F495504

General Info

Members Datasets Scaffolds Average Seq Length
1731 572 1620 229

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10029219|Ga0075364_100292193
Length 281
Sequence VPAEPVIAPVVGLPTAEPALAPSATRNPTNADDARPNRERRQPMAMPTTSVLVVEDEDSFIDALTVGLEREGFTVQVARDGAEALDVFDDVQPDVVLLDVMLPKVSGIDVCRELRARSNVPIIMVTAKGAEIDTVVGLEVGADDYVTKPYRLRELVARMRAVLRRRPADDPLRAALDGDDVVQVDDVLVDHQRHEVVIRGAQVQLPLKEFELLALLLENAGRVLTRDQLIDRVWGADYVGDTKTLDVHVKRLRSKVEEDPSNPTRIVTIRGLGYKYEVPRD

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2517572101 Frankia sp. DC12 Isolate Nodule
3 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
4 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
5 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
6 2643221553 Microbacterium sp. Root553 Isolate Unclassified
7 2643221566 Microbacterium sp. Root166 Isolate Unclassified
8 2643221575 Microbacterium sp. Root61 Isolate Unclassified
9 2643221597 Microbacterium sp. Root180 Isolate Unclassified
10 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
11 2643221613 Oerskovia sp. Root22 Isolate Unclassified
12 2643221630 Microbacterium sp. Root322 Isolate Unclassified
13 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
14 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
15 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
16 2643221721 Oerskovia sp. Root918 Isolate Unclassified
17 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
18 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
19 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
20 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
21 2687453737 Frankia sp. BMG5.36 Isolate Nodule
22 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
23 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
24 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
25 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
26 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
27 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
28 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
29 2773857759 Microbacterium sp. 1294 Isolate Unclassified
30 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
31 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
32 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
33 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
34 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
35 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
36 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
37 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
38 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
39 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
40 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
41 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
42 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
43 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
44 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
45 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
46 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
47 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
48 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
49 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
50 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
51 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
52 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
53 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
54 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
55 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
56 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
57 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
58 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
59 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
60 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
61 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
62 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
63 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
64 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
65 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
66 2919069694 Microbacterium sp. 1154 Isolate Unclassified
67 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
68 2919395869 Microbacterium resistens 2980 Isolate Unclassified
69 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
70 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
71 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
72 2920879853 Kocuria salina CV6 Isolate Unclassified
73 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
74 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
75 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
76 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
77 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
78 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
79 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
80 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
81 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
82 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
83 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
84 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
85 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
86 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
87 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
88 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
89 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
90 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
91 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
92 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
93 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
94 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
95 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
96 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
97 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
98 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
99 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
100 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
101 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
102 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
103 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
104 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
105 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
106 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
107 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
108 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
109 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
110 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
111 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
113 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
115 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
116 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
117 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
118 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
119 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
120 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
121 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
122 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
123 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
124 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
125 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
126 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
127 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
128 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
129 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
130 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
131 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
132 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
133 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
134 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
135 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
136 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
137 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
138 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
139 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
140 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
141 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
142 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
143 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
144 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
145 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
146 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
147 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
148 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
149 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
150 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
151 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
152 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
153 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
154 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
155 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
156 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
157 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
158 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
159 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
160 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
161 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
162 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
163 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
164 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
165 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
166 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
167 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
168 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
169 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
170 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
171 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
172 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
173 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
174 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
175 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
176 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
177 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
178 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
179 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
180 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
181 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
182 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
183 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
184 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
185 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
186 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
187 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
188 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
189 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
190 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
191 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
192 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
193 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
194 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
195 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
196 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
197 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
198 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
199 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
200 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
201 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
202 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
203 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
204 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
205 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
206 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
207 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
208 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
209 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
210 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
211 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
212 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
213 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
214 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
215 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
216 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
217 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
218 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
219 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
220 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
221 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
222 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
223 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
224 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
225 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
226 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
227 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
284 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
285 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
289 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
290 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
291 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
292 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
293 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
294 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
295 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
296 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
297 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
298 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
299 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
300 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
301 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
302 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
303 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
304 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
305 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
306 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
307 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
308 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
309 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
310 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
311 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
312 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
313 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
314 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
315 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
316 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
317 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
318 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
319 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
320 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
321 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
322 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
323 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
324 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
325 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
326 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
327 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
328 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
329 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
330 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
331 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
332 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
333 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
334 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
335 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
336 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
337 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
338 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
339 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
340 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
341 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
342 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
343 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
344 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
345 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
346 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
347 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
348 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
349 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
350 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
351 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
352 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
353 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
354 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
355 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
356 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
357 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
358 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
359 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
360 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
361 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
362 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
363 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
364 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
365 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
366 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
367 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
368 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
369 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
370 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
371 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
372 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
373 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
374 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
375 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
376 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
377 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
378 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
379 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
380 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
381 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
382 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
383 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
384 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
385 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
386 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
387 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
388 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
389 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
390 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
391 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
392 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
393 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
394 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
395 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
396 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
397 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
398 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
399 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
400 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
401 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
402 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
403 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
404 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
405 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
406 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
407 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
408 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
409 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
410 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
411 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
412 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
413 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
414 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
415 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
416 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
417 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
418 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
419 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
420 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
421 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
422 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
423 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
424 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
425 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
426 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
427 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
428 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
429 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
430 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
431 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
432 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
433 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
434 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
435 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
436 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
437 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
438 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
439 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
440 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
441 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
442 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
443 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
444 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
445 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
446 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
447 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
448 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
449 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
450 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
451 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
452 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
453 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
454 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
455 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
456 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
457 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
458 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
459 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
460 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
461 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
462 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
463 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
464 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
465 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
466 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
467 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
468 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
469 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
470 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
471 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
472 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
473 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
474 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
475 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
476 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
477 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
478 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
479 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
480 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
481 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
482 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
483 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
484 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
485 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
486 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
487 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
488 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
489 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
490 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
491 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
492 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
493 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
494 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
498 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
499 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
503 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
505 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
506 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
511 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
512 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
513 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
514 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
515 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
516 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
517 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
518 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
519 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
520 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
521 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
522 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
523 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
524 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
525 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
526 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
527 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
528 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
529 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
