190
13 3300048924 Ga0496121_0004571 Ga0496121_0004571_5082_5702 190
14 3300049583 Ga0501067_0145557 Ga0501067_0145557_313_885 190
15 3300050507 nmdc:mga05p37_49715_c1 nmdc:mga05p37_49715_c1_3380_3952 190
16 3300050512 nmdc:mga0n895_8394_c1 nmdc:mga0n895_8394_c1_4983_5555 190
17 3300050515 nmdc:mga0a205_13358_c2 nmdc:mga0a205_13358_c2_1974_2546 190
18 3300014325 Ga0163163_10027872 Ga0163163_100278725 191
19 3300046455 Ga0495603_0046154 Ga0495603_0046154_1937_2512 191
20 3300046462 Ga0495651_0165048 Ga0495651_0165048_161_736 191
21 3300046472 Ga0495580_0031674 Ga0495580_0031674_636_1211 191
22 3300046474 Ga0495605_0040069 Ga0495605_0040069_1552_2127 191
23 3300046536 Ga0495587_0089827 Ga0495587_0089827_146_721 191
24 3300046674 Ga0495588_0072095 Ga0495588_0072095_143_718 191
25 3300046675 Ga0495657_0101426 Ga0495657_0101426_824_1399 191
26 3300046684 Ga0495669_0017600 Ga0495669_0017600_588_1163 191
27 3300046684 Ga0495669_0071269 Ga0495669_0071269_997_1572 191
28 3300047315 Ga0495581_0101105 Ga0495581_0101105_674_1249 191
29 3300047317 Ga0495604_0040276 Ga0495604_0040276_3022_3597 191
30 3300047318 Ga0495636_0280047 Ga0495636_0280047_100_675 191
31 3300047323 Ga0495683_0232989 Ga0495683_0232989_167_742 191
32 3300047444 Ga0495675_0118019 Ga0495675_0118019_36_611 191
33 3300047445 Ga0495677_0015676 Ga0495677_0015676_1849_2424 191
34 3300048088 Ga0495602_0030031 Ga0495602_0030031_895_1470 191
35 3300048907 Ga0496104_0902491 Ga0496104_0902491_168_743 191
36 3300048915 Ga0496112_0171068 Ga0496112_0171068_369_944 191
37 3300048916 Ga0496113_0637164 Ga0496113_0637164_112_687 191
38 3300048918 Ga0496115_0289000 Ga0496115_0289000_324_899 191
39 3300059508 Ga0587088_020342 Ga0587088_020342_218_793 191
40 3300059513 Ga0587094_030635 Ga0587094_030635_142_717 191
41 3300059514 Ga0587095_013868 Ga0587095_013868_30_605 191
42 3300059623 Ga0587101_020116 Ga0587101_020116_164_739 191
43 3300006846 Ga0075430_100197694 Ga0075430_1001976942 192
44 3300006880 Ga0075429_100002293 Ga0075429_1000022937 192
45 3300049588 Ga0501072_0402934 Ga0501072_0402934_18_596 192
46 3300050508 nmdc:mga09592_10768_c1 nmdc:mga09592_10768_c1_5460_6038 192
47 3300050509 nmdc:mga0qj67_298104_c1 nmdc:mga0qj67_298104_c1_427_1005 192
48 3300004799 Ga0058863_10026251 Ga0058863_100262517 193
49 3300004799 Ga0058863_10037759 Ga0058863_100377592 193
50 3300004799 Ga0058863_10136436 Ga0058863_101364362 193
51 3300004800 Ga0058861_10156011 Ga0058861_101560112 193
52 3300004801 Ga0058860_11957815 Ga0058860_119578152 193
53 3300004803 Ga0058862_10234844 Ga0058862_102348444 193
54 3300005331 Ga0070670_100051413 Ga0070670_1000514132 193
55 3300005334 Ga0068869_100578706 Ga0068869_1005787061 193
56 3300005336 Ga0070680_100062302 Ga0070680_1000623024 193
57 3300005336 Ga0070680_100102236 Ga0070680_1001022362 193
58 3300005336 Ga0070680_100206481 Ga0070680_1002064812 193
59 3300005337 Ga0070682_100291596 Ga0070682_1002915962 193
60 3300005337 Ga0070682_100463268 Ga0070682_1004632682 193
61 3300005338 Ga0068868_100024752 Ga0068868_1000247524 193
62 3300005338 Ga0068868_100034989 Ga0068868_1000349892 193
63 3300005339 Ga0070660_100033980 Ga0070660_1000339802 193
64 3300005355 Ga0070671_100041355 Ga0070671_1000413553 193
65 3300005355 Ga0070671_100085807 Ga0070671_1000858072 193
66 3300005434 Ga0070709_10004335 Ga0070709_100043358 193
67 3300005434 Ga0070709_10010621 Ga0070709_100106212 193
68 3300005434 Ga0070709_10066848 Ga0070709_100668482 193
69 3300005434 Ga0070709_10146282 Ga0070709_101462823 193
70 3300005434 Ga0070709_10846071 Ga0070709_108460711 193
71 3300005435 Ga0070714_100000096 Ga0070714_10000009656 193
72 3300005435 Ga0070714_100014828 Ga0070714_1000148285 193
73 3300005435 Ga0070714_100021848 Ga0070714_1000218484 193
74 3300005435 Ga0070714_100057752 Ga0070714_1000577521 193
75 3300005435 Ga0070714_100081313 Ga0070714_1000813133 193
76 3300005435 Ga0070714_100179139 Ga0070714_1001791392 193
77 3300005435 Ga0070714_100289683 Ga0070714_1002896832 193
78 3300005436 Ga0070713_100005638 Ga0070713_1000056385 193
79 3300005436 Ga0070713_100210876 Ga0070713_1002108763 193
80 3300005436 Ga0070713_100776000 Ga0070713_1007760001 193
81 3300005437 Ga0070710_10014281 Ga0070710_100142815 193
82 3300005437 Ga0070710_10025351 Ga0070710_100253513 193
83 3300005437 Ga0070710_10054593 Ga0070710_100545931 193
84 3300005437 Ga0070710_10062762 Ga0070710_100627622 193
85 3300005437 Ga0070710_10164129 Ga0070710_101641292 193
86 3300005439 Ga0070711_100037919 Ga0070711_1000379194 193
87 3300005439 Ga0070711_100141157 Ga0070711_1001411573 193
88 3300005439 Ga0070711_100304852 Ga0070711_1003048522 193
89 3300005444 Ga0070694_100353900 Ga0070694_1003539002 193
90 3300005445 Ga0070708_100007485 Ga0070708_1000074858 193
91 3300005445 Ga0070708_100222333 Ga0070708_1002223331 193
92 3300005456 Ga0070678_100476332 Ga0070678_1004763321 193
93 3300005458 Ga0070681_10008803 Ga0070681_1000880313 193
94 3300005458 Ga0070681_10484651 Ga0070681_104846512 193
95 3300005467 Ga0070706_100033341 Ga0070706_1000333417 193
96 3300005467 Ga0070706_100036494 Ga0070706_1000364945 193
97 3300005468 Ga0070707_100086842 Ga0070707_1000868422 193
98 3300005518 Ga0070699_100066299 Ga0070699_1000662992 193
99 3300005530 Ga0070679_100022709 Ga0070679_1000227098 193
100 3300005530 Ga0070679_100030101 Ga0070679_1000301019 193
101 3300005530 Ga0070679_100077741 Ga0070679_1000777415 193
102 3300005530 Ga0070679_100316152 Ga0070679_1003161521 193
103 3300005535 Ga0070684_100014412 Ga0070684_1000144125 193
104 3300005535 Ga0070684_101083870 Ga0070684_1010838701 193
105 3300005536 Ga0070697_100062370 Ga0070697_1000623701 193
106 3300005539 Ga0068853_100393457 Ga0068853_1003934572 193
107 3300005545 Ga0070695_100065143 Ga0070695_1000651434 193
108 3300005546 Ga0070696_100315666 Ga0070696_1003156661 193
109 3300005546 Ga0070696_100489663 Ga0070696_1004896632 193
110 3300005547 Ga0070693_100274903 Ga0070693_1002749031 193
111 3300005563 Ga0068855_100516497 Ga0068855_1005164972 193
112 3300005564 Ga0070664_100919153 Ga0070664_1009191532 193
113 3300005577 Ga0068857_100011854 Ga0068857_1000118545 193
114 3300005614 Ga0068856_100007334 Ga0068856_10000733411 193
115 3300005617 Ga0068859_100013371 Ga0068859_1000133717 193
116 3300005843 Ga0068860_100052099 Ga0068860_1000520994 193
117 3300006028 Ga0070717_10006374 Ga0070717_1000637413 193
118 3300006028 Ga0070717_10022846 Ga0070717_100228467 193
119 3300006028 Ga0070717_10093917 Ga0070717_100939172 193
120 3300006028 Ga0070717_10111819 Ga0070717_101118193 193
121 3300006175 Ga0070712_100003022 Ga0070712_10000302215 193
122 3300006175 Ga0070712_100004622 Ga0070712_1000046224 193
123 3300006847 Ga0075431_100576231 Ga0075431_1005762312 193
124 3300006914 Ga0075436_100012852 Ga0075436_1000128527 193
125 3300006931 Ga0097620_100013371 Ga0097620_1000133717 193
126 3300007265 Ga0099794_10369028 Ga0099794_103690281 193
127 3300007788 Ga0099795_10060382 Ga0099795_100603822 193
128 3300009093 Ga0105240_10037261 Ga0105240_100372619 193
129 3300009093 Ga0105240_10108134 Ga0105240_101081344 193
130 3300009093 Ga0105240_10110548 Ga0105240_101105484 193
131 3300009093 Ga0105240_10186196 Ga0105240_101861962 193
132 3300009093 Ga0105240_10228278 Ga0105240_102282782 193
133 3300009093 Ga0105240_10274537 Ga0105240_102745373 193
134 3300009093 Ga0105240_10286869 Ga0105240_102868692 193
135 3300009093 Ga0105240_10906619 Ga0105240_109066191 193
136 3300009098 Ga0105245_10005238 Ga0105245_100052386 193
137 3300009098 Ga0105245_10082389 Ga0105245_100823896 193
138 3300009098 Ga0105245_10123823 Ga0105245_101238232 193
139 3300009101 Ga0105247_10229429 Ga0105247_102294292 193
140 3300009147 Ga0114129_10030197 Ga0114129_100301977 193
141 3300009147 Ga0114129_10208126 Ga0114129_102081266 193
142 3300009148 Ga0105243_10017394 Ga0105243_100173948 193
143 3300009148 Ga0105243_10702039 Ga0105243_107020391 193
144 3300009174 Ga0105241_10002253 Ga0105241_1000225311 193
145 3300009174 Ga0105241_10063724 Ga0105241_100637242 193
146 3300009174 Ga0105241_10294305 Ga0105241_102943051 193
147 3300009174 Ga0105241_10548892 Ga0105241_105488922 193
148 3300009176 Ga0105242_10021257 Ga0105242_100212573 193
149 3300009176 Ga0105242_10133023 Ga0105242_101330235 193
150 3300009177 Ga0105248_10013851 Ga0105248_100138519 193
151 3300009177 Ga0105248_10036545 Ga0105248_100365454 193
152 3300009177 Ga0105248_10103405 Ga0105248_101034052 193
153 3300009177 Ga0105248_10252963 Ga0105248_102529632 193
154 3300009177 Ga0105248_10577948 Ga0105248_105779482 193
155 3300009545 Ga0105237_10048898 Ga0105237_100488982 193
156 3300009545 Ga0105237_10105889 Ga0105237_101058893 193
157 3300009545 Ga0105237_10248723 Ga0105237_102487232 193
158 3300009551 Ga0105238_10004639 Ga0105238_1000463913 193
159 3300009551 Ga0105238_10108840 Ga0105238_101088402 193
160 3300009551 Ga0105238_10118790 Ga0105238_101187903 193
161 3300009551 Ga0105238_10265310 Ga0105238_102653102 193
162 3300010375 Ga0105239_10063760 Ga0105239_100637603 193
163 3300010375 Ga0105239_10094486 Ga0105239_100944865 193
164 3300010375 Ga0105239_10103049 Ga0105239_101030492 193
165 3300010375 Ga0105239_10381887 Ga0105239_103818872 193
166 3300010375 Ga0105239_10681055 Ga0105239_106810552 193
167 3300010375 Ga0105239_11744843 Ga0105239_117448432 193
168 3300011119 Ga0105246_10032679 Ga0105246_100326793 193
169 3300011119 Ga0105246_10146659 Ga0105246_101466592 193
170 3300013100 Ga0157373_10001852 Ga0157373_100018522 193
171 3300013100 Ga0157373_10034685 Ga0157373_100346857 193
172 3300013100 Ga0157373_10060289 Ga0157373_100602893 193
173 3300013100 Ga0157373_10689093 Ga0157373_106890931 193
174 3300013102 Ga0157371_10016410 Ga0157371_100164102 193
175 3300013102 Ga0157371_10192378 Ga0157371_101923782 193
176 3300013104 Ga0157370_10566708 Ga0157370_105667081 193
177 3300013105 Ga0157369_10213461 Ga0157369_102134612 193
178 3300013105 Ga0157369_10286053 Ga0157369_102860532 193
179 3300013105 Ga0157369_10530669 Ga0157369_105306692 193
180 3300013296 Ga0157374_10000588 Ga0157374_1000058823 193
181 3300013296 Ga0157374_10039283 Ga0157374_100392836 193
182 3300013296 Ga0157374_10153758 Ga0157374_101537583 193
183 3300013296 Ga0157374_10158462 Ga0157374_101584621 193
184 3300013296 Ga0157374_10161972 Ga0157374_101619723 193
185 3300013297 Ga0157378_10000411 Ga0157378_1000041126 193
186 3300013297 Ga0157378_10000516 Ga0157378_100005166 193
187 3300013297 Ga0157378_10000641 Ga0157378_1000064128 193
188 3300013297 Ga0157378_10023476 Ga0157378_100234766 193
189 3300013297 Ga0157378_10110687 Ga0157378_101106874 193
190 3300013297 Ga0157378_10181281 Ga0157378_101812812 193
191 3300013297 Ga0157378_10569332 Ga0157378_105693322 193
192 3300013306 Ga0163162_10010248 Ga0163162_100102481 193
193 3300013306 Ga0163162_10065584 Ga0163162_100655846 193
194 3300013306 Ga0163162_10298543 Ga0163162_102985433 193
195 3300013306 Ga0163162_10507438 Ga0163162_105074381 193
196 3300013307 Ga0157372_10009293 Ga0157372_100092931 193
197 3300013307 Ga0157372_10016043 Ga0157372_1001604311 193
198 3300013307 Ga0157372_10029430 Ga0157372_100294304 193
199 3300013307 Ga0157372_10040143 Ga0157372_100401434 193
200 3300013307 Ga0157372_10099232 Ga0157372_100992322 193
201 3300013307 Ga0157372_10145131 Ga0157372_101451311 193
202 3300013307 Ga0157372_10213851 Ga0157372_102138512 193
203 3300013307 Ga0157372_10236271 Ga0157372_102362713 193
204 3300013307 Ga0157372_10281682 Ga0157372_102816822 193
205 3300013308 Ga0157375_10466818 Ga0157375_104668182 193
206 3300014325 Ga0163163_10016389 Ga0163163_100163892 193
207 3300014325 Ga0163163_10038186 Ga0163163_100381866 193
208 3300014325 Ga0163163_10238385 Ga0163163_102383852 193
209 3300014325 Ga0163163_11362196 Ga0163163_113621961 193
210 3300014497 Ga0182008_10009078 Ga0182008_100090788 193
211 3300014745 Ga0157377_10293428 Ga0157377_102934282 193
212 3300014968 Ga0157379_10033657 Ga0157379_100336574 193
213 3300014968 Ga0157379_10320419 Ga0157379_103204192 193
214 3300014968 Ga0157379_10787096 Ga0157379_107870961 193
215 3300014969 Ga0157376_10103087 Ga0157376_101030873 193
216 3300014969 Ga0157376_10166124 Ga0157376_101661242 193
217 3300014969 Ga0157376_10327637 Ga0157376_103276372 193
218 3300015262 Ga0182007_10012624 Ga0182007_100126243 193
219 3300015265 Ga0182005_1024393 Ga0182005_10243932 193
220 3300019183 Ga0184601_131050 Ga0184601_1310503 193
221 3300021358 Ga0213873_10034791 Ga0213873_100347911 193
222 3300021361 Ga0213872_10002663 Ga0213872_1000266313 193
223 3300021361 Ga0213872_10010393 Ga0213872_100103933 193
224 3300021361 Ga0213872_10155277 Ga0213872_101552772 193
225 3300021377 Ga0213874_10013462 Ga0213874_100134621 193
226 3300021441 Ga0213871_10000310 Ga0213871_100003105 193
227 3300025898 Ga0207692_10006388 Ga0207692_100063883 193
228 3300025906 Ga0207699_10005640 Ga0207699_100056405 193
229 3300025906 Ga0207699_10032560 Ga0207699_100325604 193
230 3300025906 Ga0207699_10185910 Ga0207699_101859102 193
231 3300025911 Ga0207654_10078455 Ga0207654_100784552 193
232 3300025912 Ga0207707_10003361 Ga0207707_100033616 193
233 3300025913 Ga0207695_10132896 Ga0207695_101328962 193
234 3300025913 Ga0207695_10133436 Ga0207695_101334362 193
235 3300025915 Ga0207693_10001260 Ga0207693_100012607 193
