metagRoot

F495478

General Info

Members	Datasets	Scaffolds	Average Seq Length
1723	592	1714	152

Family's Representative Sequence

Representative Sequence	3300005458\|Ga0070681_10898991\|Ga0070681_108989912
Length	187
Sequence	MTVRIELKVLDPRLAGWGFPHYGSELAAGLDLHACIDEPLLLRPQAPAVLISSGIAVRIGDPGWCALVLPRSGLGHREGLVLGNAVGLIDADYEGPCLVSAWNRNPASANRTDEGILIRPGDRIAQLVVTSVARPAFTVVAEFSARGGRQAGGFGSTGTAAADANACSDPAAGRHYPEREDPAARKP

Samples

	Sample ID	Description	Type	Environment
1	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
2	2643221665	Acinetobacter sp. Root1280	Isolate	Unclassified
3	2765235841	Pseudomonas putida AA7	Isolate	Unclassified
4	2855020534	Paracoccus endophyticus SYSUP0003	Isolate	Stem Tuber
5	2861691609	Methylorubrum thiocyanatum DSM 11490	Isolate	Rhizosphere
6	2919155634	Pseudomonas fulva 1992	Isolate	Unclassified
7	2928515477	Acinetobacter bereziniae 1375	Isolate	Rhizosphere
8	2952252522	Salinicola sp. DM10	Isolate	Unclassified
9	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
10	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
11	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
12	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
13	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
14	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
15	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
16	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
17	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
18	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
19	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
20	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
21	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
22	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
23	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
24	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
25	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
26	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
27	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
28	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
29	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
30	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
31	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
32	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
33	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
34	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
35	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
36	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
37	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
38	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
39	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
40	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
41	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
42	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
43	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
44	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
45	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
46	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
47	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
48	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
49	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
50	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
51	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
52	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
53	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
54	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
55	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
56	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
57	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
58	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
59	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
60	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
61	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
62	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
63	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
64	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
65	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
66	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
67	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
68	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
69	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
70	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
71	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
72	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
73	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
74	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
75	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
76	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
77	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
78	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
79	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
80	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
81	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
82	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
83	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
84	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
85	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
86	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
87	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
88	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
89	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
90	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
91	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
92	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
93	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
94	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
95	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
96	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
97	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
98	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
99	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
100	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
101	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
102	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
103	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
104	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
105	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
106	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
107	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
108	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
109	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
110	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
111	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
112	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
113	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
114	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
115	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
116	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
117	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
118	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
119	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
120	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
121	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
122	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
123	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
124	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
125	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
126	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
127	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
128	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
129	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
130	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