531 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
532 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
533 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
534 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
535 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
536 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
537 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
538 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
539 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
540 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
541 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
542 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
543 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
544 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
545 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
546 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
547 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
548 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
549 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
550 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
551 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
552 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
553 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
554 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
555 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
556 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
557 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
558 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
559 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
560 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
562 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
563 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
564 8002775197 Frankia nepalensis CN7 Isolate Nodule
565 8002784119 Frankia sp. AgB1.9 Isolate Nodule
566 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
567 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
568 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
569 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
570 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
571 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
572 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 0.35
Isolates 6.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 3.35
Nodule 0.46
Rhizoplane 6.12
Rhizosphere 82.03
Stem 0
Stem Tuber 0
Unclassified 7.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001275 3300000549 Bacteria 3800
2 LJQas_1001475 3300000549 Bacteria 3502
3 JGI24740J21852_10040272 3300001979 Bacteria 1418
4 JGI24739J22299_10009836 3300001989 Bacteria 3555
5 JGI24739J22299_10017839 3300001989 Bacteria 2557
6 JGI24737J22298_10007017 3300001990 Bacteria 3819
7 JGI24735J21928_10060836 3300002067 Bacteria 1085
8 JGI25154J39366_1002756 3300002738 Bacteria 4251
9 JGI25152J39213_1000335 3300002773 Bacteria 29846
10 JGI25151J46595_10011197 3300003187 Bacteria 4131
11 JGI25406J46586_10009616 3300003203 Bacteria 4324
12 JGI25407J50210_10000232 3300003373 Bacteria 9645
13 JGI25407J50210_10002720 3300003373 Bacteria 4203
14 JGI25407J50210_10048409 3300003373 Bacteria 1079
15 JGI25405J52794_10012237 3300003911 Bacteria 1650
16 Ga0065714_10007799 3300005288 Bacteria 2741
17 Ga0070658_10074956 3300005327 Bacteria 2775
18 Ga0070658_10200386 3300005327 Bacteria 1684
19 Ga0070676_10237571 3300005328 Bacteria 1211
20 Ga0070676_10471740 3300005328 Bacteria 886
21 Ga0070683_100003701 3300005329 Bacteria 12476
22 Ga0070683_100112442 3300005329 Bacteria 2570
23 Ga0070683_100158347 3300005329 Bacteria 2148
24 Ga0070690_100040614 3300005330 Bacteria 2943
25 Ga0070690_100061256 3300005330 Bacteria 2424
26 Ga0070670_100077353 3300005331 Bacteria 2859
27 Ga0070670_100080871 3300005331 Bacteria 2792
28 Ga0070670_100626665 3300005331 Bacteria 964
29 Ga0070677_10007609 3300005333 Bacteria 3622
30 Ga0068869_100004314 3300005334 Bacteria 8829
31 Ga0070680_100000651 3300005336 Bacteria 24087
32 Ga0070680_100061939 3300005336 Bacteria 3063
33 Ga0070680_100187633 3300005336 Bacteria 1742
34 Ga0070680_100243592 3300005336 Bacteria 1520
35 Ga0070682_100006883 3300005337 Bacteria 6391
36 Ga0070682_100085211 3300005337 Bacteria 2055
37 Ga0070682_100124200 3300005337 Bacteria 1737
38 Ga0068868_100005203 3300005338 Bacteria 9132
39 Ga0068868_100717357 3300005338 Bacteria 896
40 Ga0070660_100014778 3300005339 Bacteria 5632
41 Ga0070660_100065907 3300005339 Bacteria 2819
42 Ga0070660_100163222 3300005339 Bacteria 1796
43 Ga0070660_100178855 3300005339 Bacteria 1716
44 Ga0070660_100191918 3300005339 Bacteria 1655
45 Ga0070660_100279889 3300005339 Bacteria 1365
46 Ga0070668_100018238 3300005347 Bacteria 5265
47 Ga0070668_100032937 3300005347 Bacteria 3944
48 Ga0070668_100039488 3300005347 Bacteria 3609
49 Ga0070668_100226407 3300005347 Bacteria 1544
50 Ga0070668_100450413 3300005347 Bacteria 1106
51 Ga0070669_100021093 3300005353 Bacteria 4655
52 Ga0070669_100207076 3300005353 Bacteria 1546
53 Ga0070669_100474472 3300005353 Bacteria 1034
54 Ga0070675_100001433 3300005354 Bacteria 17504
55 Ga0070675_100127240 3300005354 Bacteria 2168
56 Ga0070675_100787253 3300005354 Bacteria 869
57 Ga0070671_100002578 3300005355 Bacteria 14054
58 Ga0070671_100066493 3300005355 Bacteria 3004
59 Ga0070671_100430718 3300005355 Bacteria 1130
60 Ga0070674_100092292 3300005356 Bacteria 2188
61 Ga0070674_100255639 3300005356 Bacteria 1378
62 Ga0070674_100437034 3300005356 Bacteria 1077
63 Ga0070659_100015596 3300005366 Bacteria 5691
64 Ga0070659_100157076 3300005366 Bacteria 1858
65 Ga0070659_100158990 3300005366 Bacteria 1847
66 Ga0070659_100267584 3300005366 Bacteria 1419
67 Ga0070667_100005632 3300005367 Bacteria 10460
68 Ga0070667_100016921 3300005367 Bacteria 6034
69 Ga0070667_100110730 3300005367 Bacteria 2381
70 Ga0070714_100036644 3300005435 Bacteria 4115
71 Ga0070713_100071033 3300005436 Bacteria 2941
72 Ga0070700_100012269 3300005441 Bacteria 4775
73 Ga0070700_100019460 3300005441 Bacteria 3918
74 Ga0070708_100004013 3300005445 Bacteria 11562
75 Ga0070708_100289211 3300005445 Bacteria 1543
76 Ga0070663_100002797 3300005455 Bacteria 9900
77 Ga0070663_100159637 3300005455 Bacteria 1735
78 Ga0070678_100050169 3300005456 Bacteria 3017
79 Ga0070678_100057529 3300005456 Bacteria 2849
80 Ga0070678_100234646 3300005456 Bacteria 1531
81 Ga0070678_100432803 3300005456 Bacteria 1149
82 Ga0070662_100171090 3300005457 Bacteria 1706
83 Ga0070662_100325505 3300005457 Bacteria 1254
84 Ga0070662_100366962 3300005457 Bacteria 1182
85 Ga0070662_100677724 3300005457 Bacteria 871
86 Ga0070681_10000045 3300005458 Bacteria 84615
87 Ga0070681_10002651 3300005458 Bacteria 16433
88 Ga0070681_10020407 3300005458 Bacteria 6641
89 Ga0070681_10273653 3300005458 Bacteria 1600
90 Ga0070681_10516370 3300005458 Bacteria 1108
91 Ga0068867_100144154 3300005459 Bacteria 1865
92 Ga0070685_10177742 3300005466 Bacteria 1368
93 Ga0070685_10264021 3300005466 Bacteria 1146
94 Ga0070706_100030434 3300005467 Bacteria 4973
95 Ga0070699_100107135 3300005518 Bacteria 2452
96 Ga0070679_100000169 3300005530 Bacteria 52696
97 Ga0070679_100005047 3300005530 Bacteria 12185
98 Ga0070679_100040379 3300005530 Bacteria 4642
99 Ga0070679_100159808 3300005530 Bacteria 2228
100 Ga0070679_100181943 3300005530 Bacteria 2074
101 Ga0070684_100034172 3300005535 Bacteria 4346
102 Ga0070697_100111733 3300005536 Bacteria 2278
103 Ga0068853_100326398 3300005539 Bacteria 1423
104 Ga0070672_100023485 3300005543 Bacteria 4546
105 Ga0070672_100251679 3300005543 Bacteria 1488
106 Ga0070672_100424888 3300005543 Bacteria 1142
107 Ga0070686_100036595 3300005544 Bacteria 3041
108 Ga0070696_100408980 3300005546 Bacteria 1063
109 Ga0070665_100152798 3300005548 Bacteria 2311
110 Ga0070665_100333720 3300005548 Bacteria 1521
111 Ga0070665_100560550 3300005548 Bacteria 1155
112 Ga0068855_100024556 3300005563 Bacteria 7210
113 Ga0068855_100076070 3300005563 Bacteria 3897
114 Ga0068855_100320456 3300005563 Bacteria 1713
115 Ga0068855_100938921 3300005563 Bacteria 912
116 Ga0070664_100000129 3300005564 Bacteria 50535
117 Ga0068857_100223591 3300005577 Bacteria 1720
118 Ga0068854_100504961 3300005578 Bacteria 1019
119 Ga0068854_100543810 3300005578 Bacteria 984
120 Ga0068856_100245390 3300005614 Bacteria 1806
121 Ga0068856_100478102 3300005614 Bacteria 1267
122 Ga0068852_100134908 3300005616 Bacteria 2278
123 Ga0068859_100000197 3300005617 Bacteria 58973
124 Ga0068859_100009591 3300005617 Bacteria 9775
125 Ga0068859_100322940 3300005617 Bacteria 1638
126 Ga0068859_100772821 3300005617 Bacteria 1049
127 Ga0068864_100264755 3300005618 Bacteria 1600
128 Ga0068866_10004378 3300005718 Bacteria 5797
129 Ga0068866_10013450 3300005718 Bacteria 3591
130 Ga0068861_100016016 3300005719 Bacteria 5294
131 Ga0068861_100249226 3300005719 Bacteria 1515
132 Ga0068861_100391708 3300005719 Bacteria 1230
133 Ga0068863_100000595 3300005841 Bacteria 36684
134 Ga0068858_100019202 3300005842 Bacteria 6393
135 Ga0068858_100022526 3300005842 Bacteria 5878
136 Ga0068858_100182102 3300005842 Bacteria 1984
137 Ga0068858_100536765 3300005842 Bacteria 1132
138 Ga0068858_100785739 3300005842 Bacteria 928
139 Ga0068860_100094710 3300005843 Bacteria 2846
140 Ga0068860_100121243 3300005843 Bacteria 2504
141 Ga0068860_100546511 3300005843 Bacteria 1160
142 Ga0068862_100000297 3300005844 Bacteria 54476
143 Ga0068862_100015289 3300005844 Bacteria 6375
144 Ga0068862_100103977 3300005844 Bacteria 2487
145 Ga0068862_100112147 3300005844 Bacteria 2395
146 Ga0068862_100512076 3300005844 Bacteria 1141
147 Ga0081455_10000125 3300005937 Bacteria 89043
148 Ga0081455_10000239 3300005937 Bacteria 71193
149 Ga0081455_10000954 3300005937 Bacteria 37046
150 Ga0081455_10001233 3300005937 Bacteria 31972
151 Ga0081455_10003571 3300005937 Bacteria 17853
152 Ga0081455_10006788 3300005937 Bacteria 12205
153 Ga0081455_10011764 3300005937 Bacteria 8764
154 Ga0081455_10023426 3300005937 Bacteria 5745
155 Ga0081455_10032780 3300005937 Bacteria 4677
156 Ga0081455_10053078 3300005937 Bacteria 3465
157 Ga0081455_10077662 3300005937 Bacteria 2730
158 Ga0081455_10116409 3300005937 Bacteria 2114
159 Ga0081455_10153168 3300005937 Bacteria 1775
160 Ga0081455_10220360 3300005937 Bacteria 1406
161 Ga0081455_10253026 3300005937 Bacteria 1287
162 Ga0081455_10460196 3300005937 Bacteria 866
163 Ga0081538_10000111 3300005981 Bacteria 81814
164 Ga0081538_10000380 3300005981 Bacteria 50675
165 Ga0081538_10001492 3300005981 Bacteria 24021
166 Ga0081538_10029435 3300005981 Bacteria 3751
167 Ga0081538_10038265 3300005981 Bacteria 3098
168 Ga0081538_10044426 3300005981 Bacteria 2771
169 Ga0081538_10158769 3300005981 Bacteria 1009
170 Ga0081539_10077474 3300005985 Bacteria 1758
171 Ga0081539_10083016 3300005985 Bacteria 1678
172 Ga0070717_10517952 3300006028 Bacteria 1079
173 Ga0075365_10004603 3300006038 Bacteria 7339
174 Ga0075365_10034553 3300006038 Bacteria 3265
175 Ga0075365_10068882 3300006038 Bacteria 2378
176 Ga0075365_10111444 3300006038 Bacteria 1880
177 Ga0075365_10135116 3300006038 Bacteria 1709
178 Ga0075363_100247996 3300006048 Bacteria 1025
179 Ga0075364_10001141 3300006051 Bacteria 14192
180 Ga0075364_10024920 3300006051 Bacteria 3803
181 Ga0075364_10026862 3300006051 Bacteria 3675
182 Ga0075364_10029219 3300006051 Bacteria 3534
183 Ga0075364_10043884 3300006051 Bacteria 2907
184 Ga0075364_10056054 3300006051 Bacteria 2579
185 Ga0075364_10264657 3300006051 Bacteria 1169
186 Ga0075364_10332543 3300006051 Bacteria 1035
187 Ga0075432_10000041 3300006058 Bacteria 24263
188 Ga0075432_10000349 3300006058 Bacteria 13226
189 Ga0075432_10000912 3300006058 Bacteria 9304
190 Ga0075432_10034331 3300006058 Bacteria 1761
191 Ga0075362_10257584 3300006177 Bacteria 859
192 Ga0075367_10004865 3300006178 Bacteria 6615
193 Ga0075367_10025743 3300006178 Bacteria 3330
194 Ga0075367_10395443 3300006178 Bacteria 874
195 Ga0075367_10401956 3300006178 Bacteria 866
196 Ga0075369_10012568 3300006186 Bacteria 3346
197 Ga0075370_10171912 3300006353 Bacteria 1274
198 Ga0075370_10234514 3300006353 Bacteria 1086
199 Ga0068871_100583842 3300006358 Bacteria 1015
200 Ga0068871_100627063 3300006358 Bacteria 980
201 Ga0075428_100000001 3300006844 Bacteria 772630
202 Ga0075428_100001374 3300006844 Bacteria 25865
203 Ga0075428_100002044 3300006844 Bacteria 21763
204 Ga0075428_100003635 3300006844 Bacteria 16907
205 Ga0075428_100005226 3300006844 Bacteria 14434
206 Ga0075428_100007810 3300006844 Bacteria 11858
207 Ga0075428_100011656 3300006844 Bacteria 9783
208 Ga0075428_100282677 3300006844 Bacteria 1785
209 Ga0075428_100584777 3300006844 Bacteria 1193
210 Ga0075428_100617563 3300006844 Bacteria 1157
211 Ga0075428_100652309 3300006844 Bacteria 1122
212 Ga0075430_100000532 3300006846 Bacteria 28687
213 Ga0075430_100001780 3300006846 Bacteria 17607
214 Ga0075430_100003977 3300006846 Bacteria 12464
215 Ga0075430_100028278 3300006846 Bacteria 4763
216 Ga0075430_100059879 3300006846 Bacteria 3200
217 Ga0075430_100128138 3300006846 Bacteria 2116
218 Ga0075430_100162913 3300006846 Bacteria 1856
219 Ga0075430_100199713 3300006846 Bacteria 1661
220 Ga0075431_100000852 3300006847 Bacteria 26748
221 Ga0075431_100002775 3300006847 Bacteria 16962
222 Ga0075431_100010147 3300006847 Bacteria 9468
223 Ga0075431_100047215 3300006847 Bacteria 4439
224 Ga0075431_100116706 3300006847 Bacteria 2755
225 Ga0075431_100147034 3300006847 Bacteria 2428
226 Ga0075431_100161051 3300006847 Bacteria 2307
227 Ga0075431_100252173 3300006847 Bacteria 1793
228 Ga0075431_100297214 3300006847 Bacteria 1632
229 Ga0075431_100374679 3300006847 Bacteria 1428
230 Ga0075433_10000386 3300006852 Bacteria 27949
231 Ga0075433_10055131 3300006852 Bacteria 3469
232 Ga0075433_10065126 3300006852 Bacteria 3196
233 Ga0075434_100000345 3300006871 Bacteria 33484
234 Ga0075434_100000865 3300006871 Bacteria 24184
235 Ga0075429_100000058 3300006880 Bacteria 53378
236 Ga0075429_100000980 3300006880 Bacteria 22677
237 Ga0075429_100003113 3300006880 Bacteria 14093
238 Ga0075429_100003890 3300006880 Bacteria 12752
239 Ga0075429_100019865 3300006880 Bacteria 5825
240 Ga0075429_100389555 3300006880 Bacteria 1220
241 Ga0068865_100037667 3300006881 Bacteria 3267
242 Ga0068865_100044554 3300006881 Bacteria 3037
243 Ga0068865_100131575 3300006881 Bacteria 1875
244 Ga0068865_100430752 3300006881 Bacteria 1086
245 Ga0075436_100001303 3300006914 Bacteria 16951
246 Ga0075436_100047029 3300006914 Bacteria 2976
247 Ga0097620_100000197 3300006931 Bacteria 58973
248 Ga0097620_100009591 3300006931 Bacteria 9775
249 Ga0097620_100322925 3300006931 Bacteria 1638
250 Ga0097620_100772791 3300006931 Bacteria 1049
251 Ga0079104_1025959 3300006946 Bacteria 1521
252 Ga0075435_100003134 3300007076 Bacteria 11172
253 Ga0075435_100003320 3300007076 Bacteria 10915
254 Ga0105251_10007055 3300009011 Bacteria 7006
255 Ga0105251_10201976 3300009011 Bacteria 895
256 Ga0105244_10034555 3300009036 Bacteria 2660
257 Ga0105244_10035296 3300009036 Bacteria 2627
258 Ga0105244_10054617 3300009036 Bacteria 2026
259 Ga0105240_10007278 3300009093 Bacteria 16111
260 Ga0105240_10079965 3300009093 Bacteria 4021
261 Ga0111539_10000866 3300009094 Bacteria 39504
262 Ga0111539_10002620 3300009094 Bacteria 23860
263 Ga0111539_10006065 3300009094 Bacteria 15599
264 Ga0111539_10006583 3300009094 Bacteria 14969
265 Ga0111539_10054167 3300009094 Bacteria 4774
266 Ga0111539_10056352 3300009094 Bacteria 4671
267 Ga0111539_10143499 3300009094 Bacteria 2795
268 Ga0111539_10326003 3300009094 Bacteria 1787
269 Ga0105245_10010908 3300009098 Bacteria 7904
270 Ga0105245_10017708 3300009098 Bacteria 6218
271 Ga0105245_10100896 3300009098 Bacteria 2671
272 Ga0105245_10218682 3300009098 Bacteria 1837
273 Ga0105245_10407508 3300009098 Bacteria 1360
274 Ga0105247_10058854 3300009101 Bacteria 2378
275 Ga0105247_10097741 3300009101 Bacteria 1873
276 Ga0114129_10000045 3300009147 Bacteria 105937
277 Ga0114129_10001738 3300009147 Bacteria 29647
278 Ga0114129_10003450 3300009147 Bacteria 22236
279 Ga0114129_10011334 3300009147 Bacteria 12699
280 Ga0114129_10049777 3300009147 Bacteria 5887
281 Ga0114129_10105827 3300009147 Bacteria 3887
282 Ga0114129_10288951 3300009147 Bacteria 2189
283 Ga0114129_10572814 3300009147 Bacteria 1466
284 Ga0114129_11560164 3300009147 Bacteria 810
285 Ga0105243_10000176 3300009148 Bacteria 73715
286 Ga0105243_10004454 3300009148 Bacteria 11077
287 Ga0105243_10026497 3300009148 Bacteria 4437
288 Ga0105243_10120300 3300009148 Bacteria 2213
289 Ga0105243_10210273 3300009148 Bacteria 1712
290 Ga0105243_10268301 3300009148 Bacteria 1531
291 Ga0105243_10279309 3300009148 Bacteria 1503
292 Ga0105243_10289216 3300009148 Bacteria 1480
293 Ga0105243_10327492 3300009148 Bacteria 1398
294 Ga0105243_10667854 3300009148 Bacteria 1009
295 Ga0105242_10021812 3300009176 Bacteria 5033
296 Ga0105242_10089399 3300009176 Bacteria 2589
297 Ga0105242_10129345 3300009176 Bacteria 2177
298 Ga0105248_10000419 3300009177 Bacteria 48685
299 Ga0105248_10023531 3300009177 Bacteria 6843
300 Ga0105248_10077488 3300009177 Bacteria 3737
301 Ga0105248_10549063 3300009177 Bacteria 1303
302 Ga0105248_11296583 3300009177 Bacteria 824
303 Ga0105237_10023369 3300009545 Bacteria 6335
304 Ga0105237_10199157 3300009545 Bacteria 2002
305 Ga0105237_10480338 3300009545 Bacteria 1249
306 Ga0105238_10316780 3300009551 Bacteria 1545
307 Ga0105238_10378913 3300009551 Bacteria 1406
308 Ga0105238_10599155 3300009551 Bacteria 1110
309 Ga0105238_10606164 3300009551 Bacteria 1103
310 Ga0105249_10043927 3300009553 Bacteria 4064
311 Ga0105249_10182856 3300009553 Bacteria 2041
312 Ga0105249_10347972 3300009553 Bacteria 1501
313 Ga0105249_10350798 3300009553 Bacteria 1495
314 Ga0105249_10637905 3300009553 Bacteria 1122
315 Ga0105239_10012640 3300010375 Bacteria 9394
316 Ga0105239_10042399 3300010375 Bacteria 4987
317 Ga0105239_10858405 3300010375 Bacteria 1041
318 Ga0105246_10002272 3300011119 Bacteria 11598
319 Ga0105246_10014621 3300011119 Bacteria 4940
320 Ga0105246_10028517 3300011119 Bacteria 3668
321 Ga0105246_10254189 3300011119 Bacteria 1396
322 Ga0105246_10268642 3300011119 Bacteria 1362
323 Ga0105246_10275027 3300011119 Bacteria 1348
324 Ga0105246_10376920 3300011119 Bacteria 1171
325 Ga0157342_1011045 3300012507 Bacteria 932
326 Ga0157326_1021392 3300012513 Bacteria 801
327 Ga0157373_10044107 3300013100 Bacteria 3184
328 Ga0157371_10004373 3300013102 Bacteria 12358
329 Ga0157371_10078114 3300013102 Bacteria 2344
330 Ga0157371_10079597 3300013102 Bacteria 2321
331 Ga0157371_10129378 3300013102 Bacteria 1796
332 Ga0157371_10289394 3300013102 Bacteria 1184
333 Ga0157371_10602123 3300013102 Bacteria 817
334 Ga0157370_10001509 3300013104 Bacteria 28736
335 Ga0157370_10022864 3300013104 Bacteria 6216
336 Ga0157370_10030312 3300013104 Bacteria 5301
337 Ga0157370_10598583 3300013104 Bacteria 1009
338 Ga0157369_10002974 3300013105 Bacteria 20281
339 Ga0157369_10087565 3300013105 Bacteria 3325
340 Ga0157369_10173929 3300013105 Bacteria 2268
341 Ga0157369_10187784 3300013105 Bacteria 2173
342 Ga0157369_10225691 3300013105 Bacteria 1959
343 Ga0157369_10400045 3300013105 Bacteria 1425
344 Ga0157369_10510394 3300013105 Bacteria 1244
345 Ga0157369_10739971 3300013105 Bacteria 1012
346 Ga0157374_10429399 3300013296 Bacteria 1321
347 Ga0157374_10454122 3300013296 Bacteria 1283
348 Ga0157374_10931582 3300013296 Bacteria 887
349 Ga0157378_10003477 3300013297 Bacteria 13982
350 Ga0157378_10071359 3300013297 Bacteria 3119
351 Ga0157378_10651829 3300013297 Bacteria 1069
352 Ga0163162_10053293 3300013306 Bacteria 4065
353 Ga0163162_10071500 3300013306 Bacteria 3522
354 Ga0163162_10076741 3300013306 Bacteria 3404
355 Ga0163162_10191229 3300013306 Bacteria 2174
356 Ga0163162_10546167 3300013306 Bacteria 1287
357 Ga0163162_10576101 3300013306 Bacteria 1253
358 Ga0157372_10017632 3300013307 Bacteria 7663
359 Ga0157372_10122895 3300013307 Bacteria 2983
360 Ga0157372_10403565 3300013307 Bacteria 1593
361 Ga0157372_10931587 3300013307 Bacteria 1007
362 Ga0157375_10031470 3300013308 Bacteria 5016
363 Ga0157375_10414164 3300013308 Bacteria 1514
364 Ga0157375_10610661 3300013308 Bacteria 1249
365 Ga0157375_10642977 3300013308 Bacteria 1217
366 Ga0163163_10002450 3300014325 Bacteria 15686
367 Ga0163163_10060845 3300014325 Bacteria 3740
368 Ga0163163_10411460 3300014325 Bacteria 1411
369 Ga0157380_10229117 3300014326 Bacteria 1667
370 Ga0157380_11146492 3300014326 Bacteria 819
371 Ga0157376_10221593 3300014969 Bacteria 1752
372 Ga0163161_10030613 3300017792 Bacteria 3832
373 Ga0163161_10035889 3300017792 Bacteria 3549
374 Ga0163161_10218275 3300017792 Bacteria 1476
375 Ga0206354_10613629 3300020081 Bacteria 2294
376 Ga0206353_10243206 3300020082 Bacteria 1584
377 Ga0206353_10495411 3300020082 Bacteria 810
378 Ga0206353_11859265 3300020082 Bacteria 2253
379 Ga0213876_10001702 3300021384 Bacteria 13378
380 Ga0213876_10001722 3300021384 Bacteria 13287
381 Ga0213876_10050576 3300021384 Bacteria 2196
382 Ga0209646_1000013 3300025246 Bacteria 565830
383 Ga0209129_1000112 3300025258 Bacteria 148742
384 Ga0209025_1000250 3300025294 Bacteria 126596
385 Ga0209051_1002132 3300025303 Bacteria 14737
386 Ga0209051_1079971 3300025303 Bacteria 947
387 Ga0207697_10006159 3300025315 Bacteria 5473
388 Ga0207655_1008116 3300025728 Bacteria 6716
389 Ga0207655_1008601 3300025728 Bacteria 6455
390 Ga0207655_1029481 3300025728 Bacteria 2568
391 Ga0207655_1038532 3300025728 Bacteria 2088
392 Ga0207713_1009922 3300025735 Bacteria 5323
393 Ga0207682_10003013 3300025893 Bacteria 7387
394 Ga0207642_10002427 3300025899 Bacteria 5806
395 Ga0207710_10199200 3300025900 Bacteria 988
396 Ga0207688_10013737 3300025901 Bacteria 4402
397 Ga0207688_10140320 3300025901 Bacteria 1422
398 Ga0207647_10005141 3300025904 Bacteria 9630
399 Ga0207647_10038645 3300025904 Bacteria 3016
400 Ga0207647_10050600 3300025904 Bacteria 2571
401 Ga0207647_10159036 3300025904 Bacteria 1318
402 Ga0207645_10001283 3300025907 Bacteria 20650
403 Ga0207645_10248874 3300025907 Bacteria 1175
404 Ga0207645_10437888 3300025907 Bacteria 882
405 Ga0207705_10139920 3300025909 Bacteria 1807
406 Ga0207705_10214838 3300025909 Bacteria 1459
407 Ga0207684_10251032 3300025910 Bacteria 1526
408 Ga0207654_10298106 3300025911 Bacteria 1095
409 Ga0207707_10000066 3300025912 Bacteria 106182
410 Ga0207671_10023680 3300025914 Bacteria 4627
411 Ga0207671_10499369 3300025914 Bacteria 970
412 Ga0207663_10644534 3300025916 Bacteria 836
413 Ga0207660_10000148 3300025917 Bacteria 42843
414 Ga0207660_10046017 3300025917 Bacteria 3077
415 Ga0207662_10002627 3300025918 Bacteria 9061
416 Ga0207662_10388223 3300025918 Bacteria 944
417 Ga0207657_10005554 3300025919 Bacteria 13161
418 Ga0207657_10076149 3300025919 Bacteria 2831
419 Ga0207657_10118937 3300025919 Bacteria 2175
420 Ga0207657_10134663 3300025919 Bacteria 2023
421 Ga0207657_10168401 3300025919 Bacteria 1776
422 Ga0207657_10302934 3300025919 Bacteria 1266
423 Ga0207657_10323260 3300025919 Bacteria 1219
424 Ga0207649_10236817 3300025920 Bacteria 1308
425 Ga0207652_10000287 3300025921 Bacteria 52686
426 Ga0207652_10025784 3300025921 Bacteria 4892
427 Ga0207652_10027986 3300025921 Bacteria 4701
428 Ga0207652_10186211 3300025921 Bacteria 1867
429 Ga0207652_10197309 3300025921 Bacteria 1811
430 Ga0207681_10039309 3300025923 Bacteria 3140
431 Ga0207681_10277216 3300025923 Bacteria 1319
432 Ga0207681_10366566 3300025923 Bacteria 1157
433 Ga0207650_10008172 3300025925 Bacteria 7135
434 Ga0207650_10108716 3300025925 Bacteria 2144
435 Ga0207659_10001580 3300025926 Bacteria 13505
436 Ga0207659_10031388 3300025926 Bacteria 3636
437 Ga0207687_10009453 3300025927 Bacteria 6377
438 Ga0207687_10139392 3300025927 Bacteria 1838
439 Ga0207687_10478525 3300025927 Bacteria 1037
440 Ga0207700_10091105 3300025928 Bacteria 2408
441 Ga0207700_10481039 3300025928 Bacteria 1097
442 Ga0207664_10047270 3300025929 Bacteria 3380
443 Ga0207664_10114977 3300025929 Bacteria 2243
444 Ga0207664_10131491 3300025929 Bacteria 2107
445 Ga0207664_10682215 3300025929 Bacteria 924
446 Ga0207644_10128035 3300025931 Bacteria 1940
447 Ga0207644_10162806 3300025931 Bacteria 1735
448 Ga0207690_10073573 3300025932 Bacteria 2364
449 Ga0207690_10121379 3300025932 Bacteria 1899
450 Ga0207690_10225888 3300025932 Bacteria 1435
451 Ga0207706_10043694 3300025933 Bacteria 3971
452 Ga0207706_10106560 3300025933 Bacteria 2466
453 Ga0207706_10374579 3300025933 Bacteria 1236
454 Ga0207686_10114522 3300025934 Bacteria 1825
455 Ga0207709_10007669 3300025935 Bacteria 5987
456 Ga0207709_10014309 3300025935 Bacteria 4379
457 Ga0207709_10017672 3300025935 Bacteria 3983
458 Ga0207709_10035285 3300025935 Bacteria 2956
459 Ga0207709_10070929 3300025935 Bacteria 2211
460 Ga0207709_10146627 3300025935 Bacteria 1629
461 Ga0207709_10178766 3300025935 Bacteria 1496
462 Ga0207709_10237105 3300025935 Bacteria 1325
463 Ga0207709_10423157 3300025935 Bacteria 1023
464 Ga0207709_10448767 3300025935 Bacteria 996
465 Ga0207669_10079969 3300025937 Bacteria 2089
466 Ga0207669_10251376 3300025937 Bacteria 1316
467 Ga0207669_10530088 3300025937 Bacteria 947
468 Ga0207704_10030615 3300025938 Bacteria 3019
469 Ga0207704_10429983 3300025938 Bacteria 1049
470 Ga0207691_10005671 3300025940 Bacteria 12067
471 Ga0207691_10262581 3300025940 Bacteria 1488
472 Ga0207711_10000357 3300025941 Bacteria 48637
473 Ga0207711_10056370 3300025941 Bacteria 3377
474 Ga0207689_10013205 3300025942 Bacteria 7050
475 Ga0207661_10009949 3300025944 Bacteria 6831
476 Ga0207661_10042144 3300025944 Bacteria 3598
477 Ga0207661_10074417 3300025944 Bacteria 2784
478 Ga0207679_10005935 3300025945 Bacteria 7680
479 Ga0207667_10012942 3300025949 Bacteria 9579
480 Ga0207667_10154941 3300025949 Bacteria 2358
481 Ga0207651_10010662 3300025960 Bacteria 5105
482 Ga0207712_10011271 3300025961 Bacteria 5690
483 Ga0207712_10047322 3300025961 Bacteria 2986
484 Ga0207712_10367077 3300025961 Bacteria 1201
485 Ga0207668_10011633 3300025972 Bacteria 5354
486 Ga0207668_10072044 3300025972 Bacteria 2471
487 Ga0207668_10084045 3300025972 Bacteria 2318
488 Ga0207668_10099356 3300025972 Bacteria 2159
489 Ga0207668_10257001 3300025972 Bacteria 1422
490 Ga0207668_10303567 3300025972 Bacteria 1318
491 Ga0207668_10327880 3300025972 Bacteria 1273
492 Ga0207658_10043456 3300025986 Bacteria 3266
493 Ga0207658_10058273 3300025986 Bacteria 2873
494 Ga0207658_10077238 3300025986 Bacteria 2540
495 Ga0207677_10009515 3300026023 Bacteria 5471
496 Ga0207703_10009560 3300026035 Bacteria 7613
497 Ga0207703_10017348 3300026035 Bacteria 5619
498 Ga0207703_10147644 3300026035 Bacteria 2047
499 Ga0207639_10097470 3300026041 Bacteria 2368
500 Ga0207639_10404075 3300026041 Bacteria 1231
501 Ga0207639_10924477 3300026041 Bacteria 816
502 Ga0207678_10004858 3300026067 Bacteria 12071
503 Ga0207678_10602004 3300026067 Bacteria 964