236 3300025915 Ga0207693_10004232 Ga0207693_100042321 193
237 3300025915 Ga0207693_10017084 Ga0207693_100170842 193
238 3300025915 Ga0207693_10214442 Ga0207693_102144422 193
239 3300025917 Ga0207660_10071681 Ga0207660_100716813 193
240 3300025921 Ga0207652_10007763 Ga0207652_100077634 193
241 3300025927 Ga0207687_10007797 Ga0207687_100077971 193
242 3300025928 Ga0207700_10063404 Ga0207700_100634041 193
243 3300025928 Ga0207700_10077528 Ga0207700_100775283 193
244 3300025928 Ga0207700_10318586 Ga0207700_103185862 193
245 3300025929 Ga0207664_10000087 Ga0207664_1000008765 193
246 3300025929 Ga0207664_10068430 Ga0207664_100684302 193
247 3300025929 Ga0207664_10108154 Ga0207664_101081542 193
248 3300025939 Ga0207665_10026437 Ga0207665_100264372 193
249 3300025944 Ga0207661_10022412 Ga0207661_100224125 193
250 3300025944 Ga0207661_10080823 Ga0207661_100808233 193
251 3300025949 Ga0207667_10364698 Ga0207667_103646983 193
252 3300025981 Ga0207640_10041360 Ga0207640_100413603 193
253 3300026023 Ga0207677_10004546 Ga0207677_100045465 193
254 3300026041 Ga0207639_10447872 Ga0207639_104478722 193
255 3300026078 Ga0207702_10013988 Ga0207702_100139888 193
256 3300026088 Ga0207641_10008139 Ga0207641_1000813910 193
257 3300026095 Ga0207676_10028706 Ga0207676_100287064 193
258 3300028381 Ga0268264_10020090 Ga0268264_100200905 193
259 3300028666 Ga0265336_10040710 Ga0265336_100407101 193
260 3300028800 Ga0265338_10100116 Ga0265338_101001162 193
261 3300028800 Ga0265338_10134881 Ga0265338_101348814 193
262 3300030836 Ga0265767_100139 Ga0265767_1001393 193
263 3300031235 Ga0265330_10215121 Ga0265330_102151212 193
264 3300031241 Ga0265325_10026100 Ga0265325_100261002 193
265 3300031247 Ga0265340_10007516 Ga0265340_100075167 193
266 3300031344 Ga0265316_10230653 Ga0265316_102306532 193
267 3300031344 Ga0265316_10607160 Ga0265316_106071601 193
268 3300031548 Ga0307408_100038203 Ga0307408_1000382032 193
269 3300031711 Ga0265314_10138873 Ga0265314_101388732 193
270 3300031731 Ga0307405_10015156 Ga0307405_100151565 193
271 3300031731 Ga0307405_10128624 Ga0307405_101286242 193
272 3300031824 Ga0307413_10126764 Ga0307413_101267641 193
273 3300031852 Ga0307410_10138300 Ga0307410_101383001 193
274 3300031903 Ga0307407_10372992 Ga0307407_103729921 193
275 3300031995 Ga0307409_100081033 Ga0307409_1000810333 193
276 3300031995 Ga0307409_100310441 Ga0307409_1003104411 193
277 3300032002 Ga0307416_101004170 Ga0307416_1010041701 193
278 3300032126 Ga0307415_100013588 Ga0307415_1000135883 193
279 3300032126 Ga0307415_100144010 Ga0307415_1001440104 193
280 3300032126 Ga0307415_101232857 Ga0307415_1012328571 193
281 3300034816 Ga0373930_0059074 Ga0373930_0059074_260_841 193
282 3300035083 Ga0373926_0001605 Ga0373926_0001605_1371_1952 193
283 3300035083 Ga0373926_0003574 Ga0373926_0003574_2478_3059 193
284 3300035085 Ga0373929_0050219 Ga0373929_0050219_128_709 193
285 3300035086 Ga0373934_0054968 Ga0373934_0054968_132_713 193
286 3300035086 Ga0373934_0102134 Ga0373934_0102134_183_764 193
287 3300035086 Ga0373934_0300413 Ga0373934_0300413_47_628 193
288 3300035088 Ga0373940_0124714 Ga0373940_0124714_57_638 193
289 3300035091 Ga0373951_0011910 Ga0373951_0011910_1311_1892 193
290 3300035111 Ga0373923_0057443 Ga0373923_0057443_294_875 193
291 3300035111 Ga0373923_0353723 Ga0373923_0353723_46_627 193
292 3300035112 Ga0373932_0033795 Ga0373932_0033795_174_755 193
293 3300035112 Ga0373932_0044220 Ga0373932_0044220_30_611 193
294 3300035113 Ga0373936_0002697 Ga0373936_0002697_4792_5373 193
295 3300035113 Ga0373936_0004182 Ga0373936_0004182_996_1577 193
296 3300035113 Ga0373936_0039861 Ga0373936_0039861_850_1431 193
297 3300035113 Ga0373936_0201330 Ga0373936_0201330_71_652 193
298 3300035114 Ga0373939_0026421 Ga0373939_0026421_220_801 193
299 3300035114 Ga0373939_0042332 Ga0373939_0042332_170_751 193
300 3300035115 Ga0373941_0063619 Ga0373941_0063619_251_832 193
301 3300035115 Ga0373941_0095216 Ga0373941_0095216_75_656 193
302 3300035116 Ga0373945_0076153 Ga0373945_0076153_600_1181 193
303 3300035116 Ga0373945_0211146 Ga0373945_0211146_210_791 193
304 3300035116 Ga0373945_0244323 Ga0373945_0244323_81_662 193
305 3300035117 Ga0373953_0108341 Ga0373953_0108341_130_711 193
306 3300035118 Ga0373954_0081901 Ga0373954_0081901_61_642 193
307 3300035119 Ga0373956_0008775 Ga0373956_0008775_1616_2197 193
308 3300035119 Ga0373956_0121721 Ga0373956_0121721_220_801 193
309 3300035120 Ga0373957_0103483 Ga0373957_0103483_364_945 193
310 3300035121 Ga0373960_0005438 Ga0373960_0005438_955_1536 193
311 3300035121 Ga0373960_0028473 Ga0373960_0028473_166_747 193
312 3300035170 Ga0373943_0000594 Ga0373943_0000594_2728_3309 193
313 3300035170 Ga0373943_0094669 Ga0373943_0094669_939_1520 193
314 3300035170 Ga0373943_0122694 Ga0373943_0122694_618_1199 193
315 3300035171 Ga0373946_0011730 Ga0373946_0011730_303_884 193
316 3300035172 Ga0373955_0098421 Ga0373955_0098421_1001_1582 193
317 3300035172 Ga0373955_0369090 Ga0373955_0369090_60_641 193
318 3300035172 Ga0373955_0403489 Ga0373955_0403489_79_660 193
319 3300035172 Ga0373955_0516715 Ga0373955_0516715_124_705 193
320 3300035172 Ga0373955_0656555 Ga0373955_0656555_31_612 193
321 3300035241 Ga0373961_0023934 Ga0373961_0023934_381_962 193
322 3300035410 Ga0373924_0265450 Ga0373924_0265450_59_640 193
323 3300035410 Ga0373924_0272396 Ga0373924_0272396_29_610 193
324 3300035691 Ga0373931_0025357 Ga0373931_0025357_1932_2513 193
325 3300035691 Ga0373931_0029341 Ga0373931_0029341_1392_1973 193
326 3300035691 Ga0373931_0043624 Ga0373931_0043624_270_851 193
327 3300035691 Ga0373931_0337178 Ga0373931_0337178_287_868 193
328 3300035691 Ga0373931_0463015 Ga0373931_0463015_171_752 193
329 3300035692 Ga0373935_0001675 Ga0373935_0001675_4508_5089 193
330 3300035692 Ga0373935_0190175 Ga0373935_0190175_529_1110 193
331 3300035692 Ga0373935_0425978 Ga0373935_0425978_59_640 193
332 3300035692 Ga0373935_0449172 Ga0373935_0449172_316_897 193
333 3300035695 Ga0373927_0000747 Ga0373927_0000747_15928_16509 193
334 3300035695 Ga0373927_0440199 Ga0373927_0440199_30_611 193
335 3300035695 Ga0373927_0447087 Ga0373927_0447087_213_794 193
336 3300035695 Ga0373927_0530360 Ga0373927_0530360_107_688 193
337 3300035724 Ga0373933_0336351 Ga0373933_0336351_351_932 193
338 3300035725 Ga0373947_0000971 Ga0373947_0000971_3451_4032 193
339 3300035725 Ga0373947_0001211 Ga0373947_0001211_10225_10806 193
340 3300035725 Ga0373947_0020444 Ga0373947_0020444_1665_2246 193
341 3300035725 Ga0373947_0084341 Ga0373947_0084341_521_1102 193
342 3300036401 Ga0373937_0054915 Ga0373937_0054915_2670_3251 193
343 3300036401 Ga0373937_0126516 Ga0373937_0126516_1518_2099 193
344 3300036401 Ga0373937_0151139 Ga0373937_0151139_732_1313 193
345 3300036401 Ga0373937_0231089 Ga0373937_0231089_286_867 193
346 3300036401 Ga0373937_0345213 Ga0373937_0345213_710_1291 193
347 3300036401 Ga0373937_0577078 Ga0373937_0577078_433_1014 193
348 3300036457 Ga0265778_000492 Ga0265778_000492_2032_2613 193
349 3300036457 Ga0265778_012606 Ga0265778_012606_114_695 193
350 3300037068 Ga0373925_0021559 Ga0373925_0021559_1481_2062 193
351 3300037068 Ga0373925_0033272 Ga0373925_0033272_1673_2254 193
352 3300037068 Ga0373925_0059866 Ga0373925_0059866_1419_2000 193
353 3300037068 Ga0373925_0162989 Ga0373925_0162989_63_644 193
354 3300037068 Ga0373925_0260673 Ga0373925_0260673_701_1282 193
355 3300037466 Ga0395898_0077092 Ga0395898_0077092_2035_2616 193
356 3300037853 Ga0436364_1031963 Ga0436364_1031963_2175_2756 193
357 3300038443 Ga0395901_0270701 Ga0395901_0270701_942_1523 193
358 3300038443 Ga0395901_0716095 Ga0395901_0716095_266_847 193
359 3300039437 Ga0436365_1271434 Ga0436365_1271434_183_764 193
360 3300039437 Ga0436365_1790709 Ga0436365_1790709_53_634 193
361 3300039438 Ga0436360_0624708 Ga0436360_0624708_69_650 193
362 3300039438 Ga0436360_0855749 Ga0436360_0855749_18_599 193
363 3300039438 Ga0436360_1207783 Ga0436360_1207783_1063_1644 193
364 3300039447 Ga0436361_0209675 Ga0436361_0209675_2093_2674 193
365 3300039447 Ga0436361_0382600 Ga0436361_0382600_643_1224 193
366 3300039447 Ga0436361_0689088 Ga0436361_0689088_1393_1974 193
367 3300039447 Ga0436361_0938053 Ga0436361_0938053_1509_2090 193
368 3300039450 Ga0436363_0314896 Ga0436363_0314896_1868_2449 193
369 3300039450 Ga0436363_0852547 Ga0436363_0852547_35_616 193
370 3300039450 Ga0436363_1142140 Ga0436363_1142140_799_1380 193
371 3300039450 Ga0436363_1380006 Ga0436363_1380006_320_901 193
372 3300039450 Ga0436363_1692139 Ga0436363_1692139_252_833 193
373 3300039453 Ga0436362_0535191 Ga0436362_0535191_32_613 193
374 3300042876 Ga0451577_0694484 Ga0451577_0694484_25_606 193
375 3300044673 Ga0453683_0063100 Ga0453683_0063100_1287_1868 193
376 3300044683 Ga0466965_0266526 Ga0466965_0266526_163_744 193
377 3300044684 Ga0466966_0047128 Ga0466966_0047128_946_1527 193
378 3300044684 Ga0466966_0152134 Ga0466966_0152134_143_724 193
379 3300044693 Ga0466961_0089241 Ga0466961_0089241_64_645 193
380 3300044693 Ga0466961_0156584 Ga0466961_0156584_149_730 193
381 3300044693 Ga0466961_0293117 Ga0466961_0293117_279_860 193
382 3300044694 Ga0466963_0000986 Ga0466963_0000986_9133_9714 193
383 3300044694 Ga0466963_0092431 Ga0466963_0092431_912_1493 193
384 3300044694 Ga0466963_0544574 Ga0466963_0544574_69_650 193
385 3300044706 Ga0466964_0407546 Ga0466964_0407546_101_682 193
386 3300044712 Ga0453684_0000951 Ga0453684_0000951_79546_80127 193
387 3300044842 Ga0466957_0346492 Ga0466957_0346492_286_867 193
388 3300044842 Ga0466957_0473955 Ga0466957_0473955_144_725 193
389 3300044842 Ga0466957_0795093 Ga0466957_0795093_46_627 193
390 3300045049 Ga0466959_0328204 Ga0466959_0328204_96_677 193
391 3300045049 Ga0466959_0524886 Ga0466959_0524886_149_730 193
392 3300045051 Ga0451576_0395444 Ga0451576_0395444_206_787 193
393 3300045836 Ga0466958_0016862 Ga0466958_0016862_975_1556 193
394 3300045976 Ga0466967_0008372 Ga0466967_0008372_1432_2013 193
395 3300045976 Ga0466967_0128251 Ga0466967_0128251_1423_2019 193
396 3300045976 Ga0466967_0259472 Ga0466967_0259472_570_1151 193
397 3300045976 Ga0466967_0283528 Ga0466967_0283528_554_1135 193
398 3300046457 Ga0495590_0087060 Ga0495590_0087060_252_833 193
399 3300046459 Ga0495629_0164610 Ga0495629_0164610_714_1295 193
400 3300046463 Ga0495653_0406401 Ga0495653_0406401_199_780 193
401 3300046472 Ga0495580_0001673 Ga0495580_0001673_13170_13751 193
402 3300046472 Ga0495580_0001845 Ga0495580_0001845_1965_2546 193
403 3300046472 Ga0495580_0004834 Ga0495580_0004834_8712_9293 193
404 3300046472 Ga0495580_0005942 Ga0495580_0005942_5236_5817 193
405 3300046472 Ga0495580_0018154 Ga0495580_0018154_4069_4650 193
406 3300046472 Ga0495580_0055771 Ga0495580_0055771_1078_1659 193
407 3300046472 Ga0495580_0095688 Ga0495580_0095688_197_778 193
408 3300046472 Ga0495580_0161799 Ga0495580_0161799_261_842 193
409 3300046472 Ga0495580_0395723 Ga0495580_0395723_158_739 193
410 3300046472 Ga0495580_0417060 Ga0495580_0417060_36_617 193
411 3300046473 Ga0495582_0000596 Ga0495582_0000596_12323_12904 193
412 3300046473 Ga0495582_0037043 Ga0495582_0037043_364_945 193
413 3300046473 Ga0495582_0078987 Ga0495582_0078987_225_806 193
414 3300046475 Ga0495639_0175929 Ga0495639_0175929_16_597 193
415 3300046477 Ga0495664_0254302 Ga0495664_0254302_145_726 193
416 3300046507 Ga0495606_0120784 Ga0495606_0120784_55_636 193
417 3300046516 Ga0495628_0317387 Ga0495628_0317387_23_604 193
418 3300046517 Ga0495630_0097944 Ga0495630_0097944_553_1134 193
419 3300046517 Ga0495630_0498970 Ga0495630_0498970_177_758 193
420 3300046526 Ga0495666_0034520 Ga0495666_0034520_425_1006 193
421 3300046529 Ga0495652_0127181 Ga0495652_0127181_61_642 193
422 3300046529 Ga0495652_0210409 Ga0495652_0210409_63_644 193
423 3300046531 Ga0495665_0019981 Ga0495665_0019981_2168_2749 193
424 3300046531 Ga0495665_0040708 Ga0495665_0040708_55_636 193
425 3300046531 Ga0495665_0079884 Ga0495665_0079884_178_759 193
426 3300046535 Ga0495586_0057650 Ga0495586_0057650_923_1504 193
427 3300046536 Ga0495587_0491001 Ga0495587_0491001_69_650 193
428 3300046543 Ga0495645_0160096 Ga0495645_0160096_376_957 193
429 3300046559 Ga0495667_0162033 Ga0495667_0162033_541_1122 193
430 3300046681 Ga0495647_0259766 Ga0495647_0259766_165_746 193
431 3300046684 Ga0495669_0068720 Ga0495669_0068720_760_1341 193
432 3300046684 Ga0495669_0134815 Ga0495669_0134815_369_950 193
433 3300046690 Ga0495624_0135893 Ga0495624_0135893_170_751 193
434 3300046690 Ga0495624_0325832 Ga0495624_0325832_120_701 193
435 3300046694 Ga0495649_0077651 Ga0495649_0077651_60_641 193
436 3300047315 Ga0495581_0310403 Ga0495581_0310403_232_813 193
437 3300047319 Ga0495674_0180903 Ga0495674_0180903_185_766 193
438 3300047319 Ga0495674_0323002 Ga0495674_0323002_342_923 193
439 3300047319 Ga0495674_0596391 Ga0495674_0596391_121_702 193
440 3300047443 Ga0495687_104264 Ga0495687_104264_347_928 193
441 3300047444 Ga0495675_0468254 Ga0495675_0468254_76_657 193
442 3300047471 Ga0495684_0695282 Ga0495684_0695282_62_643 193
443 3300047471 Ga0495684_0714570 Ga0495684_0714570_16_597 193
444 3300048088 Ga0495602_0363205 Ga0495602_0363205_16_597 193
445 3300048089 Ga0495614_0225108 Ga0495614_0225108_35_616 193
446 3300048903 Ga0496100_0045986 Ga0496100_0045986_1114_1695 193
447 3300048903 Ga0496100_0268251 Ga0496100_0268251_65_646 193