131	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
132	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
133	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
134	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
135	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
136	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
137	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
138	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
139	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
140	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
141	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
142	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
143	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
144	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
145	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
146	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
147	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
148	3300012475	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610	Metagenome	Rhizosphere
149	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
150	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
151	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
152	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
153	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
154	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
155	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
156	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
157	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
158	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
159	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
160	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
161	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
162	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
163	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
164	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
165	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
166	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
167	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
168	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
169	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
170	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
171	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
172	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
173	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
174	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
177	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
178	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
179	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
180	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
181	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
182	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
183	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
184	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
185	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
186	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
188	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
189	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
190	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
191	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
192	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
193	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
194	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
259	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
260	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
262	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
266	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
267	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
268	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
269	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
270	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
271	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
272	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
273	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
274	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
275	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
276	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
277	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
278	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
279	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
280	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
281	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
282	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
283	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
284	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
285	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
286	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
287	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
288	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
289	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
290	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
291	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
292	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
293	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
294	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
295	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
296	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
297	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
298	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
299	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
300	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
301	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
302	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
303	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
304	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
305	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
306	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
307	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
308	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
309	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
310	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
311	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
312	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
313	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
314	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
315	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
316	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
317	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
318	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
319	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
320	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
321	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
322	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
323	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
324	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
325	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
326	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
327	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
328	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
329	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
330	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
331	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
332	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
333	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
334	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
335	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
336	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
337	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