504 Ga0207708_10021961 3300026075 Bacteria 4817
505 Ga0207708_10619886 3300026075 Bacteria 918
506 Ga0207702_10127692 3300026078 Bacteria 2285
507 Ga0207702_10342596 3300026078 Bacteria 1428
508 Ga0207702_10350848 3300026078 Bacteria 1412
509 Ga0207702_10473485 3300026078 Bacteria 1218
510 Ga0207702_11036978 3300026078 Bacteria 814
511 Ga0207641_10014037 3300026088 Bacteria 6567
512 Ga0207648_10071725 3300026089 Bacteria 3019
513 Ga0207648_10172188 3300026089 Bacteria 1914
514 Ga0207674_10134607 3300026116 Bacteria 2434
515 Ga0207675_100017497 3300026118 Bacteria 6690
516 Ga0207675_100034422 3300026118 Bacteria 4723
517 Ga0207675_100068281 3300026118 Bacteria 3323
518 Ga0207675_100460982 3300026118 Bacteria 1261
519 Ga0207675_100631516 3300026118 Bacteria 1076
520 Ga0207675_100705376 3300026118 Bacteria 1018
521 Ga0207683_10007071 3300026121 Bacteria 9626
522 Ga0207683_10028508 3300026121 Bacteria 4828
523 Ga0207683_10080070 3300026121 Bacteria 2897
524 Ga0207683_10418343 3300026121 Bacteria 1234
525 Ga0207698_10391439 3300026142 Bacteria 1325
526 Ga0209813_10039637 3300027866 Bacteria 1428
527 Ga0207428_10000346 3300027907 Bacteria 60257
528 Ga0207428_10001766 3300027907 Bacteria 22169
529 Ga0207428_10004452 3300027907 Bacteria 13308
530 Ga0207428_10004666 3300027907 Bacteria 12982
531 Ga0207428_10012747 3300027907 Bacteria 7371
532 Ga0207428_10014933 3300027907 Bacteria 6728
533 Ga0268266_10558977 3300028379 Bacteria 1097
534 Ga0268266_10608333 3300028379 Bacteria 1050
535 Ga0268265_10000301 3300028380 Bacteria 55125
536 Ga0268265_10083029 3300028380 Bacteria 2535
537 Ga0268265_10285507 3300028380 Bacteria 1479
538 Ga0268264_10010062 3300028381 Bacteria 7828
539 Ga0268264_10122036 3300028381 Bacteria 2298
540 Ga0268264_10401871 3300028381 Bacteria 1317
541 Ga0268264_10449199 3300028381 Bacteria 1248
542 Ga0265336_10017438 3300028666 Bacteria 2339
543 Ga0307517_10048046 3300028786 Bacteria 4404
544 Ga0307515_10068935 3300028794 Bacteria 4847
545 Ga0307515_10081632 3300028794 Bacteria 4196
546 Ga0265338_10016035 3300028800 Bacteria 8184
547 Ga0265338_10303744 3300028800 Bacteria 1159
548 Ga0307512_10125499 3300030522 Bacteria 1631
549 Ga0316183_1015614 3300030742 Bacteria 996
550 Ga0316181_1253205 3300030744 Bacteria 1751
551 Ga0316182_1190892 3300030745 Bacteria 5151
552 Ga0316182_1205415 3300030745 Bacteria 1233
553 Ga0265320_10011336 3300031240 Bacteria 5250
554 Ga0265325_10001754 3300031241 Bacteria 15021
555 Ga0265340_10001024 3300031247 Bacteria 15948
556 Ga0265340_10059850 3300031247 Bacteria 1826
557 Ga0265340_10210202 3300031247 Bacteria 874
558 Ga0265339_10006471 3300031249 Bacteria 7681
559 Ga0265316_10067843 3300031344 Bacteria 2757
560 Ga0307513_10000001 3300031456 Bacteria 1660464
561 Ga0307509_10342842 3300031507 Bacteria 1221
562 Ga0307408_100005164 3300031548 Bacteria 8756
563 Ga0307408_100005986 3300031548 Bacteria 8096
564 Ga0307408_100016000 3300031548 Bacteria 5001
565 Ga0307408_100027662 3300031548 Bacteria 3910
566 Ga0307408_100032792 3300031548 Bacteria 3623
567 Ga0307408_100037452 3300031548 Bacteria 3416
568 Ga0307408_100048680 3300031548 Bacteria 3041
569 Ga0307408_100055182 3300031548 Bacteria 2875
570 Ga0307408_100061286 3300031548 Bacteria 2746
571 Ga0307408_100073303 3300031548 Bacteria 2537
572 Ga0307408_100075640 3300031548 Bacteria 2502
573 Ga0307408_100082793 3300031548 Bacteria 2402
574 Ga0307408_100147900 3300031548 Bacteria 1851
575 Ga0307408_100173071 3300031548 Bacteria 1725
576 Ga0307408_100284375 3300031548 Bacteria 1379
577 Ga0307408_100286218 3300031548 Bacteria 1374
578 Ga0307408_100492540 3300031548 Bacteria 1071
579 Ga0307408_100573670 3300031548 Bacteria 999
580 Ga0307408_100752048 3300031548 Bacteria 880
581 Ga0307408_100904279 3300031548 Bacteria 808
582 Ga0265313_10021221 3300031595 Bacteria 3557
583 Ga0265313_10034121 3300031595 Bacteria 2577
584 Ga0307508_10074392 3300031616 Bacteria 2973
585 Ga0307508_10254741 3300031616 Bacteria 1351
586 Ga0316575_10081277 3300031665 Bacteria 1307
587 Ga0316575_10135447 3300031665 Bacteria 1012
588 Ga0316579_10229664 3300031691 Bacteria 897
589 Ga0265314_10015557 3300031711 Bacteria 6035
590 Ga0265342_10271656 3300031712 Bacteria 899
591 Ga0316576_10018067 3300031727 Bacteria 4806
592 Ga0316576_10039175 3300031727 Bacteria 3401
593 Ga0316576_10042580 3300031727 Bacteria 3273
594 Ga0316576_10068389 3300031727 Bacteria 2616
595 Ga0316576_10658407 3300031727 Bacteria 761
596 Ga0316578_10001817 3300031728 Bacteria 8974
597 Ga0316578_10017371 3300031728 Bacteria 3913
598 Ga0316578_10027267 3300031728 Bacteria 3227
599 Ga0307405_10000281 3300031731 Bacteria 18836
600 Ga0307405_10007053 3300031731 Bacteria 5587
601 Ga0307405_10015310 3300031731 Bacteria 4151
602 Ga0307405_10016394 3300031731 Bacteria 4040
603 Ga0307405_10072931 3300031731 Bacteria 2215
604 Ga0307405_10073209 3300031731 Bacteria 2211
605 Ga0307405_10079051 3300031731 Bacteria 2142
606 Ga0307405_10083863 3300031731 Bacteria 2090
607 Ga0307405_10084481 3300031731 Bacteria 2084
608 Ga0307405_10090262 3300031731 Bacteria 2026
609 Ga0307405_10123870 3300031731 Bacteria 1774
610 Ga0307405_10339060 3300031731 Bacteria 1155
611 Ga0307405_10530132 3300031731 Bacteria 949
612 Ga0307405_10573289 3300031731 Bacteria 917
613 Ga0307405_10607003 3300031731 Bacteria 894
614 Ga0316577_10001193 3300031733 Bacteria 12006
615 Ga0316577_10089786 3300031733 Bacteria 1720
616 Ga0307413_10012935 3300031824 Bacteria 4174
617 Ga0307413_10018336 3300031824 Bacteria 3669
618 Ga0307413_10078543 3300031824 Bacteria 2106
619 Ga0307413_10125716 3300031824 Bacteria 1746
620 Ga0307413_10137909 3300031824 Bacteria 1681
621 Ga0307413_10222586 3300031824 Bacteria 1379
622 Ga0307413_10317006 3300031824 Bacteria 1189
623 Ga0307413_10349432 3300031824 Bacteria 1140
624 Ga0307413_10397782 3300031824 Bacteria 1078
625 Ga0307410_10002324 3300031852 Bacteria 9141
626 Ga0307410_10003125 3300031852 Bacteria 8222
627 Ga0307410_10004438 3300031852 Bacteria 7253
628 Ga0307410_10005859 3300031852 Bacteria 6560
629 Ga0307410_10011957 3300031852 Bacteria 4991
630 Ga0307410_10027074 3300031852 Bacteria 3619
631 Ga0307410_10027721 3300031852 Bacteria 3582
632 Ga0307410_10036116 3300031852 Bacteria 3214
633 Ga0307410_10080447 3300031852 Bacteria 2286
634 Ga0307410_10105887 3300031852 Bacteria 2025
635 Ga0307410_10111066 3300031852 Bacteria 1984
636 Ga0307410_10208422 3300031852 Bacteria 1496
637 Ga0307410_10214353 3300031852 Bacteria 1477
638 Ga0307410_10290141 3300031852 Bacteria 1287
639 Ga0307410_10472549 3300031852 Bacteria 1027
640 Ga0307410_10566355 3300031852 Bacteria 943
641 Ga0307410_10667372 3300031852 Bacteria 873
642 Ga0307410_10770515 3300031852 Bacteria 816
643 Ga0307406_10000008 3300031901 Bacteria 120233
644 Ga0307406_10000031 3300031901 Bacteria 87391
645 Ga0307406_10008604 3300031901 Bacteria 5698
646 Ga0307406_10017530 3300031901 Bacteria 4171
647 Ga0307406_10021072 3300031901 Bacteria 3850
648 Ga0307406_10024253 3300031901 Bacteria 3621
649 Ga0307406_10031116 3300031901 Bacteria 3247
650 Ga0307406_10061735 3300031901 Bacteria 2422
651 Ga0307406_10064492 3300031901 Bacteria 2378
652 Ga0307406_10067807 3300031901 Bacteria 2327
653 Ga0307406_10087869 3300031901 Bacteria 2084
654 Ga0307406_10101009 3300031901 Bacteria 1965
655 Ga0307406_10186338 3300031901 Bacteria 1515
656 Ga0307406_10188105 3300031901 Bacteria 1509
657 Ga0307406_10199598 3300031901 Bacteria 1471
658 Ga0307406_10266599 3300031901 Bacteria 1299
659 Ga0307406_10422860 3300031901 Bacteria 1062
660 Ga0307406_10431119 3300031901 Bacteria 1053
661 Ga0307406_10534268 3300031901 Bacteria 956
662 Ga0307406_10634808 3300031901 Bacteria 885
663 Ga0307406_10700924 3300031901 Bacteria 845
664 Ga0307407_10000362 3300031903 Bacteria 13722
665 Ga0307407_10005454 3300031903 Bacteria 5521
666 Ga0307407_10005760 3300031903 Bacteria 5418
667 Ga0307407_10012988 3300031903 Bacteria 4026
668 Ga0307407_10014241 3300031903 Bacteria 3888
669 Ga0307407_10031516 3300031903 Bacteria 2872
670 Ga0307407_10031637 3300031903 Bacteria 2868
671 Ga0307407_10067880 3300031903 Bacteria 2109
672 Ga0307407_10087264 3300031903 Bacteria 1903
673 Ga0307407_10097549 3300031903 Bacteria 1817
674 Ga0307407_10115045 3300031903 Bacteria 1695
675 Ga0307412_10005839 3300031911 Bacteria 6926
676 Ga0307412_10008626 3300031911 Bacteria 5828
677 Ga0307412_10021599 3300031911 Bacteria 3935
678 Ga0307412_10028258 3300031911 Bacteria 3507
679 Ga0307412_10032257 3300031911 Bacteria 3317
680 Ga0307412_10035361 3300031911 Bacteria 3191
681 Ga0307412_10077265 3300031911 Bacteria 2289
682 Ga0307412_10079484 3300031911 Bacteria 2262
683 Ga0307412_10086977 3300031911 Bacteria 2176
684 Ga0307412_10088391 3300031911 Bacteria 2161
685 Ga0307412_10094891 3300031911 Bacteria 2096
686 Ga0307412_10105408 3300031911 Bacteria 2002
687 Ga0307412_10157056 3300031911 Bacteria 1685
688 Ga0307412_10187445 3300031911 Bacteria 1561
689 Ga0307412_10202375 3300031911 Bacteria 1509
690 Ga0307412_10387556 3300031911 Bacteria 1133
691 Ga0307412_10422219 3300031911 Bacteria 1091
692 Ga0307412_11068588 3300031911 Bacteria 717
693 Ga0307409_100000014 3300031995 Bacteria 62867
694 Ga0307409_100003794 3300031995 Bacteria 8321
695 Ga0307409_100015008 3300031995 Bacteria 5065
696 Ga0307409_100017156 3300031995 Bacteria 4816
697 Ga0307409_100056099 3300031995 Bacteria 3045
698 Ga0307409_100056910 3300031995 Bacteria 3026
699 Ga0307409_100068474 3300031995 Bacteria 2807
700 Ga0307409_100084499 3300031995 Bacteria 2577
701 Ga0307409_100103244 3300031995 Bacteria 2370
702 Ga0307409_100130496 3300031995 Bacteria 2146
703 Ga0307409_100142442 3300031995 Bacteria 2068
704 Ga0307409_100228769 3300031995 Bacteria 1684
705 Ga0307409_100375202 3300031995 Bacteria 1350
706 Ga0307409_100404819 3300031995 Bacteria 1304
707 Ga0307409_100492363 3300031995 Bacteria 1192
708 Ga0307409_100620273 3300031995 Bacteria 1071
709 Ga0307409_100720737 3300031995 Bacteria 999
710 Ga0307409_100832275 3300031995 Bacteria 933
711 Ga0307409_101240451 3300031995 Bacteria 770
712 Ga0307416_100000823 3300032002 Bacteria 16270
713 Ga0307416_100000902 3300032002 Bacteria 15696
714 Ga0307416_100004483 3300032002 Bacteria 8421
715 Ga0307416_100005303 3300032002 Bacteria 7902
716 Ga0307416_100044194 3300032002 Bacteria 3495
717 Ga0307416_100045316 3300032002 Bacteria 3462
718 Ga0307416_100065823 3300032002 Bacteria 2980
719 Ga0307416_100071504 3300032002 Bacteria 2882
720 Ga0307416_100083951 3300032002 Bacteria 2704
721 Ga0307416_100105793 3300032002 Bacteria 2464
722 Ga0307416_100118332 3300032002 Bacteria 2354
723 Ga0307416_100133618 3300032002 Bacteria 2239
724 Ga0307416_100156552 3300032002 Bacteria 2098
725 Ga0307416_100222932 3300032002 Bacteria 1810
726 Ga0307416_100233912 3300032002 Bacteria 1774
727 Ga0307416_100245822 3300032002 Bacteria 1737
728 Ga0307416_100321560 3300032002 Bacteria 1549
729 Ga0307416_100368499 3300032002 Bacteria 1461
730 Ga0307416_100399930 3300032002 Bacteria 1411
731 Ga0307416_100448907 3300032002 Bacteria 1341
732 Ga0307416_100703253 3300032002 Bacteria 1100
733 Ga0307414_10001630 3300032004 Bacteria 11687
734 Ga0307414_10055699 3300032004 Bacteria 2770
735 Ga0307414_10064707 3300032004 Bacteria 2605
736 Ga0307414_10122504 3300032004 Bacteria 2002
737 Ga0307414_10148821 3300032004 Bacteria 1844
738 Ga0307414_10244826 3300032004 Bacteria 1487
739 Ga0307414_10365907 3300032004 Bacteria 1242
740 Ga0307414_10405518 3300032004 Bacteria 1185
741 Ga0307414_10621317 3300032004 Bacteria 971
742 Ga0307414_10793654 3300032004 Bacteria 863
743 Ga0307411_10006668 3300032005 Bacteria 5799
744 Ga0307411_10050788 3300032005 Bacteria 2702
745 Ga0307411_10096043 3300032005 Bacteria 2082
746 Ga0307411_10124243 3300032005 Bacteria 1873
747 Ga0307411_10227633 3300032005 Bacteria 1451
748 Ga0307411_10234357 3300032005 Bacteria 1433
749 Ga0307411_10561784 3300032005 Bacteria 975
750 Ga0307415_100001061 3300032126 Bacteria 12785
751 Ga0307415_100048630 3300032126 Bacteria 2863
752 Ga0307415_100075741 3300032126 Bacteria 2382
753 Ga0307415_100085017 3300032126 Bacteria 2272
754 Ga0307415_100163003 3300032126 Bacteria 1730
755 Ga0307415_100174882 3300032126 Bacteria 1678
756 Ga0307415_100178041 3300032126 Bacteria 1665
757 Ga0307415_100187371 3300032126 Bacteria 1629
758 Ga0307415_100191026 3300032126 Bacteria 1616
759 Ga0307415_100194874 3300032126 Bacteria 1602
760 Ga0307415_100201065 3300032126 Bacteria 1581
761 Ga0307415_100218169 3300032126 Bacteria 1527
762 Ga0307415_100241802 3300032126 Bacteria 1460
763 Ga0307415_100262244 3300032126 Bacteria 1411
764 Ga0307415_100350021 3300032126 Bacteria 1243
765 Ga0307415_100351311 3300032126 Bacteria 1241
766 Ga0307415_100648544 3300032126 Bacteria 946
767 Ga0307415_100837657 3300032126 Bacteria 843
768 Ga0316583_10010523 3300032133 Bacteria 3337
769 Ga0316585_10002798 3300032137 Bacteria 4741
770 Ga0316580_10002931 3300032139 Bacteria 4783
771 Ga0316580_10038595 3300032139 Bacteria 1476
772 Ga0307510_10103679 3300033180 Bacteria 2621
773 Ga0373948_0000792 3300034817 Bacteria 4151
774 Ga0373928_0014153 3300035084 Bacteria 1609
775 Ga0373929_0000920 3300035085 Bacteria 5727
776 Ga0373932_0002142 3300035112 Bacteria 5127
777 Ga0373932_0010215 3300035112 Bacteria 2269
778 Ga0373953_0120468 3300035117 Bacteria 1114
779 Ga0373954_0015029 3300035118 Bacteria 3458
780 Ga0316574_0066433 3300035398 Bacteria 2273
781 Ga0316574_0068274 3300035398 Bacteria 2242
782 Ga0316574_0071537 3300035398 Bacteria 2191
783 Ga0316574_0185521 3300035398 Bacteria 1338
784 Ga0316574_0213299 3300035398 Bacteria 1238
785 Ga0316574_0228368 3300035398 Bacteria 1191
786 Ga0373931_0000003 3300035691 Bacteria 560286
787 Ga0373931_0000023 3300035691 Bacteria 130307
788 Ga0373937_0009492 3300036401 Bacteria 8458
789 Ga0316582_0008698 3300036647 Bacteria 5464
790 Ga0316584_0000847 3300036712 Bacteria 17312
791 Ga0316584_0022023 3300036712 Bacteria 4642
792 Ga0316584_0033361 3300036712 Bacteria 3813
793 Ga0395899_0034316 3300037312 Bacteria 3809
794 Ga0395899_0064125 3300037312 Bacteria 2702
795 Ga0395899_0077630 3300037312 Bacteria 2422
796 Ga0395899_0088309 3300037312 Bacteria 2249
797 Ga0395899_0097548 3300037312 Bacteria 2124
798 Ga0395900_0084120 3300037418 Bacteria 3269
799 Ga0395900_0086719 3300037418 Bacteria 3217
800 Ga0395900_0102477 3300037418 Bacteria 2940
801 Ga0395900_0171516 3300037418 Bacteria 2208
802 Ga0395898_0049824 3300037466 Bacteria 4102
803 Ga0395898_0060318 3300037466 Bacteria 3687
804 Ga0395898_0067095 3300037466 Bacteria 3474
805 Ga0395898_0098159 3300037466 Bacteria 2812
806 Ga0395898_0100013 3300037466 Bacteria 2785
807 Ga0395898_0116589 3300037466 Bacteria 2559
808 Ga0395898_0124865 3300037466 Bacteria 2465
809 Ga0395898_0205907 3300037466 Bacteria 1877
810 Ga0395905_0015221 3300037471 Bacteria 7315
811 Ga0395905_0374719 3300037471 Bacteria 1317
812 Ga0395905_0512248 3300037471 Bacteria 1100
813 Ga0436364_0904584 3300037853 Bacteria 4177
814 Ga0395901_0001750 3300038443 Bacteria 22414
815 Ga0395901_0022967 3300038443 Bacteria 6394
816 Ga0395901_0088274 3300038443 Bacteria 3243
817 Ga0395901_0215506 3300038443 Bacteria 2008
818 Ga0395901_0217933 3300038443 Bacteria 1995
819 Ga0395901_0410108 3300038443 Bacteria 1391
820 Ga0395901_0418140 3300038443 Bacteria 1375
821 Ga0395901_0527063 3300038443 Bacteria 1199
822 Ga0400485_05539 3300038735 Bacteria 8336
823 Ga0400486_22540 3300038742 Bacteria 84879
824 Ga0400483_016771 3300039062 Bacteria 12610
825 Ga0400483_128455 3300039062 Bacteria 1710
826 Ga0400483_273888 3300039062 Bacteria 5268
827 Ga0436365_0205421 3300039437 Bacteria 31451
828 Ga0436365_0300504 3300039437 Bacteria 16684
829 Ga0436365_0308134 3300039437 Bacteria 27467
830 Ga0436365_0954458 3300039437 Bacteria 3193
831 Ga0436365_1495022 3300039437 Bacteria 1433
832 Ga0436360_0616885 3300039438 Bacteria 1755
833 Ga0436360_0890333 3300039438 Bacteria 819
834 Ga0436363_0772320 3300039450 Bacteria 1296
835 Ga0436363_0955217 3300039450 Bacteria 1873
836 Ga0436362_0652720 3300039453 Bacteria 1134
837 Ga0439436_0006833 3300041404 Bacteria 3505
838 Ga0439436_0008699 3300041404 Bacteria 3121
839 Ga0439436_0009152 3300041404 Bacteria 3038
840 Ga0439436_0023303 3300041404 Bacteria 1831
841 Ga0439436_0032794 3300041404 Bacteria 1505
842 Ga0439436_0040913 3300041404 Bacteria 1327
843 Ga0439438_014731 3300041405 Bacteria 2320
844 Ga0439439_0003256 3300041406 Bacteria 3568
845 Ga0439439_0007161 3300041406 Bacteria 2601
846 Ga0439439_0008921 3300041406 Bacteria 2374
847 Ga0439447_018092 3300041407 Bacteria 1907
848 Ga0439461_0005337 3300041410 Bacteria 2185
849 Ga0439466_0001051 3300041411 Bacteria 10668
850 Ga0439466_0042351 3300041411 Bacteria 1516
851 Ga0439466_0049119 3300041411 Bacteria 1386
852 Ga0439465_0015070 3300041413 Bacteria 2413
853 Ga0439465_0028450 3300041413 Bacteria 1772
854 Ga0451793_0488353 3300041452 Bacteria 4997
855 Ga0451793_0562410 3300041452 Bacteria 2180
856 Ga0451797_0694708 3300041453 Bacteria 4444
857 Ga0451795_1381046 3300041456 Bacteria 2563
858 Ga0451807_0477298 3300041486 Bacteria 1794
859 Ga0451833_0343967 3300041491 Bacteria 15518
860 Ga0451837_0506656 3300041494 Bacteria 8799
861 Ga0451837_1462739 3300041494 Bacteria 892
862 Ga0451849_0051958 3300041505 Bacteria 1092
863 Ga0451849_0630459 3300041505 Bacteria 820
864 Ga0451843_0362347 3300041509 Bacteria 1000
865 Ga0451843_0666080 3300041509 Bacteria 956
866 Ga0451853_1498319 3300041512 Bacteria 1644
867 Ga0439433_0000260 3300041999 Bacteria 8933
868 Ga0439433_0002202 3300041999 Bacteria 4111
869 Ga0439433_0006192 3300041999 Bacteria 2574
870 Ga0439433_0019342 3300041999 Bacteria 1517
871 Ga0439442_000041 3300042002 Bacteria 29264
872 Ga0439442_000092 3300042002 Bacteria 21656
873 Ga0439442_000269 3300042002 Bacteria 12687
874 Ga0439442_006136 3300042002 Bacteria 2410
875 Ga0439442_011812 3300042002 Bacteria 1782
876 Ga0439442_020281 3300042002 Bacteria 1377
877 Ga0439443_021632 3300042003 Bacteria 1017
878 Ga0439448_0002025 3300042005 Bacteria 5419
879 Ga0439432_010720 3300042006 Bacteria 3169
880 Ga0439432_043949 3300042006 Bacteria 1408
881 Ga0439432_073650 3300042006 Bacteria 1039
882 Ga0439432_148512 3300042006 Bacteria 688
883 Ga0439449_0003153 3300042007 Bacteria 6415
884 Ga0439449_0003322 3300042007 Bacteria 6275
885 Ga0439449_0004923 3300042007 Bacteria 5142
886 Ga0439449_0028885 3300042007 Bacteria 2066
887 Ga0439449_0054707 3300042007 Bacteria 1474
888 Ga0439449_0057454 3300042007 Bacteria 1436
889 Ga0439450_010671 3300042008 Bacteria 1778
890 Ga0439452_004513 3300042010 Bacteria 4656
891 Ga0439452_060932 3300042010 Bacteria 845
892 Ga0439455_0023611 3300042012 Bacteria 1481
893 Ga0439455_0082070 3300042012 Bacteria 877
894 Ga0439457_002935 3300042014 Bacteria 4741
895 Ga0439457_003741 3300042014 Bacteria 4089
896 Ga0439457_038990 3300042014 Bacteria 1057
897 Ga0439462_0011701 3300042015 Bacteria 2237
898 Ga0439463_000856 3300042016 Bacteria 8354
899 Ga0439463_012020 3300042016 Bacteria 2126
900 Ga0439463_042736 3300042016 Bacteria 1153
901 Ga0450911_013148 3300042115 Bacteria 1110
902 Ga0450919_000753 3300042121 Bacteria 4120
903 Ga0450920_001402 3300042122 Bacteria 3979
904 Ga0450920_002860 3300042122 Bacteria 2968
905 Ga0450920_006830 3300042122 Bacteria 2057
906 Ga0450920_035051 3300042122 Bacteria 993
907 Ga0450907_002147 3300042146 Bacteria 3878
908 Ga0450907_005635 3300042146 Bacteria 2109
909 Ga0450907_008522 3300042146 Bacteria 1701
910 Ga0450907_039985 3300042146 Bacteria 803
911 Ga0439446_0053122 3300042156 Bacteria 1213
912 Ga0450908_002304 3300042184 Bacteria 3734
913 Ga0450909_001099 3300042185 Bacteria 3730
914 Ga0439434_0000105 3300042435 Bacteria 21658
915 Ga0439434_0000679 3300042435 Bacteria 9825
916 Ga0439434_0082557 3300042435 Bacteria 1021
917 Ga0439435_0006676 3300042436 Bacteria 2602
918 Ga0439444_0021740 3300042437 Bacteria 1138
919 Ga0439464_0004133 3300042439 Bacteria 3697
920 Ga0439464_0088182 3300042439 Bacteria 933
921 Ga0439460_0002312 3300042461 Bacteria 4585
922 Ga0439460_0077475 3300042461 Bacteria 1039
923 Ga0450918_001804 3300042531 Bacteria 4173
924 Ga0450918_034841 3300042531 Bacteria 894
925 Ga0451577_0152269 3300042876 Bacteria 2081
926 Ga0451577_0200228 3300042876 Bacteria 1803
927 Ga0439440_0007260 3300042993 Bacteria 2248
928 Ga0466969_0032373 3300044656 Bacteria 2658
929 Ga0466969_0055256 3300044656 Bacteria 1943
930 Ga0466969_0087342 3300044656 Bacteria 1481
931 Ga0466969_0154921 3300044656 Bacteria 1054
932 Ga0466972_0053110 3300044658 Bacteria 1952
933 Ga0466972_0088259 3300044658 Bacteria 1472
934 Ga0466972_0106094 3300044658 Bacteria 1328
935 Ga0466965_0028886 3300044683 Bacteria 2696
936 Ga0466965_0069833 3300044683 Bacteria 1765
937 Ga0466965_0095266 3300044683 Bacteria 1518
938 Ga0466965_0168610 3300044683 Bacteria 1151
939 Ga0466965_0304716 3300044683 Bacteria 865
940 Ga0466966_0005677 3300044684 Bacteria 8207
941 Ga0466966_0023799 3300044684 Bacteria 4008
942 Ga0466966_0037839 3300044684 Bacteria 3109
943 Ga0466966_0072661 3300044684 Bacteria 2153
944 Ga0466966_0106241 3300044684 Bacteria 1733
945 Ga0466966_0134746 3300044684 Bacteria 1511
946 Ga0466966_0201128 3300044684 Bacteria 1205
947 Ga0466966_0462898 3300044684 Bacteria 762
948 Ga0466961_0003699 3300044693 Bacteria 9551
949 Ga0466961_0003745 3300044693 Bacteria 9503
950 Ga0466961_0005124 3300044693 Bacteria 8247
951 Ga0466961_0037056 3300044693 Bacteria 3130
952 Ga0466961_0039848 3300044693 Bacteria 3011
953 Ga0466961_0072862 3300044693 Bacteria 2178
954 Ga0466961_0079267 3300044693 Bacteria 2080
955 Ga0466961_0099559 3300044693 Bacteria 1832
956 Ga0466961_0234779 3300044693 Bacteria 1128
957 Ga0466961_0425095 3300044693 Bacteria 805
958 Ga0466963_0005018 3300044694 Bacteria 7729
959 Ga0466963_0005440 3300044694 Bacteria 7461
960 Ga0466963_0007432 3300044694 Bacteria 6530
961 Ga0466963_0020152 3300044694 Bacteria 4192
962 Ga0466963_0031784 3300044694 Bacteria 3414
963 Ga0466963_0046863 3300044694 Bacteria 2851
964 Ga0466963_0074466 3300044694 Bacteria 2290
965 Ga0466963_0078039 3300044694 Bacteria 2238
966 Ga0466963_0103255 3300044694 Bacteria 1953
967 Ga0466963_0144967 3300044694 Bacteria 1647
968 Ga0466963_0217533 3300044694 Bacteria 1337
969 Ga0466963_0231494 3300044694 Bacteria 1295
970 Ga0466963_0261433 3300044694 Bacteria 1215
971 Ga0466963_0291896 3300044694 Bacteria 1146
972 Ga0466963_0399528 3300044694 Bacteria 969
973 Ga0466964_0367359 3300044706 Bacteria 743
974 Ga0453684_0007886 3300044712 Bacteria 19339
975 Ga0466971_0003970 3300044719 Bacteria 6359
976 Ga0466971_0004022 3300044719 Bacteria 6323
977 Ga0466971_0007127 3300044719 Bacteria 4865
978 Ga0466971_0026801 3300044719 Bacteria 2578
979 Ga0466971_0239586 3300044719 Bacteria 862
980 Ga0466970_0000168 3300044765 Bacteria 31020
981 Ga0466970_0016696 3300044765 Bacteria 3788
982 Ga0466970_0047224 3300044765 Bacteria 2294
983 Ga0466970_0065770 3300044765 Bacteria 1946
984 Ga0466970_0232694 3300044765 Bacteria 1030
985 Ga0466970_0468714 3300044765 Bacteria 723
986 Ga0466957_0012062 3300044842 Bacteria 4996
987 Ga0466957_0022592 3300044842 Bacteria 3714
988 Ga0466957_0051871 3300044842 Bacteria 2496
989 Ga0466957_0083176 3300044842 Bacteria 1996
990 Ga0466957_0130697 3300044842 Bacteria 1608
991 Ga0466957_0171754 3300044842 Bacteria 1412
992 Ga0466957_0195404 3300044842 Bacteria 1327
993 Ga0466957_0273447 3300044842 Bacteria 1129
994 Ga0466957_0443213 3300044842 Bacteria 894
995 Ga0466960_0003209 3300044901 Bacteria 6267
996 Ga0466960_0092556 3300044901 Bacteria 1544
997 Ga0466960_0108573 3300044901 Bacteria 1439
998 Ga0466960_0112687 3300044901 Bacteria 1415
999 Ga0466960_0321493 3300044901 Bacteria 876
1000 Ga0466959_0000799 3300045049 Bacteria 18547
1001 Ga0466959_0002194 3300045049 Bacteria 12414
1002 Ga0466959_0073757 3300045049 Bacteria 2468
1003 Ga0466959_0087636 3300045049 Bacteria 2239
1004 Ga0466959_0229954 3300045049 Bacteria 1284
1005 Ga0466959_0277744 3300045049 Bacteria 1150
1006 Ga0466959_0284293 3300045049 Bacteria 1135
1007 Ga0466958_0002735 3300045836 Bacteria 8950
1008 Ga0466958_0004510 3300045836 Bacteria 7359
1009 Ga0466958_0007800 3300045836 Bacteria 5909
1010 Ga0466958_0017971 3300045836 Bacteria 4098
1011 Ga0466958_0030121 3300045836 Bacteria 3221
1012 Ga0466958_0044760 3300045836 Bacteria 2668
1013 Ga0466958_0071048 3300045836 Bacteria 2131
1014 Ga0466958_0155112 3300045836 Bacteria 1445
1015 Ga0466958_0157407 3300045836 Bacteria 1434
1016 Ga0466958_0332731 3300045836 Bacteria 977
1017 Ga0466967_0003476 3300045976 Bacteria 10290
1018 Ga0466967_0012908 3300045976 Bacteria 6423
1019 Ga0466967_0025215 3300045976 Bacteria 4900
1020 Ga0466967_0037223 3300045976 Bacteria 4162
1021 Ga0466967_0045308 3300045976 Bacteria 3821
1022 Ga0466967_0059796 3300045976 Bacteria 3374
1023 Ga0466967_0064206 3300045976 Bacteria 3265
1024 Ga0466967_0065390 3300045976 Bacteria 3237
1025 Ga0466967_0070810 3300045976 Bacteria 3120
1026 Ga0466967_0077298 3300045976 Bacteria 2996
1027 Ga0466967_0123875 3300045976 Bacteria 2392
1028 Ga0466967_0128387 3300045976 Bacteria 2350
1029 Ga0466967_0155753 3300045976 Bacteria 2140
1030 Ga0466967_0166210 3300045976 Bacteria 2073
1031 Ga0466967_0170992 3300045976 Bacteria 2044
1032 Ga0466967_0205549 3300045976 Bacteria 1866
1033 Ga0466967_0421660 3300045976 Bacteria 1301
1034 Ga0466967_0486835 3300045976 Bacteria 1209
1035 Ga0466967_0814876 3300045976 Bacteria 927
1036 Ga0495627_001242 3300046453 Bacteria 15867
1037 Ga0495627_113319 3300046453 Bacteria 769
1038 Ga0495592_0053377 3300046454 Bacteria 2998
1039 Ga0495603_0167125 3300046455 Bacteria 1275
1040 Ga0495629_0082065 3300046459 Bacteria 2250
1041 Ga0495641_0024793 3300046461 Bacteria 2954
1042 Ga0495641_0064507 3300046461 Bacteria 1650
1043 Ga0495641_0104322 3300046461 Bacteria 1265
1044 Ga0495651_0000144 3300046462 Bacteria 52145
1045 Ga0495651_0018602 3300046462 Bacteria 5382
1046 Ga0495653_0006896 3300046463 Bacteria 9337
1047 Ga0495653_0087445 3300046463 Bacteria 2289
1048 Ga0495653_0172074 3300046463 Bacteria 1494
1049 Ga0495580_0014881 3300046472 Bacteria 5893
1050 Ga0495582_0131649 3300046473 Bacteria 1413
1051 Ga0495582_0153572 3300046473 Bacteria 1307
1052 Ga0495639_0020518 3300046475 Bacteria 2887
1053 Ga0495662_0195226 3300046476 Bacteria 998
1054 Ga0495664_0076660 3300046477 Bacteria 2001
1055 Ga0495664_0168700 3300046477 Bacteria 1328
1056 Ga0495585_0077010 3300046492 Bacteria 1811
1057 Ga0495594_0078434 3300046499 Bacteria 1843
1058 Ga0495594_0227677 3300046499 Bacteria 1063
1059 Ga0495607_0248740 3300046501 Bacteria 857
1060 Ga0495606_0169426 3300046507 Bacteria 1268
1061 Ga0495608_0040482 3300046511 Bacteria 3121
1062 Ga0495630_0087628 3300046517 Bacteria 2351
1063 Ga0495630_0136078 3300046517 Bacteria 1867
1064 Ga0495630_0189513 3300046517 Bacteria 1569
1065 Ga0495630_0214763 3300046517 Bacteria 1468
1066 Ga0495630_0702721 3300046517 Bacteria 774
1067 Ga0495631_0031118 3300046518 Bacteria 2417