448 3300048903 Ga0496100_0352937 Ga0496100_0352937_286_867 193
449 3300048904 Ga0496101_0220663 Ga0496101_0220663_867_1448 193
450 3300048904 Ga0496101_0387805 Ga0496101_0387805_39_620 193
451 3300048904 Ga0496101_0427794 Ga0496101_0427794_342_923 193
452 3300048905 Ga0496102_0003212 Ga0496102_0003212_8565_9146 193
453 3300048905 Ga0496102_0016554 Ga0496102_0016554_3245_3826 193
454 3300048905 Ga0496102_0081622 Ga0496102_0081622_1715_2296 193
455 3300048905 Ga0496102_0456557 Ga0496102_0456557_254_835 193
456 3300048905 Ga0496102_0476208 Ga0496102_0476208_398_979 193
457 3300048906 Ga0496103_0002380 Ga0496103_0002380_3850_4431 193
458 3300048906 Ga0496103_0129820 Ga0496103_0129820_817_1398 193
459 3300048907 Ga0496104_0083424 Ga0496104_0083424_1878_2459 193
460 3300048907 Ga0496104_0124754 Ga0496104_0124754_636_1217 193
461 3300048907 Ga0496104_0142669 Ga0496104_0142669_1387_1968 193
462 3300048907 Ga0496104_0345845 Ga0496104_0345845_772_1353 193
463 3300048907 Ga0496104_1157341 Ga0496104_1157341_60_641 193
464 3300048908 Ga0496105_0308346 Ga0496105_0308346_89_670 193
465 3300048908 Ga0496105_0532248 Ga0496105_0532248_327_908 193
466 3300048909 Ga0496106_0108392 Ga0496106_0108392_1474_2055 193
467 3300048909 Ga0496106_0187507 Ga0496106_0187507_927_1508 193
468 3300048909 Ga0496106_0556673 Ga0496106_0556673_138_719 193
469 3300048910 Ga0496107_0158253 Ga0496107_0158253_1073_1654 193
470 3300048910 Ga0496107_0857144 Ga0496107_0857144_19_600 193
471 3300048911 Ga0496108_0022698 Ga0496108_0022698_74_655 193
472 3300048911 Ga0496108_0057994 Ga0496108_0057994_1032_1613 193
473 3300048911 Ga0496108_0727150 Ga0496108_0727150_86_667 193
474 3300048912 Ga0496109_0059551 Ga0496109_0059551_1878_2459 193
475 3300048912 Ga0496109_0083291 Ga0496109_0083291_2234_2815 193
476 3300048912 Ga0496109_0989319 Ga0496109_0989319_119_700 193
477 3300048913 Ga0496110_0618221 Ga0496110_0618221_238_819 193
478 3300048915 Ga0496112_0003360 Ga0496112_0003360_1931_2512 193
479 3300048915 Ga0496112_0027473 Ga0496112_0027473_763_1344 193
480 3300048915 Ga0496112_0045265 Ga0496112_0045265_3483_4064 193
481 3300048915 Ga0496112_0080868 Ga0496112_0080868_64_645 193
482 3300048915 Ga0496112_0330085 Ga0496112_0330085_58_639 193
483 3300048915 Ga0496112_0447852 Ga0496112_0447852_575_1156 193
484 3300048916 Ga0496113_0049168 Ga0496113_0049168_2522_3103 193
485 3300048916 Ga0496113_0596932 Ga0496113_0596932_69_650 193
486 3300048916 Ga0496113_0637604 Ga0496113_0637604_128_709 193
487 3300048917 Ga0496114_0916500 Ga0496114_0916500_35_616 193
488 3300048918 Ga0496115_0004694 Ga0496115_0004694_6923_7504 193
489 3300048918 Ga0496115_0097755 Ga0496115_0097755_1349_1930 193
490 3300048918 Ga0496115_0641457 Ga0496115_0641457_51_632 193
491 3300048918 Ga0496115_0860945 Ga0496115_0860945_91_672 193
492 3300049460 Ga0495682_0181155 Ga0495682_0181155_10_591 193
493 3300049522 Ga0501299_077580 Ga0501299_077580_128_709 193
494 3300049679 Ga0501249_005219 Ga0501249_005219_674_1255 193
495 3300049771 Ga0501274_011428 Ga0501274_011428_149_730 193
496 3300050510 nmdc:mga06r32_554166_c1 nmdc:mga06r32_554166_c1_431_1012 193
497 3300050512 nmdc:mga0n895_1436792_c1 nmdc:mga0n895_1436792_c1_63_644 193
498 3300050512 nmdc:mga0n895_231102_c1 nmdc:mga0n895_231102_c1_864_1445 193
499 3300050512 nmdc:mga0n895_267034_c1 nmdc:mga0n895_267034_c1_302_883 193
500 3300050512 nmdc:mga0n895_344_c1 nmdc:mga0n895_344_c1_12063_12644 193
501 3300050513 nmdc:mga0rr50_198174_c1 nmdc:mga0rr50_198174_c1_447_1028 193
502 3300050513 nmdc:mga0rr50_872_c1 nmdc:mga0rr50_872_c1_1048_1629 193
503 3300050514 nmdc:mga08x19_1302_c1 nmdc:mga08x19_1302_c1_1743_2324 193
504 3300050514 nmdc:mga08x19_3391_c1 nmdc:mga08x19_3391_c1_8344_8925 193
505 3300050514 nmdc:mga08x19_3614_c1 nmdc:mga08x19_3614_c1_4619_5200 193
506 3300050514 nmdc:mga08x19_54609_c1 nmdc:mga08x19_54609_c1_328_909 193
507 3300050515 nmdc:mga0a205_896_c2 nmdc:mga0a205_896_c2_12026_12607 193
508 3300053077 Ga0495601_0081121 Ga0495601_0081121_348_929 193
509 3300053077 Ga0495601_0528441 Ga0495601_0528441_72_653 193
510 3300053078 Ga0495612_0301436 Ga0495612_0301436_19_600 193
511 3300053085 Ga0495619_0066799 Ga0495619_0066799_1050_1631 193
512 3300053085 Ga0495619_0200847 Ga0495619_0200847_12_593 193
513 3300059477 Ga0587084_022376 Ga0587084_022376_163_744 193
514 3300059478 Ga0587093_001799 Ga0587093_001799_1232_1813 193
515 3300059508 Ga0587088_022059 Ga0587088_022059_192_773 193
516 3300059606 Ga0587121_03790 Ga0587121_03790_71_652 193
517 3300059622 Ga0587099_010779 Ga0587099_010779_179_760 193
518 3300059623 Ga0587101_011958 Ga0587101_011958_351_932 193
519 3300059630 Ga0587128_012200 Ga0587128_012200_119_700 193
520 3300059631 Ga0587130_007888 Ga0587130_007888_179_760 193
521 3300059640 Ga0587067_022361 Ga0587067_022361_262_843 193
522 3300059643 Ga0587072_033771 Ga0587072_033771_101_682 193
523 3300059651 Ga0587105_004925 Ga0587105_004925_83_664 193
524 3300060344 Ga0587071_073893 Ga0587071_073893_77_658 193
525 3300061719 Ga0466962_0315455 Ga0466962_0315455_61_642 193
526 3300061734 Ga0530510_0008715 Ga0530510_0008715_4323_4919 193
527 3300005536 Ga0070697_101174357 Ga0070697_1011743571 195
528 3300046518 Ga0495631_0132767 Ga0495631_0132767_366_986 195
529 3300046691 Ga0495670_0060245 Ga0495670_0060245_836_1456 195
530 3300044712 Ga0453684_0010967 Ga0453684_0010967_1996_2595 198
531 3300044712 Ga0453684_0829514 Ga0453684_0829514_120_719 198
532 3300005437 Ga0070710_10432680 Ga0070710_104326802 199
533 3300007076 Ga0075435_100150546 Ga0075435_1001505461 199
534 3300035170 Ga0373943_0138576 Ga0373943_0138576_94_693 199
535 3300035724 Ga0373933_0372896 Ga0373933_0372896_94_693 199
536 3300041496 Ga0451839_1143755 Ga0451839_1143755_23_622 199
537 3300046679 Ga0495623_0215479 Ga0495623_0215479_352_951 199
538 3300025893 Ga0207682_10365728 Ga0207682_103657281 202
539 3300025923 Ga0207681_10533825 Ga0207681_105338252 202
540 3300044673 Ga0453683_0099584 Ga0453683_0099584_655_1263 202
541 3300048909 Ga0496106_0519942 Ga0496106_0519942_307_915 202
542 3300005328 Ga0070676_10464982 Ga0070676_104649822 206
543 3300005347 Ga0070668_100114484 Ga0070668_1001144842 206
544 3300005535 Ga0070684_100280465 Ga0070684_1002804652 206
545 3300005545 Ga0070695_100338990 Ga0070695_1003389901 206
546 3300005549 Ga0070704_100275399 Ga0070704_1002753992 206
547 3300006058 Ga0075432_10027314 Ga0075432_100273143 206
548 3300006844 Ga0075428_100253498 Ga0075428_1002534982 206
549 3300006846 Ga0075430_100008055 Ga0075430_10000805514 206
550 3300006847 Ga0075431_100012805 Ga0075431_1000128054 206
551 3300006852 Ga0075433_10019501 Ga0075433_100195016 206
552 3300006871 Ga0075434_100024374 Ga0075434_10002437410 206
553 3300006880 Ga0075429_100031807 Ga0075429_1000318076 206
554 3300006881 Ga0068865_100647073 Ga0068865_1006470732 206
555 3300009098 Ga0105245_11513123 Ga0105245_115131231 206
556 3300009147 Ga0114129_10115757 Ga0114129_101157575 206
557 3300009147 Ga0114129_10549684 Ga0114129_105496842 206
558 3300014325 Ga0163163_10063924 Ga0163163_100639245 206
559 3300025945 Ga0207679_11324682 Ga0207679_113246821 206
560 3300025972 Ga0207668_10363073 Ga0207668_103630732 206
561 3300026089 Ga0207648_10525679 Ga0207648_105256792 206
562 3300026095 Ga0207676_10049309 Ga0207676_100493095 206
563 3300026095 Ga0207676_10290649 Ga0207676_102906491 206
564 3300026095 Ga0207676_10709036 Ga0207676_107090362 206
565 3300026116 Ga0207674_10529493 Ga0207674_105294931 206
566 3300026142 Ga0207698_10558773 Ga0207698_105587732 206
567 3300031344 Ga0265316_10088489 Ga0265316_100884893 206
568 3300031344 Ga0265316_10330089 Ga0265316_103300892 206
569 3300031727 Ga0316576_10010133 Ga0316576_100101335 206
570 3300032133 Ga0316583_10021356 Ga0316583_100213564 206
571 3300035398 Ga0316574_0059501 Ga0316574_0059501_1243_1863 206
572 3300036712 Ga0316584_0073536 Ga0316584_0073536_1787_2407 206
573 3300037312 Ga0395899_0080728 Ga0395899_0080728_815_1435 206
574 3300038443 Ga0395901_0453925 Ga0395901_0453925_343_963 206
575 3300041512 Ga0451853_0430726 Ga0451853_0430726_1158_1778 206
576 3300048905 Ga0496102_0391639 Ga0496102_0391639_270_890 206
577 3300048912 Ga0496109_0047729 Ga0496109_0047729_2150_2770 206
578 3300048913 Ga0496110_0304919 Ga0496110_0304919_803_1423 206
579 3300048913 Ga0496110_0362898 Ga0496110_0362898_307_927 206
580 3300048914 Ga0496111_0124599 Ga0496111_0124599_688_1308 206
581 3300048915 Ga0496112_0427765 Ga0496112_0427765_354_974 206
582 3300048915 Ga0496112_0872889 Ga0496112_0872889_67_687 206
583 3300048916 Ga0496113_0352579 Ga0496113_0352579_246_866 206
584 3300049575 Ga0501039_0381689 Ga0501039_0381689_224_844 206
585 3300049585 Ga0501069_0419246 Ga0501069_0419246_127_747 206
586 3300049591 Ga0501075_0304697 Ga0501075_0304697_107_727 206
587 3300049593 Ga0501077_0209336 Ga0501077_0209336_228_848 206
588 3300050490 nmdc:mga03n38_488740_c1 nmdc:mga03n38_488740_c1_53_673 206
589 3300050507 nmdc:mga05p37_18551_c1 nmdc:mga05p37_18551_c1_356_976 206
590 3300050507 nmdc:mga05p37_89014_c1 nmdc:mga05p37_89014_c1_2535_3155 206
591 3300050508 nmdc:mga09592_12635_c1 nmdc:mga09592_12635_c1_1130_1750 206
592 3300050509 nmdc:mga0qj67_5582_c1 nmdc:mga0qj67_5582_c1_1258_1878 206
593 3300050510 nmdc:mga06r32_24817_c1 nmdc:mga06r32_24817_c1_1582_2202 206
594 3300061734 Ga0530510_0164995 Ga0530510_0164995_609_1229 206
595 3300003579 Ga0007429J51699_1127926 Ga0007429J51699_11279262 208
596 3300004799 Ga0058863_11884672 Ga0058863_118846722 208
597 3300004800 Ga0058861_11876811 Ga0058861_118768111 208
598 3300004803 Ga0058862_12696583 Ga0058862_126965832 208
599 3300005547 Ga0070693_100525745 Ga0070693_1005257452 208
600 3300006844 Ga0075428_100009444 Ga0075428_10000944412 208
601 3300006846 Ga0075430_100001741 Ga0075430_10000174114 208
602 3300006847 Ga0075431_100037006 Ga0075431_1000370067 208
603 3300006880 Ga0075429_100012040 Ga0075429_10001204012 208
604 3300009147 Ga0114129_10003653 Ga0114129_1000365329 208
605 3300020070 Ga0206356_11492308 Ga0206356_114923081 208
606 3300022467 Ga0224712_10133673 Ga0224712_101336731 208
607 3300026075 Ga0207708_10519098 Ga0207708_105190982 208
608 3300031665 Ga0316575_10019726 Ga0316575_100197263 208
609 3300031691 Ga0316579_10115099 Ga0316579_101150992 208
610 3300032133 Ga0316583_10001999 Ga0316583_100019994 208
611 3300032168 Ga0316593_10002310 Ga0316593_100023103 208
612 3300033541 Ga0316596_1010400 Ga0316596_10104001 208
613 3300035398 Ga0316574_0231056 Ga0316574_0231056_133_759 208
614 3300036647 Ga0316582_0004900 Ga0316582_0004900_2858_3484 208
615 3300036712 Ga0316584_0072077 Ga0316584_0072077_1521_2147 208
616 3300041494 Ga0451837_0208259 Ga0451837_0208259_1290_1919 208
617 3300049582 Ga0501048_0362754 Ga0501048_0362754_361_987 208
618 3300049587 Ga0501071_0056652 Ga0501071_0056652_848_1477 208
619 3300049742 Ga0501080_0047083 Ga0501080_0047083_3312_3941 208
620 3300049742 Ga0501080_0390994 Ga0501080_0390994_445_1074 208
621 3300050493 nmdc:mga0k408_89190_c1 nmdc:mga0k408_89190_c1_347_976 208
622 3300050507 nmdc:mga05p37_6288_c1 nmdc:mga05p37_6288_c1_7609_8235 208
623 3300050508 nmdc:mga09592_3850_c1 nmdc:mga09592_3850_c1_2390_3016 208
624 3300050509 nmdc:mga0qj67_134910_c1 nmdc:mga0qj67_134910_c1_448_1074 208
625 3300050509 nmdc:mga0qj67_5215_c1 nmdc:mga0qj67_5215_c1_6251_6877 208
626 3300050510 nmdc:mga06r32_1321_c1 nmdc:mga06r32_1321_c1_13912_14538 208
627 3300001976 JGI24752J21851_1006565 JGI24752J21851_10065651 209
628 3300004798 Ga0058859_11329556 Ga0058859_113295562 209
629 3300004798 Ga0058859_11779288 Ga0058859_117792882 209
630 3300004801 Ga0058860_12198664 Ga0058860_121986647 209
631 3300004803 Ga0058862_10043223 Ga0058862_100432232 209
632 3300005290 Ga0065712_10079443 Ga0065712_100794434 209
633 3300005293 Ga0065715_10109115 Ga0065715_101091151 209
634 3300005293 Ga0065715_10145303 Ga0065715_101453033 209
635 3300005293 Ga0065715_10280885 Ga0065715_102808851 209
636 3300005327 Ga0070658_10507017 Ga0070658_105070171 209
637 3300005329 Ga0070683_100009168 Ga0070683_1000091682 209
638 3300005329 Ga0070683_100175744 Ga0070683_1001757443 209
639 3300005329 Ga0070683_100255121 Ga0070683_1002551211 209
640 3300005329 Ga0070683_100273793 Ga0070683_1002737932 209
641 3300005329 Ga0070683_100383417 Ga0070683_1003834172 209
642 3300005329 Ga0070683_100504504 Ga0070683_1005045041 209
643 3300005329 Ga0070683_100592877 Ga0070683_1005928772 209
644 3300005330 Ga0070690_100000550 Ga0070690_10000055029 209
645 3300005331 Ga0070670_100025892 Ga0070670_1000258922 209
646 3300005331 Ga0070670_100090897 Ga0070670_1000908971 209
647 3300005331 Ga0070670_101051226 Ga0070670_1010512261 209
648 3300005333 Ga0070677_10018326 Ga0070677_100183261 209
649 3300005334 Ga0068869_100000786 Ga0068869_10000078615 209
650 3300005334 Ga0068869_100001846 Ga0068869_1000018464 209
651 3300005334 Ga0068869_100029277 Ga0068869_1000292774 209
652 3300005334 Ga0068869_100234042 Ga0068869_1002340422 209
653 3300005334 Ga0068869_100669477 Ga0068869_1006694771 209
654 3300005335 Ga0070666_10014850 Ga0070666_100148502 209
655 3300005335 Ga0070666_10043461 Ga0070666_100434616 209
656 3300005335 Ga0070666_10415003 Ga0070666_104150031 209
657 3300005336 Ga0070680_100276198 Ga0070680_1002761981 209