338	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
339	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
340	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
341	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
342	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
343	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
344	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
345	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
346	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
347	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
348	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
349	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
350	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
351	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
352	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
353	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
354	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
355	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
356	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
357	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
358	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
359	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
360	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
361	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
362	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
363	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
364	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
365	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
366	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
367	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
368	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
369	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
370	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
371	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
372	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
373	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
374	3300042117	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937	Metagenome	Rhizosphere
375	3300042120	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192	Metagenome	Rhizosphere
376	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
377	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
378	3300042130	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97	Metagenome	Rhizosphere
379	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
380	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
381	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
382	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
383	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
384	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
385	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
386	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
387	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
388	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
389	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
390	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
391	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
392	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
393	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
394	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
395	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
396	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
397	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
398	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
399	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
400	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
401	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
402	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
403	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
404	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
405	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
406	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
407	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
408	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
409	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
410	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
411	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
412	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
413	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
414	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
415	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
416	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
417	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
418	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
419	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
420	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
421	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
422	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
423	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
424	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
425	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
426	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
427	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
428	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
429	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
430	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
431	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
432	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
433	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
434	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
435	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
436	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
437	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
438	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
439	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
440	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
441	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
442	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
443	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
444	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
445	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
446	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
447	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
448	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
449	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
450	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
451	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
452	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
453	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
454	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
455	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
456	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
457	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
458	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
459	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
460	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
461	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
462	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
463	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
464	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
465	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
466	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
467	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
468	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
469	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
470	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
471	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
472	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