1068 Ga0495631_0096037 3300046518 Bacteria 1276
1069 Ga0495643_0098473 3300046522 Bacteria 1501
1070 Ga0495644_0125150 3300046523 Bacteria 979
1071 Ga0495663_0069916 3300046525 Bacteria 1116
1072 Ga0495663_0177435 3300046525 Bacteria 737
1073 Ga0495642_0018365 3300046528 Bacteria 2737
1074 Ga0495642_0057106 3300046528 Bacteria 1613
1075 Ga0495642_0154260 3300046528 Bacteria 994
1076 Ga0495652_0001024 3300046529 Bacteria 31928
1077 Ga0495654_0056838 3300046530 Bacteria 1891
1078 Ga0495665_0004689 3300046531 Bacteria 7369
1079 Ga0495665_0030512 3300046531 Bacteria 2885
1080 Ga0495665_0034836 3300046531 Bacteria 2692
1081 Ga0495586_0005825 3300046535 Bacteria 6586
1082 Ga0495586_0079492 3300046535 Bacteria 1800
1083 Ga0495587_0035365 3300046536 Bacteria 3008
1084 Ga0495587_0043688 3300046536 Bacteria 2668
1085 Ga0495609_0112124 3300046538 Bacteria 1177
1086 Ga0495621_0003457 3300046539 Bacteria 4360
1087 Ga0495645_0014119 3300046543 Bacteria 5661
1088 Ga0495645_0064402 3300046543 Bacteria 2653
1089 Ga0495645_0117322 3300046543 Bacteria 1878
1090 Ga0495645_0142870 3300046543 Bacteria 1668
1091 Ga0495633_0087005 3300046558 Bacteria 1453
1092 Ga0495667_0000893 3300046559 Bacteria 19286
1093 Ga0495667_0009607 3300046559 Bacteria 6558
1094 Ga0495667_0126107 3300046559 Bacteria 1652
1095 Ga0495656_0021159 3300046615 Bacteria 2530
1096 Ga0495656_0081037 3300046615 Bacteria 1465
1097 Ga0495656_0250084 3300046615 Bacteria 895
1098 Ga0495634_0007971 3300046642 Bacteria 7900
1099 Ga0495634_0077211 3300046642 Bacteria 2185
1100 Ga0495634_0120662 3300046642 Bacteria 1679
1101 Ga0495625_0236260 3300046660 Bacteria 1192
1102 Ga0495635_0008605 3300046663 Bacteria 7126
1103 Ga0495635_0168902 3300046663 Bacteria 1488
1104 Ga0495659_0037409 3300046664 Bacteria 1719
1105 Ga0495588_0023188 3300046674 Bacteria 3071
1106 Ga0495588_0055876 3300046674 Bacteria 2037
1107 Ga0495588_0056110 3300046674 Bacteria 2033
1108 Ga0495657_0017106 3300046675 Bacteria 5270
1109 Ga0495657_0020156 3300046675 Bacteria 4797
1110 Ga0495623_0003088 3300046679 Bacteria 10976
1111 Ga0495623_0042872 3300046679 Bacteria 2880
1112 Ga0495646_0014680 3300046680 Bacteria 4978
1113 Ga0495669_0008900 3300046684 Bacteria 4230
1114 Ga0495613_0000722 3300046689 Bacteria 25894
1115 Ga0495613_0006422 3300046689 Bacteria 8789
1116 Ga0495613_0148484 3300046689 Bacteria 1673
1117 Ga0495613_0411075 3300046689 Bacteria 922
1118 Ga0495624_0204996 3300046690 Bacteria 1197
1119 Ga0495670_0114282 3300046691 Bacteria 1399
1120 Ga0495649_0255699 3300046694 Bacteria 899
1121 Ga0495600_0018577 3300046809 Bacteria 4430
1122 Ga0495600_0025653 3300046809 Bacteria 3798
1123 Ga0495600_0306038 3300046809 Bacteria 1002
1124 Ga0495581_0043587 3300047315 Bacteria 2595
1125 Ga0495581_0055725 3300047315 Bacteria 2281
1126 Ga0495581_0059368 3300047315 Bacteria 2210
1127 Ga0495581_0120113 3300047315 Bacteria 1529
1128 Ga0495581_0153760 3300047315 Bacteria 1344
1129 Ga0495581_0328282 3300047315 Bacteria 893
1130 Ga0495581_0337139 3300047315 Bacteria 880
1131 Ga0495604_0013452 3300047317 Bacteria 6520
1132 Ga0495604_0089688 3300047317 Bacteria 2285
1133 Ga0495604_0254165 3300047317 Bacteria 1197
1134 Ga0495636_0039019 3300047318 Bacteria 1966
1135 Ga0495676_0169836 3300047321 Bacteria 1536
1136 Ga0495676_0272059 3300047321 Bacteria 1149
1137 Ga0495680_0006450 3300047322 Bacteria 10900
1138 Ga0495680_0029703 3300047322 Bacteria 4474
1139 Ga0495680_0122908 3300047322 Bacteria 1915
1140 Ga0495675_0002410 3300047444 Bacteria 11174
1141 Ga0495675_0041407 3300047444 Bacteria 2936
1142 Ga0495675_0047384 3300047444 Bacteria 2735
1143 Ga0495675_0361261 3300047444 Bacteria 852
1144 Ga0495685_142381 3300047447 Bacteria 781
1145 Ga0495681_0121821 3300047470 Bacteria 1118
1146 Ga0495684_0204267 3300047471 Bacteria 1455
1147 Ga0495593_0350058 3300047673 Bacteria 738
1148 Ga0496100_0072118 3300048903 Bacteria 2307
1149 Ga0496100_0103874 3300048903 Bacteria 1962
1150 Ga0496100_0114353 3300048903 Bacteria 1880
1151 Ga0496101_0021074 3300048904 Bacteria 4473
1152 Ga0496101_0228841 3300048904 Bacteria 1445
1153 Ga0496102_0000409 3300048905 Bacteria 49825
1154 Ga0496102_0001269 3300048905 Bacteria 22791
1155 Ga0496102_0009801 3300048905 Bacteria 8236
1156 Ga0496102_0020076 3300048905 Bacteria 5899
1157 Ga0496102_0049140 3300048905 Bacteria 3837
1158 Ga0496102_0087762 3300048905 Bacteria 2874
1159 Ga0496102_0126603 3300048905 Bacteria 2388
1160 Ga0496102_0152320 3300048905 Bacteria 2173
1161 Ga0496102_0570234 3300048905 Bacteria 1055
1162 Ga0496102_0593515 3300048905 Bacteria 1030
1163 Ga0496103_0018655 3300048906 Bacteria 4162
1164 Ga0496103_0029132 3300048906 Bacteria 3354
1165 Ga0496103_0029148 3300048906 Bacteria 3353
1166 Ga0496103_0092429 3300048906 Bacteria 1910
1167 Ga0496103_0132762 3300048906 Bacteria 1590
1168 Ga0496104_0000677 3300048907 Bacteria 29304
1169 Ga0496104_0024448 3300048907 Bacteria 5556
1170 Ga0496104_0038836 3300048907 Bacteria 4456
1171 Ga0496104_0113004 3300048907 Bacteria 2605
1172 Ga0496104_0732910 3300048907 Bacteria 896
1173 Ga0496105_0007909 3300048908 Bacteria 8259
1174 Ga0496105_0063313 3300048908 Bacteria 3051
1175 Ga0496105_0067874 3300048908 Bacteria 2945
1176 Ga0496105_0150267 3300048908 Bacteria 1914
1177 Ga0496105_0166024 3300048908 Bacteria 1811
1178 Ga0496105_0206186 3300048908 Bacteria 1603
1179 Ga0496105_0283527 3300048908 Bacteria 1335
1180 Ga0496105_0486647 3300048908 Bacteria 970
1181 Ga0496107_0031450 3300048910 Bacteria 3788
1182 Ga0496107_0039486 3300048910 Bacteria 3386
1183 Ga0496107_0132777 3300048910 Bacteria 1838
1184 Ga0496108_0002096 3300048911 Bacteria 15958
1185 Ga0496108_0004730 3300048911 Bacteria 10980
1186 Ga0496108_0099096 3300048911 Bacteria 2484
1187 Ga0496108_0145310 3300048911 Bacteria 2044
1188 Ga0496108_0201150 3300048911 Bacteria 1729
1189 Ga0496108_0205105 3300048911 Bacteria 1711
1190 Ga0496108_0257422 3300048911 Bacteria 1518
1191 Ga0496108_0281742 3300048911 Bacteria 1447
1192 Ga0496108_0364632 3300048911 Bacteria 1261
1193 Ga0496108_0419190 3300048911 Bacteria 1169
1194 Ga0496108_0568240 3300048911 Bacteria 989
1195 Ga0496109_0006659 3300048912 Bacteria 9727
1196 Ga0496109_0017905 3300048912 Bacteria 6218
1197 Ga0496109_0019346 3300048912 Bacteria 6002
1198 Ga0496109_0042917 3300048912 Bacteria 4099
1199 Ga0496109_0044527 3300048912 Bacteria 4026
1200 Ga0496109_0086667 3300048912 Bacteria 2892
1201 Ga0496109_0107932 3300048912 Bacteria 2587
1202 Ga0496109_0179702 3300048912 Bacteria 1987
1203 Ga0496109_0180005 3300048912 Bacteria 1985
1204 Ga0496110_0012109 3300048913 Bacteria 7086
1205 Ga0496110_0032019 3300048913 Bacteria 4539
1206 Ga0496110_0037321 3300048913 Bacteria 4223
1207 Ga0496110_0040321 3300048913 Bacteria 4070
1208 Ga0496110_0044227 3300048913 Bacteria 3889
1209 Ga0496110_0072149 3300048913 Bacteria 3063
1210 Ga0496110_0224875 3300048913 Bacteria 1707
1211 Ga0496110_0344006 3300048913 Bacteria 1358
1212 Ga0496110_0354476 3300048913 Bacteria 1337
1213 Ga0496110_0578378 3300048913 Bacteria 1020
1214 Ga0496110_0651186 3300048913 Bacteria 953
1215 Ga0496111_0003289 3300048914 Bacteria 9988
1216 Ga0496111_0006826 3300048914 Bacteria 7444
1217 Ga0496111_0007706 3300048914 Bacteria 7081
1218 Ga0496111_0008464 3300048914 Bacteria 6812
1219 Ga0496111_0014992 3300048914 Bacteria 5310
1220 Ga0496111_0335877 3300048914 Bacteria 1119
1221 Ga0496112_0016783 3300048915 Bacteria 6867
1222 Ga0496112_0123812 3300048915 Bacteria 2557
1223 Ga0496112_0182486 3300048915 Bacteria 2062
1224 Ga0496112_0204767 3300048915 Bacteria 1931
1225 Ga0496113_0022828 3300048916 Bacteria 4432
1226 Ga0496113_0175270 3300048916 Bacteria 1699
1227 Ga0496113_0485260 3300048916 Bacteria 992
1228 Ga0496113_0668689 3300048916 Bacteria 830
1229 Ga0496113_0776912 3300048916 Bacteria 762
1230 Ga0496114_0001765 3300048917 Bacteria 16418
1231 Ga0496114_0002831 3300048917 Bacteria 13302
1232 Ga0496114_0117138 3300048917 Bacteria 2288
1233 Ga0496114_0139188 3300048917 Bacteria 2100
1234 Ga0496114_0161986 3300048917 Bacteria 1946
1235 Ga0496114_0247422 3300048917 Bacteria 1568
1236 Ga0496114_0273060 3300048917 Bacteria 1490
1237 Ga0496114_0279667 3300048917 Bacteria 1471
1238 Ga0496114_0305878 3300048917 Bacteria 1404
1239 Ga0496114_0360374 3300048917 Bacteria 1286
1240 Ga0496114_0362502 3300048917 Bacteria 1282
1241 Ga0496114_0384377 3300048917 Bacteria 1243
1242 Ga0496114_0708282 3300048917 Bacteria 883
1243 Ga0496115_0005178 3300048918 Bacteria 9482
1244 Ga0496115_0071896 3300048918 Bacteria 2806
1245 Ga0496115_0135168 3300048918 Bacteria 2033
1246 Ga0496115_0157824 3300048918 Bacteria 1874
1247 Ga0496115_0408775 3300048918 Bacteria 1101
1248 Ga0496115_0569984 3300048918 Bacteria 903
1249 Ga0496116_0000182 3300048919 Bacteria 125343
1250 Ga0496117_0007048 3300048920 Bacteria 11121
1251 Ga0496117_0012166 3300048920 Bacteria 7621
1252 Ga0496117_0037616 3300048920 Bacteria 3603
1253 Ga0496117_0074371 3300048920 Bacteria 2262
1254 Ga0496118_0001362 3300048921 Bacteria 36823
1255 Ga0496118_0010443 3300048921 Bacteria 9197
1256 Ga0496118_0078468 3300048921 Bacteria 2336
1257 Ga0496118_0113997 3300048921 Bacteria 1784
1258 Ga0496118_0114678 3300048921 Bacteria 1776
1259 Ga0496118_0176247 3300048921 Bacteria 1298
1260 Ga0496119_0001767 3300048922 Bacteria 25169
1261 Ga0496119_0006539 3300048922 Bacteria 10754
1262 Ga0496119_0006711 3300048922 Bacteria 10578
1263 Ga0496119_0007010 3300048922 Bacteria 10263
1264 Ga0496119_0007499 3300048922 Bacteria 9806
1265 Ga0496119_0107651 3300048922 Bacteria 1554
1266 Ga0496120_0000878 3300048923 Bacteria 42397
1267 Ga0496120_0002268 3300048923 Bacteria 19999
1268 Ga0496120_0003203 3300048923 Bacteria 15219
1269 Ga0496122_0000096 3300048925 Bacteria 200503
1270 Ga0496122_0006853 3300048925 Bacteria 12910
1271 Ga0496122_0034906 3300048925 Bacteria 4105
1272 Ga0496123_0000031 3300048926 Bacteria 287596
1273 Ga0496123_0006613 3300048926 Bacteria 11196
1274 Ga0496123_0008186 3300048926 Bacteria 9643
1275 Ga0496123_0111452 3300048926 Bacteria 1563
1276 Ga0496124_0001640 3300048927 Bacteria 32069
1277 Ga0496124_0002763 3300048927 Bacteria 22327
1278 Ga0496124_0025215 3300048927 Bacteria 5389
1279 Ga0496124_0173640 3300048927 Bacteria 1666
1280 Ga0496124_0199513 3300048927 Bacteria 1523
1281 Ga0496124_0213832 3300048927 Bacteria 1456
1282 Ga0496124_0493061 3300048927 Bacteria 824
1283 Ga0496125_0000069 3300048928 Bacteria 246981
1284 Ga0496125_0001305 3300048928 Bacteria 36944
1285 Ga0496125_0001344 3300048928 Bacteria 36236
1286 Ga0496125_0005189 3300048928 Bacteria 14634
1287 Ga0496125_0012813 3300048928 Bacteria 8289
1288 Ga0496125_0024117 3300048928 Bacteria 5601
1289 Ga0496126_0000003 3300048929 Bacteria 961576
1290 Ga0496126_0001649 3300048929 Bacteria 33603
1291 Ga0496126_0030497 3300048929 Bacteria 5108
1292 Ga0496126_0062762 3300048929 Bacteria 3332
1293 Ga0496126_0075468 3300048929 Bacteria 2992
1294 Ga0496126_0346035 3300048929 Bacteria 1217
1295 Ga0496126_0508450 3300048929 Bacteria 962
1296 Ga0501299_039643 3300049522 Bacteria 941
1297 Ga0501325_018220 3300049541 Bacteria 717
1298 Ga0501031_0028624 3300049568 Bacteria 3633
1299 Ga0501031_0031333 3300049568 Bacteria 3469
1300 Ga0501031_0071271 3300049568 Bacteria 2263
1301 Ga0501031_0230558 3300049568 Bacteria 1205
1302 Ga0501031_0245734 3300049568 Bacteria 1163
1303 Ga0501031_0258313 3300049568 Bacteria 1132
1304 Ga0501032_0013580 3300049569 Bacteria 5788
1305 Ga0501032_0026939 3300049569 Bacteria 3952
1306 Ga0501032_0041344 3300049569 Bacteria 3132
1307 Ga0501032_0074717 3300049569 Bacteria 2258
1308 Ga0501032_0192998 3300049569 Bacteria 1331
1309 Ga0501032_0206226 3300049569 Bacteria 1282
1310 Ga0501032_0263957 3300049569 Bacteria 1116
1311 Ga0501032_0293700 3300049569 Bacteria 1051
1312 Ga0501033_0000285 3300049570 Bacteria 48668
1313 Ga0501033_0001458 3300049570 Bacteria 20971
1314 Ga0501033_0033163 3300049570 Bacteria 3878
1315 Ga0501034_0000366 3300049571 Bacteria 77097
1316 Ga0501034_0001844 3300049571 Bacteria 26913
1317 Ga0501034_0001978 3300049571 Bacteria 25960
1318 Ga0501034_0003536 3300049571 Bacteria 17747
1319 Ga0501034_0018939 3300049571 Bacteria 7053
1320 Ga0501034_0020347 3300049571 Bacteria 6774
1321 Ga0501034_0020973 3300049571 Bacteria 6670
1322 Ga0501034_0025246 3300049571 Bacteria 6048
1323 Ga0501034_0028948 3300049571 Bacteria 5634
1324 Ga0501034_0033627 3300049571 Bacteria 5200
1325 Ga0501034_0035142 3300049571 Bacteria 5083
1326 Ga0501034_0103654 3300049571 Bacteria 2838
1327 Ga0501034_0707902 3300049571 Bacteria 905
1328 Ga0501036_0000324 3300049572 Bacteria 33202
1329 Ga0501036_0034200 3300049572 Bacteria 4299
1330 Ga0501036_0047948 3300049572 Bacteria 3617
1331 Ga0501036_0076423 3300049572 Bacteria 2833
1332 Ga0501036_0155034 3300049572 Bacteria 1932
1333 Ga0501036_0290499 3300049572 Bacteria 1368
1334 Ga0501036_0510962 3300049572 Bacteria 999
1335 Ga0501037_0008494 3300049573 Bacteria 7529
1336 Ga0501037_0010367 3300049573 Bacteria 6837
1337 Ga0501037_0059238 3300049573 Bacteria 2794
1338 Ga0501037_0295095 3300049573 Bacteria 1127
1339 Ga0501037_0565599 3300049573 Bacteria 766
1340 Ga0501037_0605428 3300049573 Bacteria 735
1341 Ga0501038_0024723 3300049574 Bacteria 5355
1342 Ga0501038_0025154 3300049574 Bacteria 5308
1343 Ga0501038_0062786 3300049574 Bacteria 3173
1344 Ga0501038_0089418 3300049574 Bacteria 2583
1345 Ga0501038_0613663 3300049574 Bacteria 822
1346 Ga0501039_0009364 3300049575 Bacteria 7465
1347 Ga0501039_0048091 3300049575 Bacteria 3297
1348 Ga0501039_0058265 3300049575 Bacteria 2991
1349 Ga0501039_0073701 3300049575 Bacteria 2652
1350 Ga0501039_0142152 3300049575 Bacteria 1885
1351 Ga0501039_0469047 3300049575 Bacteria 988
1352 Ga0501039_0587717 3300049575 Bacteria 873
1353 Ga0501040_0007927 3300049576 Bacteria 6888
1354 Ga0501040_0017800 3300049576 Bacteria 4716
1355 Ga0501040_0026852 3300049576 Bacteria 3874
1356 Ga0501040_0030516 3300049576 Bacteria 3641
1357 Ga0501040_0034216 3300049576 Bacteria 3443
1358 Ga0501040_0066617 3300049576 Bacteria 2481
1359 Ga0501040_0074570 3300049576 Bacteria 2345
1360 Ga0501040_0089001 3300049576 Bacteria 2145
1361 Ga0501040_0138387 3300049576 Bacteria 1714
1362 Ga0501041_0001442 3300049577 Bacteria 13153
1363 Ga0501041_0252573 3300049577 Bacteria 1108
1364 Ga0501041_0425473 3300049577 Bacteria 842
1365 Ga0501042_0007298 3300049578 Bacteria 7233
1366 Ga0501042_0011674 3300049578 Bacteria 5935
1367 Ga0501042_0012255 3300049578 Bacteria 5803
1368 Ga0501042_0013414 3300049578 Bacteria 5576
1369 Ga0501042_0043256 3300049578 Bacteria 3207
1370 Ga0501042_0142792 3300049578 Bacteria 1726
1371 Ga0501042_0144136 3300049578 Bacteria 1718
1372 Ga0501042_0322076 3300049578 Bacteria 1117
1373 Ga0501043_0004041 3300049579 Bacteria 11997
1374 Ga0501043_0009299 3300049579 Bacteria 7721
1375 Ga0501043_0039319 3300049579 Bacteria 3717
1376 Ga0501043_0124379 3300049579 Bacteria 2022
1377 Ga0501043_0355735 3300049579 Bacteria 1112
1378 Ga0501046_0010068 3300049580 Bacteria 8143
1379 Ga0501046_0030465 3300049580 Bacteria 4379
1380 Ga0501046_0109796 3300049580 Bacteria 2108
1381 Ga0501046_0203702 3300049580 Bacteria 1471
1382 Ga0501047_0036754 3300049581 Bacteria 4734
1383 Ga0501047_0084362 3300049581 Bacteria 3053
1384 Ga0501047_0180220 3300049581 Bacteria 1979
1385 Ga0501047_0284410 3300049581 Bacteria 1498
1386 Ga0501047_0339217 3300049581 Bacteria 1341
1387 Ga0501047_0409775 3300049581 Bacteria 1188
1388 Ga0501048_0015721 3300049582 Bacteria 5584
1389 Ga0501048_0018030 3300049582 Bacteria 5195
1390 Ga0501048_0236764 3300049582 Bacteria 1295
1391 Ga0501048_0587869 3300049582 Bacteria 799
1392 Ga0501067_0002319 3300049583 Bacteria 10526
1393 Ga0501067_0041336 3300049583 Bacteria 2560
1394 Ga0501068_0000264 3300049584 Bacteria 25937
1395 Ga0501068_0161555 3300049584 Bacteria 1412
1396 Ga0501069_0000069 3300049585 Bacteria 52472
1397 Ga0501069_0000356 3300049585 Bacteria 20543
1398 Ga0501069_0001045 3300049585 Bacteria 13242
1399 Ga0501069_0024201 3300049585 Bacteria 3312
1400 Ga0501069_0066115 3300049585 Bacteria 2022
1401 Ga0501069_0139060 3300049585 Bacteria 1393
1402 Ga0501070_0000016 3300049586 Bacteria 178549
1403 Ga0501070_0000693 3300049586 Bacteria 30887
1404 Ga0501070_0000746 3300049586 Bacteria 29642
1405 Ga0501070_0001283 3300049586 Bacteria 22544
1406 Ga0501070_0001642 3300049586 Bacteria 19817
1407 Ga0501070_0011128 3300049586 Bacteria 7594
1408 Ga0501070_0014540 3300049586 Bacteria 6622
1409 Ga0501070_0017692 3300049586 Bacteria 5985
1410 Ga0501070_0063716 3300049586 Bacteria 3053
1411 Ga0501070_0295999 3300049586 Bacteria 1319
1412 Ga0501071_0001553 3300049587 Bacteria 13422
1413 Ga0501071_0029066 3300049587 Bacteria 3899
1414 Ga0501071_0055451 3300049587 Bacteria 2861
1415 Ga0501071_0065350 3300049587 Bacteria 2641
1416 Ga0501071_0075789 3300049587 Bacteria 2456
1417 Ga0501071_0077792 3300049587 Bacteria 2423
1418 Ga0501071_0119342 3300049587 Bacteria 1954
1419 Ga0501071_0140006 3300049587 Bacteria 1801
1420 Ga0501071_0142626 3300049587 Bacteria 1784
1421 Ga0501071_0272130 3300049587 Bacteria 1281
1422 Ga0501071_0285900 3300049587 Bacteria 1248
1423 Ga0501071_0746450 3300049587 Bacteria 754
1424 Ga0501072_0009842 3300049588 Bacteria 7269
1425 Ga0501072_0014829 3300049588 Bacteria 5975
1426 Ga0501072_0016598 3300049588 Bacteria 5656
1427 Ga0501072_0028917 3300049588 Bacteria 4327
1428 Ga0501072_0073646 3300049588 Bacteria 2700
1429 Ga0501072_0165466 3300049588 Bacteria 1764
1430 Ga0501072_0375920 3300049588 Bacteria 1127
1431 Ga0501073_0003817 3300049589 Bacteria 11307
1432 Ga0501073_0004708 3300049589 Bacteria 10247
1433 Ga0501073_0027437 3300049589 Bacteria 4072
1434 Ga0501073_0119839 3300049589 Bacteria 1824
1435 Ga0501074_0002476 3300049590 Bacteria 12874
1436 Ga0501074_0007891 3300049590 Bacteria 7710
1437 Ga0501074_0022339 3300049590 Bacteria 4595
1438 Ga0501074_0045582 3300049590 Bacteria 3172
1439 Ga0501074_0072046 3300049590 Bacteria 2483
1440 Ga0501074_0090401 3300049590 Bacteria 2193
1441 Ga0501074_0267461 3300049590 Bacteria 1215
1442 Ga0501074_0496020 3300049590 Bacteria 865
1443 Ga0501075_0000643 3300049591 Bacteria 21372
1444 Ga0501075_0003925 3300049591 Bacteria 10016
1445 Ga0501075_0077325 3300049591 Bacteria 2518
1446 Ga0501075_0088728 3300049591 Bacteria 2345
1447 Ga0501075_0107859 3300049591 Bacteria 2117
1448 Ga0501075_0155387 3300049591 Bacteria 1744
1449 Ga0501075_0426665 3300049591 Bacteria 1011
1450 Ga0501075_0433296 3300049591 Bacteria 1002
1451 Ga0501076_0002904 3300049592 Bacteria 11868
1452 Ga0501076_0004459 3300049592 Bacteria 9963
1453 Ga0501076_0021629 3300049592 Bacteria 4936
1454 Ga0501076_0038999 3300049592 Bacteria 3729
1455 Ga0501076_0138076 3300049592 Bacteria 1979
1456 Ga0501076_0211311 3300049592 Bacteria 1585
1457 Ga0501076_0327632 3300049592 Bacteria 1256
1458 Ga0501076_0397259 3300049592 Bacteria 1133
1459 Ga0501076_0428096 3300049592 Bacteria 1089
1460 Ga0501077_0001765 3300049593 Bacteria 13052
1461 Ga0501077_0019766 3300049593 Bacteria 4260
1462 Ga0501077_0051452 3300049593 Bacteria 2618
1463 Ga0501217_043199 3300049661 Bacteria 1154
1464 Ga0501247_018140 3300049677 Bacteria 897
1465 Ga0501259_017194 3300049688 Bacteria 1252
1466 Ga0501079_0008247 3300049741 Bacteria 7896
1467 Ga0501079_0020182 3300049741 Bacteria 5093
1468 Ga0501079_0034714 3300049741 Bacteria 3880
1469 Ga0501079_0041676 3300049741 Bacteria 3545
1470 Ga0501079_0103348 3300049741 Bacteria 2210
1471 Ga0501079_0136224 3300049741 Bacteria 1912
1472 Ga0501079_0267828 3300049741 Bacteria 1335
1473 Ga0501080_0003538 3300049742 Bacteria 13760
1474 Ga0501080_0006465 3300049742 Bacteria 10525
1475 Ga0501080_0019742 3300049742 Bacteria 6240
1476 Ga0501080_0023782 3300049742 Bacteria 5677
1477 Ga0501080_0047889 3300049742 Bacteria 3980
1478 Ga0501080_0069045 3300049742 Bacteria 3286
1479 Ga0501080_0113018 3300049742 Bacteria 2517
1480 Ga0501080_0196990 3300049742 Bacteria 1850
1481 Ga0501080_0215768 3300049742 Bacteria 1757
1482 Ga0501080_0311312 3300049742 Bacteria 1427
1483 Ga0501080_0329809 3300049742 Bacteria 1380
1484 Ga0501081_0010797 3300049743 Bacteria 5965
1485 Ga0501081_0012555 3300049743 Bacteria 5571
1486 Ga0501081_0026196 3300049743 Bacteria 3930
1487 Ga0501081_0096238 3300049743 Bacteria 2088
1488 Ga0501081_0139381 3300049743 Bacteria 1737
1489 Ga0501081_0143792 3300049743 Bacteria 1710
1490 Ga0501083_0000318 3300049744 Bacteria 30528
1491 Ga0501083_0002553 3300049744 Bacteria 12507
1492 Ga0501083_0141562 3300049744 Bacteria 1575
1493 Ga0501241_041002 3300049758 Bacteria 897
1494 Ga0501035_0182370 3300049822 Bacteria 1808
1495 Ga0501035_0644665 3300049822 Bacteria 859
1496 Ga0501044_0010622 3300049823 Bacteria 9989
1497 Ga0501044_0013397 3300049823 Bacteria 8867
1498 Ga0501044_0019557 3300049823 Bacteria 7240
1499 Ga0501044_0049694 3300049823 Bacteria 4329
1500 Ga0501044_0088696 3300049823 Bacteria 3122
1501 Ga0501044_0190588 3300049823 Bacteria 2013
1502 Ga0501044_0242019 3300049823 Bacteria 1748
1503 Ga0501044_0703740 3300049823 Bacteria 895
1504 Ga0501045_0008592 3300049824 Bacteria 7118
1505 Ga0501045_0013364 3300049824 Bacteria 5797
1506 Ga0501045_0024363 3300049824 Bacteria 4345
1507 Ga0501045_0065646 3300049824 Bacteria 2664
1508 Ga0501045_0076300 3300049824 Bacteria 2469
1509 Ga0501045_0212637 3300049824 Bacteria 1440
1510 Ga0501045_0262813 3300049824 Bacteria 1285
1511 Ga0501045_0287489 3300049824 Bacteria 1224
1512 nmdc:mga03683_113360_c1 3300050489 Bacteria 1200
1513 nmdc:mga00v17_135798_c1 3300050491 Bacteria 1574
1514 nmdc:mga00v17_2726_c1 3300050491 Bacteria 9067
1515 nmdc:mga00v17_373822_c1 3300050491 Bacteria 927
1516 nmdc:mga00v17_41109_c1 3300050491 Bacteria 2775
1517 nmdc:mga00v17_411582_c1 3300050491 Bacteria 878
1518 nmdc:mga00v17_5246_c1 3300050491 Bacteria 6823
1519 nmdc:mga00v17_56865_c1 3300050491 Bacteria 2392
1520 nmdc:mga00v17_61606_c1 3300050491 Bacteria 2307
1521 nmdc:mga00v17_754_c1 3300050491 Bacteria 17588
1522 nmdc:mga00v17_76666_c1 3300050491 Bacteria 2080
1523 nmdc:mga0yw44_11660_c1 3300050492 Bacteria 4550
1524 nmdc:mga0yw44_362949_c1 3300050492 Bacteria 976
1525 nmdc:mga0yw44_427600_c1 3300050492 Bacteria 897
1526 nmdc:mga0yw44_49239_c1 3300050492 Bacteria 2542
1527 nmdc:mga0yw44_70014_c1 3300050492 Bacteria 2174
1528 nmdc:mga04h51_60310_c1 3300050495 Bacteria 1298
1529 nmdc:mga07m45_190415_c1 3300050496 Bacteria 1193
1530 nmdc:mga07m45_262677_c1 3300050496 Bacteria 1004
1531 nmdc:mga07m45_78446_c1 3300050496 Bacteria 1884
1532 nmdc:mga05p37_1240121_c1 3300050507 Bacteria 766
1533 nmdc:mga05p37_137926_c1 3300050507 Bacteria 2990
1534 nmdc:mga05p37_17788_c1 3300050507 Bacteria 8577
1535 nmdc:mga05p37_272_c1 3300050507 Bacteria 49943
1536 nmdc:mga05p37_27518_c1 3300050507 Bacteria 6922
1537 nmdc:mga05p37_3013_c1 3300050507 Bacteria 19548
1538 nmdc:mga05p37_91274_c1 3300050507 Bacteria 3753
1539 nmdc:mga09592_1380_c1 3300050508 Bacteria 19427
1540 nmdc:mga09592_3249_c1 3300050508 Bacteria 13149
1541 nmdc:mga09592_4313_c1 3300050508 Bacteria 11491
1542 nmdc:mga09592_469220_c1 3300050508 Bacteria 1085
1543 nmdc:mga09592_53980_c1 3300050508 Bacteria 3394
1544 nmdc:mga09592_696_c1 3300050508 Bacteria 25711
1545 nmdc:mga0qj67_115963_c1 3300050509 Bacteria 2164
1546 nmdc:mga0qj67_117_c1 3300050509 Bacteria 52622
1547 nmdc:mga0qj67_132261_c1 3300050509 Bacteria 2021
1548 nmdc:mga0qj67_140136_c1 3300050509 Bacteria 1961
1549 nmdc:mga0qj67_391691_c1 3300050509 Bacteria 1122
1550 nmdc:mga0qj67_581_c1 3300050509 Bacteria 24951
1551 nmdc:mga0qj67_92240_c1 3300050509 Bacteria 2435
1552 nmdc:mga06r32_162266_c1 3300050510 Bacteria 2217
1553 nmdc:mga06r32_17441_c2 3300050510 Bacteria 4420
1554 nmdc:mga06r32_2648_c1 3300050510 Bacteria 15995
1555 nmdc:mga06r32_31164_c1 3300050510 Bacteria 5007
1556 nmdc:mga06r32_48331_c1 3300050510 Bacteria 4066
1557 nmdc:mga06r32_58872_c1 3300050510 Bacteria 3693
1558 nmdc:mga06r32_60054_c1 3300050510 Bacteria 3658
1559 nmdc:mga06r32_68_c1 3300050510 Bacteria 67093
1560 nmdc:mga06r32_7319_c1 3300050510 Bacteria 9938
1561 nmdc:mga08y16_1042_c1 3300050511 Bacteria 27170
1562 nmdc:mga08y16_15375_c1 3300050511 Bacteria 8048
1563 nmdc:mga08y16_234331_c1 3300050511 Bacteria 1898
1564 nmdc:mga08y16_2982_c1 3300050511 Bacteria 17452
1565 nmdc:mga08y16_48424_c1 3300050511 Bacteria 4448
1566 nmdc:mga08y16_5866_c1 3300050511 Bacteria 12866
1567 nmdc:mga0n895_3207_c1 3300050512 Bacteria 13095
1568 nmdc:mga0rr50_34641_c1 3300050513 Bacteria 3618
1569 nmdc:mga0rr50_4910_c1 3300050513 Bacteria 7914
1570 nmdc:mga08x19_1671_c1 3300050514 Bacteria 13659
1571 nmdc:mga08x19_172131_c1 3300050514 Bacteria 1475
1572 nmdc:mga0a205_12836_c1 3300050515 Bacteria 7772
1573 nmdc:mga0a205_2580_c1 3300050515 Bacteria 15986
1574 nmdc:mga0a205_405844_c1 3300050515 Bacteria 1226
1575 Ga0495601_0070849 3300053077 Bacteria 2225
1576 Ga0495601_0323608 3300053077 Bacteria 1004
1577 Ga0500635_0002811 3300053080 Bacteria 4320
1578 Ga0495655_0116602 3300053083 Bacteria 808
1579 Ga0495595_0216594 3300053084 Bacteria 955
1580 Ga0495619_0013120 3300053085 Bacteria 5222
1581 Ga0495619_0230771 3300053085 Bacteria 1282
1582 Ga0500643_000483 3300053087 Bacteria 29043
1583 Ga0500583_0033239 3300053092 Bacteria 2282
1584 Ga0500566_0001537 3300053094 Bacteria 13554
1585 Ga0500566_0095162 3300053094 Bacteria 1641
1586 Ga0500641_0003380 3300053096 Bacteria 5644
1587 Ga0500568_0000033 3300053139 Bacteria 143926
1588 Ga0500568_0016033 3300053139 Bacteria 3340
1589 Ga0500616_0000201 3300053153 Bacteria 97711
1590 Ga0501084_0000435 3300054114 Bacteria 32177
1591 Ga0501084_0019165 3300054114 Bacteria 5699
1592 Ga0501084_0019201 3300054114 Bacteria 5693
1593 Ga0501084_0057681 3300054114 Bacteria 3249
1594 Ga0501084_0066720 3300054114 Bacteria 3011
1595 Ga0501084_0091766 3300054114 Bacteria 2550
1596 Ga0501084_0095152 3300054114 Bacteria 2501
1597 Ga0501084_0384801 3300054114 Bacteria 1185
1598 Ga0590071_036856 3300059421 Bacteria 1173
1599 Ga0590074_039237 3300059423 Bacteria 850
1600 Ga0587088_001988 3300059508 Bacteria 2238
1601 Ga0501082_0019250 3300060353 Bacteria 5884
1602 Ga0501082_0037842 3300060353 Bacteria 4161
1603 Ga0501082_0078687 3300060353 Bacteria 2844
1604 Ga0501082_0080593 3300060353 Bacteria 2809
1605 Ga0501082_0127309 3300060353 Bacteria 2209
1606 Ga0501082_0282735 3300060353 Bacteria 1444
1607 Ga0466962_0002524 3300061719 Bacteria 8694
1608 Ga0466962_0007661 3300061719 Bacteria 5172
1609 Ga0466962_0011281 3300061719 Bacteria 4304
1610 Ga0466962_0013282 3300061719 Bacteria 3961
1611 Ga0466962_0024833 3300061719 Bacteria 2877
1612 Ga0466962_0076647 3300061719 Bacteria 1598
1613 Ga0466962_0148578 3300061719 Bacteria 1137
1614 Ga0466962_0191996 3300061719 Bacteria 997
1615 Ga0530510_0003757 3300061734 Bacteria 10452
1616 Ga0530510_0009785 3300061734 Bacteria 6728
1617 Ga0530510_0060060 3300061734 Bacteria 2751
1618 Ga0530510_0072845 3300061734 Bacteria 2493
1619 Ga0530510_0078713 3300061734 Bacteria 2397
1620 Ga0530510_0241260 3300061734 Bacteria 1345