658 3300005336 Ga0070680_100487016 Ga0070680_1004870161 209
659 3300005337 Ga0070682_100311796 Ga0070682_1003117962 209
660 3300005338 Ga0068868_100001851 Ga0068868_1000018515 209
661 3300005338 Ga0068868_100006530 Ga0068868_1000065304 209
662 3300005338 Ga0068868_100011852 Ga0068868_1000118522 209
663 3300005338 Ga0068868_100018268 Ga0068868_1000182684 209
664 3300005338 Ga0068868_100039004 Ga0068868_1000390042 209
665 3300005338 Ga0068868_100111181 Ga0068868_1001111811 209
666 3300005338 Ga0068868_100227716 Ga0068868_1002277162 209
667 3300005339 Ga0070660_100002901 Ga0070660_1000029016 209
668 3300005339 Ga0070660_100007894 Ga0070660_1000078941 209
669 3300005339 Ga0070660_100014239 Ga0070660_1000142396 209
670 3300005341 Ga0070691_10280292 Ga0070691_102802921 209
671 3300005343 Ga0070687_100000493 Ga0070687_10000049314 209
672 3300005344 Ga0070661_100008885 Ga0070661_1000088853 209
673 3300005344 Ga0070661_100095173 Ga0070661_1000951733 209
674 3300005344 Ga0070661_100183186 Ga0070661_1001831862 209
675 3300005344 Ga0070661_100268471 Ga0070661_1002684712 209
676 3300005347 Ga0070668_100048006 Ga0070668_1000480063 209
677 3300005347 Ga0070668_100321191 Ga0070668_1003211912 209
678 3300005347 Ga0070668_101073417 Ga0070668_1010734171 209
679 3300005353 Ga0070669_100028539 Ga0070669_1000285391 209
680 3300005353 Ga0070669_100167037 Ga0070669_1001670372 209
681 3300005354 Ga0070675_100004817 Ga0070675_10000481717 209
682 3300005355 Ga0070671_100000878 Ga0070671_10000087813 209
683 3300005355 Ga0070671_100081485 Ga0070671_1000814852 209
684 3300005355 Ga0070671_100416676 Ga0070671_1004166762 209
685 3300005356 Ga0070674_100202196 Ga0070674_1002021961 209
686 3300005364 Ga0070673_100012689 Ga0070673_1000126894 209
687 3300005364 Ga0070673_100045709 Ga0070673_1000457094 209
688 3300005364 Ga0070673_100056666 Ga0070673_1000566665 209
689 3300005364 Ga0070673_100113817 Ga0070673_1001138172 209
690 3300005365 Ga0070688_100072267 Ga0070688_1000722673 209
691 3300005365 Ga0070688_100147391 Ga0070688_1001473912 209
692 3300005365 Ga0070688_100315254 Ga0070688_1003152542 209
693 3300005366 Ga0070659_100050026 Ga0070659_1000500261 209
694 3300005366 Ga0070659_100141282 Ga0070659_1001412821 209
695 3300005367 Ga0070667_100001517 Ga0070667_1000015176 209
696 3300005367 Ga0070667_100024269 Ga0070667_1000242694 209
697 3300005367 Ga0070667_100042414 Ga0070667_1000424142 209
698 3300005367 Ga0070667_100597629 Ga0070667_1005976292 209
699 3300005434 Ga0070709_10000423 Ga0070709_100004236 209
700 3300005434 Ga0070709_10043831 Ga0070709_100438312 209
701 3300005434 Ga0070709_10088709 Ga0070709_100887091 209
702 3300005434 Ga0070709_10141470 Ga0070709_101414702 209
703 3300005434 Ga0070709_10219018 Ga0070709_102190182 209
704 3300005434 Ga0070709_10345193 Ga0070709_103451932 209
705 3300005435 Ga0070714_100037410 Ga0070714_1000374104 209
706 3300005435 Ga0070714_100080554 Ga0070714_1000805542 209
707 3300005435 Ga0070714_100148852 Ga0070714_1001488523 209
708 3300005435 Ga0070714_100198705 Ga0070714_1001987052 209
709 3300005435 Ga0070714_100224679 Ga0070714_1002246792 209
710 3300005435 Ga0070714_100243208 Ga0070714_1002432082 209
711 3300005435 Ga0070714_100588419 Ga0070714_1005884191 209
712 3300005435 Ga0070714_100767837 Ga0070714_1007678371 209
713 3300005436 Ga0070713_100000364 Ga0070713_10000036418 209
714 3300005436 Ga0070713_100002249 Ga0070713_1000022498 209
715 3300005436 Ga0070713_100051909 Ga0070713_1000519092 209
716 3300005436 Ga0070713_100076328 Ga0070713_1000763283 209
717 3300005436 Ga0070713_100158569 Ga0070713_1001585692 209
718 3300005436 Ga0070713_100176499 Ga0070713_1001764992 209
719 3300005436 Ga0070713_100348849 Ga0070713_1003488492 209
720 3300005436 Ga0070713_100363676 Ga0070713_1003636762 209
721 3300005436 Ga0070713_100419504 Ga0070713_1004195042 209
722 3300005436 Ga0070713_100456638 Ga0070713_1004566382 209
723 3300005436 Ga0070713_100607376 Ga0070713_1006073762 209
724 3300005436 Ga0070713_100666515 Ga0070713_1006665151 209
725 3300005436 Ga0070713_101159265 Ga0070713_1011592651 209
726 3300005436 Ga0070713_101395016 Ga0070713_1013950161 209
727 3300005437 Ga0070710_10054554 Ga0070710_100545542 209
728 3300005437 Ga0070710_10237332 Ga0070710_102373322 209
729 3300005437 Ga0070710_10467446 Ga0070710_104674461 209
730 3300005439 Ga0070711_100000191 Ga0070711_10000019115 209
731 3300005439 Ga0070711_100033538 Ga0070711_1000335383 209
732 3300005439 Ga0070711_100141287 Ga0070711_1001412872 209
733 3300005439 Ga0070711_100202033 Ga0070711_1002020332 209
734 3300005439 Ga0070711_100234078 Ga0070711_1002340781 209
735 3300005439 Ga0070711_100295255 Ga0070711_1002952551 209
736 3300005439 Ga0070711_100419208 Ga0070711_1004192082 209
737 3300005444 Ga0070694_100032066 Ga0070694_1000320665 209
738 3300005445 Ga0070708_100000356 Ga0070708_10000035628 209
739 3300005445 Ga0070708_100000459 Ga0070708_10000045929 209
740 3300005445 Ga0070708_100005339 Ga0070708_1000053394 209
741 3300005445 Ga0070708_100019745 Ga0070708_1000197455 209
742 3300005445 Ga0070708_100054805 Ga0070708_1000548052 209
743 3300005445 Ga0070708_100127716 Ga0070708_1001277162 209
744 3300005455 Ga0070663_100017453 Ga0070663_1000174535 209
745 3300005455 Ga0070663_100051468 Ga0070663_1000514681 209
746 3300005455 Ga0070663_100072676 Ga0070663_1000726762 209
747 3300005456 Ga0070678_100096152 Ga0070678_1000961522 209
748 3300005457 Ga0070662_100038232 Ga0070662_1000382322 209
749 3300005457 Ga0070662_100098473 Ga0070662_1000984734 209
750 3300005457 Ga0070662_100133595 Ga0070662_1001335952 209
751 3300005457 Ga0070662_100145549 Ga0070662_1001455493 209
752 3300005458 Ga0070681_10006468 Ga0070681_100064682 209
753 3300005458 Ga0070681_10065771 Ga0070681_100657715 209
754 3300005458 Ga0070681_10139914 Ga0070681_101399142 209
755 3300005458 Ga0070681_10435284 Ga0070681_104352842 209
756 3300005459 Ga0068867_100094506 Ga0068867_1000945062 209
757 3300005459 Ga0068867_100187487 Ga0068867_1001874872 209
758 3300005459 Ga0068867_100364879 Ga0068867_1003648792 209
759 3300005459 Ga0068867_101074233 Ga0068867_1010742331 209
760 3300005466 Ga0070685_10001292 Ga0070685_1000129212 209
761 3300005467 Ga0070706_100000278 Ga0070706_10000027828 209
762 3300005467 Ga0070706_100000514 Ga0070706_10000051428 209
763 3300005467 Ga0070706_100411726 Ga0070706_1004117262 209
764 3300005467 Ga0070706_100421077 Ga0070706_1004210772 209
765 3300005468 Ga0070707_100000662 Ga0070707_10000066220 209
766 3300005468 Ga0070707_100025509 Ga0070707_1000255094 209
767 3300005468 Ga0070707_100061516 Ga0070707_1000615166 209
768 3300005468 Ga0070707_100092839 Ga0070707_1000928393 209
769 3300005468 Ga0070707_100147415 Ga0070707_1001474152 209
770 3300005468 Ga0070707_100255822 Ga0070707_1002558222 209
771 3300005468 Ga0070707_100258396 Ga0070707_1002583961 209
772 3300005468 Ga0070707_100267256 Ga0070707_1002672562 209
773 3300005468 Ga0070707_100329921 Ga0070707_1003299212 209
774 3300005471 Ga0070698_100002449 Ga0070698_10000244930 209
775 3300005471 Ga0070698_100004533 Ga0070698_1000045337 209
776 3300005471 Ga0070698_100149049 Ga0070698_1001490492 209
777 3300005518 Ga0070699_100000441 Ga0070699_10000044124 209
778 3300005518 Ga0070699_100001725 Ga0070699_1000017257 209
779 3300005518 Ga0070699_100003886 Ga0070699_1000038868 209
780 3300005518 Ga0070699_100142072 Ga0070699_1001420723 209
781 3300005518 Ga0070699_100192358 Ga0070699_1001923582 209
782 3300005530 Ga0070679_100059099 Ga0070679_1000590993 209
783 3300005530 Ga0070679_100076758 Ga0070679_1000767586 209
784 3300005530 Ga0070679_100114378 Ga0070679_1001143782 209
785 3300005530 Ga0070679_100114508 Ga0070679_1001145084 209
786 3300005530 Ga0070679_100219362 Ga0070679_1002193622 209
787 3300005530 Ga0070679_100416649 Ga0070679_1004166492 209
788 3300005530 Ga0070679_100629907 Ga0070679_1006299072 209
789 3300005535 Ga0070684_100001423 Ga0070684_10000142317 209
790 3300005535 Ga0070684_100030620 Ga0070684_1000306201 209
791 3300005535 Ga0070684_100098787 Ga0070684_1000987873 209
792 3300005535 Ga0070684_100126487 Ga0070684_1001264874 209
793 3300005535 Ga0070684_100134212 Ga0070684_1001342122 209
794 3300005535 Ga0070684_100221867 Ga0070684_1002218671 209
795 3300005535 Ga0070684_100561092 Ga0070684_1005610922 209
796 3300005535 Ga0070684_101046066 Ga0070684_1010460661 209
797 3300005536 Ga0070697_100000975 Ga0070697_10000097529 209
798 3300005536 Ga0070697_100000993 Ga0070697_1000009937 209
799 3300005536 Ga0070697_100001451 Ga0070697_1000014514 209
800 3300005536 Ga0070697_100003489 Ga0070697_1000034896 209
801 3300005536 Ga0070697_100061836 Ga0070697_1000618362 209
802 3300005536 Ga0070697_100074825 Ga0070697_1000748254 209
803 3300005536 Ga0070697_100081447 Ga0070697_1000814472 209
804 3300005536 Ga0070697_100271127 Ga0070697_1002711271 209
805 3300005536 Ga0070697_100357892 Ga0070697_1003578921 209
806 3300005536 Ga0070697_100709895 Ga0070697_1007098951 209
807 3300005539 Ga0068853_100001096 Ga0068853_10000109624 209
808 3300005539 Ga0068853_100138867 Ga0068853_1001388671 209
809 3300005539 Ga0068853_100190031 Ga0068853_1001900311 209
810 3300005539 Ga0068853_100271338 Ga0068853_1002713381 209
811 3300005539 Ga0068853_101172338 Ga0068853_1011723381 209
812 3300005539 Ga0068853_101193933 Ga0068853_1011939331 209
813 3300005539 Ga0068853_101271405 Ga0068853_1012714051 209
814 3300005543 Ga0070672_100008157 Ga0070672_1000081577 209
815 3300005543 Ga0070672_100008480 Ga0070672_1000084809 209
816 3300005544 Ga0070686_100082005 Ga0070686_1000820052 209
817 3300005544 Ga0070686_100306801 Ga0070686_1003068012 209
818 3300005546 Ga0070696_100046425 Ga0070696_1000464252 209
819 3300005546 Ga0070696_100068936 Ga0070696_1000689362 209
820 3300005546 Ga0070696_100386570 Ga0070696_1003865701 209
821 3300005547 Ga0070693_100060801 Ga0070693_1000608012 209
822 3300005547 Ga0070693_100068524 Ga0070693_1000685241 209
823 3300005547 Ga0070693_100219415 Ga0070693_1002194151 209
824 3300005547 Ga0070693_100265393 Ga0070693_1002653932 209
825 3300005548 Ga0070665_100013944 Ga0070665_1000139447 209
826 3300005548 Ga0070665_100046727 Ga0070665_1000467272 209
827 3300005548 Ga0070665_100116012 Ga0070665_1001160122 209
828 3300005548 Ga0070665_100376988 Ga0070665_1003769882 209
829 3300005548 Ga0070665_101320812 Ga0070665_1013208121 209
830 3300005549 Ga0070704_100085415 Ga0070704_1000854151 209
831 3300005563 Ga0068855_100000642 Ga0068855_10000064225 209
832 3300005563 Ga0068855_100005786 Ga0068855_1000057863 209
833 3300005563 Ga0068855_100029511 Ga0068855_1000295112 209
834 3300005563 Ga0068855_100066606 Ga0068855_1000666062 209
835 3300005563 Ga0068855_100086489 Ga0068855_1000864891 209
836 3300005563 Ga0068855_100094033 Ga0068855_1000940337 209
837 3300005563 Ga0068855_100095343 Ga0068855_1000953436 209
838 3300005563 Ga0068855_101374420 Ga0068855_1013744201 209
839 3300005564 Ga0070664_100000277 Ga0070664_10000027732 209
840 3300005564 Ga0070664_100249745 Ga0070664_1002497451 209
841 3300005564 Ga0070664_100821593 Ga0070664_1008215931 209
842 3300005577 Ga0068857_100001133 Ga0068857_10000113322 209
843 3300005577 Ga0068857_100034150 Ga0068857_1000341504 209
844 3300005577 Ga0068857_100249031 Ga0068857_1002490312 209
845 3300005577 Ga0068857_100310024 Ga0068857_1003100243 209
846 3300005577 Ga0068857_100326003 Ga0068857_1003260032 209
847 3300005578 Ga0068854_100008133 Ga0068854_1000081339 209
848 3300005578 Ga0068854_100017433 Ga0068854_1000174335 209
849 3300005578 Ga0068854_100028405 Ga0068854_1000284052 209
850 3300005578 Ga0068854_100133495 Ga0068854_1001334953 209
851 3300005578 Ga0068854_100218517 Ga0068854_1002185173 209
852 3300005614 Ga0068856_100005788 Ga0068856_1000057883 209
853 3300005614 Ga0068856_100010756 Ga0068856_1000107569 209
854 3300005614 Ga0068856_100011162 Ga0068856_1000111622 209
855 3300005614 Ga0068856_100018752 Ga0068856_1000187523 209
856 3300005614 Ga0068856_100020373 Ga0068856_1000203733 209
857 3300005614 Ga0068856_100025039 Ga0068856_1000250396 209
858 3300005614 Ga0068856_100025115 Ga0068856_1000251158 209
859 3300005614 Ga0068856_100033208 Ga0068856_1000332082 209
860 3300005614 Ga0068856_100033324 Ga0068856_1000333247 209
861 3300005614 Ga0068856_100034006 Ga0068856_1000340068 209
862 3300005614 Ga0068856_100087027 Ga0068856_1000870272 209
863 3300005614 Ga0068856_100182596 Ga0068856_1001825962 209
864 3300005614 Ga0068856_100464533 Ga0068856_1004645331 209
865 3300005615 Ga0070702_100265378 Ga0070702_1002653781 209
866 3300005616 Ga0068852_100001223 Ga0068852_1000012232 209
867 3300005616 Ga0068852_100002255 Ga0068852_1000022553 209
868 3300005616 Ga0068852_100041582 Ga0068852_1000415824 209
869 3300005616 Ga0068852_100053384 Ga0068852_1000533842 209
870 3300005616 Ga0068852_100075268 Ga0068852_1000752685 209
871 3300005616 Ga0068852_100135848 Ga0068852_1001358483 209
872 3300005616 Ga0068852_100239401 Ga0068852_1002394013 209
873 3300005616 Ga0068852_100314255 Ga0068852_1003142553 209
874 3300005617 Ga0068859_100010766 Ga0068859_1000107663 209
875 3300005617 Ga0068859_100017062 Ga0068859_1000170626 209
876 3300005617 Ga0068859_100187418 Ga0068859_1001874183 209
877 3300005617 Ga0068859_100337051 Ga0068859_1003370511 209
878 3300005618 Ga0068864_100011128 Ga0068864_1000111288 209