473	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
474	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
475	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
476	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
477	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
478	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
479	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
480	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
481	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
482	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
483	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
484	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
485	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
486	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
487	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
488	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
489	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
490	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
491	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
492	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
493	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
494	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
495	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
496	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
497	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
498	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
499	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
500	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
501	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
502	3300049530	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
503	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
504	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
505	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
506	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
507	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
508	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
509	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
510	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
511	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
512	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
513	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
514	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
515	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
516	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
517	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
518	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
519	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
520	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
521	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
522	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
523	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
524	3300049650	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought	Metagenome	Rhizosphere
525	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
526	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
527	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
528	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
529	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
530	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
531	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
532	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
533	3300049761	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control	Metagenome	Rhizosphere
534	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
535	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
536	3300049769	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought	Metagenome	Rhizosphere
537	3300049774	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought	Metagenome	Rhizosphere
538	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
539	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
540	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
541	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
542	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
543	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
544	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
545	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
546	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
547	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
548	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
549	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
550	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
551	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
552	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
553	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
554	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
555	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
556	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
557	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
558	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
559	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
560	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
561	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
562	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
563	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
564	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
565	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
566	3300053100	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere	Metagenome	Endosphere
567	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
568	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
569	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
570	3300053115	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere	Metagenome	Endosphere
571	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
572	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
573	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
574	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
575	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
576	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
577	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
578	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
579	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
580	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
581	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
582	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
583	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
584	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
585	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
586	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
587	3300053734	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere	Metagenome	Endosphere
588	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
589	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
590	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
591	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
592	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.25
Metatranscriptomes	0.17
Isolates	0.58

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	15.21
Nodule	0.41
Rhizoplane	3.83
Rhizosphere	74.41
Stem	0
Stem Tuber	0.06
Unclassified	6.09

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10012529	3300001979	Bacteria	3194
2	JGI25155J39150_1000079	3300002704	Bacteria	56287
3	JGI25156J39149_1000125	3300002705	Bacteria	56308
4	JGI25154J39366_1000141	3300002738	Bacteria	56305
5	JGI25157J39369_1000159	3300002741	Bacteria	56308
6	JGI25150J39212_1006333	3300002774	Bacteria	2452
7	JGI25150J39212_1007862	3300002774	Bacteria	2120
8	JGI25159J45721_1000638	3300002987	Bacteria	15559
9	JGI25159J45721_1002502	3300002987	Bacteria	6925
10	JGI25151J46595_10019053	3300003187	Bacteria	2928