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042006 Ga0439432_148512 Ga0439432_148512_10_588 187
2 3300046535 Ga0495586_0005825 Ga0495586_0005825_5941_6540 199
3 3300031824 Ga0307413_10397782 Ga0307413_103977821 201
4 3300039450 Ga0436363_0955217 Ga0436363_0955217_788_1618 203
5 3300031731 Ga0307405_10084481 Ga0307405_100844812 206
6 3300044706 Ga0466964_0367359 Ga0466964_0367359_15_638 206
7 3300046473 Ga0495582_0153572 Ga0495582_0153572_630_1250 206
8 3300048913 Ga0496110_0344006 Ga0496110_0344006_17_637 206
9 3300049758 Ga0501241_041002 Ga0501241_041002_259_879 206
10 3300044658 Ga0466972_0053110 Ga0466972_0053110_1177_1800 207
11 3300049824 Ga0501045_0024363 Ga0501045_0024363_2258_2935 207
12 3300047673 Ga0495593_0350058 Ga0495593_0350058_22_663 210
13 3300049588 Ga0501072_0073646 Ga0501072_0073646_702_1397 211
14 3300049568 Ga0501031_0031333 Ga0501031_0031333_1465_2160 212
15 3300049576 Ga0501040_0007927 Ga0501040_0007927_5092_5787 212
16 3300049578 Ga0501042_0007298 Ga0501042_0007298_6440_7135 212
17 3300049582 Ga0501048_0018030 Ga0501048_0018030_3197_3892 212
18 3300049585 Ga0501069_0139060 Ga0501069_0139060_322_1014 212
19 3300049587 Ga0501071_0029066 Ga0501071_0029066_1548_2243 212
20 3300006946 Ga0079104_1025959 Ga0079104_10259592 214
21 3300048916 Ga0496113_0776912 Ga0496113_0776912_10_654 214
22 3300026078 Ga0207702_11036978 Ga0207702_110369781 215
23 3300037853 Ga0436364_0904584 Ga0436364_0904584_565_1317 217
24 3300031733 Ga0316577_10001193 Ga0316577_100011932 218
25 3300036712 Ga0316584_0000847 Ga0316584_0000847_10653_11342 218
26 3300049578 Ga0501042_0142792 Ga0501042_0142792_237_914 218
27 3300050507 nmdc:mga05p37_1240121_c1 nmdc:mga05p37_1240121_c1_68_754 218
28 3300009094 Ga0111539_10006065 Ga0111539_100060658 219
29 3300009147 Ga0114129_10049777 Ga0114129_100497776 219
30 3300050507 nmdc:mga05p37_3013_c1 nmdc:mga05p37_3013_c1_4580_5242 219
31 3300050508 nmdc:mga09592_696_c1 nmdc:mga09592_696_c1_24188_24850 219
32 3300050509 nmdc:mga0qj67_92240_c1 nmdc:mga0qj67_92240_c1_1078_1740 219
33 3300050510 nmdc:mga06r32_68_c1 nmdc:mga06r32_68_c1_33678_34340 219
34 3300050511 nmdc:mga08y16_15375_c1 nmdc:mga08y16_15375_c1_6448_7110 219
35 3300050515 nmdc:mga0a205_405844_c1 nmdc:mga0a205_405844_c1_527_1189 219
36 iso_pu_bacteria 2884994152 2884998076 219
37 3300009036 Ga0105244_10054617 Ga0105244_100546172 220
38 3300009094 Ga0111539_10002620 Ga0111539_1000262016 220
39 3300009094 Ga0111539_10326003 Ga0111539_103260032 220
40 3300009098 Ga0105245_10010908 Ga0105245_100109088 220
41 3300009148 Ga0105243_10289216 Ga0105243_102892162 220
42 3300011119 Ga0105246_10014621 Ga0105246_100146216 220
43 3300011119 Ga0105246_10275027 Ga0105246_102750272 220
44 3300011119 Ga0105246_10376920 Ga0105246_103769202 220
45 3300031548 Ga0307408_100082793 Ga0307408_1000827932 220
46 3300031901 Ga0307406_10061735 Ga0307406_100617353 220
47 3300031903 Ga0307407_10031516 Ga0307407_100315163 220
48 3300031903 Ga0307407_10067880 Ga0307407_100678802 220
49 3300031911 Ga0307412_10077265 Ga0307412_100772652 220
50 3300031995 Ga0307409_100103244 Ga0307409_1001032442 220
51 3300032004 Ga0307414_10122504 Ga0307414_101225042 220
52 3300036712 Ga0316584_0033361 Ga0316584_0033361_1062_1742 220
53 3300037312 Ga0395899_0034316 Ga0395899_0034316_964_1626 220
54 3300037418 Ga0395900_0171516 Ga0395900_0171516_406_1068 220
55 3300037466 Ga0395898_0100013 Ga0395898_0100013_1871_2533 220
56 3300042012 Ga0439455_0082070 Ga0439455_0082070_121_783 220
57 3300042122 Ga0450920_035051 Ga0450920_035051_131_793 220
58 3300046476 Ga0495662_0195226 Ga0495662_0195226_99_803 220
59 3300046615 Ga0495656_0081037 Ga0495656_0081037_760_1422 220
60 3300046690 Ga0495624_0204996 Ga0495624_0204996_142_846 220
61 3300049541 Ga0501325_018220 Ga0501325_018220_42_704 220
62 3300049579 Ga0501043_0039319 Ga0501043_0039319_1244_1906 220
63 3300049823 Ga0501044_0190588 Ga0501044_0190588_910_1572 220
64 3300050496 nmdc:mga07m45_190415_c1 nmdc:mga07m45_190415_c1_243_911 220
65 iso_pu_bacteria 2585428094 2587864048 220
66 iso_pu_bacteria 2643221681 2644458207 220
67 iso_pu_bacteria 2643221697 2644536549 220
68 iso_pu_bacteria 2643221961 2645722307 220
69 iso_pu_bacteria 2643221962 2645725185 220
70 3300005563 Ga0068855_100076070 Ga0068855_1000760705 221
71 3300006178 Ga0075367_10395443 Ga0075367_103954431 221
72 3300009148 Ga0105243_10000176 Ga0105243_1000017675 221
73 3300013297 Ga0157378_10071359 Ga0157378_100713593 221
74 3300013308 Ga0157375_10610661 Ga0157375_106106612 221
75 3300025935 Ga0207709_10007669 Ga0207709_100076695 221
76 3300025949 Ga0207667_10154941 Ga0207667_101549412 221
77 3300044765 Ga0466970_0232694 Ga0466970_0232694_64_780 221
78 3300044842 Ga0466957_0083176 Ga0466957_0083176_1154_1870 221
79 3300045836 Ga0466958_0157407 Ga0466958_0157407_11_727 221
80 3300045976 Ga0466967_0037223 Ga0466967_0037223_824_1507 221
81 3300046679 Ga0495623_0003088 Ga0495623_0003088_5624_6304 221
82 3300047317 Ga0495604_0013452 Ga0495604_0013452_2451_3131 221
83 3300047444 Ga0495675_0002410 Ga0495675_0002410_2226_2906 221
84 3300048905 Ga0496102_0000409 Ga0496102_0000409_33796_34461 221
85 3300048905 Ga0496102_0020076 Ga0496102_0020076_2091_2783 221
86 3300048907 Ga0496104_0038836 Ga0496104_0038836_423_1115 221
87 3300048908 Ga0496105_0206186 Ga0496105_0206186_447_1139 221
88 3300048910 Ga0496107_0031450 Ga0496107_0031450_2677_3369 221
89 3300048913 Ga0496110_0072149 Ga0496110_0072149_59_751 221
90 3300048913 Ga0496110_0578378 Ga0496110_0578378_90_788 221
91 3300048914 Ga0496111_0014992 Ga0496111_0014992_4126_4818 221
92 3300048917 Ga0496114_0362502 Ga0496114_0362502_439_1137 221
93 3300049568 Ga0501031_0245734 Ga0501031_0245734_422_1102 221
94 3300049576 Ga0501040_0089001 Ga0501040_0089001_210_878 221
95 3300049582 Ga0501048_0236764 Ga0501048_0236764_379_1059 221
96 3300049584 Ga0501068_0161555 Ga0501068_0161555_293_973 221
97 3300049586 Ga0501070_0017692 Ga0501070_0017692_1006_1674 221
98 3300049588 Ga0501072_0165466 Ga0501072_0165466_985_1665 221
99 3300049590 Ga0501074_0267461 Ga0501074_0267461_44_724 221
100 3300049591 Ga0501075_0155387 Ga0501075_0155387_539_1219 221
101 3300049592 Ga0501076_0138076 Ga0501076_0138076_1064_1744 221
102 3300049743 Ga0501081_0139381 Ga0501081_0139381_27_707 221
103 3300049824 Ga0501045_0212637 Ga0501045_0212637_166_846 221
104 3300050510 nmdc:mga06r32_31164_c1 nmdc:mga06r32_31164_c1_558_1226 221
105 3300050511 nmdc:mga08y16_48424_c1 nmdc:mga08y16_48424_c1_3461_4141 221
106 3300054114 Ga0501084_0019165 Ga0501084_0019165_3420_4100 221
107 3300061719 Ga0466962_0191996 Ga0466962_0191996_253_969 221
108 3300061734 Ga0530510_0072845 Ga0530510_0072845_22_702 221
109 iso_pu_bacteria 2585428157 2588109277 221
110 iso_pu_bacteria 2643221542 2643732393 221
111 iso_pu_bacteria 2643221553 2643786500 221
112 iso_pu_bacteria 2643221566 2643849016 221
113 iso_pu_bacteria 2643221575 2643886314 221
114 iso_pu_bacteria 2643221597 2643995192 221
115 iso_pu_bacteria 2643221613 2644080863 221
116 iso_pu_bacteria 2643221630 2644171213 221
117 iso_pu_bacteria 2643221721 2644663820 221
118 iso_pu_bacteria 2643221724 2644681200 221
119 iso_pu_bacteria 2728369380 2730230367 221
120 iso_pu_bacteria 2747842429 2747953750 221
121 iso_pu_bacteria 2757320536 2758226767 221
122 iso_pu_bacteria 2773857758 2774380811 221
123 iso_pu_bacteria 2773857759 2774383320 221
124 iso_pu_bacteria 2808606306 2808630479 221
125 iso_pu_bacteria 2808606368 2808883393 221
126 iso_pu_bacteria 2808606447 2809228042 221
127 iso_pu_bacteria 2811994872 2812324069 221
128 iso_pu_bacteria 2816332119 2816423285 221
129 iso_pu_bacteria 2821268502 2821270792 221
130 iso_pu_bacteria 2852632344 2852634751 221
131 iso_pu_bacteria 2852646457 2852648974 221
132 iso_pu_bacteria 2852663356 2852664269 221
133 iso_pu_bacteria 2857720070 2857720677 221
134 iso_pu_bacteria 2857723135 2857724807 221
135 iso_pu_bacteria 2904509784 2904511304 221
136 iso_pu_bacteria 2906799679 2906801025 221
137 iso_pu_bacteria 2908678064 2908679976 221
138 iso_pu_bacteria 2919069694 2919072154 221
139 iso_pu_bacteria 2919395869 2919398056 221
140 iso_pu_bacteria 2928090899 2928091453 221
141 iso_pu_bacteria 2935890801 2935892359 221
142 iso_pu_bacteria 2945968032 2945968590 221
143 iso_pu_bacteria 2946033335 2946036753 221
144 iso_pu_bacteria 2946041624 2946045033 221
145 iso_pu_bacteria 2946080515 2946084216 221
146 iso_pu_bacteria 2974294766 2974296674 221
147 iso_pu_bacteria 2974324384 2974327092 221
148 iso_pu_bacteria 2977228692 2977228755 221
149 iso_pu_bacteria 2977236895 2977237584 221
150 iso_pu_bacteria 2977251589 2977253504 221
151 iso_pu_bacteria 2977264416 2977267446 221
152 iso_pu_bacteria 2984542743 2984544632 221
153 iso_pu_bacteria 2984580707 2984581799 221
154 iso_pu_bacteria 8004182704 8004184685 221
155 iso_pu_bacteria 8004212874 8004214779 221
156 iso_pu_bacteria 8016254467 8016256885 221
157 3300005328 Ga0070676_10471740 Ga0070676_104717401 222
158 3300005356 Ga0070674_100255639 Ga0070674_1002556392 222
159 3300005435 Ga0070714_100036644 Ga0070714_1000366443 222
160 3300005456 Ga0070678_100432803 Ga0070678_1004328032 222
161 3300005466 Ga0070685_10177742 Ga0070685_101777422 222
162 3300009098 Ga0105245_10407508 Ga0105245_104075082 222
163 3300009177 Ga0105248_10077488 Ga0105248_100774883 222
164 3300013102 Ga0157371_10004373 Ga0157371_100043733 222
165 3300013102 Ga0157371_10602123 Ga0157371_106021231 222
166 3300013308 Ga0157375_10642977 Ga0157375_106429771 222
167 3300017792 Ga0163161_10218275 Ga0163161_102182751 222
168 3300025907 Ga0207645_10248874 Ga0207645_102488742 222
169 3300025918 Ga0207662_10388223 Ga0207662_103882231 222
170 3300025923 Ga0207681_10277216 Ga0207681_102772162 222
171 3300025929 Ga0207664_10131491 Ga0207664_101314912 222
172 3300025972 Ga0207668_10257001 Ga0207668_102570012 222
173 3300025972 Ga0207668_10327880 Ga0207668_103278802 222
174 3300026075 Ga0207708_10619886 Ga0207708_106198862 222
175 3300031665 Ga0316575_10135447 Ga0316575_101354471 222
176 3300031727 Ga0316576_10039175 Ga0316576_100391753 222
177 3300031727 Ga0316576_10042580 Ga0316576_100425801 222
178 3300031727 Ga0316576_10658407 Ga0316576_106584071 222
179 3300031728 Ga0316578_10027267 Ga0316578_100272673 222
180 3300032139 Ga0316580_10038595 Ga0316580_100385951 222
181 3300035398 Ga0316574_0068274 Ga0316574_0068274_1214_1945 222
182 3300036647 Ga0316582_0008698 Ga0316582_0008698_3269_3967 222
183 3300036712 Ga0316584_0022023 Ga0316584_0022023_965_1663 222
184 3300037312 Ga0395899_0097548 Ga0395899_0097548_784_1452 222
185 3300037418 Ga0395900_0102477 Ga0395900_0102477_973_1641 222
186 3300037466 Ga0395898_0067095 Ga0395898_0067095_657_1325 222
187 3300037471 Ga0395905_0374719 Ga0395905_0374719_146_856 222
188 3300038443 Ga0395901_0217933 Ga0395901_0217933_355_1023 222
189 3300038443 Ga0395901_0410108 Ga0395901_0410108_438_1106 222
190 3300041404 Ga0439436_0009152 Ga0439436_0009152_2162_2830 222
191 3300041404 Ga0439436_0032794 Ga0439436_0032794_492_1160 222
192 3300041404 Ga0439436_0040913 Ga0439436_0040913_621_1289 222
193 3300041505 Ga0451849_0630459 Ga0451849_0630459_72_767 222
194 3300041999 Ga0439433_0006192 Ga0439433_0006192_924_1592 222
195 3300042002 Ga0439442_000041 Ga0439442_000041_17950_18618 222
196 3300042002 Ga0439442_000092 Ga0439442_000092_18748_19416 222
197 3300042006 Ga0439432_043949 Ga0439432_043949_230_898 222
198 3300042007 Ga0439449_0054707 Ga0439449_0054707_159_827 222
199 3300042007 Ga0439449_0057454 Ga0439449_0057454_231_899 222
200 3300042010 Ga0439452_060932 Ga0439452_060932_122_790 222
201 3300042016 Ga0439463_000856 Ga0439463_000856_4759_5427 222
202 3300042115 Ga0450911_013148 Ga0450911_013148_58_726 222
203 3300042122 Ga0450920_001402 Ga0450920_001402_231_899 222
204 3300042122 Ga0450920_002860 Ga0450920_002860_2197_2865 222
205 3300042146 Ga0450907_002147 Ga0450907_002147_996_1664 222
206 3300042146 Ga0450907_039985 Ga0450907_039985_107_775 222
207 3300042435 Ga0439434_0000105 Ga0439434_0000105_2243_2911 222
208 3300042531 Ga0450918_001804 Ga0450918_001804_2199_2867 222
209 3300044694 Ga0466963_0074466 Ga0466963_0074466_1120_1842 222
210 3300044901 Ga0466960_0108573 Ga0466960_0108573_697_1413 222
211 3300045976 Ga0466967_0070810 Ga0466967_0070810_1802_2524 222
212 3300046453 Ga0495627_113319 Ga0495627_113319_31_699 222
213 3300046473 Ga0495582_0131649 Ga0495582_0131649_95_805 222
214 3300046492 Ga0495585_0077010 Ga0495585_0077010_908_1576 222
215 3300046517 Ga0495630_0702721 Ga0495630_0702721_57_761 222
216 3300048908 Ga0496105_0283527 Ga0496105_0283527_554_1255 222
217 3300048911 Ga0496108_0099096 Ga0496108_0099096_117_785 222
218 3300048915 Ga0496112_0016783 Ga0496112_0016783_647_1315 222
219 3300049569 Ga0501032_0041344 Ga0501032_0041344_246_914 222
220 3300049571 Ga0501034_0001978 Ga0501034_0001978_2213_2881 222
221 3300049573 Ga0501037_0010367 Ga0501037_0010367_2240_2908 222
222 3300049575 Ga0501039_0469047 Ga0501039_0469047_181_849 222
223 3300049578 Ga0501042_0144136 Ga0501042_0144136_769_1491 222
224 3300049582 Ga0501048_0587869 Ga0501048_0587869_66_788 222
225 3300049586 Ga0501070_0295999 Ga0501070_0295999_122_790 222
226 3300049587 Ga0501071_0272130 Ga0501071_0272130_172_894 222
227 3300049591 Ga0501075_0107859 Ga0501075_0107859_278_973 222
228 3300050496 nmdc:mga07m45_262677_c1 nmdc:mga07m45_262677_c1_107_814 222
229 3300050507 nmdc:mga05p37_17788_c1 nmdc:mga05p37_17788_c1_1310_1978 222
230 3300050508 nmdc:mga09592_4313_c1 nmdc:mga09592_4313_c1_7765_8433 222
231 3300050509 nmdc:mga0qj67_140136_c1 nmdc:mga0qj67_140136_c1_442_1110 222
232 3300050510 nmdc:mga06r32_2648_c1 nmdc:mga06r32_2648_c1_339_1007 222
233 3300053083 Ga0495655_0116602 Ga0495655_0116602_117_785 222
234 iso_pu_bacteria 2508501039 2508670769 222
235 iso_pu_bacteria 2517572101 2517762430 222
236 iso_pu_bacteria 2643221601 2644014772 222
237 iso_pu_bacteria 2643221631 2644176207 222
238 iso_pu_bacteria 2675902999 2676201211 222
239 iso_pu_bacteria 2687453737 2689960564 222
240 iso_pu_bacteria 2690315906 2691512708 222
241 iso_pu_bacteria 2738543005 2739202588 222
242 iso_pu_bacteria 2738543011 2739235893 222
243 iso_pu_bacteria 2773857921 2774845787 222
244 iso_pu_bacteria 2775506735 2775658642 222
245 iso_pu_bacteria 2808606357 2808829979 222
246 iso_pu_bacteria 2808606360 2808851154 222
247 iso_pu_bacteria 2808606366 2808876319 222
248 iso_pu_bacteria 2808606370 2808894241 222
249 iso_pu_bacteria 2808606371 2808897857 222
250 iso_pu_bacteria 2811994871 2812318246 222
251 iso_pu_bacteria 2818991472 2819742010 222
252 iso_pu_bacteria 2844849076 2844851637 222
253 iso_pu_bacteria 2857740372 2857741627 222
254 iso_pu_bacteria 2861520306 2861527211 222
255 iso_pu_bacteria 2889300758 2889305490 222
256 iso_pu_bacteria 2904497146 2904497911 222
257 iso_pu_bacteria 2904765812 2904767613 222
258 iso_pu_bacteria 2904770941 2904774962 222
259 iso_pu_bacteria 2904776348 2904778931 222
260 iso_pu_bacteria 2908811453 2908813256 222
261 iso_pu_bacteria 2910809715 2910811586 222
262 iso_pu_bacteria 2919034639 2919037970 222
263 iso_pu_bacteria 2919059106 2919063144 222
264 iso_pu_bacteria 2919391150 2919391642 222
265 iso_pu_bacteria 2919420072 2919424597 222
266 iso_pu_bacteria 2919432681 2919437022 222
267 iso_pu_bacteria 2919538618 2919539394 222
268 iso_pu_bacteria 2920879853 2920883043 222
269 iso_pu_bacteria 2928142448 2928143190 222
270 iso_pu_bacteria 2932426870 2932430376 222
271 iso_pu_bacteria 2933418574 2933420088 222
272 iso_pu_bacteria 2939598168 2939600624 222
273 iso_pu_bacteria 2939647034 2939647048 222
274 iso_pu_bacteria 2939674588 2939678727 222
275 iso_pu_bacteria 2939743619 2939743626 222
276 iso_pu_bacteria 2945916053 2945916069 222
277 iso_pu_bacteria 2945920336 2945923800 222
278 iso_pu_bacteria 2945941187 2945944550 222
279 iso_pu_bacteria 2945956166 2945957259 222
280 iso_pu_bacteria 2946024296 2946024697 222
281 iso_pu_bacteria 2946037020 2946040459 222
282 iso_pu_bacteria 2946059875 2946059890 222
283 iso_pu_bacteria 2953998280 2954001721 222
284 iso_pu_bacteria 2974302888 2974303897 222
285 iso_pu_bacteria 8002775197 8002781540 222
286 iso_pu_bacteria 8002784119 8002791806 222
287 iso_pu_bacteria 8004021418 8004022236 222
288 iso_pu_bacteria 8054107350 8054110152 222
289 iso_pu_bacteria 8056054917 8056058919 222
290 iso_pu_bacteria 8057568493 8057570583 222
291 3300005339 Ga0070660_100279889 Ga0070660_1002798892 223
292 3300005347 Ga0070668_100032937 Ga0070668_1000329372 223
293 3300005355 Ga0070671_100430718 Ga0070671_1004307182 223
294 3300005457 Ga0070662_100677724 Ga0070662_1006777241 223
295 3300005458 Ga0070681_10516370 Ga0070681_105163702 223
296 3300005467 Ga0070706_100030434 Ga0070706_1000304342 223
297 3300005518 Ga0070699_100107135 Ga0070699_1001071352 223
298 3300005546 Ga0070696_100408980 Ga0070696_1004089801 223
299 3300005548 Ga0070665_100333720 Ga0070665_1003337202 223
300 3300005563 Ga0068855_100938921 Ga0068855_1009389211 223
301 3300005618 Ga0068864_100264755 Ga0068864_1002647551 223
302 3300005719 Ga0068861_100016016 Ga0068861_1000160162 223
303 3300005842 Ga0068858_100022526 Ga0068858_1000225262 223
304 3300005842 Ga0068858_100536765 Ga0068858_1005367651 223
305 3300005842 Ga0068858_100785739 Ga0068858_1007857392 223
306 3300005844 Ga0068862_100015289 Ga0068862_1000152893 223
307 3300009098 Ga0105245_10218682 Ga0105245_102186822 223
308 3300009177 Ga0105248_10549063 Ga0105248_105490631 223
309 3300009545 Ga0105237_10480338 Ga0105237_104803382 223
310 3300009551 Ga0105238_10316780 Ga0105238_103167802 223
311 3300009553 Ga0105249_10347972 Ga0105249_103479721 223
312 3300013105 Ga0157369_10739971 Ga0157369_107399712 223
313 3300013306 Ga0163162_10576101 Ga0163162_105761012 223
314 3300014325 Ga0163163_10060845 Ga0163163_100608453 223
315 3300014326 Ga0157380_11146492 Ga0157380_111464921 223
316 3300025910 Ga0207684_10251032 Ga0207684_102510321 223
317 3300025914 Ga0207671_10499369 Ga0207671_104993692 223
318 3300025927 Ga0207687_10139392 Ga0207687_101393922 223
319 3300025928 Ga0207700_10481039 Ga0207700_104810391 223
320 3300025929 Ga0207664_10114977 Ga0207664_101149773 223
321 3300025972 Ga0207668_10011633 Ga0207668_100116334 223
322 3300026035 Ga0207703_10017348 Ga0207703_100173482 223
323 3300026118 Ga0207675_100034422 Ga0207675_1000344224 223
324 3300028379 Ga0268266_10608333 Ga0268266_106083331 223
325 3300028380 Ga0268265_10083029 Ga0268265_100830292 223
326 3300031727 Ga0316576_10018067 Ga0316576_100180675 223
327 3300031728 Ga0316578_10001817 Ga0316578_100018173 223
328 3300031728 Ga0316578_10017371 Ga0316578_100173714 223
329 3300031733 Ga0316577_10089786 Ga0316577_100897862 223
330 3300031995 Ga0307409_100228769 Ga0307409_1002287692 223
331 3300035118 Ga0373954_0015029 Ga0373954_0015029_2723_3430 223
332 3300035398 Ga0316574_0066433 Ga0316574_0066433_308_1009 223
333 3300035398 Ga0316574_0071537 Ga0316574_0071537_82_792 223
334 3300035398 Ga0316574_0185521 Ga0316574_0185521_373_1098 223
335 3300035398 Ga0316574_0213299 Ga0316574_0213299_505_1206 223
336 3300039438 Ga0436360_0616885 Ga0436360_0616885_384_1151 223
337 3300042435 Ga0439434_0082557 Ga0439434_0082557_147_869 223
338 3300042876 Ga0451577_0200228 Ga0451577_0200228_446_1153 223
339 3300044656 Ga0466969_0154921 Ga0466969_0154921_275_949 223
340 3300044684 Ga0466966_0037839 Ga0466966_0037839_1929_2603 223
341 3300044684 Ga0466966_0134746 Ga0466966_0134746_634_1314 223
342 3300044693 Ga0466961_0003745 Ga0466961_0003745_5319_5993 223
343 3300044712 Ga0453684_0007886 Ga0453684_0007886_1371_2078 223
344 3300044719 Ga0466971_0003970 Ga0466971_0003970_5292_5966 223
345 3300044901 Ga0466960_0092556 Ga0466960_0092556_226_897 223
346 3300045049 Ga0466959_0002194 Ga0466959_0002194_6007_6681 223
347 3300045836 Ga0466958_0002735 Ga0466958_0002735_7565_8239 223
348 3300045976 Ga0466967_0012908 Ga0466967_0012908_253_927 223
349 3300045976 Ga0466967_0077298 Ga0466967_0077298_1245_1919 223
350 3300046454 Ga0495592_0053377 Ga0495592_0053377_1464_2138 223
351 3300046459 Ga0495629_0082065 Ga0495629_0082065_1111_1833 223
352 3300046462 Ga0495651_0000144 Ga0495651_0000144_6118_6792 223
353 3300046463 Ga0495653_0172074 Ga0495653_0172074_763_1470 223
354 3300046517 Ga0495630_0136078 Ga0495630_0136078_688_1401 223
355 3300046517 Ga0495630_0189513 Ga0495630_0189513_184_903 223
356 3300046517 Ga0495630_0214763 Ga0495630_0214763_693_1409 223
357 3300046529 Ga0495652_0001024 Ga0495652_0001024_18065_18739 223
358 3300046539 Ga0495621_0003457 Ga0495621_0003457_3261_3974 223
359 3300046543 Ga0495645_0142870 Ga0495645_0142870_367_1041 223
360 3300046642 Ga0495634_0007971 Ga0495634_0007971_5011_5724 223
361 3300046642 Ga0495634_0077211 Ga0495634_0077211_181_891 223
362 3300046642 Ga0495634_0120662 Ga0495634_0120662_587_1306 223
363 3300046663 Ga0495635_0008605 Ga0495635_0008605_3791_4465 223
364 3300046663 Ga0495635_0168902 Ga0495635_0168902_619_1332 223
365 3300046680 Ga0495646_0014680 Ga0495646_0014680_3632_4306 223
366 3300046689 Ga0495613_0000722 Ga0495613_0000722_12898_13611 223
367 3300046689 Ga0495613_0006422 Ga0495613_0006422_4676_5395 223
368 3300046689 Ga0495613_0411075 Ga0495613_0411075_177_899 223
369 3300046691 Ga0495670_0114282 Ga0495670_0114282_652_1362 223
370 3300047321 Ga0495676_0169836 Ga0495676_0169836_436_1137 223
371 3300047321 Ga0495676_0272059 Ga0495676_0272059_151_873 223
372 3300048907 Ga0496104_0024448 Ga0496104_0024448_3829_4539 223
373 3300048907 Ga0496104_0113004 Ga0496104_0113004_1681_2355 223
374 3300048908 Ga0496105_0166024 Ga0496105_0166024_727_1437 223
375 3300048911 Ga0496108_0004730 Ga0496108_0004730_900_1574 223
376 3300048911 Ga0496108_0257422 Ga0496108_0257422_262_972 223
377 3300048912 Ga0496109_0006659 Ga0496109_0006659_2010_2684 223
378 3300048912 Ga0496109_0017905 Ga0496109_0017905_3693_4403 223
379 3300048913 Ga0496110_0012109 Ga0496110_0012109_174_884 223
380 3300048913 Ga0496110_0044227 Ga0496110_0044227_2039_2713 223
381 3300048914 Ga0496111_0003289 Ga0496111_0003289_4137_4841 223
382 3300048914 Ga0496111_0007706 Ga0496111_0007706_3778_4452 223
383 3300048914 Ga0496111_0008464 Ga0496111_0008464_4636_5346 223
384 3300048914 Ga0496111_0335877 Ga0496111_0335877_276_980 223
385 3300048915 Ga0496112_0182486 Ga0496112_0182486_223_897 223
386 3300048916 Ga0496113_0175270 Ga0496113_0175270_674_1348 223
387 3300048917 Ga0496114_0002831 Ga0496114_0002831_1778_2488 223
388 3300048917 Ga0496114_0273060 Ga0496114_0273060_491_1195 223
389 3300048917 Ga0496114_0384377 Ga0496114_0384377_55_747 223
390 3300048918 Ga0496115_0157824 Ga0496115_0157824_907_1620 223
391 3300048929 Ga0496126_0508450 Ga0496126_0508450_119_793 223
392 3300049568 Ga0501031_0028624 Ga0501031_0028624_2886_3581 223
393 3300049568 Ga0501031_0230558 Ga0501031_0230558_241_945 223
394 3300049569 Ga0501032_0013580 Ga0501032_0013580_3433_4143 223
395 3300049569 Ga0501032_0293700 Ga0501032_0293700_242_946 223
396 3300049571 Ga0501034_0028948 Ga0501034_0028948_1405_2106 223
397 3300049571 Ga0501034_0033627 Ga0501034_0033627_2777_3490 223
398 3300049571 Ga0501034_0035142 Ga0501034_0035142_2366_3076 223
399 3300049572 Ga0501036_0076423 Ga0501036_0076423_505_1200 223
400 3300049572 Ga0501036_0155034 Ga0501036_0155034_660_1364 223
401 3300049573 Ga0501037_0008494 Ga0501037_0008494_1523_2233 223
402 3300049574 Ga0501038_0062786 Ga0501038_0062786_128_823 223
403 3300049575 Ga0501039_0073701 Ga0501039_0073701_316_1011 223
404 3300049575 Ga0501039_0142152 Ga0501039_0142152_368_1072 223
405 3300049575 Ga0501039_0587717 Ga0501039_0587717_99_809 223
406 3300049576 Ga0501040_0066617 Ga0501040_0066617_829_1524 223
407 3300049576 Ga0501040_0074570 Ga0501040_0074570_914_1618 223
408 3300049577 Ga0501041_0252573 Ga0501041_0252573_284_988 223
409 3300049578 Ga0501042_0013414 Ga0501042_0013414_2320_3015 223
410 3300049581 Ga0501047_0339217 Ga0501047_0339217_181_897 223
411 3300049581 Ga0501047_0409775 Ga0501047_0409775_289_999 223
412 3300049582 Ga0501048_0015721 Ga0501048_0015721_3882_4577 223
413 3300049586 Ga0501070_0063716 Ga0501070_0063716_1102_1812 223
414 3300049587 Ga0501071_0055451 Ga0501071_0055451_1136_1831 223
415 3300049587 Ga0501071_0075789 Ga0501071_0075789_1179_1883 223
416 3300049591 Ga0501075_0077325 Ga0501075_0077325_81_776 223
417 3300049591 Ga0501075_0088728 Ga0501075_0088728_1253_1957 223
418 3300049592 Ga0501076_0211311 Ga0501076_0211311_617_1312 223
419 3300049592 Ga0501076_0327632 Ga0501076_0327632_261_965 223
420 3300049592 Ga0501076_0397259 Ga0501076_0397259_240_944 223
421 3300049593 Ga0501077_0051452 Ga0501077_0051452_428_1132 223
422 3300049741 Ga0501079_0136224 Ga0501079_0136224_883_1587 223
423 3300049741 Ga0501079_0267828 Ga0501079_0267828_596_1291 223
424 3300049742 Ga0501080_0329809 Ga0501080_0329809_385_1095 223
425 3300049743 Ga0501081_0026196 Ga0501081_0026196_2144_2839 223
426 3300049743 Ga0501081_0096238 Ga0501081_0096238_742_1446 223
427 3300049823 Ga0501044_0010622 Ga0501044_0010622_4005_4715 223
428 3300049824 Ga0501045_0065646 Ga0501045_0065646_848_1552 223
429 3300050492 nmdc:mga0yw44_362949_c1 nmdc:mga0yw44_362949_c1_108_812 223
430 3300053077 Ga0495601_0070849 Ga0495601_0070849_879_1553 223
431 3300053077 Ga0495601_0323608 Ga0495601_0323608_113_820 223
432 3300053080 Ga0500635_0002811 Ga0500635_0002811_1603_2319 223
433 3300053085 Ga0495619_0013120 Ga0495619_0013120_901_1575 223
434 3300053092 Ga0500583_0033239 Ga0500583_0033239_578_1294 223
435 3300053094 Ga0500566_0095162 Ga0500566_0095162_787_1506 223
436 3300054114 Ga0501084_0057681 Ga0501084_0057681_1575_2270 223
437 3300054114 Ga0501084_0384801 Ga0501084_0384801_377_1081 223
438 3300060353 Ga0501082_0037842 Ga0501082_0037842_2625_3329 223
439 3300060353 Ga0501082_0078687 Ga0501082_0078687_1292_1990 223
440 3300061719 Ga0466962_0002524 Ga0466962_0002524_4540_5214 223
441 3300061734 Ga0530510_0241260 Ga0530510_0241260_594_1289 223
442 3300003373 JGI25407J50210_10000232 JGI25407J50210_100002321 224
443 3300003373 JGI25407J50210_10002720 JGI25407J50210_100027203 224
444 3300003373 JGI25407J50210_10048409 JGI25407J50210_100484092 224
445 3300005355 Ga0070671_100002578 Ga0070671_10000257812 224
446 3300005441 Ga0070700_100012269 Ga0070700_1000122692 224
447 3300005445 Ga0070708_100004013 Ga0070708_1000040132 224
448 3300005445 Ga0070708_100289211 Ga0070708_1002892112 224
449 3300005466 Ga0070685_10264021 Ga0070685_102640212 224
450 3300005536 Ga0070697_100111733 Ga0070697_1001117332 224
451 3300005544 Ga0070686_100036595 Ga0070686_1000365953 224
452 3300005548 Ga0070665_100560550 Ga0070665_1005605501 224
453 3300005617 Ga0068859_100322940 Ga0068859_1003229402 224
454 3300005718 Ga0068866_10004378 Ga0068866_100043782 224
455 3300005842 Ga0068858_100182102 Ga0068858_1001821022 224
456 3300005844 Ga0068862_100103977 Ga0068862_1001039772 224
457 3300005937 Ga0081455_10000125 Ga0081455_1000012584 224
458 3300005937 Ga0081455_10003571 Ga0081455_100035718 224
459 3300005937 Ga0081455_10006788 Ga0081455_100067886 224