879 3300005618 Ga0068864_100022766 Ga0068864_1000227664 209
880 3300005618 Ga0068864_100026700 Ga0068864_1000267005 209
881 3300005618 Ga0068864_100062310 Ga0068864_1000623101 209
882 3300005618 Ga0068864_100260077 Ga0068864_1002600772 209
883 3300005718 Ga0068866_10001380 Ga0068866_1000138013 209
884 3300005718 Ga0068866_10180162 Ga0068866_101801621 209
885 3300005719 Ga0068861_100029913 Ga0068861_1000299136 209
886 3300005719 Ga0068861_100248552 Ga0068861_1002485522 209
887 3300005834 Ga0068851_10013389 Ga0068851_100133891 209
888 3300005834 Ga0068851_10031925 Ga0068851_100319252 209
889 3300005834 Ga0068851_10055900 Ga0068851_100559002 209
890 3300005834 Ga0068851_10147786 Ga0068851_101477861 209
891 3300005834 Ga0068851_10299313 Ga0068851_102993131 209
892 3300005834 Ga0068851_10503421 Ga0068851_105034211 209
893 3300005840 Ga0068870_10011259 Ga0068870_100112596 209
894 3300005841 Ga0068863_100044079 Ga0068863_1000440797 209
895 3300005841 Ga0068863_100065291 Ga0068863_1000652913 209
896 3300005841 Ga0068863_100168315 Ga0068863_1001683152 209
897 3300005841 Ga0068863_100173415 Ga0068863_1001734153 209
898 3300005841 Ga0068863_100400114 Ga0068863_1004001142 209
899 3300005841 Ga0068863_100991680 Ga0068863_1009916802 209
900 3300005842 Ga0068858_100004747 Ga0068858_10000474717 209
901 3300005842 Ga0068858_100020862 Ga0068858_1000208629 209
902 3300005842 Ga0068858_100031378 Ga0068858_1000313784 209
903 3300005842 Ga0068858_100047535 Ga0068858_1000475357 209
904 3300005842 Ga0068858_100099222 Ga0068858_1000992222 209
905 3300005842 Ga0068858_100129796 Ga0068858_1001297962 209
906 3300005842 Ga0068858_100212871 Ga0068858_1002128712 209
907 3300005842 Ga0068858_100375689 Ga0068858_1003756892 209
908 3300005842 Ga0068858_100423949 Ga0068858_1004239492 209
909 3300005842 Ga0068858_100462159 Ga0068858_1004621592 209
910 3300005843 Ga0068860_100000786 Ga0068860_10000078635 209
911 3300005843 Ga0068860_100025252 Ga0068860_1000252528 209
912 3300005843 Ga0068860_100056753 Ga0068860_1000567535 209
913 3300005843 Ga0068860_100342535 Ga0068860_1003425352 209
914 3300005843 Ga0068860_100713800 Ga0068860_1007138002 209
915 3300005843 Ga0068860_100956822 Ga0068860_1009568221 209
916 3300005844 Ga0068862_100013382 Ga0068862_1000133826 209
917 3300005844 Ga0068862_100136758 Ga0068862_1001367582 209
918 3300005937 Ga0081455_10171735 Ga0081455_101717353 209
919 3300006028 Ga0070717_10002614 Ga0070717_1000261419 209
920 3300006028 Ga0070717_10012892 Ga0070717_100128928 209
921 3300006028 Ga0070717_10028717 Ga0070717_100287176 209
922 3300006028 Ga0070717_10068777 Ga0070717_100687775 209
923 3300006028 Ga0070717_10091046 Ga0070717_100910463 209
924 3300006028 Ga0070717_10115860 Ga0070717_101158602 209
925 3300006028 Ga0070717_10191253 Ga0070717_101912533 209
926 3300006028 Ga0070717_10196565 Ga0070717_101965652 209
927 3300006028 Ga0070717_10210607 Ga0070717_102106072 209
928 3300006028 Ga0070717_10236166 Ga0070717_102361662 209
929 3300006028 Ga0070717_10319884 Ga0070717_103198842 209
930 3300006028 Ga0070717_10413574 Ga0070717_104135742 209
931 3300006028 Ga0070717_10435272 Ga0070717_104352722 209
932 3300006028 Ga0070717_10520629 Ga0070717_105206292 209
933 3300006028 Ga0070717_10536022 Ga0070717_105360222 209
934 3300006028 Ga0070717_10550464 Ga0070717_105504641 209
935 3300006163 Ga0070715_10036552 Ga0070715_100365521 209
936 3300006163 Ga0070715_10093903 Ga0070715_100939032 209
937 3300006163 Ga0070715_10348626 Ga0070715_103486261 209
938 3300006173 Ga0070716_100005801 Ga0070716_1000058014 209
939 3300006173 Ga0070716_100005841 Ga0070716_1000058418 209
940 3300006173 Ga0070716_100007139 Ga0070716_1000071398 209
941 3300006173 Ga0070716_100016153 Ga0070716_1000161531 209
942 3300006173 Ga0070716_100023979 Ga0070716_1000239796 209
943 3300006173 Ga0070716_100040702 Ga0070716_1000407023 209
944 3300006173 Ga0070716_100134745 Ga0070716_1001347452 209
945 3300006173 Ga0070716_100175840 Ga0070716_1001758401 209
946 3300006173 Ga0070716_100185500 Ga0070716_1001855002 209
947 3300006173 Ga0070716_100377264 Ga0070716_1003772642 209
948 3300006175 Ga0070712_100000593 Ga0070712_10000059320 209
949 3300006175 Ga0070712_100001135 Ga0070712_1000011355 209
950 3300006175 Ga0070712_100008275 Ga0070712_1000082753 209
951 3300006175 Ga0070712_100042553 Ga0070712_1000425533 209
952 3300006175 Ga0070712_100068183 Ga0070712_1000681833 209
953 3300006175 Ga0070712_100291745 Ga0070712_1002917452 209
954 3300006175 Ga0070712_100359724 Ga0070712_1003597242 209
955 3300006175 Ga0070712_100617380 Ga0070712_1006173801 209
956 3300006175 Ga0070712_100693817 Ga0070712_1006938171 209
957 3300006175 Ga0070712_100872571 Ga0070712_1008725711 209
958 3300006237 Ga0097621_100003318 Ga0097621_10000331815 209
959 3300006237 Ga0097621_100017658 Ga0097621_1000176581 209
960 3300006237 Ga0097621_100046566 Ga0097621_1000465662 209
961 3300006237 Ga0097621_100061733 Ga0097621_1000617332 209
962 3300006237 Ga0097621_100092213 Ga0097621_1000922132 209
963 3300006237 Ga0097621_100108499 Ga0097621_1001084993 209
964 3300006237 Ga0097621_100140476 Ga0097621_1001404762 209
965 3300006237 Ga0097621_100309240 Ga0097621_1003092402 209
966 3300006358 Ga0068871_100001396 Ga0068871_10000139610 209
967 3300006358 Ga0068871_100015915 Ga0068871_1000159154 209
968 3300006358 Ga0068871_100022802 Ga0068871_1000228025 209
969 3300006358 Ga0068871_100026575 Ga0068871_1000265752 209
970 3300006358 Ga0068871_100126504 Ga0068871_1001265042 209
971 3300006358 Ga0068871_100256717 Ga0068871_1002567172 209
972 3300006358 Ga0068871_100527541 Ga0068871_1005275412 209
973 3300006358 Ga0068871_101034499 Ga0068871_1010344991 209
974 3300006852 Ga0075433_10002887 Ga0075433_100028872 209
975 3300006852 Ga0075433_10030331 Ga0075433_100303313 209
976 3300006852 Ga0075433_10339870 Ga0075433_103398702 209
977 3300006871 Ga0075434_100000230 Ga0075434_10000023029 209
978 3300006871 Ga0075434_100005131 Ga0075434_10000513114 209
979 3300006871 Ga0075434_100068934 Ga0075434_1000689343 209
980 3300006881 Ga0068865_100006206 Ga0068865_1000062067 209
981 3300006881 Ga0068865_100050410 Ga0068865_1000504101 209
982 3300006881 Ga0068865_100092303 Ga0068865_1000923033 209
983 3300006881 Ga0068865_100093232 Ga0068865_1000932322 209
984 3300006881 Ga0068865_100477967 Ga0068865_1004779672 209
985 3300006914 Ga0075436_100000510 Ga0075436_10000051010 209
986 3300006914 Ga0075436_100002324 Ga0075436_1000023244 209
987 3300006914 Ga0075436_100013001 Ga0075436_1000130019 209
988 3300006914 Ga0075436_100524003 Ga0075436_1005240031 209
989 3300006931 Ga0097620_100010766 Ga0097620_1000107669 209
990 3300006931 Ga0097620_100017062 Ga0097620_1000170626 209
991 3300006931 Ga0097620_100187419 Ga0097620_1001874193 209
992 3300006931 Ga0097620_100337066 Ga0097620_1003370662 209
993 3300007076 Ga0075435_100000389 Ga0075435_10000038929 209
994 3300007076 Ga0075435_100083489 Ga0075435_1000834893 209
995 3300007076 Ga0075435_100218018 Ga0075435_1002180182 209
996 3300007076 Ga0075435_100228678 Ga0075435_1002286782 209
997 3300007265 Ga0099794_10041745 Ga0099794_100417454 209
998 3300007265 Ga0099794_10053309 Ga0099794_100533092 209
999 3300009093 Ga0105240_10000267 Ga0105240_1000026711 209
1000 3300009093 Ga0105240_10001326 Ga0105240_1000132633 209
1001 3300009093 Ga0105240_10029138 Ga0105240_100291385 209
1002 3300009093 Ga0105240_10030655 Ga0105240_100306557 209
1003 3300009093 Ga0105240_10032052 Ga0105240_100320521 209
1004 3300009093 Ga0105240_10035826 Ga0105240_100358262 209
1005 3300009093 Ga0105240_10044876 Ga0105240_100448763 209
1006 3300009093 Ga0105240_10193853 Ga0105240_101938533 209
1007 3300009093 Ga0105240_10535919 Ga0105240_105359191 209
1008 3300009093 Ga0105240_10809886 Ga0105240_108098861 209
1009 3300009093 Ga0105240_10982463 Ga0105240_109824631 209
1010 3300009098 Ga0105245_10005029 Ga0105245_100050292 209
1011 3300009098 Ga0105245_10006634 Ga0105245_100066348 209
1012 3300009098 Ga0105245_10127154 Ga0105245_101271544 209
1013 3300009098 Ga0105245_10202184 Ga0105245_102021843 209
1014 3300009098 Ga0105245_10608389 Ga0105245_106083892 209
1015 3300009101 Ga0105247_10002611 Ga0105247_100026118 209
1016 3300009101 Ga0105247_10099547 Ga0105247_100995471 209
1017 3300009101 Ga0105247_10469254 Ga0105247_104692542 209
1018 3300009148 Ga0105243_10496459 Ga0105243_104964592 209
1019 3300009174 Ga0105241_10000142 Ga0105241_1000014231 209
1020 3300009174 Ga0105241_10050555 Ga0105241_100505554 209
1021 3300009174 Ga0105241_10071880 Ga0105241_100718802 209
1022 3300009174 Ga0105241_10088787 Ga0105241_100887872 209
1023 3300009174 Ga0105241_10169237 Ga0105241_101692373 209
1024 3300009177 Ga0105248_10011815 Ga0105248_100118158 209
1025 3300009177 Ga0105248_10092108 Ga0105248_100921082 209
1026 3300009545 Ga0105237_10017228 Ga0105237_100172286 209
1027 3300009545 Ga0105237_10040500 Ga0105237_100405004 209
1028 3300009545 Ga0105237_10047915 Ga0105237_100479155 209
1029 3300009545 Ga0105237_10055094 Ga0105237_100550944 209
1030 3300009545 Ga0105237_10174065 Ga0105237_101740651 209
1031 3300009545 Ga0105237_10325463 Ga0105237_103254631 209
1032 3300009545 Ga0105237_10361985 Ga0105237_103619852 209
1033 3300009545 Ga0105237_10558148 Ga0105237_105581481 209
1034 3300009545 Ga0105237_10777535 Ga0105237_107775351 209
1035 3300009551 Ga0105238_10000504 Ga0105238_1000050410 209
1036 3300009551 Ga0105238_10000635 Ga0105238_1000063534 209
1037 3300009551 Ga0105238_10005646 Ga0105238_100056466 209
1038 3300009551 Ga0105238_10022135 Ga0105238_100221357 209
1039 3300009551 Ga0105238_10046166 Ga0105238_100461663 209
1040 3300009551 Ga0105238_10178796 Ga0105238_101787962 209
1041 3300009551 Ga0105238_10355278 Ga0105238_103552783 209
1042 3300009553 Ga0105249_10104557 Ga0105249_101045572 209
1043 3300010375 Ga0105239_10002713 Ga0105239_1000271318 209
1044 3300010375 Ga0105239_10015584 Ga0105239_100155847 209
1045 3300010375 Ga0105239_10058062 Ga0105239_100580621 209
1046 3300010375 Ga0105239_10069658 Ga0105239_100696584 209
1047 3300010375 Ga0105239_10142903 Ga0105239_101429032 209
1048 3300010375 Ga0105239_10234246 Ga0105239_102342464 209
1049 3300011119 Ga0105246_10366230 Ga0105246_103662302 209
1050 3300013100 Ga0157373_10001758 Ga0157373_1000175829 209
1051 3300013102 Ga0157371_10002134 Ga0157371_100021344 209
1052 3300013102 Ga0157371_10185418 Ga0157371_101854183 209
1053 3300013104 Ga0157370_10511649 Ga0157370_105116492 209
1054 3300013105 Ga0157369_10020480 Ga0157369_100204802 209
1055 3300013105 Ga0157369_10024038 Ga0157369_100240382 209
1056 3300013105 Ga0157369_10030317 Ga0157369_100303172 209
1057 3300013105 Ga0157369_10046224 Ga0157369_100462242 209
1058 3300013105 Ga0157369_10050004 Ga0157369_100500042 209
1059 3300013105 Ga0157369_10082161 Ga0157369_100821616 209
1060 3300013105 Ga0157369_10089388 Ga0157369_100893881 209
1061 3300013105 Ga0157369_10248395 Ga0157369_102483952 209
1062 3300013105 Ga0157369_10252078 Ga0157369_102520782 209
1063 3300013105 Ga0157369_10316132 Ga0157369_103161322 209
1064 3300013105 Ga0157369_10574087 Ga0157369_105740871 209
1065 3300013105 Ga0157369_11375361 Ga0157369_113753611 209
1066 3300013296 Ga0157374_10013096 Ga0157374_100130965 209
1067 3300013296 Ga0157374_10014284 Ga0157374_1001428411 209
1068 3300013296 Ga0157374_10016183 Ga0157374_100161837 209
1069 3300013296 Ga0157374_10053416 Ga0157374_100534166 209
1070 3300013296 Ga0157374_10077388 Ga0157374_100773882 209
1071 3300013296 Ga0157374_10211641 Ga0157374_102116413 209
1072 3300013296 Ga0157374_10763682 Ga0157374_107636821 209
1073 3300013296 Ga0157374_10795954 Ga0157374_107959542 209
1074 3300013297 Ga0157378_10011996 Ga0157378_100119967 209
1075 3300013297 Ga0157378_10026937 Ga0157378_100269372 209
1076 3300013297 Ga0157378_10044668 Ga0157378_100446687 209
1077 3300013297 Ga0157378_10116780 Ga0157378_101167802 209
1078 3300013297 Ga0157378_10746532 Ga0157378_107465321 209
1079 3300013306 Ga0163162_10020357 Ga0163162_100203572 209
1080 3300013306 Ga0163162_10068979 Ga0163162_100689793 209
1081 3300013306 Ga0163162_10082691 Ga0163162_100826914 209
1082 3300013306 Ga0163162_10093076 Ga0163162_100930762 209
1083 3300013306 Ga0163162_11072695 Ga0163162_110726952 209
1084 3300013306 Ga0163162_11682594 Ga0163162_116825941 209
1085 3300013307 Ga0157372_10002154 Ga0157372_100021545 209
1086 3300013307 Ga0157372_10007931 Ga0157372_100079312 209
1087 3300013307 Ga0157372_10014586 Ga0157372_100145867 209
1088 3300013307 Ga0157372_10087746 Ga0157372_100877467 209
1089 3300013307 Ga0157372_10089943 Ga0157372_100899434 209
1090 3300013307 Ga0157372_10115083 Ga0157372_101150835 209
1091 3300013307 Ga0157372_10116657 Ga0157372_101166571 209
1092 3300013307 Ga0157372_10176626 Ga0157372_101766261 209
1093 3300013307 Ga0157372_10179706 Ga0157372_101797061 209
1094 3300013307 Ga0157372_10187665 Ga0157372_101876652 209
1095 3300013307 Ga0157372_10197066 Ga0157372_101970662 209
1096 3300013307 Ga0157372_10239052 Ga0157372_102390523 209
1097 3300013307 Ga0157372_10303131 Ga0157372_103031313 209
1098 3300013308 Ga0157375_10012757 Ga0157375_100127572 209
1099 3300013308 Ga0157375_10118645 Ga0157375_101186452 209
1100 3300014325 Ga0163163_10000795 Ga0163163_100007957 209