11	JGI25406J46586_10000015	3300003203	Bacteria	91406
12	JGI25153J46596_10002603	3300003215	Bacteria	10329
13	JGI25153J46596_10002737	3300003215	Bacteria	10048
14	rootL2_10048698	3300003322	Bacteria	6451
15	rootH1_10008298	3300003316	Bacteria	7116
16	rootH1_10008298	3300003323	Bacteria	13422
17	rootH1_10032418	3300003323	Bacteria	4244
18	rootH1_10219628	3300003323	Bacteria	1059
19	rootH1_10235640	3300003323	Bacteria	3076
20	JGI25160J50197_1000067	3300003354	Bacteria	113436
21	JGI25161J50226_1000035	3300003374	Bacteria	133666
22	Ga0055526_1000542	3300003771	Bacteria	29770
23	Ga0055526_1007532	3300003771	Bacteria	5632
24	Ga0055526_1007544	3300003771	Bacteria	5625
25	Ga0055537_1001739	3300003773	Bacteria	8036
26	Ga0055537_1024062	3300003773	Bacteria	861
27	Ga0055524_1000006	3300003775	Bacteria	324702
28	Ga0055524_1000079	3300003775	Bacteria	120203
29	Ga0055524_1001129	3300003775	Bacteria	16068
30	Ga0055536_1000447	3300003781	Bacteria	29029
31	Ga0055534_1001178	3300003784	Bacteria	10992
32	Ga0055534_1003541	3300003784	Bacteria	4874
33	Ga0055528_1000374	3300003790	Bacteria	36367
34	Ga0055530_10000346	3300003791	Bacteria	41934
35	Ga0055530_10002750	3300003791	Bacteria	10882
36	Ga0055530_10013673	3300003791	Bacteria	2755
37	Ga0055530_10018865	3300003791	Bacteria	2110
38	Ga0055540_1000005	3300003792	Bacteria	378126
39	Ga0055540_1000086	3300003792	Bacteria	102576
40	Ga0055540_1056259	3300003792	Bacteria	797
41	Ga0055531_10000604	3300003794	Bacteria	31172
42	Ga0055531_10000607	3300003794	Bacteria	31111
43	Ga0055531_10002992	3300003794	Bacteria	10972
44	Ga0055531_10003346	3300003794	Bacteria	10256
45	Ga0055531_10005016	3300003794	Bacteria	7847
46	Ga0055531_10009416	3300003794	Bacteria	4992
47	Ga0055543_1001289	3300004625	Bacteria	10317
48	Ga0065165_1010114	3300005262	Bacteria	4130
49	Ga0065165_1014561	3300005262	Bacteria	3047
50	Ga0065165_1018974	3300005262	Bacteria	2470
51	Ga0065165_1021684	3300005262	Bacteria	2223
52	Ga0065712_10188573	3300005290	Bacteria	1148
53	Ga0065707_10242902	3300005295	Bacteria	1150
54	Ga0070658_10165783	3300005327	Bacteria	1855
55	Ga0070658_10178500	3300005327	Bacteria	1787
56	Ga0070658_10376755	3300005327	Bacteria	1217
57	Ga0070676_10002509	3300005328	Bacteria	9418
58	Ga0070676_10025454	3300005328	Bacteria	3345
59	Ga0070676_10075715	3300005328	Bacteria	2030
60	Ga0070676_10224705	3300005328	Bacteria	1242
61	Ga0070683_100037706	3300005329	Bacteria	4425
62	Ga0070683_100121661	3300005329	Bacteria	2466
63	Ga0070690_100010662	3300005330	Bacteria	5354
64	Ga0070690_100239905	3300005330	Bacteria	1278
65	Ga0070670_100024964	3300005331	Bacteria	5142
66	Ga0070670_100046533	3300005331	Bacteria	3731
67	Ga0070670_100949901	3300005331	Bacteria	780
68	Ga0070670_101241508	3300005331	Bacteria	681
69	Ga0070670_101617950	3300005331	Bacteria	595
70	Ga0070677_10006749	3300005333	Bacteria	3821
71	Ga0070677_10012615	3300005333	Bacteria	2937
72	Ga0070677_10017639	3300005333	Bacteria	2559
73	Ga0070677_10092265	3300005333	Bacteria	1319
74	Ga0070677_10334597	3300005333	Bacteria	780
75	Ga0068869_100012500	3300005334	Bacteria	5614
76	Ga0068869_100096147	3300005334	Bacteria	2235
77	Ga0070666_10000910	3300005335	Bacteria	17957
78	Ga0070666_10004166	3300005335	Bacteria	8775
79	Ga0070666_10241796	3300005335	Bacteria	1277
80	Ga0070666_10429708	3300005335	Bacteria	952
81	Ga0070666_10457645	3300005335	Bacteria	922
82	Ga0070680_100056960	3300005336	Bacteria	3194
83	Ga0070680_100157655	3300005336	Bacteria	1907
84	Ga0070680_100573155	3300005336	Bacteria	968
85	Ga0068868_100004895	3300005338	Bacteria	9402
86	Ga0068868_100019803	3300005338	Bacteria	5048
87	Ga0068868_100615315	3300005338	Bacteria	964
88	Ga0068868_101493088	3300005338	Bacteria	632
89	Ga0070660_100019427	3300005339	Bacteria	4980
90	Ga0070689_100103553	3300005340	Bacteria	2256
91	Ga0070689_101208455	3300005340	Bacteria	679
92	Ga0070691_10049116	3300005341	Bacteria	2009
93	Ga0070687_100107854	3300005343	Bacteria	1571
94	Ga0070661_100000925	3300005344	Bacteria	21020
95	Ga0070668_100000411	3300005347	Bacteria	28460
96	Ga0070668_100253166	3300005347	Bacteria	1463
97	Ga0070669_100005882	3300005353	Bacteria	8848
98	Ga0070669_100007708	3300005353	Bacteria	7696
99	Ga0070669_100153600	3300005353	Bacteria	1783
100	Ga0070669_100197215	3300005353	Bacteria	1582
101	Ga0070669_100442007	3300005353	Bacteria	1070
102	Ga0070675_100000199	3300005354	Bacteria	37845
103	Ga0070675_100003618	3300005354	Bacteria	11759
104	Ga0070675_100016158	3300005354	Bacteria	5918
105	Ga0070675_100025060	3300005354	Bacteria	4781
106	Ga0070675_100059825	3300005354	Bacteria	3144
107	Ga0070675_100063020	3300005354	Bacteria	3064
108	Ga0070675_100129478	3300005354	Bacteria	2149
109	Ga0070675_100175593	3300005354	Bacteria	1850
110	Ga0070675_100234314	3300005354	Bacteria	1602
111	Ga0070675_100261486	3300005354	Bacteria	1517
112	Ga0070675_100304386	3300005354	Bacteria	1405
113	Ga0070675_100605865	3300005354	Bacteria	993
114	Ga0070671_100068600	3300005355	Bacteria	2958
115	Ga0070671_100082092	3300005355	Bacteria	2695
116	Ga0070671_100119592	3300005355	Bacteria	2216
117	Ga0070671_100174389	3300005355	Bacteria	1819
118	Ga0070671_100282123	3300005355	Bacteria	1413
119	Ga0070671_100558339	3300005355	Bacteria	988
120	Ga0070671_100577438	3300005355	Bacteria	971
121	Ga0070671_100751456	3300005355	Bacteria	848
122	Ga0070674_100008421	3300005356	Bacteria	6142
123	Ga0070674_100009710	3300005356	Bacteria	5777
124	Ga0070674_100076188	3300005356	Bacteria	2384
125	Ga0070674_100171882	3300005356	Bacteria	1653
126	Ga0070674_100191479	3300005356	Bacteria	1574
127	Ga0070674_100224656	3300005356	Bacteria	1462
128	Ga0070674_100803409	3300005356	Bacteria	812
129	Ga0070674_101195863	3300005356	Bacteria	675
130	Ga0070673_100001468	3300005364	Bacteria	13793
131	Ga0070673_100008853	3300005364	Bacteria	6723
132	Ga0070673_100028271	3300005364	Bacteria	4167
133	Ga0070673_100070117	3300005364	Bacteria	2812
134	Ga0070673_100147698	3300005364	Bacteria	1988
135	Ga0070673_100150088	3300005364	Bacteria	1973
136	Ga0070673_100177443	3300005364	Bacteria	1822
137	Ga0070673_100319302	3300005364	Bacteria	1371
138	Ga0070688_100317323	3300005365	Bacteria	1131
139	Ga0070659_100001694	3300005366	Bacteria	15853
140	Ga0070659_100788685	3300005366	Bacteria	826
141	Ga0070667_100000463	3300005367	Bacteria	41711
142	Ga0070667_100003988	3300005367	Bacteria	12507
143	Ga0070667_100019707	3300005367	Bacteria	5596
144	Ga0070667_100044588	3300005367	Bacteria	3725
145	Ga0070667_100088182	3300005367	Bacteria	2664
146	Ga0070667_100162405	3300005367	Bacteria	1968
147	Ga0070667_100274337	3300005367	Bacteria	1513
148	Ga0070667_100857417	3300005367	Bacteria	844
149	Ga0070714_100085415	3300005435	Bacteria	2756
150	Ga0070714_100940801	3300005435	Bacteria	840
151	Ga0070713_100150212	3300005436	Bacteria	2071
152	Ga0070713_100276595	3300005436	Bacteria	1539
153	Ga0070713_100473741	3300005436	Bacteria	1179
154	Ga0070713_100495254	3300005436	Bacteria	1153
155	Ga0070713_100626243	3300005436	Bacteria	1023
156	Ga0070713_100753871	3300005436	Bacteria	931
157	Ga0070710_10007341	3300005437	Bacteria	5334
158	Ga0070710_10065129	3300005437	Bacteria	2087
159	Ga0070710_10506754	3300005437	Bacteria	827
160	Ga0070710_10549970	3300005437	Bacteria	797
161	Ga0070701_10346409	3300005438	Bacteria	927
162	Ga0070711_100061388	3300005439	Bacteria	2617
163	Ga0070705_100857867	3300005440	Bacteria	727
164	Ga0070705_100978965	3300005440	Bacteria	685
165	Ga0070700_100054257	3300005441	Bacteria	2504
166	Ga0070700_100081321	3300005441	Bacteria	2093
167	Ga0070708_100104465	3300005445	Bacteria	2598
168	Ga0070708_100595274	3300005445	Bacteria	1042
169	Ga0070663_100003243	3300005455	Bacteria	9358
170	Ga0070663_100003886	3300005455	Bacteria	8706
171	Ga0070663_100850583	3300005455	Bacteria	785
172	Ga0070663_101262511	3300005455	Bacteria	651
173	Ga0070678_100001786	3300005456	Bacteria	11591
174	Ga0070678_100025816	3300005456	Bacteria	3960
175	Ga0070678_100028458	3300005456	Bacteria	3812