460 3300005937 Ga0081455_10011764 Ga0081455_100117648 224
461 3300005937 Ga0081455_10053078 Ga0081455_100530782 224
462 3300005937 Ga0081455_10077662 Ga0081455_100776622 224
463 3300005937 Ga0081455_10220360 Ga0081455_102203601 224
464 3300005937 Ga0081455_10460196 Ga0081455_104601962 224
465 3300005981 Ga0081538_10000111 Ga0081538_1000011150 224
466 3300005981 Ga0081538_10001492 Ga0081538_1000149218 224
467 3300005981 Ga0081538_10029435 Ga0081538_100294355 224
468 3300005981 Ga0081538_10038265 Ga0081538_100382652 224
469 3300005981 Ga0081538_10044426 Ga0081538_100444262 224
470 3300005981 Ga0081538_10158769 Ga0081538_101587691 224
471 3300006038 Ga0075365_10034553 Ga0075365_100345532 224
472 3300006038 Ga0075365_10135116 Ga0075365_101351162 224
473 3300006048 Ga0075363_100247996 Ga0075363_1002479962 224
474 3300006051 Ga0075364_10001141 Ga0075364_100011414 224
475 3300006051 Ga0075364_10029219 Ga0075364_100292193 224
476 3300006051 Ga0075364_10056054 Ga0075364_100560542 224
477 3300006051 Ga0075364_10264657 Ga0075364_102646572 224
478 3300006051 Ga0075364_10332543 Ga0075364_103325431 224
479 3300006177 Ga0075362_10257584 Ga0075362_102575841 224
480 3300006178 Ga0075367_10401956 Ga0075367_104019561 224
481 3300006353 Ga0075370_10171912 Ga0075370_101719122 224
482 3300006353 Ga0075370_10234514 Ga0075370_102345142 224
483 3300006358 Ga0068871_100627063 Ga0068871_1006270632 224
484 3300006844 Ga0075428_100000001 Ga0075428_100000001444 224
485 3300006844 Ga0075428_100002044 Ga0075428_10000204421 224
486 3300006844 Ga0075428_100003635 Ga0075428_10000363511 224
487 3300006844 Ga0075428_100282677 Ga0075428_1002826771 224
488 3300006844 Ga0075428_100584777 Ga0075428_1005847771 224
489 3300006844 Ga0075428_100652309 Ga0075428_1006523092 224
490 3300006846 Ga0075430_100000532 Ga0075430_10000053213 224
491 3300006846 Ga0075430_100003977 Ga0075430_10000397710 224
492 3300006846 Ga0075430_100059879 Ga0075430_1000598793 224
493 3300006846 Ga0075430_100162913 Ga0075430_1001629132 224
494 3300006847 Ga0075431_100002775 Ga0075431_10000277514 224
495 3300006847 Ga0075431_100010147 Ga0075431_1000101471 224
496 3300006847 Ga0075431_100047215 Ga0075431_1000472153 224
497 3300006847 Ga0075431_100147034 Ga0075431_1001470343 224
498 3300006847 Ga0075431_100161051 Ga0075431_1001610512 224
499 3300006847 Ga0075431_100252173 Ga0075431_1002521732 224
500 3300006852 Ga0075433_10065126 Ga0075433_100651265 224
501 3300006880 Ga0075429_100000058 Ga0075429_10000005846 224
502 3300006880 Ga0075429_100000980 Ga0075429_1000009805 224
503 3300006880 Ga0075429_100019865 Ga0075429_1000198655 224
504 3300006881 Ga0068865_100430752 Ga0068865_1004307522 224
505 3300006931 Ga0097620_100322925 Ga0097620_1003229252 224
506 3300009094 Ga0111539_10006583 Ga0111539_1000658312 224
507 3300009094 Ga0111539_10056352 Ga0111539_100563522 224
508 3300009094 Ga0111539_10143499 Ga0111539_101434992 224
509 3300009098 Ga0105245_10100896 Ga0105245_101008964 224
510 3300009147 Ga0114129_10001738 Ga0114129_1000173821 224
511 3300009147 Ga0114129_10288951 Ga0114129_102889512 224
512 3300009147 Ga0114129_10572814 Ga0114129_105728142 224
513 3300009147 Ga0114129_11560164 Ga0114129_115601641 224
514 3300009148 Ga0105243_10667854 Ga0105243_106678542 224
515 3300009176 Ga0105242_10129345 Ga0105242_101293452 224
516 3300009177 Ga0105248_11296583 Ga0105248_112965831 224
517 3300009553 Ga0105249_10350798 Ga0105249_103507982 224
518 3300009553 Ga0105249_10637905 Ga0105249_106379052 224
519 3300011119 Ga0105246_10268642 Ga0105246_102686422 224
520 3300013105 Ga0157369_10510394 Ga0157369_105103942 224
521 3300013297 Ga0157378_10003477 Ga0157378_100034774 224
522 3300013297 Ga0157378_10651829 Ga0157378_106518292 224
523 3300013306 Ga0163162_10546167 Ga0163162_105461672 224
524 3300013308 Ga0157375_10031470 Ga0157375_100314706 224
525 3300014325 Ga0163163_10411460 Ga0163163_104114601 224
526 3300021384 Ga0213876_10001702 Ga0213876_1000170214 224
527 3300025899 Ga0207642_10002427 Ga0207642_100024272 224
528 3300025907 Ga0207645_10437888 Ga0207645_104378881 224
529 3300025918 Ga0207662_10002627 Ga0207662_100026277 224
530 3300025920 Ga0207649_10236817 Ga0207649_102368172 224
531 3300025931 Ga0207644_10128035 Ga0207644_101280352 224
532 3300025934 Ga0207686_10114522 Ga0207686_101145222 224
533 3300025935 Ga0207709_10070929 Ga0207709_100709292 224
534 3300025935 Ga0207709_10423157 Ga0207709_104231572 224
535 3300025937 Ga0207669_10079969 Ga0207669_100799693 224
536 3300026035 Ga0207703_10147644 Ga0207703_101476442 224
537 3300026089 Ga0207648_10071725 Ga0207648_100717252 224
538 3300026118 Ga0207675_100017497 Ga0207675_1000174978 224
539 3300026118 Ga0207675_100631516 Ga0207675_1006315162 224
540 3300027907 Ga0207428_10012747 Ga0207428_100127478 224
541 3300027907 Ga0207428_10014933 Ga0207428_100149334 224
542 3300028381 Ga0268264_10010062 Ga0268264_100100622 224
543 3300030745 Ga0316182_1190892 Ga0316182_11908926 224
544 3300031852 Ga0307410_10770515 Ga0307410_107705151 224
545 3300032002 Ga0307416_100156552 Ga0307416_1001565521 224
546 3300032126 Ga0307415_100262244 Ga0307415_1002622442 224
547 3300032126 Ga0307415_100351311 Ga0307415_1003513112 224
548 3300034817 Ga0373948_0000792 Ga0373948_0000792_270_992 224
549 3300035084 Ga0373928_0014153 Ga0373928_0014153_767_1486 224
550 3300035085 Ga0373929_0000920 Ga0373929_0000920_434_1153 224
551 3300035112 Ga0373932_0002142 Ga0373932_0002142_3514_4233 224
552 3300035112 Ga0373932_0010215 Ga0373932_0010215_1030_1752 224
553 3300035691 Ga0373931_0000003 Ga0373931_0000003_262415_263134 224
554 3300035691 Ga0373931_0000023 Ga0373931_0000023_105370_106092 224
555 3300036401 Ga0373937_0009492 Ga0373937_0009492_2431_3147 224
556 3300039437 Ga0436365_0205421 Ga0436365_0205421_250_984 224
557 3300039438 Ga0436360_0890333 Ga0436360_0890333_10_765 224
558 3300041413 Ga0439465_0028450 Ga0439465_0028450_76_756 224
559 3300041452 Ga0451793_0562410 Ga0451793_0562410_168_848 224
560 3300041491 Ga0451833_0343967 Ga0451833_0343967_10675_11355 224
561 3300041494 Ga0451837_0506656 Ga0451837_0506656_873_1553 224
562 3300042003 Ga0439443_021632 Ga0439443_021632_278_1000 224
563 3300042005 Ga0439448_0002025 Ga0439448_0002025_2691_3413 224
564 3300042006 Ga0439432_073650 Ga0439432_073650_161_841 224
565 3300042008 Ga0439450_010671 Ga0439450_010671_668_1390 224
566 3300042012 Ga0439455_0023611 Ga0439455_0023611_106_828 224
567 3300042439 Ga0439464_0004133 Ga0439464_0004133_2255_2977 224
568 3300042461 Ga0439460_0002312 Ga0439460_0002312_1071_1793 224
569 3300045976 Ga0466967_0166210 Ga0466967_0166210_383_1066 224
570 3300045976 Ga0466967_0486835 Ga0466967_0486835_155_868 224
571 3300046462 Ga0495651_0018602 Ga0495651_0018602_3060_3776 224
572 3300046463 Ga0495653_0087445 Ga0495653_0087445_1097_1813 224
573 3300046511 Ga0495608_0040482 Ga0495608_0040482_56_772 224
574 3300046536 Ga0495587_0043688 Ga0495587_0043688_486_1202 224
575 3300046543 Ga0495645_0117322 Ga0495645_0117322_1041_1757 224
576 3300046559 Ga0495667_0009607 Ga0495667_0009607_1721_2437 224
577 3300046615 Ga0495656_0250084 Ga0495656_0250084_50_763 224
578 3300046675 Ga0495657_0020156 Ga0495657_0020156_2901_3617 224
579 3300046684 Ga0495669_0008900 Ga0495669_0008900_1945_2637 224
580 3300046809 Ga0495600_0025653 Ga0495600_0025653_946_1662 224
581 3300047317 Ga0495604_0089688 Ga0495604_0089688_297_1013 224
582 3300047322 Ga0495680_0006450 Ga0495680_0006450_8747_9463 224
583 3300047444 Ga0495675_0047384 Ga0495675_0047384_785_1501 224
584 3300048908 Ga0496105_0486647 Ga0496105_0486647_10_726 224
585 3300048911 Ga0496108_0419190 Ga0496108_0419190_310_999 224
586 3300048912 Ga0496109_0044527 Ga0496109_0044527_2699_3412 224
587 3300048912 Ga0496109_0179702 Ga0496109_0179702_20_736 224
588 3300048913 Ga0496110_0040321 Ga0496110_0040321_136_849 224
589 3300048913 Ga0496110_0354476 Ga0496110_0354476_416_1120 224
590 3300048925 Ga0496122_0034906 Ga0496122_0034906_2205_2885 224
591 3300048926 Ga0496123_0008186 Ga0496123_0008186_8770_9450 224
592 3300048927 Ga0496124_0173640 Ga0496124_0173640_937_1617 224
593 3300049568 Ga0501031_0071271 Ga0501031_0071271_1069_1833 224
594 3300049569 Ga0501032_0192998 Ga0501032_0192998_187_897 224
595 3300049569 Ga0501032_0206226 Ga0501032_0206226_477_1157 224
596 3300049569 Ga0501032_0263957 Ga0501032_0263957_353_1084 224
597 3300049570 Ga0501033_0001458 Ga0501033_0001458_14394_15125 224
598 3300049570 Ga0501033_0033163 Ga0501033_0033163_1479_2201 224
599 3300049571 Ga0501034_0003536 Ga0501034_0003536_4344_5057 224
600 3300049571 Ga0501034_0020973 Ga0501034_0020973_2314_3030 224
601 3300049572 Ga0501036_0034200 Ga0501036_0034200_529_1239 224
602 3300049572 Ga0501036_0290499 Ga0501036_0290499_472_1203 224
603 3300049573 Ga0501037_0059238 Ga0501037_0059238_696_1409 224
604 3300049573 Ga0501037_0295095 Ga0501037_0295095_93_803 224
605 3300049573 Ga0501037_0605428 Ga0501037_0605428_42_722 224
606 3300049574 Ga0501038_0024723 Ga0501038_0024723_4220_4900 224
607 3300049574 Ga0501038_0089418 Ga0501038_0089418_1473_2195 224
608 3300049575 Ga0501039_0009364 Ga0501039_0009364_3386_4108 224
609 3300049575 Ga0501039_0058265 Ga0501039_0058265_341_1105 224
610 3300049576 Ga0501040_0017800 Ga0501040_0017800_3062_3772 224
611 3300049576 Ga0501040_0026852 Ga0501040_0026852_2084_2815 224
612 3300049576 Ga0501040_0030516 Ga0501040_0030516_1241_1963 224
613 3300049577 Ga0501041_0001442 Ga0501041_0001442_2558_3280 224
614 3300049578 Ga0501042_0012255 Ga0501042_0012255_3463_4185 224
615 3300049578 Ga0501042_0043256 Ga0501042_0043256_329_1039 224
616 3300049578 Ga0501042_0322076 Ga0501042_0322076_369_1052 224
617 3300049580 Ga0501046_0010068 Ga0501046_0010068_3346_4068 224
618 3300049580 Ga0501046_0030465 Ga0501046_0030465_3164_3844 224
619 3300049580 Ga0501046_0203702 Ga0501046_0203702_263_973 224
620 3300049581 Ga0501047_0084362 Ga0501047_0084362_171_851 224
621 3300049583 Ga0501067_0041336 Ga0501067_0041336_953_1663 224
622 3300049584 Ga0501068_0000264 Ga0501068_0000264_11775_12488 224
623 3300049585 Ga0501069_0000069 Ga0501069_0000069_27825_28538 224
624 3300049586 Ga0501070_0000016 Ga0501070_0000016_52864_53577 224
625 3300049587 Ga0501071_0077792 Ga0501071_0077792_556_1266 224
626 3300049587 Ga0501071_0119342 Ga0501071_0119342_134_856 224
627 3300049587 Ga0501071_0140006 Ga0501071_0140006_1008_1742 224
628 3300049587 Ga0501071_0285900 Ga0501071_0285900_51_782 224
629 3300049588 Ga0501072_0009842 Ga0501072_0009842_2787_3509 224
630 3300049588 Ga0501072_0014829 Ga0501072_0014829_3058_3822 224
631 3300049588 Ga0501072_0016598 Ga0501072_0016598_4352_5104 224
632 3300049588 Ga0501072_0375920 Ga0501072_0375920_28_762 224
633 3300049589 Ga0501073_0004708 Ga0501073_0004708_694_1407 224
634 3300049589 Ga0501073_0119839 Ga0501073_0119839_41_763 224
635 3300049590 Ga0501074_0007891 Ga0501074_0007891_3420_4133 224
636 3300049590 Ga0501074_0090401 Ga0501074_0090401_1500_2180 224
637 3300049590 Ga0501074_0496020 Ga0501074_0496020_112_825 224
638 3300049591 Ga0501075_0000643 Ga0501075_0000643_17552_18274 224
639 3300049591 Ga0501075_0003925 Ga0501075_0003925_7587_8297 224
640 3300049591 Ga0501075_0426665 Ga0501075_0426665_35_739 224
641 3300049592 Ga0501076_0002904 Ga0501076_0002904_4133_4843 224
642 3300049592 Ga0501076_0004459 Ga0501076_0004459_7599_8321 224
643 3300049592 Ga0501076_0038999 Ga0501076_0038999_2544_3275 224
644 3300049592 Ga0501076_0428096 Ga0501076_0428096_32_745 224
645 3300049593 Ga0501077_0001765 Ga0501077_0001765_5266_5988 224
646 3300049593 Ga0501077_0019766 Ga0501077_0019766_2215_2925 224
647 3300049741 Ga0501079_0008247 Ga0501079_0008247_3941_4651 224
648 3300049741 Ga0501079_0041676 Ga0501079_0041676_558_1289 224
649 3300049742 Ga0501080_0003538 Ga0501080_0003538_8098_8832 224
650 3300049742 Ga0501080_0006465 Ga0501080_0006465_315_1028 224
651 3300049742 Ga0501080_0023782 Ga0501080_0023782_295_1008 224
652 3300049742 Ga0501080_0047889 Ga0501080_0047889_1328_2062 224
653 3300049742 Ga0501080_0196990 Ga0501080_0196990_242_964 224
654 3300049742 Ga0501080_0311312 Ga0501080_0311312_121_801 224
655 3300049743 Ga0501081_0010797 Ga0501081_0010797_1564_2286 224
656 3300049743 Ga0501081_0143792 Ga0501081_0143792_368_1078 224
657 3300049744 Ga0501083_0002553 Ga0501083_0002553_4914_5624 224
658 3300049822 Ga0501035_0182370 Ga0501035_0182370_746_1468 224
659 3300049822 Ga0501035_0644665 Ga0501035_0644665_58_738 224
660 3300049823 Ga0501044_0049694 Ga0501044_0049694_1753_2484 224
661 3300049823 Ga0501044_0703740 Ga0501044_0703740_106_786 224
662 3300049824 Ga0501045_0008592 Ga0501045_0008592_3900_4631 224
663 3300049824 Ga0501045_0013364 Ga0501045_0013364_2108_2818 224
664 3300049824 Ga0501045_0076300 Ga0501045_0076300_1501_2223 224
665 3300049824 Ga0501045_0262813 Ga0501045_0262813_507_1208 224
666 3300049824 Ga0501045_0287489 Ga0501045_0287489_187_870 224
667 3300050489 nmdc:mga03683_113360_c1 nmdc:mga03683_113360_c1_252_968 224
668 3300050491 nmdc:mga00v17_135798_c1 nmdc:mga00v17_135798_c1_449_1207 224
669 3300050491 nmdc:mga00v17_411582_c1 nmdc:mga00v17_411582_c1_101_826 224
670 3300050491 nmdc:mga00v17_56865_c1 nmdc:mga00v17_56865_c1_31_747 224
671 3300050491 nmdc:mga00v17_61606_c1 nmdc:mga00v17_61606_c1_688_1410 224
672 3300050491 nmdc:mga00v17_754_c1 nmdc:mga00v17_754_c1_11394_12074 224
673 3300050492 nmdc:mga0yw44_427600_c1 nmdc:mga0yw44_427600_c1_142_876 224
674 3300050492 nmdc:mga0yw44_70014_c1 nmdc:mga0yw44_70014_c1_501_1211 224
675 3300050495 nmdc:mga04h51_60310_c1 nmdc:mga04h51_60310_c1_267_1010 224
676 3300050507 nmdc:mga05p37_272_c1 nmdc:mga05p37_272_c1_44363_45073 224
677 3300050507 nmdc:mga05p37_27518_c1 nmdc:mga05p37_27518_c1_3352_4062 224
678 3300050508 nmdc:mga09592_1380_c1 nmdc:mga09592_1380_c1_2392_3102 224
679 3300050508 nmdc:mga09592_3249_c1 nmdc:mga09592_3249_c1_9428_10141 224
680 3300050508 nmdc:mga09592_469220_c1 nmdc:mga09592_469220_c1_73_795 224
681 3300050509 nmdc:mga0qj67_132261_c1 nmdc:mga0qj67_132261_c1_1062_1772 224
682 3300050509 nmdc:mga0qj67_391691_c1 nmdc:mga0qj67_391691_c1_394_1104 224
683 3300050509 nmdc:mga0qj67_581_c1 nmdc:mga0qj67_581_c1_17548_18258 224
684 3300050510 nmdc:mga06r32_60054_c1 nmdc:mga06r32_60054_c1_332_1045 224
685 3300050510 nmdc:mga06r32_7319_c1 nmdc:mga06r32_7319_c1_7681_8391 224
686 3300050511 nmdc:mga08y16_1042_c1 nmdc:mga08y16_1042_c1_10816_11526 224
687 3300050511 nmdc:mga08y16_234331_c1 nmdc:mga08y16_234331_c1_739_1443 224
688 3300053085 Ga0495619_0230771 Ga0495619_0230771_269_985 224
689 3300053096 Ga0500641_0003380 Ga0500641_0003380_1030_1710 224
690 3300053139 Ga0500568_0000033 Ga0500568_0000033_91273_92013 224
691 3300053139 Ga0500568_0016033 Ga0500568_0016033_1587_2300 224
692 3300053153 Ga0500616_0000201 Ga0500616_0000201_38066_38779 224
693 3300054114 Ga0501084_0019201 Ga0501084_0019201_2027_2737 224
694 3300054114 Ga0501084_0091766 Ga0501084_0091766_167_898 224
695 3300054114 Ga0501084_0095152 Ga0501084_0095152_252_974 224
696 3300059421 Ga0590071_036856 Ga0590071_036856_469_1146 224
697 3300059423 Ga0590074_039237 Ga0590074_039237_47_736 224
698 3300060353 Ga0501082_0019250 Ga0501082_0019250_3011_3721 224
699 3300060353 Ga0501082_0080593 Ga0501082_0080593_1841_2563 224
700 3300060353 Ga0501082_0282735 Ga0501082_0282735_399_1133 224
701 3300061734 Ga0530510_0003757 Ga0530510_0003757_1620_2351 224
702 3300061734 Ga0530510_0009785 Ga0530510_0009785_2370_3080 224
703 3300061734 Ga0530510_0078713 Ga0530510_0078713_1636_2358 224
704 3300001979 JGI24740J21852_10040272 JGI24740J21852_100402721 225
705 3300001989 JGI24739J22299_10009836 JGI24739J22299_100098362 225
706 3300001989 JGI24739J22299_10017839 JGI24739J22299_100178391 225
707 3300001990 JGI24737J22298_10007017 JGI24737J22298_100070173 225
708 3300002067 JGI24735J21928_10060836 JGI24735J21928_100608362 225
709 3300002738 JGI25154J39366_1002756 JGI25154J39366_10027562 225
710 3300003203 JGI25406J46586_10009616 JGI25406J46586_100096164 225
711 3300003911 JGI25405J52794_10012237 JGI25405J52794_100122372 225
712 3300005327 Ga0070658_10200386 Ga0070658_102003862 225
713 3300005331 Ga0070670_100626665 Ga0070670_1006266651 225
714 3300005339 Ga0070660_100014778 Ga0070660_1000147785 225
715 3300005339 Ga0070660_100163222 Ga0070660_1001632222 225
716 3300005339 Ga0070660_100178855 Ga0070660_1001788553 225
717 3300005347 Ga0070668_100039488 Ga0070668_1000394883 225
718 3300005347 Ga0070668_100226407 Ga0070668_1002264072 225
719 3300005347 Ga0070668_100450413 Ga0070668_1004504132 225
720 3300005353 Ga0070669_100474472 Ga0070669_1004744722 225
721 3300005356 Ga0070674_100437034 Ga0070674_1004370342 225
722 3300005366 Ga0070659_100015596 Ga0070659_1000155962 225
723 3300005366 Ga0070659_100267584 Ga0070659_1002675842 225
724 3300005367 Ga0070667_100110730 Ga0070667_1001107302 225
725 3300005441 Ga0070700_100019460 Ga0070700_1000194603 225
726 3300005455 Ga0070663_100159637 Ga0070663_1001596372 225
727 3300005456 Ga0070678_100050169 Ga0070678_1000501693 225
728 3300005457 Ga0070662_100325505 Ga0070662_1003255051 225
729 3300005457 Ga0070662_100366962 Ga0070662_1003669622 225
730 3300005459 Ga0068867_100144154 Ga0068867_1001441542 225
731 3300005530 Ga0070679_100040379 Ga0070679_1000403792 225
732 3300005530 Ga0070679_100159808 Ga0070679_1001598083 225
733 3300005539 Ga0068853_100326398 Ga0068853_1003263982 225
734 3300005563 Ga0068855_100024556 Ga0068855_1000245563 225
735 3300005577 Ga0068857_100223591 Ga0068857_1002235913 225
736 3300005578 Ga0068854_100504961 Ga0068854_1005049612 225
737 3300005614 Ga0068856_100478102 Ga0068856_1004781022 225
738 3300005616 Ga0068852_100134908 Ga0068852_1001349082 225
739 3300005617 Ga0068859_100772821 Ga0068859_1007728212 225
740 3300005718 Ga0068866_10013450 Ga0068866_100134503 225
741 3300005719 Ga0068861_100249226 Ga0068861_1002492261 225
742 3300005719 Ga0068861_100391708 Ga0068861_1003917081 225
743 3300005843 Ga0068860_100121243 Ga0068860_1001212432 225
744 3300005843 Ga0068860_100546511 Ga0068860_1005465112 225
745 3300005844 Ga0068862_100112147 Ga0068862_1001121473 225
746 3300005937 Ga0081455_10000239 Ga0081455_1000023962 225
747 3300005937 Ga0081455_10000954 Ga0081455_100009543 225
748 3300005937 Ga0081455_10001233 Ga0081455_1000123323 225
749 3300005937 Ga0081455_10023426 Ga0081455_100234266 225
750 3300005937 Ga0081455_10116409 Ga0081455_101164092 225
751 3300005937 Ga0081455_10153168 Ga0081455_101531682 225
752 3300005937 Ga0081455_10253026 Ga0081455_102530262 225
753 3300005981 Ga0081538_10000380 Ga0081538_100003806 225
754 3300005985 Ga0081539_10083016 Ga0081539_100830162 225
755 3300006038 Ga0075365_10004603 Ga0075365_100046035 225
756 3300006051 Ga0075364_10024920 Ga0075364_100249201 225
757 3300006051 Ga0075364_10026862 Ga0075364_100268624 225
758 3300006051 Ga0075364_10043884 Ga0075364_100438844 225
759 3300006058 Ga0075432_10000041 Ga0075432_1000004110 225
760 3300006058 Ga0075432_10000349 Ga0075432_100003494 225
761 3300006178 Ga0075367_10004865 Ga0075367_100048654 225
762 3300006178 Ga0075367_10025743 Ga0075367_100257434 225
763 3300006186 Ga0075369_10012568 Ga0075369_100125681 225
764 3300006358 Ga0068871_100583842 Ga0068871_1005838421 225
765 3300006844 Ga0075428_100001374 Ga0075428_1000013748 225
766 3300006844 Ga0075428_100005226 Ga0075428_10000522610 225
767 3300006844 Ga0075428_100007810 Ga0075428_1000078106 225
768 3300006844 Ga0075428_100011656 Ga0075428_1000116564 225
769 3300006844 Ga0075428_100617563 Ga0075428_1006175632 225
770 3300006846 Ga0075430_100001780 Ga0075430_1000017809 225
771 3300006846 Ga0075430_100028278 Ga0075430_1000282783 225
772 3300006846 Ga0075430_100128138 Ga0075430_1001281382 225
773 3300006846 Ga0075430_100199713 Ga0075430_1001997132 225
774 3300006847 Ga0075431_100000852 Ga0075431_10000085211 225
775 3300006847 Ga0075431_100116706 Ga0075431_1001167063 225
776 3300006847 Ga0075431_100297214 Ga0075431_1002972143 225
777 3300006847 Ga0075431_100374679 Ga0075431_1003746791 225
778 3300006852 Ga0075433_10000386 Ga0075433_1000038620 225
779 3300006852 Ga0075433_10055131 Ga0075433_100551312 225
780 3300006871 Ga0075434_100000345 Ga0075434_1000003458 225
781 3300006871 Ga0075434_100000865 Ga0075434_1000008652 225
782 3300006880 Ga0075429_100003113 Ga0075429_10000311312 225
783 3300006880 Ga0075429_100003890 Ga0075429_1000038908 225
784 3300006880 Ga0075429_100389555 Ga0075429_1003895552 225
785 3300006881 Ga0068865_100037667 Ga0068865_1000376673 225
786 3300006881 Ga0068865_100044554 Ga0068865_1000445543 225
787 3300006914 Ga0075436_100001303 Ga0075436_10000130313 225
788 3300006914 Ga0075436_100047029 Ga0075436_1000470291 225
789 3300006931 Ga0097620_100772791 Ga0097620_1007727912 225
790 3300007076 Ga0075435_100003134 Ga0075435_1000031349 225
791 3300007076 Ga0075435_100003320 Ga0075435_1000033204 225
792 3300009011 Ga0105251_10201976 Ga0105251_102019761 225
793 3300009093 Ga0105240_10007278 Ga0105240_100072785 225
794 3300009094 Ga0111539_10000866 Ga0111539_1000086636 225
795 3300009094 Ga0111539_10054167 Ga0111539_100541675 225
796 3300009098 Ga0105245_10017708 Ga0105245_100177083 225
797 3300009147 Ga0114129_10000045 Ga0114129_1000004598 225
798 3300009147 Ga0114129_10003450 Ga0114129_1000345016 225
799 3300009147 Ga0114129_10011334 Ga0114129_1001133411 225
800 3300009147 Ga0114129_10105827 Ga0114129_101058274 225
801 3300009148 Ga0105243_10026497 Ga0105243_100264972 225
802 3300009148 Ga0105243_10120300 Ga0105243_101203002 225
803 3300009148 Ga0105243_10210273 Ga0105243_102102731 225
804 3300009148 Ga0105243_10279309 Ga0105243_102793092 225
805 3300009148 Ga0105243_10327492 Ga0105243_103274922 225
806 3300009176 Ga0105242_10021812 Ga0105242_100218125 225
807 3300009545 Ga0105237_10199157 Ga0105237_101991572 225
808 3300009551 Ga0105238_10378913 Ga0105238_103789132 225
809 3300009551 Ga0105238_10599155 Ga0105238_105991551 225
810 3300010375 Ga0105239_10042399 Ga0105239_100423995 225
811 3300010375 Ga0105239_10858405 Ga0105239_108584051 225
812 3300012507 Ga0157342_1011045 Ga0157342_10110451 225
813 3300012513 Ga0157326_1021392 Ga0157326_10213922 225
814 3300013102 Ga0157371_10078114 Ga0157371_100781142 225
815 3300013104 Ga0157370_10001509 Ga0157370_1000150915 225
816 3300013105 Ga0157369_10002974 Ga0157369_1000297413 225
817 3300013105 Ga0157369_10173929 Ga0157369_101739295 225
818 3300013306 Ga0163162_10053293 Ga0163162_100532934 225
819 3300013306 Ga0163162_10071500 Ga0163162_100715003 225
820 3300013306 Ga0163162_10076741 Ga0163162_100767414 225
821 3300013307 Ga0157372_10017632 Ga0157372_100176324 225
822 3300013307 Ga0157372_10403565 Ga0157372_104035654 225
823 3300014326 Ga0157380_10229117 Ga0157380_102291172 225
824 3300017792 Ga0163161_10030613 Ga0163161_100306134 225
825 3300021384 Ga0213876_10050576 Ga0213876_100505762 225
826 3300025246 Ga0209646_1000013 Ga0209646_1000013105 225
827 3300025728 Ga0207655_1038532 Ga0207655_10385322 225
828 3300025901 Ga0207688_10140320 Ga0207688_101403202 225
829 3300025904 Ga0207647_10005141 Ga0207647_100051415 225
830 3300025904 Ga0207647_10038645 Ga0207647_100386455 225
831 3300025904 Ga0207647_10159036 Ga0207647_101590362 225
832 3300025909 Ga0207705_10139920 Ga0207705_101399202 225
833 3300025919 Ga0207657_10005554 Ga0207657_100055544 225
834 3300025919 Ga0207657_10168401 Ga0207657_101684012 225
835 3300025919 Ga0207657_10302934 Ga0207657_103029342 225
836 3300025919 Ga0207657_10323260 Ga0207657_103232602 225
837 3300025921 Ga0207652_10027986 Ga0207652_100279863 225
838 3300025921 Ga0207652_10197309 Ga0207652_101973091 225
839 3300025923 Ga0207681_10366566 Ga0207681_103665662 225
840 3300025927 Ga0207687_10478525 Ga0207687_104785252 225
841 3300025929 Ga0207664_10682215 Ga0207664_106822152 225
842 3300025932 Ga0207690_10225888 Ga0207690_102258882 225
843 3300025933 Ga0207706_10043694 Ga0207706_100436942 225
844 3300025933 Ga0207706_10374579 Ga0207706_103745791 225
845 3300025935 Ga0207709_10014309 Ga0207709_100143092 225
846 3300025935 Ga0207709_10146627 Ga0207709_101466272 225
847 3300025935 Ga0207709_10237105 Ga0207709_102371052 225
848 3300025935 Ga0207709_10448767 Ga0207709_104487672 225
849 3300025937 Ga0207669_10530088 Ga0207669_105300882 225
850 3300025938 Ga0207704_10030615 Ga0207704_100306153 225
851 3300025972 Ga0207668_10072044 Ga0207668_100720443 225
852 3300025972 Ga0207668_10084045 Ga0207668_100840453 225
853 3300025972 Ga0207668_10099356 Ga0207668_100993562 225
854 3300025986 Ga0207658_10077238 Ga0207658_100772382 225
855 3300026041 Ga0207639_10097470 Ga0207639_100974702 225
856 3300026041 Ga0207639_10404075 Ga0207639_104040752 225
857 3300026041 Ga0207639_10924477 Ga0207639_109244771 225
858 3300026067 Ga0207678_10602004 Ga0207678_106020041 225
859 3300026075 Ga0207708_10021961 Ga0207708_100219613 225
860 3300026078 Ga0207702_10342596 Ga0207702_103425962 225
861 3300026089 Ga0207648_10172188 Ga0207648_101721882 225
862 3300026116 Ga0207674_10134607 Ga0207674_101346072 225
863 3300026118 Ga0207675_100068281 Ga0207675_1000682813 225
864 3300026118 Ga0207675_100460982 Ga0207675_1004609821 225
865 3300026121 Ga0207683_10418343 Ga0207683_104183432 225
866 3300026142 Ga0207698_10391439 Ga0207698_103914392 225
867 3300027907 Ga0207428_10000346 Ga0207428_1000034610 225
868 3300027907 Ga0207428_10001766 Ga0207428_1000176617 225
869 3300028380 Ga0268265_10285507 Ga0268265_102855072 225
870 3300028381 Ga0268264_10401871 Ga0268264_104018712 225
871 3300028381 Ga0268264_10449199 Ga0268264_104491992 225
872 3300028794 Ga0307515_10081632 Ga0307515_100816323 225
873 3300028800 Ga0265338_10303744 Ga0265338_103037442 225
874 3300030522 Ga0307512_10125499 Ga0307512_101254992 225
875 3300031247 Ga0265340_10059850 Ga0265340_100598502 225
876 3300031247 Ga0265340_10210202 Ga0265340_102102022 225
877 3300031548 Ga0307408_100005986 Ga0307408_1000059867 225
878 3300031548 Ga0307408_100048680 Ga0307408_1000486802 225
879 3300031548 Ga0307408_100284375 Ga0307408_1002843752 225
880 3300031595 Ga0265313_10034121 Ga0265313_100341213 225
881 3300031616 Ga0307508_10254741 Ga0307508_102547412 225
882 3300031665 Ga0316575_10081277 Ga0316575_100812771 225
883 3300031691 Ga0316579_10229664 Ga0316579_102296642 225
884 3300031727 Ga0316576_10068389 Ga0316576_100683891 225
885 3300031731 Ga0307405_10000281 Ga0307405_1000028110 225
886 3300031731 Ga0307405_10083863 Ga0307405_100838633 225
887 3300031824 Ga0307413_10018336 Ga0307413_100183362 225
888 3300031824 Ga0307413_10317006 Ga0307413_103170062 225
889 3300031852 Ga0307410_10003125 Ga0307410_100031259 225
890 3300031852 Ga0307410_10005859 Ga0307410_100058596 225
891 3300031852 Ga0307410_10027721 Ga0307410_100277212 225
892 3300031852 Ga0307410_10111066 Ga0307410_101110662 225
893 3300031852 Ga0307410_10566355 Ga0307410_105663551 225
894 3300031901 Ga0307406_10000008 Ga0307406_1000000866 225
895 3300031901 Ga0307406_10000031 Ga0307406_1000003176 225
896 3300031901 Ga0307406_10008604 Ga0307406_100086045 225
897 3300031901 Ga0307406_10017530 Ga0307406_100175304 225