1101 3300014325 Ga0163163_10001073 Ga0163163_1000107329 209
1102 3300014325 Ga0163163_10586403 Ga0163163_105864032 209
1103 3300014326 Ga0157380_10081804 Ga0157380_100818042 209
1104 3300014326 Ga0157380_11435351 Ga0157380_114353511 209
1105 3300014497 Ga0182008_10004904 Ga0182008_100049047 209
1106 3300014497 Ga0182008_10213325 Ga0182008_102133251 209
1107 3300014745 Ga0157377_10025960 Ga0157377_100259604 209
1108 3300014745 Ga0157377_10107059 Ga0157377_101070591 209
1109 3300014968 Ga0157379_10000770 Ga0157379_100007707 209
1110 3300014968 Ga0157379_10005366 Ga0157379_1000536621 209
1111 3300014969 Ga0157376_10103085 Ga0157376_101030853 209
1112 3300014969 Ga0157376_10528204 Ga0157376_105282042 209
1113 3300014969 Ga0157376_10595023 Ga0157376_105950232 209
1114 3300015262 Ga0182007_10006522 Ga0182007_100065222 209
1115 3300015262 Ga0182007_10020865 Ga0182007_100208652 209
1116 3300017792 Ga0163161_10005915 Ga0163161_100059158 209
1117 3300017792 Ga0163161_10059520 Ga0163161_100595202 209
1118 3300019161 Ga0184602_126656 Ga0184602_1266561 209
1119 3300019179 Ga0184593_104762 Ga0184593_1047621 209
1120 3300019182 Ga0184598_110756 Ga0184598_1107562 209
1121 3300019182 Ga0184598_116461 Ga0184598_1164611 209
1122 3300019182 Ga0184598_118549 Ga0184598_1185491 209
1123 3300019182 Ga0184598_124195 Ga0184598_1241951 209
1124 3300019183 Ga0184601_100499 Ga0184601_1004992 209
1125 3300019183 Ga0184601_114868 Ga0184601_1148682 209
1126 3300019183 Ga0184601_129479 Ga0184601_1294792 209
1127 3300019188 Ga0184599_124137 Ga0184599_1241377 209
1128 3300019190 Ga0184600_109839 Ga0184600_1098394 209
1129 3300020069 Ga0197907_10507665 Ga0197907_105076652 209
1130 3300020069 Ga0197907_11019727 Ga0197907_110197271 209
1131 3300020070 Ga0206356_10566607 Ga0206356_105666072 209
1132 3300020070 Ga0206356_10871175 Ga0206356_108711751 209
1133 3300020070 Ga0206356_11407138 Ga0206356_114071382 209
1134 3300020077 Ga0206351_10077883 Ga0206351_100778833 209
1135 3300020078 Ga0206352_10151154 Ga0206352_101511541 209
1136 3300020078 Ga0206352_10944950 Ga0206352_109449503 209
1137 3300020080 Ga0206350_10413921 Ga0206350_104139214 209
1138 3300020080 Ga0206350_11158700 Ga0206350_111587006 209
1139 3300020081 Ga0206354_11048501 Ga0206354_110485013 209
1140 3300020082 Ga0206353_11628862 Ga0206353_116288621 209
1141 3300021361 Ga0213872_10002420 Ga0213872_1000242011 209
1142 3300021377 Ga0213874_10006467 Ga0213874_100064672 209
1143 3300022467 Ga0224712_10007954 Ga0224712_100079542 209
1144 3300022467 Ga0224712_10013443 Ga0224712_100134433 209
1145 3300022467 Ga0224712_10091314 Ga0224712_100913142 209
1146 3300022732 Ga0224569_102106 Ga0224569_1021062 209
1147 3300022734 Ga0224571_100071 Ga0224571_1000715 209
1148 3300023547 Ga0247554_100866 Ga0247554_1008661 209
1149 3300023672 Ga0247553_100035 Ga0247553_1000355 209
1150 3300023672 Ga0247553_101154 Ga0247553_1011541 209
1151 3300024225 Ga0224572_1001037 Ga0224572_10010371 209
1152 3300024225 Ga0224572_1016073 Ga0224572_10160732 209
1153 3300024225 Ga0224572_1058653 Ga0224572_10586531 209
1154 3300024227 Ga0228598_1000213 Ga0228598_100021318 209
1155 3300024227 Ga0228598_1001862 Ga0228598_10018624 209
1156 3300024227 Ga0228598_1011503 Ga0228598_10115031 209
1157 3300025315 Ga0207697_10002087 Ga0207697_100020876 209
1158 3300025321 Ga0207656_10007877 Ga0207656_100078775 209
1159 3300025321 Ga0207656_10016605 Ga0207656_100166052 209
1160 3300025321 Ga0207656_10074907 Ga0207656_100749071 209
1161 3300025893 Ga0207682_10040680 Ga0207682_100406802 209
1162 3300025898 Ga0207692_10005801 Ga0207692_100058016 209
1163 3300025898 Ga0207692_10038102 Ga0207692_100381024 209
1164 3300025898 Ga0207692_10067935 Ga0207692_100679352 209
1165 3300025898 Ga0207692_10223862 Ga0207692_102238622 209
1166 3300025898 Ga0207692_10233067 Ga0207692_102330672 209
1167 3300025898 Ga0207692_10236339 Ga0207692_102363391 209
1168 3300025898 Ga0207692_10346364 Ga0207692_103463641 209
1169 3300025899 Ga0207642_10011302 Ga0207642_100113021 209
1170 3300025900 Ga0207710_10004826 Ga0207710_100048267 209
1171 3300025900 Ga0207710_10224442 Ga0207710_102244421 209
1172 3300025901 Ga0207688_10005204 Ga0207688_1000520411 209
1173 3300025903 Ga0207680_10154851 Ga0207680_101548512 209
1174 3300025903 Ga0207680_10557613 Ga0207680_105576131 209
1175 3300025904 Ga0207647_10005658 Ga0207647_100056582 209
1176 3300025904 Ga0207647_10006875 Ga0207647_100068756 209
1177 3300025904 Ga0207647_10012233 Ga0207647_100122337 209
1178 3300025904 Ga0207647_10019145 Ga0207647_100191452 209
1179 3300025904 Ga0207647_10255127 Ga0207647_102551271 209
1180 3300025905 Ga0207685_10111598 Ga0207685_101115982 209
1181 3300025905 Ga0207685_10242992 Ga0207685_102429921 209
1182 3300025906 Ga0207699_10002321 Ga0207699_100023217 209
1183 3300025906 Ga0207699_10086087 Ga0207699_100860874 209
1184 3300025906 Ga0207699_10090641 Ga0207699_100906412 209
1185 3300025906 Ga0207699_10147272 Ga0207699_101472721 209
1186 3300025906 Ga0207699_10219035 Ga0207699_102190352 209
1187 3300025906 Ga0207699_10426609 Ga0207699_104266092 209
1188 3300025906 Ga0207699_10430005 Ga0207699_104300052 209
1189 3300025906 Ga0207699_10568172 Ga0207699_105681721 209
1190 3300025907 Ga0207645_10001180 Ga0207645_100011806 209
1191 3300025907 Ga0207645_10004038 Ga0207645_100040388 209
1192 3300025907 Ga0207645_10049336 Ga0207645_100493363 209
1193 3300025907 Ga0207645_10297681 Ga0207645_102976811 209
1194 3300025908 Ga0207643_10001067 Ga0207643_100010672 209
1195 3300025909 Ga0207705_10072541 Ga0207705_100725412 209
1196 3300025909 Ga0207705_10074091 Ga0207705_100740912 209
1197 3300025909 Ga0207705_10115147 Ga0207705_101151472 209
1198 3300025909 Ga0207705_10187860 Ga0207705_101878602 209
1199 3300025910 Ga0207684_10000614 Ga0207684_1000061429 209
1200 3300025910 Ga0207684_10001048 Ga0207684_1000104829 209
1201 3300025910 Ga0207684_10011624 Ga0207684_100116242 209
1202 3300025910 Ga0207684_10044528 Ga0207684_100445282 209
1203 3300025910 Ga0207684_10182766 Ga0207684_101827663 209
1204 3300025910 Ga0207684_10193252 Ga0207684_101932523 209
1205 3300025910 Ga0207684_10265248 Ga0207684_102652481 209
1206 3300025910 Ga0207684_10282072 Ga0207684_102820721 209
1207 3300025911 Ga0207654_10000027 Ga0207654_10000027102 209
1208 3300025911 Ga0207654_10000457 Ga0207654_1000045710 209
1209 3300025911 Ga0207654_10021637 Ga0207654_100216371 209
1210 3300025911 Ga0207654_10231921 Ga0207654_102319212 209
1211 3300025911 Ga0207654_10379643 Ga0207654_103796431 209
1212 3300025912 Ga0207707_10007456 Ga0207707_1000745611 209
1213 3300025912 Ga0207707_10088061 Ga0207707_100880611 209
1214 3300025912 Ga0207707_10361838 Ga0207707_103618381 209
1215 3300025912 Ga0207707_10670877 Ga0207707_106708771 209
1216 3300025913 Ga0207695_10000379 Ga0207695_1000037971 209
1217 3300025913 Ga0207695_10001178 Ga0207695_1000117835 209
1218 3300025913 Ga0207695_10003215 Ga0207695_1000321530 209
1219 3300025913 Ga0207695_10003457 Ga0207695_1000345714 209
1220 3300025913 Ga0207695_10007039 Ga0207695_100070396 209
1221 3300025913 Ga0207695_10008453 Ga0207695_1000845321 209
1222 3300025913 Ga0207695_10144827 Ga0207695_101448273 209
1223 3300025913 Ga0207695_10198512 Ga0207695_101985121 209
1224 3300025913 Ga0207695_10388409 Ga0207695_103884092 209
1225 3300025914 Ga0207671_10000071 Ga0207671_1000007129 209
1226 3300025914 Ga0207671_10000503 Ga0207671_1000050354 209
1227 3300025914 Ga0207671_10073333 Ga0207671_100733332 209
1228 3300025914 Ga0207671_10310899 Ga0207671_103108992 209
1229 3300025915 Ga0207693_10000026 Ga0207693_1000002666 209
1230 3300025915 Ga0207693_10000922 Ga0207693_1000092216 209
1231 3300025915 Ga0207693_10011801 Ga0207693_100118017 209
1232 3300025915 Ga0207693_10076512 Ga0207693_100765123 209
1233 3300025915 Ga0207693_10076545 Ga0207693_100765453 209
1234 3300025915 Ga0207693_10217433 Ga0207693_102174332 209
1235 3300025915 Ga0207693_10287539 Ga0207693_102875392 209
1236 3300025915 Ga0207693_10316434 Ga0207693_103164341 209
1237 3300025915 Ga0207693_10365097 Ga0207693_103650972 209
1238 3300025915 Ga0207693_10513609 Ga0207693_105136092 209
1239 3300025915 Ga0207693_10580807 Ga0207693_105808071 209
1240 3300025915 Ga0207693_10590609 Ga0207693_105906091 209
1241 3300025916 Ga0207663_10006104 Ga0207663_100061044 209
1242 3300025916 Ga0207663_10040067 Ga0207663_100400672 209
1243 3300025916 Ga0207663_10058540 Ga0207663_100585401 209
1244 3300025916 Ga0207663_10099304 Ga0207663_100993042 209
1245 3300025916 Ga0207663_10122489 Ga0207663_101224892 209
1246 3300025916 Ga0207663_10143190 Ga0207663_101431902 209
1247 3300025917 Ga0207660_10090148 Ga0207660_100901483 209
1248 3300025917 Ga0207660_10127659 Ga0207660_101276593 209
1249 3300025917 Ga0207660_10145741 Ga0207660_101457412 209
1250 3300025917 Ga0207660_10256966 Ga0207660_102569662 209
1251 3300025917 Ga0207660_10261820 Ga0207660_102618202 209
1252 3300025918 Ga0207662_10001544 Ga0207662_100015446 209
1253 3300025919 Ga0207657_10003185 Ga0207657_1000318523 209
1254 3300025919 Ga0207657_10009917 Ga0207657_100099174 209
1255 3300025919 Ga0207657_10081973 Ga0207657_100819735 209
1256 3300025919 Ga0207657_10212312 Ga0207657_102123121 209
1257 3300025920 Ga0207649_10001087 Ga0207649_1000108729 209
1258 3300025920 Ga0207649_10038778 Ga0207649_100387782 209
1259 3300025920 Ga0207649_10112473 Ga0207649_101124731 209
1260 3300025920 Ga0207649_10129360 Ga0207649_101293603 209
1261 3300025920 Ga0207649_10248484 Ga0207649_102484842 209
1262 3300025921 Ga0207652_10032833 Ga0207652_100328334 209
1263 3300025921 Ga0207652_10043118 Ga0207652_100431184 209
1264 3300025921 Ga0207652_10051244 Ga0207652_100512444 209
1265 3300025921 Ga0207652_10061950 Ga0207652_100619502 209
1266 3300025921 Ga0207652_10062982 Ga0207652_100629821 209
1267 3300025921 Ga0207652_10428362 Ga0207652_104283622 209
1268 3300025921 Ga0207652_10575319 Ga0207652_105753192 209
1269 3300025922 Ga0207646_10001230 Ga0207646_1000123031 209
1270 3300025922 Ga0207646_10004899 Ga0207646_1000489921 209
1271 3300025922 Ga0207646_10017066 Ga0207646_100170661 209
1272 3300025922 Ga0207646_10092911 Ga0207646_100929116 209
1273 3300025922 Ga0207646_10108061 Ga0207646_101080613 209
1274 3300025922 Ga0207646_10213799 Ga0207646_102137992 209
1275 3300025922 Ga0207646_10270842 Ga0207646_102708421 209
1276 3300025922 Ga0207646_10306158 Ga0207646_103061582 209
1277 3300025922 Ga0207646_10501424 Ga0207646_105014242 209
1278 3300025922 Ga0207646_11060523 Ga0207646_110605231 209
1279 3300025923 Ga0207681_10312184 Ga0207681_103121842 209
1280 3300025924 Ga0207694_10000247 Ga0207694_1000024729 209
1281 3300025924 Ga0207694_10000580 Ga0207694_100005801 209
1282 3300025924 Ga0207694_10000718 Ga0207694_1000071825 209
1283 3300025924 Ga0207694_10001290 Ga0207694_1000129030 209
1284 3300025924 Ga0207694_10023728 Ga0207694_100237282 209
1285 3300025924 Ga0207694_10045546 Ga0207694_100455461 209
1286 3300025924 Ga0207694_10080494 Ga0207694_100804941 209
1287 3300025924 Ga0207694_10198429 Ga0207694_101984291 209
1288 3300025924 Ga0207694_10407321 Ga0207694_104073211 209
1289 3300025925 Ga0207650_10000152 Ga0207650_1000015252 209
1290 3300025925 Ga0207650_10017448 Ga0207650_100174482 209
1291 3300025925 Ga0207650_10117795 Ga0207650_101177952 209
1292 3300025925 Ga0207650_10199647 Ga0207650_101996472 209
1293 3300025925 Ga0207650_10497671 Ga0207650_104976711 209
1294 3300025927 Ga0207687_10010750 Ga0207687_100107502 209
1295 3300025927 Ga0207687_10079919 Ga0207687_100799192 209
1296 3300025927 Ga0207687_10093489 Ga0207687_100934892 209
1297 3300025927 Ga0207687_10661885 Ga0207687_106618851 209
1298 3300025927 Ga0207687_10680753 Ga0207687_106807532 209
1299 3300025927 Ga0207687_10990669 Ga0207687_109906691 209
1300 3300025928 Ga0207700_10010311 Ga0207700_100103116 209
1301 3300025928 Ga0207700_10014066 Ga0207700_100140666 209
1302 3300025928 Ga0207700_10040547 Ga0207700_100405471 209
1303 3300025928 Ga0207700_10048859 Ga0207700_100488594 209
1304 3300025928 Ga0207700_10086619 Ga0207700_100866193 209
1305 3300025928 Ga0207700_10174220 Ga0207700_101742202 209
1306 3300025928 Ga0207700_10188567 Ga0207700_101885672 209
1307 3300025928 Ga0207700_10211319 Ga0207700_102113192 209
1308 3300025928 Ga0207700_10231086 Ga0207700_102310861 209
1309 3300025928 Ga0207700_10327994 Ga0207700_103279942 209
1310 3300025928 Ga0207700_10479131 Ga0207700_104791312 209
1311 3300025928 Ga0207700_10808877 Ga0207700_108088771 209
1312 3300025928 Ga0207700_10894995 Ga0207700_108949951 209
1313 3300025929 Ga0207664_10030225 Ga0207664_100302251 209
1314 3300025929 Ga0207664_10032913 Ga0207664_100329137 209
1315 3300025929 Ga0207664_10039554 Ga0207664_100395546 209
1316 3300025929 Ga0207664_10103097 Ga0207664_101030974 209
1317 3300025929 Ga0207664_10137959 Ga0207664_101379593 209
1318 3300025929 Ga0207664_10199406 Ga0207664_101994063 209
1319 3300025929 Ga0207664_10204228 Ga0207664_102042282 209
1320 3300025929 Ga0207664_10548264 Ga0207664_105482641 209
1321 3300025929 Ga0207664_10800142 Ga0207664_108001422 209
1322 3300025931 Ga0207644_10003318 Ga0207644_100033187 209
1323 3300025931 Ga0207644_10008126 Ga0207644_100081266 209
1324 3300025931 Ga0207644_10036649 Ga0207644_100366491 209
1325 3300025931 Ga0207644_10377620 Ga0207644_103776201 209