176	Ga0070678_100087358	3300005456	Bacteria	2381
177	Ga0070678_100289859	3300005456	Bacteria	1387
178	Ga0070678_100338210	3300005456	Bacteria	1290
179	Ga0070678_101232293	3300005456	Bacteria	695
180	Ga0070678_101284639	3300005456	Bacteria	681
181	Ga0070662_100034028	3300005457	Bacteria	3591
182	Ga0070662_100093049	3300005457	Bacteria	2267
183	Ga0070662_100182623	3300005457	Bacteria	1655
184	Ga0070662_100183998	3300005457	Bacteria	1649
185	Ga0070662_100509332	3300005457	Bacteria	1005
186	Ga0070681_10005119	3300005458	Bacteria	12655
187	Ga0070681_10188912	3300005458	Bacteria	1980
188	Ga0070681_10239500	3300005458	Bacteria	1728
189	Ga0070681_10675550	3300005458	Bacteria	948
190	Ga0070681_10898991	3300005458	Bacteria	804
191	Ga0068867_100000077	3300005459	Bacteria	59836
192	Ga0068867_100000932	3300005459	Bacteria	19916
193	Ga0068867_100012398	3300005459	Bacteria	6029
194	Ga0068867_100038819	3300005459	Bacteria	3468
195	Ga0068867_100054825	3300005459	Bacteria	2945
196	Ga0068867_100136111	3300005459	Bacteria	1915
197	Ga0068867_100213688	3300005459	Bacteria	1550
198	Ga0068867_100411850	3300005459	Bacteria	1143
199	Ga0068867_100569602	3300005459	Bacteria	983
200	Ga0070685_10111492	3300005466	Bacteria	1686
201	Ga0070706_100001777	3300005467	Bacteria	22328
202	Ga0070706_100375056	3300005467	Bacteria	1325
203	Ga0070706_100855603	3300005467	Bacteria	841
204	Ga0070707_100036485	3300005468	Bacteria	4691
205	Ga0070707_100417757	3300005468	Bacteria	1302
206	Ga0070698_100933444	3300005471	Unclassified	814
207	Ga0070699_100232285	3300005518	Bacteria	1645
208	Ga0070679_100077785	3300005530	Bacteria	3307
209	Ga0070679_100120419	3300005530	Bacteria	2609
210	Ga0070679_100128179	3300005530	Bacteria	2519
211	Ga0070679_100337587	3300005530	Bacteria	1455
212	Ga0070684_100039305	3300005535	Bacteria	4068
213	Ga0068853_100006065	3300005539	Bacteria	9563
214	Ga0068853_100034477	3300005539	Bacteria	4296
215	Ga0068853_100071781	3300005539	Bacteria	3015
216	Ga0068853_100078556	3300005539	Bacteria	2884
217	Ga0070672_100000674	3300005543	Bacteria	20065
218	Ga0070672_100001496	3300005543	Bacteria	14501
219	Ga0070672_100027912	3300005543	Bacteria	4216
220	Ga0070672_100029785	3300005543	Bacteria	4096
221	Ga0070672_100112138	3300005543	Bacteria	2224
222	Ga0070672_100130914	3300005543	Bacteria	2061
223	Ga0070672_100689912	3300005543	Bacteria	894
224	Ga0070672_100693904	3300005543	Bacteria	891
225	Ga0070672_101302960	3300005543	Bacteria	649
226	Ga0070686_100089925	3300005544	Bacteria	2052
227	Ga0070686_100533423	3300005544	Bacteria	916
228	Ga0070696_100166665	3300005546	Bacteria	1626
229	Ga0070693_100220427	3300005547	Bacteria	1243
230	Ga0070665_101304575	3300005548	Bacteria	736
231	Ga0070704_101847512	3300005549	Bacteria	559
232	Ga0068855_100022408	3300005563	Bacteria	7571
233	Ga0068855_100039828	3300005563	Bacteria	5578
234	Ga0068855_100077143	3300005563	Bacteria	3866
235	Ga0068855_100092900	3300005563	Bacteria	3479
236	Ga0068855_100256710	3300005563	Bacteria	1948
237	Ga0070664_100000939	3300005564	Bacteria	22774
238	Ga0070664_100025855	3300005564	Bacteria	4867
239	Ga0070664_100063541	3300005564	Bacteria	3148
240	Ga0070664_100091218	3300005564	Bacteria	2637
241	Ga0070664_100532892	3300005564	Bacteria	1085
242	Ga0068857_100117060	3300005577	Bacteria	2398
243	Ga0068857_100131701	3300005577	Bacteria	2255
244	Ga0068857_100655455	3300005577	Bacteria	995
245	Ga0068857_101040811	3300005577	Bacteria	789
246	Ga0068854_100069996	3300005578	Bacteria	2563
247	Ga0068854_100882064	3300005578	Bacteria	785
248	Ga0068856_100012917	3300005614	Bacteria	8084
249	Ga0068856_100289670	3300005614	Bacteria	1654
250	Ga0068856_100447216	3300005614	Bacteria	1313
251	Ga0070702_100474759	3300005615	Bacteria	913
252	Ga0068852_100014816	3300005616	Bacteria	6022
253	Ga0068852_100018603	3300005616	Bacteria	5475
254	Ga0068852_100027821	3300005616	Bacteria	4615
255	Ga0068852_100044259	3300005616	Bacteria	3779
256	Ga0068852_100046620	3300005616	Bacteria	3694
257	Ga0068852_100198851	3300005616	Bacteria	1896
258	Ga0068852_100252895	3300005616	Bacteria	1689
259	Ga0068852_100466299	3300005616	Bacteria	1253
260	Ga0068852_100526853	3300005616	Bacteria	1179
261	Ga0068859_100007180	3300005617	Bacteria	11309
262	Ga0068859_100032232	3300005617	Bacteria	5264
263	Ga0068859_100183101	3300005617	Bacteria	2178
264	Ga0068859_100468786	3300005617	Bacteria	1355
265	Ga0068864_100000354	3300005618	Bacteria	40336
266	Ga0068864_100002399	3300005618	Bacteria	15473
267	Ga0068864_100037250	3300005618	Bacteria	4150
268	Ga0068864_100055665	3300005618	Bacteria	3416
269	Ga0068864_100115684	3300005618	Bacteria	2392
270	Ga0068864_101070786	3300005618	Bacteria	802
271	Ga0068864_102265800	3300005618	Bacteria	550
272	Ga0068866_10002910	3300005718	Bacteria	7059
273	Ga0068866_10456408	3300005718	Bacteria	837
274	Ga0068861_100003227	3300005719	Bacteria	10790
275	Ga0068861_100026530	3300005719	Bacteria	4212
276	Ga0068861_100268015	3300005719	Bacteria	1465
277	Ga0068851_10004231	3300005834	Bacteria	6460
278	Ga0068851_10065962	3300005834	Bacteria	1864
279	Ga0068851_10351275	3300005834	Bacteria	858
280	Ga0068870_10012786	3300005840	Bacteria	3931
281	Ga0068870_10029084	3300005840	Bacteria	2781
282	Ga0068870_10292604	3300005840	Bacteria	1025
283	Ga0068863_100003312	3300005841	Bacteria	15900
284	Ga0068863_100034898	3300005841	Bacteria	4791
285	Ga0068863_100037190	3300005841	Bacteria	4635
286	Ga0068863_100044132	3300005841	Bacteria	4232
287	Ga0068863_100100578	3300005841	Bacteria	2748
288	Ga0068863_100178913	3300005841	Bacteria	2036
289	Ga0068863_100206566	3300005841	Bacteria	1890
290	Ga0068858_100000262	3300005842	Bacteria	56062
291	Ga0068858_100005749	3300005842	Bacteria	12118
292	Ga0068858_100009778	3300005842	Bacteria	9130
293	Ga0068858_100044019	3300005842	Bacteria	4139
294	Ga0068858_101045860	3300005842	Bacteria	801
295	Ga0068860_100006843	3300005843	Bacteria	11430
296	Ga0068860_100085476	3300005843	Bacteria	3002
297	Ga0068860_100089805	3300005843	Bacteria	2926
298	Ga0068862_100019197	3300005844	Bacteria	5701
299	Ga0068862_100023970	3300005844	Bacteria	5115
300	Ga0068862_100028761	3300005844	Bacteria	4681
301	Ga0068862_100058582	3300005844	Bacteria	3304
302	Ga0068862_100059433	3300005844	Bacteria	3283
303	Ga0068862_100094485	3300005844	Bacteria	2608
304	Ga0068862_100126510	3300005844	Bacteria	2257
305	Ga0068862_100784788	3300005844	Bacteria	929
306	Ga0081455_10004966	3300005937	Bacteria	14710
307	Ga0081455_10488458	3300005937	Bacteria	830
308	Ga0081455_10588779	3300005937	Bacteria	727
309	Ga0081540_1012498	3300005983	Bacteria	5582
310	Ga0075365_10070149	3300006038	Bacteria	2357
311	Ga0075365_10110299	3300006038	Bacteria	1890
312	Ga0075368_10029146	3300006042	Bacteria	2133
313	Ga0075368_10109207	3300006042	Bacteria	1139
314	Ga0075368_10192943	3300006042	Bacteria	861
315	Ga0075363_100537181	3300006048	Bacteria	697
316	Ga0075364_10129145	3300006051	Bacteria	1695
317	Ga0075364_10139836	3300006051	Bacteria	1628
318	Ga0075364_10154009	3300006051	Bacteria	1550
319	Ga0075432_10154894	3300006058	Bacteria	883
320	Ga0075432_10596429	3300006058	Bacteria	505
321	Ga0070715_10036873	3300006163	Bacteria	2020
322	Ga0070716_100270348	3300006173	Bacteria	1168
323	Ga0070716_101375385	3300006173	Bacteria	573
324	Ga0070712_100133058	3300006175	Bacteria	1887
325	Ga0075362_10005748	3300006177	Bacteria	4566
326	Ga0075362_10015938	3300006177	Bacteria	3067
327	Ga0075362_10030414	3300006177	Bacteria	2332
328	Ga0075362_10040413	3300006177	Bacteria	2053
329	Ga0075362_10131295	3300006177	Bacteria	1192
330	Ga0075362_10165182	3300006177	Bacteria	1067
331	Ga0075362_10294084	3300006177	Bacteria	805
332	Ga0075362_10315725	3300006177	Bacteria	778
333	Ga0075367_10008021	3300006178	Bacteria	5445
334	Ga0075367_10038031	3300006178	Bacteria	2799
335	Ga0075367_10052397	3300006178	Bacteria	2415
336	Ga0075367_10113141	3300006178	Bacteria	1667
337	Ga0075367_10309550	3300006178	Bacteria	995
338	Ga0075369_10025461	3300006186	Bacteria	2460
339	Ga0075369_10089557	3300006186	Bacteria	1372