898 3300031901 Ga0307406_10021072 Ga0307406_100210723 225
899 3300031901 Ga0307406_10024253 Ga0307406_100242533 225
900 3300031901 Ga0307406_10087869 Ga0307406_100878692 225
901 3300031901 Ga0307406_10186338 Ga0307406_101863381 225
902 3300031901 Ga0307406_10188105 Ga0307406_101881052 225
903 3300031901 Ga0307406_10422860 Ga0307406_104228601 225
904 3300031901 Ga0307406_10431119 Ga0307406_104311191 225
905 3300031901 Ga0307406_10534268 Ga0307406_105342682 225
906 3300031901 Ga0307406_10634808 Ga0307406_106348081 225
907 3300031903 Ga0307407_10000362 Ga0307407_100003629 225
908 3300031903 Ga0307407_10005760 Ga0307407_100057602 225
909 3300031903 Ga0307407_10115045 Ga0307407_101150452 225
910 3300031911 Ga0307412_10021599 Ga0307412_100215993 225
911 3300031911 Ga0307412_10032257 Ga0307412_100322574 225
912 3300031911 Ga0307412_10387556 Ga0307412_103875562 225
913 3300031995 Ga0307409_100000014 Ga0307409_10000001467 225
914 3300031995 Ga0307409_100056099 Ga0307409_1000560992 225
915 3300031995 Ga0307409_100084499 Ga0307409_1000844993 225
916 3300031995 Ga0307409_100375202 Ga0307409_1003752022 225
917 3300031995 Ga0307409_100492363 Ga0307409_1004923632 225
918 3300031995 Ga0307409_101240451 Ga0307409_1012404512 225
919 3300032002 Ga0307416_100000823 Ga0307416_1000008235 225
920 3300032002 Ga0307416_100004483 Ga0307416_1000044834 225
921 3300032002 Ga0307416_100083951 Ga0307416_1000839514 225
922 3300032002 Ga0307416_100399930 Ga0307416_1003999302 225
923 3300032004 Ga0307414_10001630 Ga0307414_100016306 225
924 3300032004 Ga0307414_10055699 Ga0307414_100556994 225
925 3300032004 Ga0307414_10064707 Ga0307414_100647073 225
926 3300032004 Ga0307414_10148821 Ga0307414_101488212 225
927 3300032004 Ga0307414_10244826 Ga0307414_102448262 225
928 3300032004 Ga0307414_10621317 Ga0307414_106213172 225
929 3300032005 Ga0307411_10050788 Ga0307411_100507882 225
930 3300032005 Ga0307411_10096043 Ga0307411_100960432 225
931 3300032126 Ga0307415_100001061 Ga0307415_1000010614 225
932 3300032126 Ga0307415_100187371 Ga0307415_1001873712 225
933 3300032126 Ga0307415_100191026 Ga0307415_1001910262 225
934 3300032126 Ga0307415_100194874 Ga0307415_1001948743 225
935 3300032126 Ga0307415_100241802 Ga0307415_1002418022 225
936 3300032126 Ga0307415_100350021 Ga0307415_1003500212 225
937 3300032133 Ga0316583_10010523 Ga0316583_100105233 225
938 3300032137 Ga0316585_10002798 Ga0316585_100027986 225
939 3300032139 Ga0316580_10002931 Ga0316580_100029315 225
940 3300035117 Ga0373953_0120468 Ga0373953_0120468_162_845 225
941 3300035398 Ga0316574_0228368 Ga0316574_0228368_203_883 225
942 3300037312 Ga0395899_0077630 Ga0395899_0077630_607_1290 225
943 3300037466 Ga0395898_0116589 Ga0395898_0116589_643_1326 225
944 3300038443 Ga0395901_0088274 Ga0395901_0088274_1648_2331 225
945 3300039062 Ga0400483_016771 Ga0400483_016771_8264_9007 225
946 3300039437 Ga0436365_0300504 Ga0436365_0300504_8558_9250 225
947 3300039437 Ga0436365_0954458 Ga0436365_0954458_1762_2475 225
948 3300039450 Ga0436363_0772320 Ga0436363_0772320_419_1102 225
949 3300041494 Ga0451837_1462739 Ga0451837_1462739_55_738 225
950 3300041505 Ga0451849_0051958 Ga0451849_0051958_171_848 225
951 3300041509 Ga0451843_0666080 Ga0451843_0666080_80_757 225
952 3300042016 Ga0439463_012020 Ga0439463_012020_570_1247 225
953 3300042016 Ga0439463_042736 Ga0439463_042736_180_863 225
954 3300042436 Ga0439435_0006676 Ga0439435_0006676_1395_2072 225
955 3300042437 Ga0439444_0021740 Ga0439444_0021740_287_964 225
956 3300042439 Ga0439464_0088182 Ga0439464_0088182_178_855 225
957 3300042461 Ga0439460_0077475 Ga0439460_0077475_106_783 225
958 3300042876 Ga0451577_0152269 Ga0451577_0152269_424_1110 225
959 3300042993 Ga0439440_0007260 Ga0439440_0007260_41_718 225
960 3300044656 Ga0466969_0055256 Ga0466969_0055256_951_1634 225
961 3300044658 Ga0466972_0088259 Ga0466972_0088259_516_1199 225
962 3300044683 Ga0466965_0028886 Ga0466965_0028886_1705_2388 225
963 3300044683 Ga0466965_0168610 Ga0466965_0168610_169_852 225
964 3300044694 Ga0466963_0231494 Ga0466963_0231494_595_1275 225
965 3300044765 Ga0466970_0000168 Ga0466970_0000168_7574_8257 225
966 3300044765 Ga0466970_0016696 Ga0466970_0016696_449_1132 225
967 3300044842 Ga0466957_0022592 Ga0466957_0022592_2094_2777 225
968 3300045836 Ga0466958_0155112 Ga0466958_0155112_12_692 225
969 3300045836 Ga0466958_0332731 Ga0466958_0332731_124_816 225
970 3300045976 Ga0466967_0155753 Ga0466967_0155753_1393_2073 225
971 3300046453 Ga0495627_001242 Ga0495627_001242_11331_12014 225
972 3300046455 Ga0495603_0167125 Ga0495603_0167125_425_1108 225
973 3300046461 Ga0495641_0064507 Ga0495641_0064507_815_1495 225
974 3300046507 Ga0495606_0169426 Ga0495606_0169426_383_1066 225
975 3300046523 Ga0495644_0125150 Ga0495644_0125150_226_903 225
976 3300046525 Ga0495663_0177435 Ga0495663_0177435_48_725 225
977 3300046538 Ga0495609_0112124 Ga0495609_0112124_224_901 225
978 3300046660 Ga0495625_0236260 Ga0495625_0236260_150_833 225
979 3300046694 Ga0495649_0255699 Ga0495649_0255699_202_885 225
980 3300048903 Ga0496100_0072118 Ga0496100_0072118_319_1002 225
981 3300048905 Ga0496102_0049140 Ga0496102_0049140_271_954 225
982 3300048906 Ga0496103_0029148 Ga0496103_0029148_226_909 225
983 3300048908 Ga0496105_0150267 Ga0496105_0150267_355_1038 225
984 3300048910 Ga0496107_0039486 Ga0496107_0039486_1643_2326 225
985 3300048911 Ga0496108_0201150 Ga0496108_0201150_575_1258 225
986 3300048911 Ga0496108_0568240 Ga0496108_0568240_16_693 225
987 3300048912 Ga0496109_0042917 Ga0496109_0042917_1774_2457 225
988 3300048915 Ga0496112_0123812 Ga0496112_0123812_1213_1926 225
989 3300048917 Ga0496114_0360374 Ga0496114_0360374_218_895 225
990 3300048918 Ga0496115_0005178 Ga0496115_0005178_3122_3805 225
991 3300048920 Ga0496117_0012166 Ga0496117_0012166_3957_4640 225
992 3300048920 Ga0496117_0074371 Ga0496117_0074371_88_771 225
993 3300048921 Ga0496118_0010443 Ga0496118_0010443_924_1607 225
994 3300048921 Ga0496118_0078468 Ga0496118_0078468_1541_2224 225
995 3300048921 Ga0496118_0114678 Ga0496118_0114678_673_1356 225
996 3300048922 Ga0496119_0001767 Ga0496119_0001767_2221_2904 225
997 3300048922 Ga0496119_0006539 Ga0496119_0006539_10001_10684 225
998 3300048922 Ga0496119_0007010 Ga0496119_0007010_7482_8165 225
999 3300048922 Ga0496119_0007499 Ga0496119_0007499_7367_8050 225
1000 3300048922 Ga0496119_0107651 Ga0496119_0107651_829_1512 225
1001 3300048923 Ga0496120_0000878 Ga0496120_0000878_41522_42205 225
1002 3300048923 Ga0496120_0002268 Ga0496120_0002268_10834_11517 225
1003 3300048923 Ga0496120_0003203 Ga0496120_0003203_7046_7729 225
1004 3300048925 Ga0496122_0000096 Ga0496122_0000096_8563_9246 225
1005 3300048925 Ga0496122_0006853 Ga0496122_0006853_6410_7093 225
1006 3300048926 Ga0496123_0000031 Ga0496123_0000031_39583_40266 225
1007 3300048926 Ga0496123_0006613 Ga0496123_0006613_3035_3718 225
1008 3300048926 Ga0496123_0111452 Ga0496123_0111452_31_714 225
1009 3300048927 Ga0496124_0001640 Ga0496124_0001640_11108_11791 225
1010 3300048927 Ga0496124_0002763 Ga0496124_0002763_1502_2185 225
1011 3300048927 Ga0496124_0025215 Ga0496124_0025215_2940_3623 225
1012 3300048927 Ga0496124_0493061 Ga0496124_0493061_60_743 225
1013 3300048928 Ga0496125_0000069 Ga0496125_0000069_35630_36337 225
1014 3300048928 Ga0496125_0001305 Ga0496125_0001305_6019_6702 225
1015 3300048928 Ga0496125_0001344 Ga0496125_0001344_11585_12268 225
1016 3300048928 Ga0496125_0005189 Ga0496125_0005189_6478_7161 225
1017 3300048928 Ga0496125_0012813 Ga0496125_0012813_7178_7861 225
1018 3300048929 Ga0496126_0001649 Ga0496126_0001649_7519_8202 225
1019 3300048929 Ga0496126_0062762 Ga0496126_0062762_1244_1927 225
1020 3300048929 Ga0496126_0075468 Ga0496126_0075468_2242_2925 225
1021 3300049522 Ga0501299_039643 Ga0501299_039643_202_879 225
1022 3300049570 Ga0501033_0000285 Ga0501033_0000285_25024_25701 225
1023 3300049571 Ga0501034_0000366 Ga0501034_0000366_24092_24808 225
1024 3300049571 Ga0501034_0001844 Ga0501034_0001844_13031_13714 225
1025 3300049571 Ga0501034_0018939 Ga0501034_0018939_5921_6640 225
1026 3300049571 Ga0501034_0020347 Ga0501034_0020347_4390_5112 225
1027 3300049571 Ga0501034_0025246 Ga0501034_0025246_1534_2253 225
1028 3300049571 Ga0501034_0103654 Ga0501034_0103654_2135_2818 225
1029 3300049572 Ga0501036_0000324 Ga0501036_0000324_13909_14586 225
1030 3300049572 Ga0501036_0510962 Ga0501036_0510962_277_960 225
1031 3300049574 Ga0501038_0025154 Ga0501038_0025154_3409_4092 225
1032 3300049576 Ga0501040_0138387 Ga0501040_0138387_604_1284 225
1033 3300049579 Ga0501043_0004041 Ga0501043_0004041_5513_6190 225
1034 3300049581 Ga0501047_0036754 Ga0501047_0036754_81_758 225
1035 3300049583 Ga0501067_0002319 Ga0501067_0002319_5479_6156 225
1036 3300049585 Ga0501069_0000356 Ga0501069_0000356_9346_10062 225
1037 3300049585 Ga0501069_0024201 Ga0501069_0024201_2195_2878 225
1038 3300049586 Ga0501070_0000693 Ga0501070_0000693_12571_13287 225
1039 3300049586 Ga0501070_0000746 Ga0501070_0000746_14323_15006 225
1040 3300049586 Ga0501070_0001283 Ga0501070_0001283_13711_14388 225
1041 3300049586 Ga0501070_0001642 Ga0501070_0001642_2368_3051 225
1042 3300049587 Ga0501071_0001553 Ga0501071_0001553_11406_12122 225
1043 3300049587 Ga0501071_0142626 Ga0501071_0142626_677_1354 225
1044 3300049589 Ga0501073_0003817 Ga0501073_0003817_1460_2176 225
1045 3300049590 Ga0501074_0002476 Ga0501074_0002476_3846_4523 225
1046 3300049590 Ga0501074_0072046 Ga0501074_0072046_941_1657 225
1047 3300049661 Ga0501217_043199 Ga0501217_043199_90_767 225
1048 3300049677 Ga0501247_018140 Ga0501247_018140_191_868 225
1049 3300049688 Ga0501259_017194 Ga0501259_017194_44_721 225
1050 3300049741 Ga0501079_0034714 Ga0501079_0034714_151_867 225
1051 3300049742 Ga0501080_0069045 Ga0501080_0069045_653_1369 225
1052 3300049742 Ga0501080_0215768 Ga0501080_0215768_421_1104 225
1053 3300049744 Ga0501083_0000318 Ga0501083_0000318_22470_23186 225
1054 3300049823 Ga0501044_0242019 Ga0501044_0242019_310_987 225
1055 3300050491 nmdc:mga00v17_2726_c1 nmdc:mga00v17_2726_c1_1481_2164 225
1056 3300050491 nmdc:mga00v17_5246_c1 nmdc:mga00v17_5246_c1_3658_4341 225
1057 3300050491 nmdc:mga00v17_76666_c1 nmdc:mga00v17_76666_c1_1241_1924 225
1058 3300050492 nmdc:mga0yw44_11660_c1 nmdc:mga0yw44_11660_c1_2047_2730 225
1059 3300050507 nmdc:mga05p37_137926_c1 nmdc:mga05p37_137926_c1_1656_2333 225
1060 3300050507 nmdc:mga05p37_91274_c1 nmdc:mga05p37_91274_c1_1684_2397 225
1061 3300050508 nmdc:mga09592_53980_c1 nmdc:mga09592_53980_c1_1876_2589 225
1062 3300050509 nmdc:mga0qj67_115963_c1 nmdc:mga0qj67_115963_c1_135_818 225
1063 3300050509 nmdc:mga0qj67_117_c1 nmdc:mga0qj67_117_c1_13434_14117 225
1064 3300050510 nmdc:mga06r32_162266_c1 nmdc:mga06r32_162266_c1_850_1533 225
1065 3300050510 nmdc:mga06r32_17441_c2 nmdc:mga06r32_17441_c2_1617_2300 225
1066 3300050510 nmdc:mga06r32_48331_c1 nmdc:mga06r32_48331_c1_324_1037 225
1067 3300050510 nmdc:mga06r32_58872_c1 nmdc:mga06r32_58872_c1_2061_2738 225
1068 3300050511 nmdc:mga08y16_5866_c1 nmdc:mga08y16_5866_c1_5395_6072 225
1069 3300050512 nmdc:mga0n895_3207_c1 nmdc:mga0n895_3207_c1_6772_7449 225
1070 3300050513 nmdc:mga0rr50_34641_c1 nmdc:mga0rr50_34641_c1_1249_1926 225
1071 3300050513 nmdc:mga0rr50_4910_c1 nmdc:mga0rr50_4910_c1_6726_7403 225
1072 3300050514 nmdc:mga08x19_1671_c1 nmdc:mga08x19_1671_c1_2024_2701 225
1073 3300050514 nmdc:mga08x19_172131_c1 nmdc:mga08x19_172131_c1_166_843 225
1074 3300050515 nmdc:mga0a205_12836_c1 nmdc:mga0a205_12836_c1_1187_1864 225
1075 3300050515 nmdc:mga0a205_2580_c1 nmdc:mga0a205_2580_c1_2488_3165 225
1076 3300053094 Ga0500566_0001537 Ga0500566_0001537_12028_12762 225
1077 3300054114 Ga0501084_0000435 Ga0501084_0000435_26971_27687 225
1078 3300060353 Ga0501082_0127309 Ga0501082_0127309_625_1341 225
1079 3300000549 LJQas_1001275 LJQas_10012755 226
1080 3300000549 LJQas_1001475 LJQas_10014752 226
1081 3300002773 JGI25152J39213_1000335 JGI25152J39213_100033510 226
1082 3300003187 JGI25151J46595_10011197 JGI25151J46595_100111974 226
1083 3300005288 Ga0065714_10007799 Ga0065714_100077991 226
1084 3300005327 Ga0070658_10074956 Ga0070658_100749561 226
1085 3300005328 Ga0070676_10237571 Ga0070676_102375711 226
1086 3300005329 Ga0070683_100003701 Ga0070683_10000370112 226
1087 3300005329 Ga0070683_100112442 Ga0070683_1001124424 226
1088 3300005329 Ga0070683_100158347 Ga0070683_1001583472 226
1089 3300005330 Ga0070690_100040614 Ga0070690_1000406144 226
1090 3300005330 Ga0070690_100061256 Ga0070690_1000612562 226
1091 3300005331 Ga0070670_100077353 Ga0070670_1000773532 226
1092 3300005331 Ga0070670_100080871 Ga0070670_1000808713 226
1093 3300005333 Ga0070677_10007609 Ga0070677_100076091 226
1094 3300005334 Ga0068869_100004314 Ga0068869_1000043145 226
1095 3300005336 Ga0070680_100000651 Ga0070680_10000065111 226
1096 3300005336 Ga0070680_100061939 Ga0070680_1000619392 226
1097 3300005336 Ga0070680_100187633 Ga0070680_1001876332 226
1098 3300005336 Ga0070680_100243592 Ga0070680_1002435921 226
1099 3300005337 Ga0070682_100006883 Ga0070682_1000068832 226
1100 3300005337 Ga0070682_100085211 Ga0070682_1000852112 226
1101 3300005337 Ga0070682_100124200 Ga0070682_1001242002 226
1102 3300005338 Ga0068868_100005203 Ga0068868_10000520311 226
1103 3300005338 Ga0068868_100717357 Ga0068868_1007173572 226
1104 3300005339 Ga0070660_100065907 Ga0070660_1000659073 226
1105 3300005339 Ga0070660_100191918 Ga0070660_1001919181 226
1106 3300005347 Ga0070668_100018238 Ga0070668_1000182385 226
1107 3300005353 Ga0070669_100021093 Ga0070669_1000210933 226
1108 3300005353 Ga0070669_100207076 Ga0070669_1002070762 226
1109 3300005354 Ga0070675_100001433 Ga0070675_10000143312 226
1110 3300005354 Ga0070675_100127240 Ga0070675_1001272402 226
1111 3300005354 Ga0070675_100787253 Ga0070675_1007872531 226
1112 3300005355 Ga0070671_100066493 Ga0070671_1000664933 226
1113 3300005356 Ga0070674_100092292 Ga0070674_1000922922 226
1114 3300005366 Ga0070659_100157076 Ga0070659_1001570763 226
1115 3300005366 Ga0070659_100158990 Ga0070659_1001589904 226
1116 3300005367 Ga0070667_100005632 Ga0070667_10000563211 226
1117 3300005367 Ga0070667_100016921 Ga0070667_1000169215 226
1118 3300005436 Ga0070713_100071033 Ga0070713_1000710333 226
1119 3300005455 Ga0070663_100002797 Ga0070663_10000279710 226
1120 3300005456 Ga0070678_100057529 Ga0070678_1000575293 226
1121 3300005456 Ga0070678_100234646 Ga0070678_1002346462 226
1122 3300005457 Ga0070662_100171090 Ga0070662_1001710902 226
1123 3300005458 Ga0070681_10000045 Ga0070681_1000004567 226
1124 3300005458 Ga0070681_10002651 Ga0070681_100026514 226
1125 3300005458 Ga0070681_10020407 Ga0070681_100204077 226
1126 3300005458 Ga0070681_10273653 Ga0070681_102736532 226
1127 3300005530 Ga0070679_100000169 Ga0070679_10000016951 226
1128 3300005530 Ga0070679_100005047 Ga0070679_1000050478 226
1129 3300005530 Ga0070679_100181943 Ga0070679_1001819434 226
1130 3300005535 Ga0070684_100034172 Ga0070684_1000341723 226
1131 3300005543 Ga0070672_100023485 Ga0070672_1000234853 226
1132 3300005543 Ga0070672_100251679 Ga0070672_1002516792 226
1133 3300005543 Ga0070672_100424888 Ga0070672_1004248882 226
1134 3300005548 Ga0070665_100152798 Ga0070665_1001527982 226
1135 3300005563 Ga0068855_100320456 Ga0068855_1003204561 226
1136 3300005564 Ga0070664_100000129 Ga0070664_10000012937 226
1137 3300005578 Ga0068854_100543810 Ga0068854_1005438102 226
1138 3300005614 Ga0068856_100245390 Ga0068856_1002453902 226
1139 3300005617 Ga0068859_100000197 Ga0068859_1000001979 226
1140 3300005617 Ga0068859_100009591 Ga0068859_1000095918 226
1141 3300005841 Ga0068863_100000595 Ga0068863_10000059528 226
1142 3300005842 Ga0068858_100019202 Ga0068858_1000192023 226
1143 3300005843 Ga0068860_100094710 Ga0068860_1000947104 226
1144 3300005844 Ga0068862_100000297 Ga0068862_1000002978 226
1145 3300005844 Ga0068862_100512076 Ga0068862_1005120762 226
1146 3300005937 Ga0081455_10032780 Ga0081455_100327803 226
1147 3300005985 Ga0081539_10077474 Ga0081539_100774743 226
1148 3300006028 Ga0070717_10517952 Ga0070717_105179522 226
1149 3300006038 Ga0075365_10068882 Ga0075365_100688822 226
1150 3300006038 Ga0075365_10111444 Ga0075365_101114442 226
1151 3300006058 Ga0075432_10000912 Ga0075432_100009125 226
1152 3300006058 Ga0075432_10034331 Ga0075432_100343312 226
1153 3300006881 Ga0068865_100131575 Ga0068865_1001315751 226
1154 3300006931 Ga0097620_100000197 Ga0097620_1000001979 226
1155 3300006931 Ga0097620_100009591 Ga0097620_1000095918 226
1156 3300009011 Ga0105251_10007055 Ga0105251_100070553 226
1157 3300009036 Ga0105244_10034555 Ga0105244_100345553 226
1158 3300009036 Ga0105244_10035296 Ga0105244_100352962 226
1159 3300009093 Ga0105240_10079965 Ga0105240_100799654 226
1160 3300009101 Ga0105247_10058854 Ga0105247_100588541 226
1161 3300009101 Ga0105247_10097741 Ga0105247_100977412 226
1162 3300009148 Ga0105243_10004454 Ga0105243_100044549 226
1163 3300009148 Ga0105243_10268301 Ga0105243_102683012 226
1164 3300009176 Ga0105242_10089399 Ga0105242_100893993 226
1165 3300009177 Ga0105248_10000419 Ga0105248_100004199 226
1166 3300009177 Ga0105248_10023531 Ga0105248_100235317 226
1167 3300009545 Ga0105237_10023369 Ga0105237_100233697 226
1168 3300009551 Ga0105238_10606164 Ga0105238_106061641 226
1169 3300009553 Ga0105249_10043927 Ga0105249_100439272 226
1170 3300009553 Ga0105249_10182856 Ga0105249_101828562 226
1171 3300010375 Ga0105239_10012640 Ga0105239_100126408 226
1172 3300011119 Ga0105246_10002272 Ga0105246_100022727 226
1173 3300011119 Ga0105246_10028517 Ga0105246_100285173 226
1174 3300011119 Ga0105246_10254189 Ga0105246_102541892 226
1175 3300013100 Ga0157373_10044107 Ga0157373_100441072 226
1176 3300013102 Ga0157371_10079597 Ga0157371_100795972 226
1177 3300013102 Ga0157371_10129378 Ga0157371_101293782 226
1178 3300013102 Ga0157371_10289394 Ga0157371_102893942 226
1179 3300013104 Ga0157370_10022864 Ga0157370_100228647 226
1180 3300013104 Ga0157370_10030312 Ga0157370_100303122 226
1181 3300013104 Ga0157370_10598583 Ga0157370_105985832 226
1182 3300013105 Ga0157369_10087565 Ga0157369_100875653 226
1183 3300013105 Ga0157369_10187784 Ga0157369_101877842 226
1184 3300013105 Ga0157369_10225691 Ga0157369_102256912 226
1185 3300013105 Ga0157369_10400045 Ga0157369_104000452 226
1186 3300013296 Ga0157374_10429399 Ga0157374_104293992 226
1187 3300013296 Ga0157374_10454122 Ga0157374_104541222 226
1188 3300013296 Ga0157374_10931582 Ga0157374_109315821 226
1189 3300013306 Ga0163162_10191229 Ga0163162_101912291 226
1190 3300013307 Ga0157372_10122895 Ga0157372_101228955 226
1191 3300013307 Ga0157372_10931587 Ga0157372_109315872 226
1192 3300013308 Ga0157375_10414164 Ga0157375_104141642 226
1193 3300014325 Ga0163163_10002450 Ga0163163_100024507 226
1194 3300014969 Ga0157376_10221593 Ga0157376_102215932 226
1195 3300017792 Ga0163161_10035889 Ga0163161_100358894 226
1196 3300020081 Ga0206354_10613629 Ga0206354_106136291 226
1197 3300020082 Ga0206353_10243206 Ga0206353_102432061 226
1198 3300020082 Ga0206353_10495411 Ga0206353_104954111 226
1199 3300020082 Ga0206353_11859265 Ga0206353_118592651 226
1200 3300021384 Ga0213876_10001722 Ga0213876_100017224 226
1201 3300025258 Ga0209129_1000112 Ga0209129_100011215 226
1202 3300025294 Ga0209025_1000250 Ga0209025_100025099 226
1203 3300025303 Ga0209051_1002132 Ga0209051_100213210 226
1204 3300025303 Ga0209051_1079971 Ga0209051_10799711 226
1205 3300025315 Ga0207697_10006159 Ga0207697_100061594 226
1206 3300025728 Ga0207655_1008116 Ga0207655_10081165 226
1207 3300025728 Ga0207655_1008601 Ga0207655_10086014 226
1208 3300025728 Ga0207655_1029481 Ga0207655_10294812 226
1209 3300025735 Ga0207713_1009922 Ga0207713_10099224 226
1210 3300025893 Ga0207682_10003013 Ga0207682_100030137 226
1211 3300025900 Ga0207710_10199200 Ga0207710_101992001 226
1212 3300025901 Ga0207688_10013737 Ga0207688_100137374 226
1213 3300025904 Ga0207647_10050600 Ga0207647_100506003 226
1214 3300025907 Ga0207645_10001283 Ga0207645_1000128317 226
1215 3300025909 Ga0207705_10214838 Ga0207705_102148383 226
1216 3300025911 Ga0207654_10298106 Ga0207654_102981061 226
1217 3300025912 Ga0207707_10000066 Ga0207707_1000006651 226
1218 3300025914 Ga0207671_10023680 Ga0207671_100236803 226
1219 3300025916 Ga0207663_10644534 Ga0207663_106445341 226
1220 3300025917 Ga0207660_10000148 Ga0207660_1000014841 226
1221 3300025917 Ga0207660_10046017 Ga0207660_100460172 226
1222 3300025919 Ga0207657_10076149 Ga0207657_100761492 226
1223 3300025919 Ga0207657_10118937 Ga0207657_101189374 226
1224 3300025919 Ga0207657_10134663 Ga0207657_101346634 226
1225 3300025921 Ga0207652_10000287 Ga0207652_1000028712 226
1226 3300025921 Ga0207652_10025784 Ga0207652_100257845 226
1227 3300025921 Ga0207652_10186211 Ga0207652_101862114 226
1228 3300025923 Ga0207681_10039309 Ga0207681_100393093 226
1229 3300025925 Ga0207650_10008172 Ga0207650_100081721 226
1230 3300025925 Ga0207650_10108716 Ga0207650_101087162 226
1231 3300025926 Ga0207659_10001580 Ga0207659_100015806 226
1232 3300025926 Ga0207659_10031388 Ga0207659_100313882 226
1233 3300025927 Ga0207687_10009453 Ga0207687_100094537 226
1234 3300025928 Ga0207700_10091105 Ga0207700_100911052 226
1235 3300025929 Ga0207664_10047270 Ga0207664_100472701 226
1236 3300025931 Ga0207644_10162806 Ga0207644_101628061 226
1237 3300025932 Ga0207690_10073573 Ga0207690_100735732 226
1238 3300025932 Ga0207690_10121379 Ga0207690_101213793 226
1239 3300025933 Ga0207706_10106560 Ga0207706_101065603 226
1240 3300025935 Ga0207709_10017672 Ga0207709_100176722 226
1241 3300025935 Ga0207709_10035285 Ga0207709_100352852 226
1242 3300025935 Ga0207709_10178766 Ga0207709_101787662 226
1243 3300025937 Ga0207669_10251376 Ga0207669_102513761 226
1244 3300025938 Ga0207704_10429983 Ga0207704_104299831 226
1245 3300025940 Ga0207691_10005671 Ga0207691_100056718 226
1246 3300025940 Ga0207691_10262581 Ga0207691_102625812 226
1247 3300025941 Ga0207711_10000357 Ga0207711_100003579 226
1248 3300025941 Ga0207711_10056370 Ga0207711_100563704 226
1249 3300025942 Ga0207689_10013205 Ga0207689_100132052 226
1250 3300025944 Ga0207661_10009949 Ga0207661_100099497 226
1251 3300025944 Ga0207661_10042144 Ga0207661_100421443 226
1252 3300025944 Ga0207661_10074417 Ga0207661_100744172 226
1253 3300025945 Ga0207679_10005935 Ga0207679_100059353 226
1254 3300025949 Ga0207667_10012942 Ga0207667_1001294210 226
1255 3300025960 Ga0207651_10010662 Ga0207651_100106626 226
1256 3300025961 Ga0207712_10011271 Ga0207712_100112711 226
1257 3300025961 Ga0207712_10047322 Ga0207712_100473224 226
1258 3300025961 Ga0207712_10367077 Ga0207712_103670772 226
1259 3300025972 Ga0207668_10303567 Ga0207668_103035672 226
1260 3300025986 Ga0207658_10043456 Ga0207658_100434562 226
1261 3300025986 Ga0207658_10058273 Ga0207658_100582734 226
1262 3300026023 Ga0207677_10009515 Ga0207677_100095152 226
1263 3300026035 Ga0207703_10009560 Ga0207703_100095606 226
1264 3300026067 Ga0207678_10004858 Ga0207678_100048584 226
1265 3300026078 Ga0207702_10127692 Ga0207702_101276923 226
1266 3300026078 Ga0207702_10350848 Ga0207702_103508481 226
1267 3300026078 Ga0207702_10473485 Ga0207702_104734852 226
1268 3300026088 Ga0207641_10014037 Ga0207641_100140372 226
1269 3300026118 Ga0207675_100705376 Ga0207675_1007053761 226
1270 3300026121 Ga0207683_10007071 Ga0207683_1000707110 226
1271 3300026121 Ga0207683_10028508 Ga0207683_100285084 226
1272 3300026121 Ga0207683_10080070 Ga0207683_100800702 226
1273 3300027866 Ga0209813_10039637 Ga0209813_100396372 226
1274 3300027907 Ga0207428_10004452 Ga0207428_1000445210 226
1275 3300027907 Ga0207428_10004666 Ga0207428_100046668 226
1276 3300028379 Ga0268266_10558977 Ga0268266_105589772 226
1277 3300028380 Ga0268265_10000301 Ga0268265_1000030138 226
1278 3300028381 Ga0268264_10122036 Ga0268264_101220362 226
1279 3300028666 Ga0265336_10017438 Ga0265336_100174382 226
1280 3300028786 Ga0307517_10048046 Ga0307517_100480465 226
1281 3300028794 Ga0307515_10068935 Ga0307515_100689354 226
1282 3300028800 Ga0265338_10016035 Ga0265338_100160357 226
1283 3300030742 Ga0316183_1015614 Ga0316183_10156142 226
1284 3300030744 Ga0316181_1253205 Ga0316181_12532052 226
1285 3300030745 Ga0316182_1205415 Ga0316182_12054151 226
1286 3300031240 Ga0265320_10011336 Ga0265320_100113363 226
1287 3300031241 Ga0265325_10001754 Ga0265325_100017545 226
1288 3300031247 Ga0265340_10001024 Ga0265340_100010245 226
1289 3300031249 Ga0265339_10006471 Ga0265339_100064719 226
1290 3300031344 Ga0265316_10067843 Ga0265316_100678432 226
1291 3300031456 Ga0307513_10000001 Ga0307513_10000001289 226
1292 3300031507 Ga0307509_10342842 Ga0307509_103428422 226
1293 3300031548 Ga0307408_100005164 Ga0307408_1000051643 226
1294 3300031548 Ga0307408_100016000 Ga0307408_1000160005 226
1295 3300031548 Ga0307408_100027662 Ga0307408_1000276622 226
1296 3300031548 Ga0307408_100032792 Ga0307408_1000327922 226
1297 3300031548 Ga0307408_100037452 Ga0307408_1000374522 226
1298 3300031548 Ga0307408_100055182 Ga0307408_1000551822 226
1299 3300031548 Ga0307408_100061286 Ga0307408_1000612863 226
1300 3300031548 Ga0307408_100073303 Ga0307408_1000733032 226
1301 3300031548 Ga0307408_100075640 Ga0307408_1000756404 226
1302 3300031548 Ga0307408_100147900 Ga0307408_1001479001 226
1303 3300031548 Ga0307408_100173071 Ga0307408_1001730712 226
1304 3300031548 Ga0307408_100286218 Ga0307408_1002862182 226
1305 3300031548 Ga0307408_100492540 Ga0307408_1004925401 226
1306 3300031548 Ga0307408_100573670 Ga0307408_1005736701 226
1307 3300031548 Ga0307408_100752048 Ga0307408_1007520481 226
1308 3300031548 Ga0307408_100904279 Ga0307408_1009042791 226
1309 3300031595 Ga0265313_10021221 Ga0265313_100212214 226
1310 3300031616 Ga0307508_10074392 Ga0307508_100743921 226
1311 3300031711 Ga0265314_10015557 Ga0265314_100155577 226
1312 3300031712 Ga0265342_10271656 Ga0265342_102716562 226
1313 3300031731 Ga0307405_10007053 Ga0307405_100070535 226
1314 3300031731 Ga0307405_10015310 Ga0307405_100153102 226
1315 3300031731 Ga0307405_10016394 Ga0307405_100163944 226
1316 3300031731 Ga0307405_10072931 Ga0307405_100729312 226
1317 3300031731 Ga0307405_10073209 Ga0307405_100732092 226
1318 3300031731 Ga0307405_10079051 Ga0307405_100790512 226
1319 3300031731 Ga0307405_10090262 Ga0307405_100902622 226
1320 3300031731 Ga0307405_10123870 Ga0307405_101238702 226
1321 3300031731 Ga0307405_10339060 Ga0307405_103390602 226
1322 3300031731 Ga0307405_10530132 Ga0307405_105301322 226
1323 3300031731 Ga0307405_10573289 Ga0307405_105732892 226
1324 3300031731 Ga0307405_10607003 Ga0307405_106070031 226
1325 3300031824 Ga0307413_10012935 Ga0307413_100129352 226
1326 3300031824 Ga0307413_10078543 Ga0307413_100785432 226
1327 3300031824 Ga0307413_10125716 Ga0307413_101257162 226
1328 3300031824 Ga0307413_10137909 Ga0307413_101379092 226
1329 3300031824 Ga0307413_10222586 Ga0307413_102225862 226
1330 3300031824 Ga0307413_10349432 Ga0307413_103494321 226
1331 3300031852 Ga0307410_10002324 Ga0307410_100023241 226
1332 3300031852 Ga0307410_10004438 Ga0307410_100044387 226
1333 3300031852 Ga0307410_10011957 Ga0307410_100119572 226