1326 3300025932 Ga0207690_10097091 Ga0207690_100970914 209
1327 3300025933 Ga0207706_10000740 Ga0207706_1000074029 209
1328 3300025933 Ga0207706_10002545 Ga0207706_100025457 209
1329 3300025933 Ga0207706_10029663 Ga0207706_100296632 209
1330 3300025933 Ga0207706_10264348 Ga0207706_102643481 209
1331 3300025934 Ga0207686_10066767 Ga0207686_100667672 209
1332 3300025934 Ga0207686_10067063 Ga0207686_100670633 209
1333 3300025934 Ga0207686_10094040 Ga0207686_100940403 209
1334 3300025935 Ga0207709_10014728 Ga0207709_100147282 209
1335 3300025936 Ga0207670_10521157 Ga0207670_105211571 209
1336 3300025938 Ga0207704_10039378 Ga0207704_100393782 209
1337 3300025938 Ga0207704_10054864 Ga0207704_100548643 209
1338 3300025938 Ga0207704_10191407 Ga0207704_101914071 209
1339 3300025938 Ga0207704_10414483 Ga0207704_104144831 209
1340 3300025939 Ga0207665_10000981 Ga0207665_1000098118 209
1341 3300025939 Ga0207665_10001798 Ga0207665_1000179825 209
1342 3300025939 Ga0207665_10011698 Ga0207665_100116982 209
1343 3300025939 Ga0207665_10012641 Ga0207665_100126412 209
1344 3300025939 Ga0207665_10013825 Ga0207665_100138251 209
1345 3300025939 Ga0207665_10017747 Ga0207665_100177474 209
1346 3300025939 Ga0207665_10067172 Ga0207665_100671721 209
1347 3300025939 Ga0207665_10083989 Ga0207665_100839892 209
1348 3300025939 Ga0207665_10096503 Ga0207665_100965031 209
1349 3300025939 Ga0207665_10112780 Ga0207665_101127801 209
1350 3300025939 Ga0207665_10134727 Ga0207665_101347272 209
1351 3300025939 Ga0207665_10262347 Ga0207665_102623472 209
1352 3300025939 Ga0207665_10360785 Ga0207665_103607852 209
1353 3300025940 Ga0207691_10000308 Ga0207691_1000030827 209
1354 3300025940 Ga0207691_10020023 Ga0207691_100200235 209
1355 3300025940 Ga0207691_10523155 Ga0207691_105231552 209
1356 3300025941 Ga0207711_10003068 Ga0207711_100030682 209
1357 3300025941 Ga0207711_10005581 Ga0207711_100055812 209
1358 3300025941 Ga0207711_10052780 Ga0207711_100527805 209
1359 3300025941 Ga0207711_10059457 Ga0207711_100594574 209
1360 3300025941 Ga0207711_10712045 Ga0207711_107120451 209
1361 3300025942 Ga0207689_10000502 Ga0207689_1000050222 209
1362 3300025942 Ga0207689_10000542 Ga0207689_100005426 209
1363 3300025942 Ga0207689_10000618 Ga0207689_1000061829 209
1364 3300025942 Ga0207689_10027283 Ga0207689_100272833 209
1365 3300025944 Ga0207661_10007082 Ga0207661_100070822 209
1366 3300025944 Ga0207661_10281865 Ga0207661_102818651 209
1367 3300025944 Ga0207661_10441935 Ga0207661_104419352 209
1368 3300025944 Ga0207661_10452492 Ga0207661_104524921 209
1369 3300025944 Ga0207661_10524643 Ga0207661_105246431 209
1370 3300025944 Ga0207661_10525623 Ga0207661_105256231 209
1371 3300025944 Ga0207661_10589096 Ga0207661_105890962 209
1372 3300025944 Ga0207661_10677990 Ga0207661_106779901 209
1373 3300025945 Ga0207679_10000298 Ga0207679_1000029829 209
1374 3300025945 Ga0207679_10058332 Ga0207679_100583322 209
1375 3300025945 Ga0207679_10192628 Ga0207679_101926281 209
1376 3300025945 Ga0207679_10413860 Ga0207679_104138601 209
1377 3300025945 Ga0207679_10436368 Ga0207679_104363681 209
1378 3300025945 Ga0207679_10501753 Ga0207679_105017531 209
1379 3300025949 Ga0207667_10000245 Ga0207667_100002456 209
1380 3300025949 Ga0207667_10002261 Ga0207667_100022617 209
1381 3300025949 Ga0207667_10004201 Ga0207667_1000420116 209
1382 3300025949 Ga0207667_10007074 Ga0207667_1000707422 209
1383 3300025949 Ga0207667_10008140 Ga0207667_100081406 209
1384 3300025949 Ga0207667_10010370 Ga0207667_1001037014 209
1385 3300025949 Ga0207667_10010808 Ga0207667_100108089 209
1386 3300025949 Ga0207667_10024417 Ga0207667_100244174 209
1387 3300025949 Ga0207667_10027091 Ga0207667_100270913 209
1388 3300025949 Ga0207667_10046387 Ga0207667_100463876 209
1389 3300025949 Ga0207667_10132903 Ga0207667_101329031 209
1390 3300025949 Ga0207667_10215988 Ga0207667_102159884 209
1391 3300025949 Ga0207667_10232241 Ga0207667_102322411 209
1392 3300025949 Ga0207667_10327623 Ga0207667_103276232 209
1393 3300025949 Ga0207667_10403647 Ga0207667_104036471 209
1394 3300025949 Ga0207667_10528451 Ga0207667_105284511 209
1395 3300025960 Ga0207651_10083698 Ga0207651_100836982 209
1396 3300025960 Ga0207651_10102556 Ga0207651_101025564 209
1397 3300025961 Ga0207712_10624912 Ga0207712_106249121 209
1398 3300025972 Ga0207668_10079642 Ga0207668_100796421 209
1399 3300025972 Ga0207668_10158330 Ga0207668_101583301 209
1400 3300025981 Ga0207640_10008195 Ga0207640_100081958 209
1401 3300025981 Ga0207640_10008701 Ga0207640_100087013 209
1402 3300025981 Ga0207640_10038889 Ga0207640_100388894 209
1403 3300025981 Ga0207640_10065766 Ga0207640_100657663 209
1404 3300025981 Ga0207640_10125894 Ga0207640_101258942 209
1405 3300025986 Ga0207658_10000267 Ga0207658_1000026733 209
1406 3300025986 Ga0207658_10003391 Ga0207658_100033912 209
1407 3300025986 Ga0207658_10813687 Ga0207658_108136871 209
1408 3300026023 Ga0207677_10000115 Ga0207677_1000011529 209
1409 3300026023 Ga0207677_10008537 Ga0207677_100085374 209
1410 3300026023 Ga0207677_10010267 Ga0207677_100102673 209
1411 3300026023 Ga0207677_10030053 Ga0207677_100300532 209
1412 3300026023 Ga0207677_10031264 Ga0207677_100312641 209
1413 3300026023 Ga0207677_10087038 Ga0207677_100870382 209
1414 3300026023 Ga0207677_10144638 Ga0207677_101446382 209
1415 3300026023 Ga0207677_10160264 Ga0207677_101602642 209
1416 3300026023 Ga0207677_10306146 Ga0207677_103061462 209
1417 3300026023 Ga0207677_10410561 Ga0207677_104105612 209
1418 3300026035 Ga0207703_10013683 Ga0207703_100136838 209
1419 3300026035 Ga0207703_10032840 Ga0207703_100328403 209
1420 3300026035 Ga0207703_10041811 Ga0207703_100418116 209
1421 3300026035 Ga0207703_10050418 Ga0207703_100504182 209
1422 3300026035 Ga0207703_10081849 Ga0207703_100818492 209
1423 3300026035 Ga0207703_10098364 Ga0207703_100983644 209
1424 3300026035 Ga0207703_10158019 Ga0207703_101580191 209
1425 3300026035 Ga0207703_10199995 Ga0207703_101999951 209
1426 3300026041 Ga0207639_10000868 Ga0207639_100008686 209
1427 3300026041 Ga0207639_10077326 Ga0207639_100773262 209
1428 3300026041 Ga0207639_10100059 Ga0207639_101000592 209
1429 3300026041 Ga0207639_10162155 Ga0207639_101621551 209
1430 3300026041 Ga0207639_10361624 Ga0207639_103616242 209
1431 3300026041 Ga0207639_10433644 Ga0207639_104336441 209
1432 3300026041 Ga0207639_11112597 Ga0207639_111125971 209
1433 3300026067 Ga0207678_10001612 Ga0207678_1000161216 209
1434 3300026067 Ga0207678_10053979 Ga0207678_100539792 209
1435 3300026067 Ga0207678_10119637 Ga0207678_101196373 209
1436 3300026075 Ga0207708_10364448 Ga0207708_103644482 209
1437 3300026078 Ga0207702_10000775 Ga0207702_100007756 209
1438 3300026078 Ga0207702_10001276 Ga0207702_1000127621 209
1439 3300026078 Ga0207702_10001425 Ga0207702_100014257 209
1440 3300026078 Ga0207702_10001589 Ga0207702_100015897 209
1441 3300026078 Ga0207702_10003851 Ga0207702_1000385124 209
1442 3300026078 Ga0207702_10041975 Ga0207702_100419752 209
1443 3300026078 Ga0207702_10058657 Ga0207702_100586572 209
1444 3300026078 Ga0207702_10114333 Ga0207702_101143335 209
1445 3300026078 Ga0207702_10279249 Ga0207702_102792491 209
1446 3300026078 Ga0207702_10666626 Ga0207702_106666261 209
1447 3300026078 Ga0207702_10684072 Ga0207702_106840721 209
1448 3300026078 Ga0207702_10684771 Ga0207702_106847712 209
1449 3300026078 Ga0207702_10718188 Ga0207702_107181881 209
1450 3300026088 Ga0207641_10000052 Ga0207641_1000005228 209
1451 3300026088 Ga0207641_10001519 Ga0207641_100015195 209
1452 3300026088 Ga0207641_10035449 Ga0207641_100354494 209
1453 3300026088 Ga0207641_10076646 Ga0207641_100766464 209
1454 3300026088 Ga0207641_10698630 Ga0207641_106986301 209
1455 3300026088 Ga0207641_10799232 Ga0207641_107992321 209
1456 3300026089 Ga0207648_10030836 Ga0207648_100308365 209
1457 3300026089 Ga0207648_10108581 Ga0207648_101085815 209
1458 3300026089 Ga0207648_10164500 Ga0207648_101645002 209
1459 3300026089 Ga0207648_10194351 Ga0207648_101943512 209
1460 3300026089 Ga0207648_10213457 Ga0207648_102134572 209
1461 3300026089 Ga0207648_10226952 Ga0207648_102269521 209
1462 3300026095 Ga0207676_10000176 Ga0207676_1000017633 209
1463 3300026095 Ga0207676_10013418 Ga0207676_100134187 209
1464 3300026095 Ga0207676_10019798 Ga0207676_100197984 209
1465 3300026095 Ga0207676_11021450 Ga0207676_110214502 209
1466 3300026116 Ga0207674_10000864 Ga0207674_100008646 209
1467 3300026116 Ga0207674_10035733 Ga0207674_100357332 209
1468 3300026116 Ga0207674_10037656 Ga0207674_100376566 209
1469 3300026116 Ga0207674_10079166 Ga0207674_100791663 209
1470 3300026116 Ga0207674_10268226 Ga0207674_102682261 209
1471 3300026118 Ga0207675_100005443 Ga0207675_1000054433 209
1472 3300026118 Ga0207675_100109928 Ga0207675_1001099282 209
1473 3300026118 Ga0207675_100645130 Ga0207675_1006451302 209
1474 3300026121 Ga0207683_10001978 Ga0207683_100019784 209
1475 3300026121 Ga0207683_10003988 Ga0207683_100039888 209
1476 3300026121 Ga0207683_10384501 Ga0207683_103845012 209
1477 3300026121 Ga0207683_10575389 Ga0207683_105753892 209
1478 3300026142 Ga0207698_10000039 Ga0207698_1000003929 209
1479 3300026142 Ga0207698_10018540 Ga0207698_100185406 209
1480 3300026142 Ga0207698_10057598 Ga0207698_100575986 209
1481 3300026142 Ga0207698_10061165 Ga0207698_100611655 209
1482 3300026142 Ga0207698_10125714 Ga0207698_101257142 209
1483 3300026142 Ga0207698_10334050 Ga0207698_103340501 209
1484 3300026142 Ga0207698_10434246 Ga0207698_104342462 209
1485 3300026142 Ga0207698_10448723 Ga0207698_104487231 209
1486 3300026142 Ga0207698_10831010 Ga0207698_108310101 209
1487 3300026142 Ga0207698_11377525 Ga0207698_113775251 209
1488 3300027695 Ga0209966_1032404 Ga0209966_10324042 209
1489 3300027717 Ga0209998_10021159 Ga0209998_100211592 209
1490 3300028016 Ga0265354_1001832 Ga0265354_10018322 209
1491 3300028016 Ga0265354_1008544 Ga0265354_10085442 209
1492 3300028017 Ga0265356_1001750 Ga0265356_10017501 209
1493 3300028379 Ga0268266_10001266 Ga0268266_1000126618 209
1494 3300028379 Ga0268266_10007476 Ga0268266_100074762 209
1495 3300028379 Ga0268266_10093413 Ga0268266_100934136 209
1496 3300028379 Ga0268266_11103983 Ga0268266_111039831 209
1497 3300028380 Ga0268265_10215468 Ga0268265_102154683 209
1498 3300028380 Ga0268265_10645325 Ga0268265_106453251 209
1499 3300028381 Ga0268264_10000863 Ga0268264_1000086313 209
1500 3300028381 Ga0268264_10005269 Ga0268264_1000526921 209
1501 3300028381 Ga0268264_10017321 Ga0268264_100173216 209
1502 3300028381 Ga0268264_10083427 Ga0268264_100834273 209
1503 3300028381 Ga0268264_10142703 Ga0268264_101427032 209
1504 3300028381 Ga0268264_10221861 Ga0268264_102218613 209
1505 3300028381 Ga0268264_10439518 Ga0268264_104395181 209
1506 3300028381 Ga0268264_10833678 Ga0268264_108336781 209
1507 3300028800 Ga0265338_10002857 Ga0265338_1000285728 209
1508 3300028800 Ga0265338_10012332 Ga0265338_100123325 209
1509 3300028800 Ga0265338_10066539 Ga0265338_100665393 209
1510 3300028800 Ga0265338_10097304 Ga0265338_100973042 209
1511 3300028800 Ga0265338_10184937 Ga0265338_101849373 209
1512 3300028800 Ga0265338_10256917 Ga0265338_102569172 209
1513 3300028800 Ga0265338_10297858 Ga0265338_102978582 209
1514 3300030760 Ga0265762_1000268 Ga0265762_10002688 209
1515 3300030760 Ga0265762_1001658 Ga0265762_10016584 209
1516 3300030760 Ga0265762_1021727 Ga0265762_10217271 209
1517 3300030762 Ga0265775_100102 Ga0265775_1001023 209
1518 3300030836 Ga0265767_102289 Ga0265767_1022892 209
1519 3300030877 Ga0265777_102633 Ga0265777_1026332 209
1520 3300030878 Ga0265770_1064017 Ga0265770_10640171 209
1521 3300030879 Ga0265765_1002819 Ga0265765_10028192 209
1522 3300030886 Ga0265772_100406 Ga0265772_1004062 209
1523 3300030888 Ga0265769_104373 Ga0265769_1043731 209
1524 3300031090 Ga0265760_10000814 Ga0265760_100008144 209
1525 3300031090 Ga0265760_10021220 Ga0265760_100212202 209
1526 3300031090 Ga0265760_10021826 Ga0265760_100218263 209
1527 3300031090 Ga0265760_10035655 Ga0265760_100356552 209
1528 3300031090 Ga0265760_10125191 Ga0265760_101251911 209
1529 3300031235 Ga0265330_10000477 Ga0265330_1000047729 209
1530 3300031235 Ga0265330_10006604 Ga0265330_100066043 209
1531 3300031235 Ga0265330_10079036 Ga0265330_100790361 209
1532 3300031238 Ga0265332_10062587 Ga0265332_100625872 209
1533 3300031239 Ga0265328_10030997 Ga0265328_100309972 209
1534 3300031241 Ga0265325_10003007 Ga0265325_1000300712 209
1535 3300031241 Ga0265325_10015826 Ga0265325_100158263 209
1536 3300031241 Ga0265325_10023797 Ga0265325_100237973 209
1537 3300031247 Ga0265340_10009745 Ga0265340_100097454 209
1538 3300031247 Ga0265340_10056803 Ga0265340_100568031 209
1539 3300031247 Ga0265340_10095665 Ga0265340_100956651 209
1540 3300031247 Ga0265340_10113642 Ga0265340_101136422 209
1541 3300031249 Ga0265339_10012597 Ga0265339_100125974 209
1542 3300031249 Ga0265339_10012679 Ga0265339_100126793 209
1543 3300031249 Ga0265339_10026466 Ga0265339_100264664 209
1544 3300031249 Ga0265339_10044450 Ga0265339_100444502 209
1545 3300031249 Ga0265339_10110105 Ga0265339_101101052 209
1546 3300031249 Ga0265339_10129874 Ga0265339_101298741 209
1547 3300031249 Ga0265339_10172958 Ga0265339_101729582 209
1548 3300031249 Ga0265339_10185948 Ga0265339_101859482 209
1549 3300031250 Ga0265331_10012160 Ga0265331_100121602 209