340	Ga0075366_10001921	3300006195	Bacteria	10509
341	Ga0075366_10002417	3300006195	Bacteria	9579
342	Ga0075366_10009102	3300006195	Bacteria	5537
343	Ga0075366_10022250	3300006195	Bacteria	3687
344	Ga0075366_10023025	3300006195	Bacteria	3628
345	Ga0075366_10043968	3300006195	Bacteria	2647
346	Ga0075366_10087477	3300006195	Bacteria	1865
347	Ga0075366_10099101	3300006195	Bacteria	1748
348	Ga0075366_10106906	3300006195	Bacteria	1682
349	Ga0075366_10190494	3300006195	Bacteria	1246
350	Ga0075366_10194245	3300006195	Bacteria	1234
351	Ga0075366_10282479	3300006195	Bacteria	1014
352	Ga0075366_10320595	3300006195	Bacteria	949
353	Ga0075366_10641719	3300006195	Bacteria	659
354	Ga0097621_100006883	3300006237	Bacteria	8088
355	Ga0097621_100016215	3300006237	Bacteria	5627
356	Ga0097621_100034883	3300006237	Bacteria	4016
357	Ga0097621_100133582	3300006237	Bacteria	2114
358	Ga0097621_100207916	3300006237	Bacteria	1701
359	Ga0097621_100222507	3300006237	Bacteria	1645
360	Ga0097621_100800847	3300006237	Bacteria	873
361	Ga0075370_10005490	3300006353	Bacteria	6312
362	Ga0075370_10005571	3300006353	Bacteria	6276
363	Ga0075370_10008637	3300006353	Bacteria	5251
364	Ga0075370_10015091	3300006353	Bacteria	4129
365	Ga0075370_10059640	3300006353	Bacteria	2172
366	Ga0075370_10136023	3300006353	Bacteria	1436
367	Ga0075370_10490564	3300006353	Bacteria	741
368	Ga0068871_100008710	3300006358	Bacteria	7297
369	Ga0068871_100065266	3300006358	Bacteria	2981
370	Ga0068871_100075803	3300006358	Bacteria	2777
371	Ga0068871_100400827	3300006358	Bacteria	1222
372	Ga0068871_100703754	3300006358	Bacteria	926
373	Ga0068871_101192775	3300006358	Bacteria	714
374	Ga0075428_100036897	3300006844	Bacteria	5382
375	Ga0075430_100496766	3300006846	Bacteria	1007
376	Ga0075431_100005587	3300006847	Bacteria	12415
377	Ga0075429_100401840	3300006880	Bacteria	1200
378	Ga0075429_100444789	3300006880	Bacteria	1136
379	Ga0068865_100010698	3300006881	Bacteria	5719
380	Ga0068865_100015466	3300006881	Bacteria	4867
381	Ga0068865_100418978	3300006881	Bacteria	1100
382	Ga0097620_100007180	3300006931	Bacteria	11309
383	Ga0097620_100032233	3300006931	Bacteria	5264
384	Ga0097620_100183102	3300006931	Bacteria	2178
385	Ga0097620_100468776	3300006931	Bacteria	1355
386	Ga0099823_1002035	3300006944	Bacteria	17811
387	Ga0079104_1000100	3300006946	Bacteria	126924
388	Ga0079104_1006080	3300006946	Bacteria	4667
389	Ga0099826_10166791	3300006948	Bacteria	1241
390	Ga0105251_10000309	3300009011	Bacteria	48873
391	Ga0105251_10043577	3300009011	Bacteria	2172
392	Ga0105251_10098387	3300009011	Bacteria	1339
393	Ga0105251_10123778	3300009011	Bacteria	1174
394	Ga0105244_10019485	3300009036	Bacteria	3785
395	Ga0105244_10019533	3300009036	Bacteria	3779
396	Ga0105244_10121111	3300009036	Bacteria	1267
397	Ga0105244_10165564	3300009036	Bacteria	1054
398	Ga0105244_10176417	3300009036	Bacteria	1015
399	Ga0105250_10010061	3300009092	Bacteria	3954
400	Ga0105250_10159959	3300009092	Bacteria	940
401	Ga0105240_10007299	3300009093	Bacteria	16087
402	Ga0105240_10031265	3300009093	Bacteria	6906
403	Ga0105240_10034862	3300009093	Bacteria	6488
404	Ga0105240_10041587	3300009093	Bacteria	5865
405	Ga0105240_10079757	3300009093	Bacteria	4028
406	Ga0105240_10377581	3300009093	Bacteria	1601
407	Ga0105240_10432590	3300009093	Bacteria	1476
408	Ga0111539_10322283	3300009094	Bacteria	1798
409	Ga0111539_10558638	3300009094	Bacteria	1333
410	Ga0111539_10627877	3300009094	Bacteria	1251
411	Ga0105245_10307238	3300009098	Bacteria	1558
412	Ga0105245_10856702	3300009098	Bacteria	949
413	Ga0105245_11120787	3300009098	Bacteria	833
414	Ga0105247_10431794	3300009101	Bacteria	945
415	Ga0105247_10977890	3300009101	Bacteria	659
416	Ga0114129_10491018	3300009147	Bacteria	1605
417	Ga0114129_11031304	3300009147	Bacteria	1034
418	Ga0105243_10002591	3300009148	Bacteria	15085
419	Ga0105243_10068864	3300009148	Bacteria	2853
420	Ga0105243_10075438	3300009148	Bacteria	2737
421	Ga0105243_10386578	3300009148	Bacteria	1296
422	Ga0105243_11957074	3300009148	Bacteria	620
423	Ga0105241_10015147	3300009174	Bacteria	5648
424	Ga0105241_10434571	3300009174	Bacteria	1158
425	Ga0105242_10587584	3300009176	Bacteria	1074
426	Ga0105242_11152775	3300009176	Bacteria	792
427	Ga0105248_10007009	3300009177	Bacteria	12342
428	Ga0105248_10056848	3300009177	Bacteria	4390
429	Ga0105248_10064841	3300009177	Bacteria	4100
430	Ga0105248_10088653	3300009177	Bacteria	3482
431	Ga0105248_10130214	3300009177	Bacteria	2838
432	Ga0105248_10191639	3300009177	Bacteria	2304
433	Ga0105248_10245116	3300009177	Bacteria	2017
434	Ga0105248_10387556	3300009177	Bacteria	1573
435	Ga0105248_10454797	3300009177	Bacteria	1443
436	Ga0105248_10958676	3300009177	Bacteria	966
437	Ga0105237_10000998	3300009545	Bacteria	38080
438	Ga0105237_10105952	3300009545	Bacteria	2803
439	Ga0105237_10179800	3300009545	Bacteria	2116
440	Ga0105237_11091736	3300009545	Bacteria	805
441	Ga0105238_10012661	3300009551	Bacteria	8514
442	Ga0105238_10018725	3300009551	Bacteria	7051
443	Ga0105238_10019715	3300009551	Bacteria	6868
444	Ga0105238_10033490	3300009551	Bacteria	5230
445	Ga0105238_10046675	3300009551	Bacteria	4370
446	Ga0105238_10244541	3300009551	Bacteria	1772
447	Ga0105238_10638696	3300009551	Bacteria	1074
448	Ga0105249_10000342	3300009553	Bacteria	47083
449	Ga0105249_10044280	3300009553	Bacteria	4047
450	Ga0105249_10104287	3300009553	Bacteria	2672
451	Ga0105249_10151394	3300009553	Bacteria	2234
452	Ga0105249_10318448	3300009553	Bacteria	1566
453	Ga0105239_10000318	3300010375	Bacteria	71045
454	Ga0105239_10509498	3300010375	Bacteria	1368
455	Ga0105239_11138897	3300010375	Bacteria	898
456	Ga0105246_12327865	3300011119	Bacteria	524
457	Ga0157317_1000493	3300012475	Bacteria	1713
458	Ga0157319_1000035	3300012497	Bacteria	40594
459	Ga0157314_1005544	3300012500	Bacteria	961
460	Ga0157326_1005406	3300012513	Bacteria	1351
461	Ga0157373_10486659	3300013100	Bacteria	890
462	Ga0157371_10005864	3300013102	Bacteria	10264
463	Ga0157371_10650304	3300013102	Bacteria	787
464	Ga0157370_10438793	3300013104	Bacteria	1201
465	Ga0157370_10815178	3300013104	Bacteria	849
466	Ga0157370_11080649	3300013104	Bacteria	725
467	Ga0157369_10031818	3300013105	Bacteria	5805
468	Ga0157369_10037600	3300013105	Bacteria	5299
469	Ga0157369_11072985	3300013105	Bacteria	823
470	Ga0157374_10025164	3300013296	Bacteria	5341
471	Ga0157374_10125887	3300013296	Bacteria	2477
472	Ga0157374_10221280	3300013296	Bacteria	1857
473	Ga0157374_10646021	3300013296	Bacteria	1070
474	Ga0157378_10180665	3300013297	Bacteria	1985
475	Ga0157378_10308886	3300013297	Bacteria	1533
476	Ga0157378_10445647	3300013297	Bacteria	1284
477	Ga0157378_10492593	3300013297	Bacteria	1223
478	Ga0157378_11466363	3300013297	Bacteria	726
479	Ga0163162_10000679	3300013306	Bacteria	31608
480	Ga0163162_10012705	3300013306	Bacteria	8221
481	Ga0163162_10025634	3300013306	Bacteria	5828
482	Ga0163162_10048557	3300013306	Bacteria	4253
483	Ga0163162_10053465	3300013306	Bacteria	4059
484	Ga0163162_10086236	3300013306	Bacteria	3217
485	Ga0163162_10871690	3300013306	Bacteria	1015
486	Ga0157372_10000718	3300013307	Bacteria	36311
487	Ga0157372_10035925	3300013307	Bacteria	5457
488	Ga0157372_10102543	3300013307	Bacteria	3269
489	Ga0157372_10117708	3300013307	Bacteria	3047
490	Ga0157372_10699447	3300013307	Bacteria	1179
491	Ga0157372_10743795	3300013307	Bacteria	1140
492	Ga0157375_10004728	3300013308	Bacteria	11830
493	Ga0157375_10018087	3300013308	Bacteria	6385
494	Ga0157375_10019246	3300013308	Bacteria	6206
495	Ga0157375_10034066	3300013308	Bacteria	4847
496	Ga0157375_10056743	3300013308	Bacteria	3868
497	Ga0157375_10207553	3300013308	Bacteria	2116
498	Ga0157375_10261577	3300013308	Bacteria	1892
499	Ga0157375_10275214	3300013308	Bacteria	1846
500	Ga0157375_10308210	3300013308	Bacteria	1747
501	Ga0157375_10592298	3300013308	Bacteria	1268
502	Ga0157375_10746747	3300013308	Bacteria	1130
503	Ga0157375_11075442	3300013308	Bacteria	941
504	Ga0163163_10004764	3300014325	Bacteria	11640