1334 3300031852 Ga0307410_10027074 Ga0307410_100270743 226
1335 3300031852 Ga0307410_10036116 Ga0307410_100361162 226
1336 3300031852 Ga0307410_10080447 Ga0307410_100804472 226
1337 3300031852 Ga0307410_10105887 Ga0307410_101058872 226
1338 3300031852 Ga0307410_10208422 Ga0307410_102084222 226
1339 3300031852 Ga0307410_10214353 Ga0307410_102143532 226
1340 3300031852 Ga0307410_10290141 Ga0307410_102901411 226
1341 3300031852 Ga0307410_10472549 Ga0307410_104725492 226
1342 3300031852 Ga0307410_10667372 Ga0307410_106673721 226
1343 3300031901 Ga0307406_10031116 Ga0307406_100311162 226
1344 3300031901 Ga0307406_10064492 Ga0307406_100644923 226
1345 3300031901 Ga0307406_10067807 Ga0307406_100678073 226
1346 3300031901 Ga0307406_10101009 Ga0307406_101010092 226
1347 3300031901 Ga0307406_10199598 Ga0307406_101995982 226
1348 3300031901 Ga0307406_10266599 Ga0307406_102665992 226
1349 3300031901 Ga0307406_10700924 Ga0307406_107009241 226
1350 3300031903 Ga0307407_10005454 Ga0307407_100054542 226
1351 3300031903 Ga0307407_10012988 Ga0307407_100129883 226
1352 3300031903 Ga0307407_10014241 Ga0307407_100142414 226
1353 3300031903 Ga0307407_10031637 Ga0307407_100316374 226
1354 3300031903 Ga0307407_10087264 Ga0307407_100872642 226
1355 3300031903 Ga0307407_10097549 Ga0307407_100975492 226
1356 3300031911 Ga0307412_10005839 Ga0307412_100058394 226
1357 3300031911 Ga0307412_10008626 Ga0307412_100086263 226
1358 3300031911 Ga0307412_10028258 Ga0307412_100282584 226
1359 3300031911 Ga0307412_10035361 Ga0307412_100353612 226
1360 3300031911 Ga0307412_10079484 Ga0307412_100794842 226
1361 3300031911 Ga0307412_10086977 Ga0307412_100869772 226
1362 3300031911 Ga0307412_10088391 Ga0307412_100883912 226
1363 3300031911 Ga0307412_10094891 Ga0307412_100948912 226
1364 3300031911 Ga0307412_10105408 Ga0307412_101054082 226
1365 3300031911 Ga0307412_10157056 Ga0307412_101570562 226
1366 3300031911 Ga0307412_10187445 Ga0307412_101874451 226
1367 3300031911 Ga0307412_10202375 Ga0307412_102023752 226
1368 3300031911 Ga0307412_10422219 Ga0307412_104222192 226
1369 3300031911 Ga0307412_11068588 Ga0307412_110685881 226
1370 3300031995 Ga0307409_100003794 Ga0307409_1000037943 226
1371 3300031995 Ga0307409_100015008 Ga0307409_1000150082 226
1372 3300031995 Ga0307409_100017156 Ga0307409_1000171562 226
1373 3300031995 Ga0307409_100056910 Ga0307409_1000569102 226
1374 3300031995 Ga0307409_100068474 Ga0307409_1000684743 226
1375 3300031995 Ga0307409_100130496 Ga0307409_1001304962 226
1376 3300031995 Ga0307409_100142442 Ga0307409_1001424422 226
1377 3300031995 Ga0307409_100404819 Ga0307409_1004048191 226
1378 3300031995 Ga0307409_100620273 Ga0307409_1006202731 226
1379 3300031995 Ga0307409_100720737 Ga0307409_1007207371 226
1380 3300031995 Ga0307409_100832275 Ga0307409_1008322752 226
1381 3300032002 Ga0307416_100000902 Ga0307416_1000009024 226
1382 3300032002 Ga0307416_100005303 Ga0307416_1000053038 226
1383 3300032002 Ga0307416_100044194 Ga0307416_1000441944 226
1384 3300032002 Ga0307416_100045316 Ga0307416_1000453162 226
1385 3300032002 Ga0307416_100065823 Ga0307416_1000658232 226
1386 3300032002 Ga0307416_100071504 Ga0307416_1000715042 226
1387 3300032002 Ga0307416_100105793 Ga0307416_1001057931 226
1388 3300032002 Ga0307416_100118332 Ga0307416_1001183323 226
1389 3300032002 Ga0307416_100133618 Ga0307416_1001336182 226
1390 3300032002 Ga0307416_100222932 Ga0307416_1002229322 226
1391 3300032002 Ga0307416_100233912 Ga0307416_1002339122 226
1392 3300032002 Ga0307416_100245822 Ga0307416_1002458221 226
1393 3300032002 Ga0307416_100321560 Ga0307416_1003215602 226
1394 3300032002 Ga0307416_100368499 Ga0307416_1003684991 226
1395 3300032002 Ga0307416_100448907 Ga0307416_1004489072 226
1396 3300032002 Ga0307416_100703253 Ga0307416_1007032531 226
1397 3300032004 Ga0307414_10365907 Ga0307414_103659072 226
1398 3300032004 Ga0307414_10405518 Ga0307414_104055182 226
1399 3300032004 Ga0307414_10793654 Ga0307414_107936542 226
1400 3300032005 Ga0307411_10006668 Ga0307411_100066686 226
1401 3300032005 Ga0307411_10124243 Ga0307411_101242431 226
1402 3300032005 Ga0307411_10227633 Ga0307411_102276332 226
1403 3300032005 Ga0307411_10234357 Ga0307411_102343572 226
1404 3300032005 Ga0307411_10561784 Ga0307411_105617842 226
1405 3300032126 Ga0307415_100048630 Ga0307415_1000486301 226
1406 3300032126 Ga0307415_100075741 Ga0307415_1000757412 226
1407 3300032126 Ga0307415_100085017 Ga0307415_1000850172 226
1408 3300032126 Ga0307415_100163003 Ga0307415_1001630032 226
1409 3300032126 Ga0307415_100174882 Ga0307415_1001748822 226
1410 3300032126 Ga0307415_100178041 Ga0307415_1001780412 226
1411 3300032126 Ga0307415_100201065 Ga0307415_1002010652 226
1412 3300032126 Ga0307415_100218169 Ga0307415_1002181691 226
1413 3300032126 Ga0307415_100648544 Ga0307415_1006485442 226
1414 3300032126 Ga0307415_100837657 Ga0307415_1008376571 226
1415 3300033180 Ga0307510_10103679 Ga0307510_101036792 226
1416 3300037312 Ga0395899_0064125 Ga0395899_0064125_40_720 226
1417 3300037312 Ga0395899_0088309 Ga0395899_0088309_599_1279 226
1418 3300037418 Ga0395900_0084120 Ga0395900_0084120_1851_2531 226
1419 3300037418 Ga0395900_0086719 Ga0395900_0086719_397_1077 226
1420 3300037466 Ga0395898_0049824 Ga0395898_0049824_1093_1773 226
1421 3300037466 Ga0395898_0060318 Ga0395898_0060318_2422_3102 226
1422 3300037466 Ga0395898_0098159 Ga0395898_0098159_68_748 226
1423 3300037466 Ga0395898_0124865 Ga0395898_0124865_67_747 226
1424 3300037466 Ga0395898_0205907 Ga0395898_0205907_162_842 226
1425 3300037471 Ga0395905_0015221 Ga0395905_0015221_6199_6879 226
1426 3300037471 Ga0395905_0512248 Ga0395905_0512248_222_902 226
1427 3300038443 Ga0395901_0001750 Ga0395901_0001750_19680_20360 226
1428 3300038443 Ga0395901_0022967 Ga0395901_0022967_2668_3348 226
1429 3300038443 Ga0395901_0215506 Ga0395901_0215506_1155_1835 226
1430 3300038443 Ga0395901_0418140 Ga0395901_0418140_49_729 226
1431 3300038443 Ga0395901_0527063 Ga0395901_0527063_90_770 226
1432 3300038735 Ga0400485_05539 Ga0400485_05539_2441_3121 226
1433 3300038742 Ga0400486_22540 Ga0400486_22540_56417_57097 226
1434 3300039062 Ga0400483_128455 Ga0400483_128455_169_936 226
1435 3300039062 Ga0400483_273888 Ga0400483_273888_4299_5075 226
1436 3300039437 Ga0436365_0308134 Ga0436365_0308134_3123_3806 226
1437 3300039437 Ga0436365_1495022 Ga0436365_1495022_453_1133 226
1438 3300039453 Ga0436362_0652720 Ga0436362_0652720_234_914 226
1439 3300041404 Ga0439436_0006833 Ga0439436_0006833_1873_2559 226
1440 3300041404 Ga0439436_0008699 Ga0439436_0008699_176_856 226
1441 3300041404 Ga0439436_0023303 Ga0439436_0023303_143_823 226
1442 3300041405 Ga0439438_014731 Ga0439438_014731_1420_2100 226
1443 3300041406 Ga0439439_0003256 Ga0439439_0003256_2088_2774 226
1444 3300041406 Ga0439439_0007161 Ga0439439_0007161_916_1596 226
1445 3300041406 Ga0439439_0008921 Ga0439439_0008921_640_1320 226
1446 3300041407 Ga0439447_018092 Ga0439447_018092_171_851 226
1447 3300041410 Ga0439461_0005337 Ga0439461_0005337_1424_2104 226
1448 3300041411 Ga0439466_0001051 Ga0439466_0001051_3103_3783 226
1449 3300041411 Ga0439466_0042351 Ga0439466_0042351_445_1125 226
1450 3300041411 Ga0439466_0049119 Ga0439466_0049119_54_734 226
1451 3300041413 Ga0439465_0015070 Ga0439465_0015070_572_1252 226
1452 3300041452 Ga0451793_0488353 Ga0451793_0488353_4150_4830 226
1453 3300041453 Ga0451797_0694708 Ga0451797_0694708_3097_3777 226
1454 3300041456 Ga0451795_1381046 Ga0451795_1381046_1817_2497 226
1455 3300041486 Ga0451807_0477298 Ga0451807_0477298_790_1470 226
1456 3300041509 Ga0451843_0362347 Ga0451843_0362347_60_740 226
1457 3300041512 Ga0451853_1498319 Ga0451853_1498319_107_811 226
1458 3300041999 Ga0439433_0000260 Ga0439433_0000260_5107_5787 226
1459 3300041999 Ga0439433_0002202 Ga0439433_0002202_2816_3496 226
1460 3300041999 Ga0439433_0019342 Ga0439433_0019342_212_898 226
1461 3300042002 Ga0439442_000269 Ga0439442_000269_8362_9042 226
1462 3300042002 Ga0439442_006136 Ga0439442_006136_449_1129 226
1463 3300042002 Ga0439442_011812 Ga0439442_011812_196_882 226
1464 3300042002 Ga0439442_020281 Ga0439442_020281_67_747 226
1465 3300042006 Ga0439432_010720 Ga0439432_010720_427_1107 226
1466 3300042007 Ga0439449_0003153 Ga0439449_0003153_386_1066 226
1467 3300042007 Ga0439449_0003322 Ga0439449_0003322_5352_6032 226
1468 3300042007 Ga0439449_0004923 Ga0439449_0004923_483_1169 226
1469 3300042007 Ga0439449_0028885 Ga0439449_0028885_913_1593 226
1470 3300042010 Ga0439452_004513 Ga0439452_004513_2768_3448 226
1471 3300042014 Ga0439457_002935 Ga0439457_002935_2161_2841 226
1472 3300042014 Ga0439457_003741 Ga0439457_003741_3360_4046 226
1473 3300042014 Ga0439457_038990 Ga0439457_038990_281_967 226
1474 3300042015 Ga0439462_0011701 Ga0439462_0011701_1158_1838 226
1475 3300042121 Ga0450919_000753 Ga0450919_000753_2169_2849 226
1476 3300042122 Ga0450920_006830 Ga0450920_006830_482_1162 226
1477 3300042146 Ga0450907_005635 Ga0450907_005635_1170_1856 226
1478 3300042146 Ga0450907_008522 Ga0450907_008522_386_1066 226
1479 3300042156 Ga0439446_0053122 Ga0439446_0053122_446_1126 226
1480 3300042184 Ga0450908_002304 Ga0450908_002304_240_920 226
1481 3300042185 Ga0450909_001099 Ga0450909_001099_2569_3249 226
1482 3300042435 Ga0439434_0000679 Ga0439434_0000679_1970_2650 226
1483 3300042531 Ga0450918_034841 Ga0450918_034841_72_752 226
1484 3300044656 Ga0466969_0032373 Ga0466969_0032373_1836_2522 226
1485 3300044656 Ga0466969_0087342 Ga0466969_0087342_580_1260 226
1486 3300044658 Ga0466972_0106094 Ga0466972_0106094_110_790 226
1487 3300044683 Ga0466965_0069833 Ga0466965_0069833_625_1305 226
1488 3300044683 Ga0466965_0095266 Ga0466965_0095266_821_1507 226
1489 3300044683 Ga0466965_0304716 Ga0466965_0304716_119_805 226
1490 3300044684 Ga0466966_0005677 Ga0466966_0005677_293_973 226
1491 3300044684 Ga0466966_0023799 Ga0466966_0023799_89_769 226
1492 3300044684 Ga0466966_0072661 Ga0466966_0072661_199_888 226
1493 3300044684 Ga0466966_0106241 Ga0466966_0106241_280_960 226
1494 3300044684 Ga0466966_0201128 Ga0466966_0201128_493_1179 226
1495 3300044684 Ga0466966_0462898 Ga0466966_0462898_25_705 226
1496 3300044693 Ga0466961_0003699 Ga0466961_0003699_6319_7005 226
1497 3300044693 Ga0466961_0005124 Ga0466961_0005124_3595_4284 226
1498 3300044693 Ga0466961_0037056 Ga0466961_0037056_792_1472 226
1499 3300044693 Ga0466961_0039848 Ga0466961_0039848_190_876 226
1500 3300044693 Ga0466961_0072862 Ga0466961_0072862_1080_1760 226
1501 3300044693 Ga0466961_0079267 Ga0466961_0079267_182_862 226
1502 3300044693 Ga0466961_0099559 Ga0466961_0099559_1109_1789 226
1503 3300044693 Ga0466961_0234779 Ga0466961_0234779_219_899 226
1504 3300044693 Ga0466961_0425095 Ga0466961_0425095_10_690 226
1505 3300044694 Ga0466963_0005018 Ga0466963_0005018_2409_3089 226
1506 3300044694 Ga0466963_0005440 Ga0466963_0005440_4064_4744 226
1507 3300044694 Ga0466963_0007432 Ga0466963_0007432_2423_3103 226
1508 3300044694 Ga0466963_0020152 Ga0466963_0020152_3418_4098 226
1509 3300044694 Ga0466963_0031784 Ga0466963_0031784_1527_2207 226
1510 3300044694 Ga0466963_0046863 Ga0466963_0046863_2126_2806 226
1511 3300044694 Ga0466963_0078039 Ga0466963_0078039_1194_1874 226
1512 3300044694 Ga0466963_0103255 Ga0466963_0103255_50_733 226
1513 3300044694 Ga0466963_0144967 Ga0466963_0144967_97_777 226
1514 3300044694 Ga0466963_0217533 Ga0466963_0217533_585_1271 226
1515 3300044694 Ga0466963_0261433 Ga0466963_0261433_62_742 226
1516 3300044694 Ga0466963_0291896 Ga0466963_0291896_184_864 226
1517 3300044694 Ga0466963_0399528 Ga0466963_0399528_23_703 226
1518 3300044719 Ga0466971_0004022 Ga0466971_0004022_682_1368 226
1519 3300044719 Ga0466971_0007127 Ga0466971_0007127_3548_4228 226
1520 3300044719 Ga0466971_0026801 Ga0466971_0026801_1463_2149 226
1521 3300044719 Ga0466971_0239586 Ga0466971_0239586_80_760 226
1522 3300044765 Ga0466970_0047224 Ga0466970_0047224_801_1487 226
1523 3300044765 Ga0466970_0065770 Ga0466970_0065770_1180_1860 226
1524 3300044765 Ga0466970_0468714 Ga0466970_0468714_14_700 226
1525 3300044842 Ga0466957_0012062 Ga0466957_0012062_1945_2631 226
1526 3300044842 Ga0466957_0051871 Ga0466957_0051871_211_891 226
1527 3300044842 Ga0466957_0130697 Ga0466957_0130697_571_1251 226
1528 3300044842 Ga0466957_0171754 Ga0466957_0171754_249_938 226
1529 3300044842 Ga0466957_0195404 Ga0466957_0195404_486_1169 226
1530 3300044842 Ga0466957_0273447 Ga0466957_0273447_111_791 226
1531 3300044842 Ga0466957_0443213 Ga0466957_0443213_61_744 226
1532 3300044901 Ga0466960_0003209 Ga0466960_0003209_3391_4122 226
1533 3300044901 Ga0466960_0112687 Ga0466960_0112687_30_710 226
1534 3300044901 Ga0466960_0321493 Ga0466960_0321493_22_705 226
1535 3300045049 Ga0466959_0000799 Ga0466959_0000799_6781_7467 226
1536 3300045049 Ga0466959_0073757 Ga0466959_0073757_854_1540 226
1537 3300045049 Ga0466959_0087636 Ga0466959_0087636_1128_1808 226
1538 3300045049 Ga0466959_0229954 Ga0466959_0229954_25_705 226
1539 3300045049 Ga0466959_0277744 Ga0466959_0277744_28_708 226
1540 3300045049 Ga0466959_0284293 Ga0466959_0284293_278_958 226
1541 3300045836 Ga0466958_0004510 Ga0466958_0004510_3052_3735 226
1542 3300045836 Ga0466958_0007800 Ga0466958_0007800_2218_2898 226
1543 3300045836 Ga0466958_0017971 Ga0466958_0017971_2734_3420 226
1544 3300045836 Ga0466958_0030121 Ga0466958_0030121_948_1628 226
1545 3300045836 Ga0466958_0044760 Ga0466958_0044760_1970_2650 226
1546 3300045836 Ga0466958_0071048 Ga0466958_0071048_812_1492 226
1547 3300045976 Ga0466967_0003476 Ga0466967_0003476_9435_10115 226
1548 3300045976 Ga0466967_0025215 Ga0466967_0025215_492_1172 226
1549 3300045976 Ga0466967_0045308 Ga0466967_0045308_1816_2502 226
1550 3300045976 Ga0466967_0059796 Ga0466967_0059796_1968_2648 226
1551 3300045976 Ga0466967_0064206 Ga0466967_0064206_1241_1924 226
1552 3300045976 Ga0466967_0065390 Ga0466967_0065390_1585_2268 226
1553 3300045976 Ga0466967_0123875 Ga0466967_0123875_596_1279 226
1554 3300045976 Ga0466967_0128387 Ga0466967_0128387_904_1584 226
1555 3300045976 Ga0466967_0170992 Ga0466967_0170992_1019_1699 226
1556 3300045976 Ga0466967_0205549 Ga0466967_0205549_637_1317 226
1557 3300045976 Ga0466967_0421660 Ga0466967_0421660_264_944 226
1558 3300045976 Ga0466967_0814876 Ga0466967_0814876_30_710 226
1559 3300046461 Ga0495641_0024793 Ga0495641_0024793_441_1121 226
1560 3300046461 Ga0495641_0104322 Ga0495641_0104322_468_1148 226
1561 3300046463 Ga0495653_0006896 Ga0495653_0006896_6485_7165 226
1562 3300046472 Ga0495580_0014881 Ga0495580_0014881_591_1271 226
1563 3300046475 Ga0495639_0020518 Ga0495639_0020518_2150_2830 226
1564 3300046477 Ga0495664_0076660 Ga0495664_0076660_153_833 226
1565 3300046477 Ga0495664_0168700 Ga0495664_0168700_612_1292 226
1566 3300046499 Ga0495594_0078434 Ga0495594_0078434_296_976 226
1567 3300046499 Ga0495594_0227677 Ga0495594_0227677_283_963 226
1568 3300046501 Ga0495607_0248740 Ga0495607_0248740_75_755 226
1569 3300046517 Ga0495630_0087628 Ga0495630_0087628_1337_2017 226
1570 3300046518 Ga0495631_0031118 Ga0495631_0031118_514_1194 226
1571 3300046518 Ga0495631_0096037 Ga0495631_0096037_100_786 226
1572 3300046522 Ga0495643_0098473 Ga0495643_0098473_92_772 226
1573 3300046525 Ga0495663_0069916 Ga0495663_0069916_424_1104 226
1574 3300046528 Ga0495642_0018365 Ga0495642_0018365_1164_1844 226
1575 3300046528 Ga0495642_0057106 Ga0495642_0057106_844_1524 226
1576 3300046528 Ga0495642_0154260 Ga0495642_0154260_275_955 226
1577 3300046530 Ga0495654_0056838 Ga0495654_0056838_824_1504 226
1578 3300046531 Ga0495665_0004689 Ga0495665_0004689_181_861 226
1579 3300046531 Ga0495665_0030512 Ga0495665_0030512_1168_1857 226
1580 3300046531 Ga0495665_0034836 Ga0495665_0034836_1912_2592 226
1581 3300046535 Ga0495586_0079492 Ga0495586_0079492_197_877 226
1582 3300046536 Ga0495587_0035365 Ga0495587_0035365_1723_2403 226
1583 3300046543 Ga0495645_0014119 Ga0495645_0014119_1751_2431 226
1584 3300046543 Ga0495645_0064402 Ga0495645_0064402_1545_2225 226
1585 3300046558 Ga0495633_0087005 Ga0495633_0087005_513_1193 226
1586 3300046559 Ga0495667_0000893 Ga0495667_0000893_2140_2820 226
1587 3300046559 Ga0495667_0126107 Ga0495667_0126107_33_713 226
1588 3300046615 Ga0495656_0021159 Ga0495656_0021159_1183_1863 226
1589 3300046664 Ga0495659_0037409 Ga0495659_0037409_988_1668 226
1590 3300046674 Ga0495588_0023188 Ga0495588_0023188_2155_2835 226
1591 3300046674 Ga0495588_0055876 Ga0495588_0055876_710_1390 226
1592 3300046674 Ga0495588_0056110 Ga0495588_0056110_472_1152 226
1593 3300046675 Ga0495657_0017106 Ga0495657_0017106_2179_2859 226
1594 3300046679 Ga0495623_0042872 Ga0495623_0042872_2102_2782 226
1595 3300046689 Ga0495613_0148484 Ga0495613_0148484_89_769 226
1596 3300046809 Ga0495600_0018577 Ga0495600_0018577_2355_3035 226
1597 3300046809 Ga0495600_0306038 Ga0495600_0306038_210_890 226
1598 3300047315 Ga0495581_0043587 Ga0495581_0043587_673_1353 226
1599 3300047315 Ga0495581_0055725 Ga0495581_0055725_564_1244 226
1600 3300047315 Ga0495581_0059368 Ga0495581_0059368_739_1419 226
1601 3300047315 Ga0495581_0120113 Ga0495581_0120113_107_787 226
1602 3300047315 Ga0495581_0153760 Ga0495581_0153760_241_921 226
1603 3300047315 Ga0495581_0328282 Ga0495581_0328282_100_789 226
1604 3300047315 Ga0495581_0337139 Ga0495581_0337139_55_735 226
1605 3300047317 Ga0495604_0254165 Ga0495604_0254165_461_1141 226
1606 3300047318 Ga0495636_0039019 Ga0495636_0039019_922_1602 226
1607 3300047322 Ga0495680_0029703 Ga0495680_0029703_1651_2331 226
1608 3300047322 Ga0495680_0122908 Ga0495680_0122908_148_828 226
1609 3300047444 Ga0495675_0041407 Ga0495675_0041407_373_1053 226
1610 3300047444 Ga0495675_0361261 Ga0495675_0361261_121_807 226
1611 3300047447 Ga0495685_142381 Ga0495685_142381_38_718 226
1612 3300047470 Ga0495681_0121821 Ga0495681_0121821_360_1040 226
1613 3300047471 Ga0495684_0204267 Ga0495684_0204267_733_1413 226
1614 3300048903 Ga0496100_0103874 Ga0496100_0103874_324_1004 226
1615 3300048903 Ga0496100_0114353 Ga0496100_0114353_956_1636 226
1616 3300048904 Ga0496101_0021074 Ga0496101_0021074_1145_1825 226
1617 3300048904 Ga0496101_0228841 Ga0496101_0228841_698_1378 226
1618 3300048905 Ga0496102_0001269 Ga0496102_0001269_3148_3834 226
1619 3300048905 Ga0496102_0009801 Ga0496102_0009801_6455_7135 226
1620 3300048905 Ga0496102_0087762 Ga0496102_0087762_72_752 226
1621 3300048905 Ga0496102_0126603 Ga0496102_0126603_892_1572 226
1622 3300048905 Ga0496102_0152320 Ga0496102_0152320_565_1245 226
1623 3300048905 Ga0496102_0570234 Ga0496102_0570234_92_775 226
1624 3300048905 Ga0496102_0593515 Ga0496102_0593515_288_968 226
1625 3300048906 Ga0496103_0018655 Ga0496103_0018655_1415_2095 226
1626 3300048906 Ga0496103_0029132 Ga0496103_0029132_1717_2397 226
1627 3300048906 Ga0496103_0092429 Ga0496103_0092429_205_945 226
1628 3300048906 Ga0496103_0132762 Ga0496103_0132762_826_1506 226
1629 3300048907 Ga0496104_0000677 Ga0496104_0000677_10052_10732 226
1630 3300048907 Ga0496104_0732910 Ga0496104_0732910_20_703 226
1631 3300048908 Ga0496105_0007909 Ga0496105_0007909_2582_3262 226
1632 3300048908 Ga0496105_0063313 Ga0496105_0063313_838_1518 226
1633 3300048908 Ga0496105_0067874 Ga0496105_0067874_241_921 226
1634 3300048910 Ga0496107_0132777 Ga0496107_0132777_827_1507 226
1635 3300048911 Ga0496108_0002096 Ga0496108_0002096_4056_4736 226
1636 3300048911 Ga0496108_0145310 Ga0496108_0145310_888_1568 226
1637 3300048911 Ga0496108_0205105 Ga0496108_0205105_1006_1686 226
1638 3300048911 Ga0496108_0281742 Ga0496108_0281742_55_735 226
1639 3300048911 Ga0496108_0364632 Ga0496108_0364632_482_1162 226
1640 3300048912 Ga0496109_0019346 Ga0496109_0019346_5015_5695 226
1641 3300048912 Ga0496109_0086667 Ga0496109_0086667_1875_2555 226
1642 3300048912 Ga0496109_0107932 Ga0496109_0107932_701_1381 226
1643 3300048912 Ga0496109_0180005 Ga0496109_0180005_995_1675 226
1644 3300048913 Ga0496110_0032019 Ga0496110_0032019_383_1063 226
1645 3300048913 Ga0496110_0037321 Ga0496110_0037321_2773_3453 226
1646 3300048913 Ga0496110_0224875 Ga0496110_0224875_812_1492 226
1647 3300048913 Ga0496110_0651186 Ga0496110_0651186_196_879 226
1648 3300048914 Ga0496111_0006826 Ga0496111_0006826_5034_5714 226
1649 3300048915 Ga0496112_0204767 Ga0496112_0204767_963_1643 226
1650 3300048916 Ga0496113_0022828 Ga0496113_0022828_1566_2246 226
1651 3300048916 Ga0496113_0485260 Ga0496113_0485260_85_765 226
1652 3300048916 Ga0496113_0668689 Ga0496113_0668689_48_731 226
1653 3300048917 Ga0496114_0001765 Ga0496114_0001765_3018_3698 226
1654 3300048917 Ga0496114_0117138 Ga0496114_0117138_192_872 226
1655 3300048917 Ga0496114_0139188 Ga0496114_0139188_920_1600 226
1656 3300048917 Ga0496114_0161986 Ga0496114_0161986_143_823 226
1657 3300048917 Ga0496114_0247422 Ga0496114_0247422_804_1484 226
1658 3300048917 Ga0496114_0279667 Ga0496114_0279667_551_1231 226
1659 3300048917 Ga0496114_0305878 Ga0496114_0305878_535_1215 226
1660 3300048917 Ga0496114_0708282 Ga0496114_0708282_137_817 226
1661 3300048918 Ga0496115_0071896 Ga0496115_0071896_1563_2243 226
1662 3300048918 Ga0496115_0135168 Ga0496115_0135168_78_758 226
1663 3300048918 Ga0496115_0408775 Ga0496115_0408775_27_707 226
1664 3300048918 Ga0496115_0569984 Ga0496115_0569984_68_751 226
1665 3300048919 Ga0496116_0000182 Ga0496116_0000182_26101_26784 226
1666 3300048920 Ga0496117_0007048 Ga0496117_0007048_9905_10588 226
1667 3300048920 Ga0496117_0037616 Ga0496117_0037616_2442_3125 226
1668 3300048921 Ga0496118_0001362 Ga0496118_0001362_9911_10594 226
1669 3300048921 Ga0496118_0113997 Ga0496118_0113997_498_1181 226
1670 3300048921 Ga0496118_0176247 Ga0496118_0176247_246_929 226
1671 3300048922 Ga0496119_0006711 Ga0496119_0006711_4909_5592 226
1672 3300048927 Ga0496124_0199513 Ga0496124_0199513_581_1261 226
1673 3300048927 Ga0496124_0213832 Ga0496124_0213832_741_1421 226
1674 3300048928 Ga0496125_0024117 Ga0496125_0024117_1516_2196 226
1675 3300048929 Ga0496126_0000003 Ga0496126_0000003_484355_485035 226
1676 3300048929 Ga0496126_0030497 Ga0496126_0030497_3457_4137 226
1677 3300048929 Ga0496126_0346035 Ga0496126_0346035_436_1116 226
1678 3300049568 Ga0501031_0258313 Ga0501031_0258313_147_827 226
1679 3300049569 Ga0501032_0026939 Ga0501032_0026939_1545_2228 226
1680 3300049569 Ga0501032_0074717 Ga0501032_0074717_815_1495 226
1681 3300049571 Ga0501034_0707902 Ga0501034_0707902_162_845 226
1682 3300049572 Ga0501036_0047948 Ga0501036_0047948_710_1390 226
1683 3300049573 Ga0501037_0565599 Ga0501037_0565599_24_704 226
1684 3300049574 Ga0501038_0613663 Ga0501038_0613663_131_811 226
1685 3300049575 Ga0501039_0048091 Ga0501039_0048091_1549_2229 226
1686 3300049576 Ga0501040_0034216 Ga0501040_0034216_947_1627 226
1687 3300049577 Ga0501041_0425473 Ga0501041_0425473_20_703 226
1688 3300049578 Ga0501042_0011674 Ga0501042_0011674_2784_3464 226
1689 3300049579 Ga0501043_0009299 Ga0501043_0009299_4858_5538 226
1690 3300049579 Ga0501043_0124379 Ga0501043_0124379_592_1272 226
1691 3300049579 Ga0501043_0355735 Ga0501043_0355735_19_702 226
1692 3300049580 Ga0501046_0109796 Ga0501046_0109796_95_775 226
1693 3300049581 Ga0501047_0180220 Ga0501047_0180220_207_947 226
1694 3300049581 Ga0501047_0284410 Ga0501047_0284410_724_1407 226
1695 3300049585 Ga0501069_0001045 Ga0501069_0001045_3302_3985 226
1696 3300049585 Ga0501069_0066115 Ga0501069_0066115_367_1047 226
1697 3300049586 Ga0501070_0011128 Ga0501070_0011128_708_1391 226
1698 3300049586 Ga0501070_0014540 Ga0501070_0014540_5720_6403 226
1699 3300049587 Ga0501071_0065350 Ga0501071_0065350_1929_2609 226
1700 3300049587 Ga0501071_0746450 Ga0501071_0746450_29_715 226
1701 3300049588 Ga0501072_0028917 Ga0501072_0028917_862_1542 226
1702 3300049589 Ga0501073_0027437 Ga0501073_0027437_651_1334 226
1703 3300049590 Ga0501074_0022339 Ga0501074_0022339_1712_2395 226
1704 3300049590 Ga0501074_0045582 Ga0501074_0045582_878_1558 226
1705 3300049591 Ga0501075_0433296 Ga0501075_0433296_257_937 226
1706 3300049592 Ga0501076_0021629 Ga0501076_0021629_2469_3149 226
1707 3300049741 Ga0501079_0020182 Ga0501079_0020182_3126_3809 226
1708 3300049741 Ga0501079_0103348 Ga0501079_0103348_534_1214 226
1709 3300049742 Ga0501080_0019742 Ga0501080_0019742_4700_5383 226
1710 3300049742 Ga0501080_0113018 Ga0501080_0113018_1511_2194 226
1711 3300049743 Ga0501081_0012555 Ga0501081_0012555_2513_3193 226
1712 3300049744 Ga0501083_0141562 Ga0501083_0141562_551_1231 226
1713 3300049823 Ga0501044_0013397 Ga0501044_0013397_3895_4578 226
1714 3300049823 Ga0501044_0019557 Ga0501044_0019557_4440_5180 226
1715 3300049823 Ga0501044_0088696 Ga0501044_0088696_304_984 226
1716 3300050491 nmdc:mga00v17_373822_c1 nmdc:mga00v17_373822_c1_169_858 226
1717 3300050491 nmdc:mga00v17_41109_c1 nmdc:mga00v17_41109_c1_828_1586 226
1718 3300050492 nmdc:mga0yw44_49239_c1 nmdc:mga0yw44_49239_c1_1114_1848 226
1719 3300050496 nmdc:mga07m45_78446_c1 nmdc:mga07m45_78446_c1_388_1077 226
1720 3300050511 nmdc:mga08y16_2982_c1 nmdc:mga08y16_2982_c1_5984_6670 226
1721 3300053084 Ga0495595_0216594 Ga0495595_0216594_31_711 226
1722 3300053087 Ga0500643_000483 Ga0500643_000483_8696_9379 226
1723 3300054114 Ga0501084_0066720 Ga0501084_0066720_323_1003 226
1724 3300059508 Ga0587088_001988 Ga0587088_001988_1479_2165 226
1725 3300061719 Ga0466962_0007661 Ga0466962_0007661_3779_4459 226
1726 3300061719 Ga0466962_0011281 Ga0466962_0011281_2572_3258 226
1727 3300061719 Ga0466962_0013282 Ga0466962_0013282_1605_2285 226
1728 3300061719 Ga0466962_0024833 Ga0466962_0024833_2137_2823 226
1729 3300061719 Ga0466962_0076647 Ga0466962_0076647_15_695 226
1730 3300061719 Ga0466962_0148578 Ga0466962_0148578_77_817 226
1731 3300061734 Ga0530510_0060060 Ga0530510_0060060_782_1462 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

51

160

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

200

276

0.97

PF23198

40

141

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9965 3 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.996 3 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9933 1 121
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9906 3 118
1nxo-assembly1.cif.gz_A-2 micarec ph7.0 0.9868 3 119
ID Description Score Start End Superfamily
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9868 3 119 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9867 2 80 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9859 2 80 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9842 1 80 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9813 2 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-X8EZZ5-F1-model_v4 deleted 1.001 1 120
AF-A0A0M9XS95-F1-model_v4 Transcriptional regulatory protein AfsQ1 0.975 1 120 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0M9XS95-F1-model_v4 Transcriptional regulatory protein AfsQ1 0.9517 1 120 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1E7LJQ0-F1-model_v4 Transcriptional regulator 0.9409 1 145 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1E7LJQ0-F1-model_v4 Transcriptional regulator 0.9347 1 145 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
90.17 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map