1550 3300031250 Ga0265331_10060079 Ga0265331_100600793 209
1551 3300031250 Ga0265331_10071318 Ga0265331_100713182 209
1552 3300031250 Ga0265331_10115722 Ga0265331_101157221 209
1553 3300031250 Ga0265331_10126261 Ga0265331_101262612 209
1554 3300031250 Ga0265331_10186645 Ga0265331_101866451 209
1555 3300031250 Ga0265331_10306024 Ga0265331_103060241 209
1556 3300031251 Ga0265327_10085096 Ga0265327_100850962 209
1557 3300031344 Ga0265316_10000447 Ga0265316_1000044734 209
1558 3300031344 Ga0265316_10012698 Ga0265316_100126986 209
1559 3300031344 Ga0265316_10024062 Ga0265316_100240622 209
1560 3300031344 Ga0265316_10093686 Ga0265316_100936863 209
1561 3300031344 Ga0265316_10134898 Ga0265316_101348981 209
1562 3300031344 Ga0265316_10234227 Ga0265316_102342271 209
1563 3300031548 Ga0307408_100579105 Ga0307408_1005791051 209
1564 3300031595 Ga0265313_10002067 Ga0265313_100020677 209
1565 3300031595 Ga0265313_10002540 Ga0265313_100025404 209
1566 3300031595 Ga0265313_10031853 Ga0265313_100318532 209
1567 3300031595 Ga0265313_10034363 Ga0265313_100343633 209
1568 3300031595 Ga0265313_10047032 Ga0265313_100470323 209
1569 3300031595 Ga0265313_10087416 Ga0265313_100874161 209
1570 3300031711 Ga0265314_10000195 Ga0265314_1000019577 209
1571 3300031711 Ga0265314_10006372 Ga0265314_100063725 209
1572 3300031711 Ga0265314_10019611 Ga0265314_100196117 209
1573 3300031711 Ga0265314_10279939 Ga0265314_102799392 209
1574 3300031712 Ga0265342_10008369 Ga0265342_100083696 209
1575 3300031712 Ga0265342_10009887 Ga0265342_100098875 209
1576 3300031712 Ga0265342_10023824 Ga0265342_100238247 209
1577 3300031712 Ga0265342_10116136 Ga0265342_101161362 209
1578 3300031712 Ga0265342_10146411 Ga0265342_101464112 209
1579 3300031712 Ga0265342_10264151 Ga0265342_102641511 209
1580 3300031852 Ga0307410_10003818 Ga0307410_100038186 209
1581 3300031901 Ga0307406_10334823 Ga0307406_103348232 209
1582 3300031911 Ga0307412_10316289 Ga0307412_103162892 209
1583 3300032120 Ga0316053_101376 Ga0316053_1013761 209
1584 3300033547 Ga0316212_1011384 Ga0316212_10113841 209
1585 3300035111 Ga0373923_0125188 Ga0373923_0125188_97_726 209
1586 3300035170 Ga0373943_0332593 Ga0373943_0332593_25_654 209
1587 3300035172 Ga0373955_0090667 Ga0373955_0090667_358_987 209
1588 3300035691 Ga0373931_0238784 Ga0373931_0238784_77_706 209
1589 3300036401 Ga0373937_0865205 Ga0373937_0865205_87_716 209
1590 3300038443 Ga0395901_0681495 Ga0395901_0681495_97_726 209
1591 3300039450 Ga0436363_0821922 Ga0436363_0821922_50_679 209
1592 3300042876 Ga0451577_0000523 Ga0451577_0000523_6479_7108 209
1593 3300042876 Ga0451577_0163564 Ga0451577_0163564_458_1087 209
1594 3300044673 Ga0453683_0262508 Ga0453683_0262508_300_929 209
1595 3300044694 Ga0466963_0017000 Ga0466963_0017000_1170_1799 209
1596 3300044694 Ga0466963_0173612 Ga0466963_0173612_679_1308 209
1597 3300044706 Ga0466964_0403458 Ga0466964_0403458_32_661 209
1598 3300044712 Ga0453684_0000375 Ga0453684_0000375_172247_172876 209
1599 3300044712 Ga0453684_0028486 Ga0453684_0028486_567_1196 209
1600 3300045051 Ga0451576_0054948 Ga0451576_0054948_441_1070 209
1601 3300045051 Ga0451576_0108377 Ga0451576_0108377_318_947 209
1602 3300045051 Ga0451576_0432832 Ga0451576_0432832_576_1205 209
1603 3300045836 Ga0466958_0575564 Ga0466958_0575564_56_685 209
1604 3300045976 Ga0466967_0001212 Ga0466967_0001212_12860_13489 209
1605 3300045976 Ga0466967_0075749 Ga0466967_0075749_2199_2828 209
1606 3300046455 Ga0495603_0316569 Ga0495603_0316569_225_866 209
1607 3300046459 Ga0495629_0111252 Ga0495629_0111252_145_774 209
1608 3300046472 Ga0495580_0005699 Ga0495580_0005699_2350_2979 209
1609 3300046472 Ga0495580_0014792 Ga0495580_0014792_2464_3093 209
1610 3300046472 Ga0495580_0072826 Ga0495580_0072826_196_825 209
1611 3300046472 Ga0495580_0478560 Ga0495580_0478560_190_819 209
1612 3300046477 Ga0495664_0041085 Ga0495664_0041085_272_901 209
1613 3300046499 Ga0495594_0097967 Ga0495594_0097967_452_1093 209
1614 3300046529 Ga0495652_0042775 Ga0495652_0042775_744_1373 209
1615 3300046543 Ga0495645_0043216 Ga0495645_0043216_927_1556 209
1616 3300046642 Ga0495634_0374163 Ga0495634_0374163_62_691 209
1617 3300046674 Ga0495588_0184362 Ga0495588_0184362_47_688 209
1618 3300046679 Ga0495623_0061023 Ga0495623_0061023_1642_2271 209
1619 3300046689 Ga0495613_0099825 Ga0495613_0099825_713_1342 209
1620 3300046691 Ga0495670_0108176 Ga0495670_0108176_579_1208 209
1621 3300047444 Ga0495675_0243636 Ga0495675_0243636_341_970 209
1622 3300048088 Ga0495602_0052250 Ga0495602_0052250_2760_3389 209
1623 3300048088 Ga0495602_0501001 Ga0495602_0501001_192_821 209
1624 3300048904 Ga0496101_0093399 Ga0496101_0093399_1025_1654 209
1625 3300048906 Ga0496103_0042709 Ga0496103_0042709_1880_2509 209
1626 3300048907 Ga0496104_0075835 Ga0496104_0075835_1026_1655 209
1627 3300048907 Ga0496104_0078899 Ga0496104_0078899_416_1045 209
1628 3300048907 Ga0496104_0624684 Ga0496104_0624684_247_876 209
1629 3300048908 Ga0496105_0023235 Ga0496105_0023235_131_760 209
1630 3300048909 Ga0496106_0537697 Ga0496106_0537697_84_713 209
1631 3300048910 Ga0496107_0226631 Ga0496107_0226631_81_710 209
1632 3300048911 Ga0496108_0000242 Ga0496108_0000242_15196_15825 209
1633 3300048912 Ga0496109_0000120 Ga0496109_0000120_13821_14450 209
1634 3300048913 Ga0496110_0000795 Ga0496110_0000795_15057_15686 209
1635 3300048913 Ga0496110_0062633 Ga0496110_0062633_2617_3246 209
1636 3300048914 Ga0496111_0072224 Ga0496111_0072224_1705_2334 209
1637 3300048915 Ga0496112_0000198 Ga0496112_0000198_22721_23350 209
1638 3300048915 Ga0496112_0023788 Ga0496112_0023788_2852_3481 209
1639 3300048915 Ga0496112_0082350 Ga0496112_0082350_1371_2000 209
1640 3300048915 Ga0496112_0099271 Ga0496112_0099271_1621_2280 209
1641 3300048915 Ga0496112_0157945 Ga0496112_0157945_355_984 209
1642 3300048916 Ga0496113_0000111 Ga0496113_0000111_19442_20071 209
1643 3300048916 Ga0496113_0164340 Ga0496113_0164340_1013_1642 209
1644 3300048916 Ga0496113_0269042 Ga0496113_0269042_49_708 209
1645 3300048917 Ga0496114_0018472 Ga0496114_0018472_2440_3069 209
1646 3300048918 Ga0496115_0344739 Ga0496115_0344739_76_705 209
1647 3300049744 Ga0501083_0076594 Ga0501083_0076594_782_1411 209
1648 3300050512 nmdc:mga0n895_538070_c1 nmdc:mga0n895_538070_c1_215_844 209
1649 3300050513 nmdc:mga0rr50_42278_c1 nmdc:mga0rr50_42278_c1_980_1609 209
1650 3300050514 nmdc:mga08x19_16597_c1 nmdc:mga08x19_16597_c1_2234_2920 209
1651 3300050515 nmdc:mga0a205_27065_c1 nmdc:mga0a205_27065_c1_2941_3570 209
1652 3300053077 Ga0495601_0289232 Ga0495601_0289232_167_796 209
1653 3300053085 Ga0495619_0067973 Ga0495619_0067973_704_1333 209
1654 3300053085 Ga0495619_0320700 Ga0495619_0320700_284_913 209
1655 3300059477 Ga0587084_038166 Ga0587084_038166_115_744 209
1656 3300059490 Ga0587066_000041 Ga0587066_000041_2951_3580 209
1657 3300059490 Ga0587066_003966 Ga0587066_003966_242_871 209
1658 3300059490 Ga0587066_024849 Ga0587066_024849_72_701 209
1659 3300059490 Ga0587066_064211 Ga0587066_064211_29_658 209
1660 3300059491 Ga0587070_000114 Ga0587070_000114_2917_3546 209
1661 3300059491 Ga0587070_005006 Ga0587070_005006_914_1543 209
1662 3300059491 Ga0587070_009437 Ga0587070_009437_188_817 209
1663 3300059492 Ga0587073_0000512 Ga0587073_0000512_2272_2901 209
1664 3300059492 Ga0587073_0010183 Ga0587073_0010183_376_1005 209
1665 3300059492 Ga0587073_0027533 Ga0587073_0027533_417_1046 209
1666 3300059492 Ga0587073_0067380 Ga0587073_0067380_196_825 209
1667 3300059493 Ga0587077_000059 Ga0587077_000059_2917_3546 209
1668 3300059493 Ga0587077_020358 Ga0587077_020358_218_847 209
1669 3300059503 Ga0587080_023497 Ga0587080_023497_171_800 209
1670 3300059504 Ga0587082_000041 Ga0587082_000041_3456_4085 209
1671 3300059504 Ga0587082_001045 Ga0587082_001045_143_772 209
1672 3300059504 Ga0587082_015966 Ga0587082_015966_72_701 209
1673 3300059504 Ga0587082_026978 Ga0587082_026978_76_705 209
1674 3300059505 Ga0587083_0000140 Ga0587083_0000140_2904_3533 209
1675 3300059505 Ga0587083_0008317 Ga0587083_0008317_445_1074 209
1676 3300059505 Ga0587083_0042069 Ga0587083_0042069_99_728 209
1677 3300059506 Ga0587085_000049 Ga0587085_000049_1062_1691 209
1678 3300059506 Ga0587085_013465 Ga0587085_013465_182_811 209
1679 3300059507 Ga0587086_001807 Ga0587086_001807_1021_1650 209
1680 3300059507 Ga0587086_002117 Ga0587086_002117_568_1197 209
1681 3300059508 Ga0587088_018587 Ga0587088_018587_110_739 209
1682 3300059508 Ga0587088_062885 Ga0587088_062885_39_668 209
1683 3300059509 Ga0587089_011038 Ga0587089_011038_439_1068 209
1684 3300059510 Ga0587090_002124 Ga0587090_002124_79_708 209
1685 3300059510 Ga0587090_004530 Ga0587090_004530_299_928 209
1686 3300059510 Ga0587090_028725 Ga0587090_028725_50_679 209
1687 3300059511 Ga0587091_000037 Ga0587091_000037_2307_2936 209
1688 3300059512 Ga0587092_017130 Ga0587092_017130_47_676 209
1689 3300059513 Ga0587094_015140 Ga0587094_015140_256_885 209
1690 3300059607 Ga0587125_002360 Ga0587125_002360_179_808 209
1691 3300059622 Ga0587099_001742 Ga0587099_001742_740_1369 209
1692 3300059623 Ga0587101_000464 Ga0587101_000464_1034_1663 209
1693 3300059623 Ga0587101_026206 Ga0587101_026206_179_808 209
1694 3300059624 Ga0587109_018150 Ga0587109_018150_364_993 209
1695 3300059625 Ga0587113_000202 Ga0587113_000202_1224_1853 209
1696 3300059625 Ga0587113_001661 Ga0587113_001661_631_1260 209
1697 3300059626 Ga0587115_000395 Ga0587115_000395_308_937 209
1698 3300059626 Ga0587115_006541 Ga0587115_006541_179_808 209
1699 3300059627 Ga0587117_031479 Ga0587117_031479_130_759 209
1700 3300059628 Ga0587122_000120 Ga0587122_000120_595_1224 209
1701 3300059630 Ga0587128_000097 Ga0587128_000097_973_1602 209
1702 3300059630 Ga0587128_013692 Ga0587128_013692_64_693 209
1703 3300059639 Ga0587062_005838 Ga0587062_005838_22_651 209
1704 3300059639 Ga0587062_021903 Ga0587062_021903_91_720 209
1705 3300059640 Ga0587067_023152 Ga0587067_023152_58_687 209
1706 3300059640 Ga0587067_031560 Ga0587067_031560_51_680 209
1707 3300059641 Ga0587068_001605 Ga0587068_001605_1256_1885 209
1708 3300059641 Ga0587068_014836 Ga0587068_014836_307_936 209
1709 3300059641 Ga0587068_018769 Ga0587068_018769_71_700 209
1710 3300059642 Ga0587069_000319 Ga0587069_000319_2015_2644 209
1711 3300059643 Ga0587072_002593 Ga0587072_002593_53_682 209
1712 3300059643 Ga0587072_011607 Ga0587072_011607_62_691 209
1713 3300059644 Ga0587075_000131 Ga0587075_000131_320_949 209
1714 3300059645 Ga0587076_000182 Ga0587076_000182_3296_3925 209
1715 3300059645 Ga0587076_005031 Ga0587076_005031_362_991 209
1716 3300059646 Ga0587078_004534 Ga0587078_004534_267_896 209
1717 3300059646 Ga0587078_005238 Ga0587078_005238_695_1324 209
1718 3300059647 Ga0587079_000058 Ga0587079_000058_2041_2670 209
1719 3300059647 Ga0587079_008309 Ga0587079_008309_463_1092 209
1720 3300059647 Ga0587079_017504 Ga0587079_017504_237_866 209
1721 3300059647 Ga0587079_055528 Ga0587079_055528_97_726 209
1722 3300059649 Ga0587102_002667 Ga0587102_002667_50_679 209
1723 3300059652 Ga0587107_005010 Ga0587107_005010_332_961 209
1724 3300059655 Ga0587114_002308 Ga0587114_002308_818_1447 209
1725 3300059655 Ga0587114_006193 Ga0587114_006193_526_1155 209
1726 3300059655 Ga0587114_039900 Ga0587114_039900_55_684 209
1727 3300060246 Ga0587081_02740 Ga0587081_02740_199_828 209
1728 3300060344 Ga0587071_000028 Ga0587071_000028_5153_5782 209
1729 3300060344 Ga0587071_008428 Ga0587071_008428_829_1458 209
1730 3300060344 Ga0587071_017121 Ga0587071_017121_406_1035 209
1731 3300060344 Ga0587071_040607 Ga0587071_040607_111_740 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00163

Ribosomal_S4

Ribosomal protein S4/S9 N-terminal domain

22

117

0.98

PF01479

S4

S4 domain

118

165

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9942 54 155
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9751 54 155
4v61-assembly1.cif.gz_AD homology model for the spinach chloroplast 30s subunit fitted to 9.4a cryo-em map of the 70s chlororibosome. 0.971 52 209
6vwl-assembly1.cif.gz_c 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.9698 52 207
1qd7-assembly1.cif.gz_C partial model for 30s ribosomal subunit 0.9668 52 209
ID Description Score Start End Superfamily
af_Q9LXG1_108_164_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 1.005 98 141 3.10.290.10
af_A0A0P0Y445_123_179_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9994 99 142 3.10.290.10
af_C6TBL4_107_182_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9824 99 141 3.10.290.10
2qalD02 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.978 101 194 3.10.290.10
af_A0A0P0X948_1_70_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9748 104 141 3.10.290.10
ID Description Score Start End GO Terms
AF-C0CVG0-F1-model_v4 Small ribosomal subunit protein uS4 0.9931 52 209 GO:0003735
GO:0006412
GO:0015935
GO:0019843
GO:0042274
AF-V9ZWC7-F1-model_v4 deleted 0.9922 57 209
AF-T0PDE1-F1-model_v4 deleted 0.991 53 209
AF-A0A3C0VSH8-F1-model_v4 Small ribosomal subunit protein uS4 0.9908 64 209 GO:0003735
GO:0006412
GO:0015935
GO:0019843
GO:0042274
AF-A0A2I6QJF7-F1-model_v4 Small ribosomal subunit protein uS4 0.9908 59 199 GO:0003735
GO:0006412
GO:0015935
GO:0019843
GO:0042274

Feature Viewer

pLDDT pTM Quality
82.7 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map