505	Ga0163163_10098591	3300014325	Bacteria	2944
506	Ga0163163_10107334	3300014325	Bacteria	2819
507	Ga0163163_10246292	3300014325	Bacteria	1837
508	Ga0163163_10526712	3300014325	Bacteria	1244
509	Ga0163163_10560854	3300014325	Bacteria	1205
510	Ga0163163_11979705	3300014325	Bacteria	642
511	Ga0157380_10022857	3300014326	Bacteria	4715
512	Ga0157380_10023566	3300014326	Bacteria	4645
513	Ga0157380_10048088	3300014326	Bacteria	3358
514	Ga0157380_10062916	3300014326	Bacteria	2974
515	Ga0157380_10069002	3300014326	Bacteria	2851
516	Ga0157380_10148857	3300014326	Bacteria	2021
517	Ga0157380_10202571	3300014326	Bacteria	1762
518	Ga0157380_10205600	3300014326	Bacteria	1750
519	Ga0157380_11222749	3300014326	Bacteria	796
520	Ga0157380_11258212	3300014326	Bacteria	786
521	Ga0157380_11438656	3300014326	Bacteria	741
522	Ga0157380_12702528	3300014326	Bacteria	563
523	Ga0182008_10003595	3300014497	Bacteria	9279
524	Ga0182008_10366545	3300014497	Bacteria	767
525	Ga0157377_10000094	3300014745	Bacteria	64283
526	Ga0157377_10521026	3300014745	Bacteria	834
527	Ga0157379_10004559	3300014968	Bacteria	11882
528	Ga0157379_10091048	3300014968	Bacteria	2736
529	Ga0157379_10157624	3300014968	Bacteria	2048
530	Ga0157376_10002171	3300014969	Bacteria	13216
531	Ga0157376_10016007	3300014969	Bacteria	5683
532	Ga0157376_10098229	3300014969	Bacteria	2552
533	Ga0157376_10151948	3300014969	Bacteria	2089
534	Ga0157376_10285856	3300014969	Bacteria	1555
535	Ga0157376_10374167	3300014969	Bacteria	1370
536	Ga0157376_10420659	3300014969	Bacteria	1297
537	Ga0157376_10451251	3300014969	Bacteria	1254
538	Ga0157376_10556812	3300014969	Bacteria	1135
539	Ga0157376_10803234	3300014969	Bacteria	953
540	Ga0182007_10035004	3300015262	Bacteria	1693
541	Ga0182005_1095988	3300015265	Bacteria	828
542	Ga0163161_10041756	3300017792	Bacteria	3296
543	Ga0163161_10073964	3300017792	Bacteria	2498
544	Ga0163161_10118524	3300017792	Bacteria	1987
545	Ga0163161_10153661	3300017792	Bacteria	1750
546	Ga0206354_11363812	3300020081	Bacteria	611
547	Ga0213872_10004955	3300021361	Bacteria	6924
548	Ga0213872_10026335	3300021361	Bacteria	2671
549	Ga0213875_10000114	3300021388	Bacteria	91363
550	Ga0213875_10008122	3300021388	Bacteria	5388
551	Ga0213875_10255900	3300021388	Bacteria	826
552	Ga0209435_100001	3300025206	Bacteria	1424171
553	Ga0209436_113645	3300025208	Bacteria	1320
554	Ga0209258_110482	3300025242	Bacteria	1201
555	Ga0207425_1002625	3300025245	Bacteria	6213
556	Ga0207425_1008135	3300025245	Bacteria	2710
557	Ga0207425_1008784	3300025245	Bacteria	2557
558	Ga0209646_1000001	3300025246	Bacteria	3092932
559	Ga0209026_1000003	3300025250	Bacteria	1060571
560	Ga0209759_1000001	3300025256	Bacteria	2799452
561	Ga0209129_1000041	3300025258	Bacteria	307590
562	Ga0209129_1003651	3300025258	Bacteria	6553
563	Ga0209129_1018536	3300025258	Bacteria	1334
564	Ga0209565_1000124	3300025263	Bacteria	110789
565	Ga0209565_1000498	3300025263	Bacteria	28727
566	Ga0209565_1009374	3300025263	Bacteria	2490
567	Ga0209565_1024593	3300025263	Bacteria	1224
568	Ga0209673_1000043	3300025273	Bacteria	291503
569	Ga0209673_1001809	3300025273	Bacteria	17590
570	Ga0209673_1007730	3300025273	Bacteria	4896
571	Ga0209673_1010237	3300025273	Bacteria	3970
572	Ga0209673_1010311	3300025273	Bacteria	3944
573	Ga0209673_1044280	3300025273	Bacteria	1233
574	Ga0209673_1049602	3300025273	Bacteria	1121
575	Ga0209130_1000442	3300025284	Bacteria	43829
576	Ga0209130_1000620	3300025284	Bacteria	33992
577	Ga0209130_1001702	3300025284	Bacteria	13299
578	Ga0209130_1055162	3300025284	Bacteria	708
579	Ga0209675_1000309	3300025291	Bacteria	44113
580	Ga0209675_1008560	3300025291	Bacteria	3738
581	Ga0209675_1031186	3300025291	Bacteria	1263
582	Ga0209675_1064089	3300025291	Bacteria	717
583	Ga0209676_1000007	3300025292	Bacteria	1029371
584	Ga0209676_1005708	3300025292	Bacteria	6399
585	Ga0209025_1002427	3300025294	Bacteria	19781
586	Ga0209025_1004916	3300025294	Bacteria	11238
587	Ga0209025_1024249	3300025294	Bacteria	3138
588	Ga0209025_1025283	3300025294	Bacteria	3028
589	Ga0209025_1095108	3300025294	Bacteria	960
590	Ga0209564_1000003	3300025295	Bacteria	1585848
591	Ga0209564_1000029	3300025295	Bacteria	505995
592	Ga0209564_1000268	3300025295	Bacteria	109101
593	Ga0209564_1000476	3300025295	Bacteria	67062
594	Ga0209564_1003314	3300025295	Bacteria	11188
595	Ga0209758_1000043	3300025297	Bacteria	402310
596	Ga0209758_1000167	3300025297	Bacteria	151074
597	Ga0209758_1043883	3300025297	Bacteria	1641
598	Ga0209758_1045258	3300025297	Bacteria	1599
599	Ga0209758_1061488	3300025297	Bacteria	1236
600	Ga0209050_1000003	3300025298	Bacteria	1609245
601	Ga0209050_1000467	3300025298	Bacteria	71711
602	Ga0209050_1000808	3300025298	Bacteria	44058
603	Ga0209050_1001494	3300025298	Bacteria	24797
604	Ga0209050_1003886	3300025298	Bacteria	10607
605	Ga0209050_1004391	3300025298	Bacteria	9566
606	Ga0209050_1016100	3300025298	Bacteria	3084
607	Ga0209050_1021541	3300025298	Bacteria	2346
608	Ga0209050_1096249	3300025298	Bacteria	595
609	Ga0209256_1000001	3300025299	Bacteria	2166974
610	Ga0209256_1000011	3300025299	Bacteria	865309
611	Ga0209256_1000398	3300025299	Bacteria	68796
612	Ga0209256_1002559	3300025299	Bacteria	14528
613	Ga0209256_1017854	3300025299	Bacteria	2335
614	Ga0209256_1021626	3300025299	Bacteria	1969
615	Ga0209256_1043431	3300025299	Bacteria	1129
616	Ga0207426_1000247	3300025302	Bacteria	119659
617	Ga0207426_1009688	3300025302	Bacteria	3790
618	Ga0207426_1046867	3300025302	Bacteria	1307
619	Ga0207426_1067929	3300025302	Bacteria	1003
620	Ga0209051_1000003	3300025303	Bacteria	1609245
621	Ga0209051_1000210	3300025303	Bacteria	102629
622	Ga0209051_1000320	3300025303	Bacteria	72764
623	Ga0209051_1001335	3300025303	Bacteria	21466
624	Ga0209051_1007045	3300025303	Bacteria	6221
625	Ga0209051_1012479	3300025303	Bacteria	4107
626	Ga0209051_1017118	3300025303	Bacteria	3250
627	Ga0209257_1000017	3300025304	Bacteria	866287
628	Ga0209257_1000020	3300025304	Bacteria	773356
629	Ga0209257_1000161	3300025304	Bacteria	176089
630	Ga0209257_1000314	3300025304	Bacteria	102629
631	Ga0209257_1000799	3300025304	Bacteria	45956
632	Ga0209257_1005062	3300025304	Bacteria	9572
633	Ga0209257_1005554	3300025304	Bacteria	8781
634	Ga0209257_1016941	3300025304	Bacteria	2905
635	Ga0207656_10005941	3300025321	Bacteria	4356
636	Ga0207655_1005008	3300025728	Bacteria	9169
637	Ga0207655_1005064	3300025728	Bacteria	9110
638	Ga0207655_1083830	3300025728	Bacteria	1141
639	Ga0207655_1105079	3300025728	Bacteria	965
640	Ga0207655_1107523	3300025728	Bacteria	948
641	Ga0207713_1069190	3300025735	Bacteria	1309
642	Ga0207713_1116723	3300025735	Bacteria	900
643	Ga0207713_1124951	3300025735	Bacteria	858
644	Ga0207653_10200309	3300025885	Bacteria	752
645	Ga0207682_10001767	3300025893	Bacteria	9913
646	Ga0207682_10001984	3300025893	Bacteria	9267
647	Ga0207682_10009729	3300025893	Bacteria	3787
648	Ga0207682_10013197	3300025893	Bacteria	3221
649	Ga0207692_10105491	3300025898	Bacteria	1554
650	Ga0207642_10006842	3300025899	Bacteria	3816
651	Ga0207642_10080122	3300025899	Bacteria	1583
652	Ga0207642_10115095	3300025899	Bacteria	1377
653	Ga0207642_10218813	3300025899	Bacteria	1063
654	Ga0207680_10003848	3300025903	Bacteria	7066
655	Ga0207680_10024370	3300025903	Bacteria	3320
656	Ga0207680_10025961	3300025903	Bacteria	3239
657	Ga0207699_10030917	3300025906	Bacteria	3001
658	Ga0207645_10012039	3300025907	Bacteria	5882
659	Ga0207645_10032364	3300025907	Bacteria	3361
660	Ga0207645_10727408	3300025907	Bacteria	675
661	Ga0207643_10003782	3300025908	Bacteria	8136
662	Ga0207643_10028009	3300025908	Bacteria	3127
663	Ga0207643_10058785	3300025908	Bacteria	2192
664	Ga0207643_10303128	3300025908	Bacteria	995
665	Ga0207705_10106972	3300025909	Bacteria	2063
666	Ga0207705_10339781	3300025909	Bacteria	1156
667	Ga0207705_10551886	3300025909	Bacteria	896
668	Ga0207684_10000743	3300025910	Bacteria	38135
669	Ga0207684_10726554	3300025910	Bacteria	843
670	Ga0207654_10044947	3300025911	Bacteria	2511
671	Ga0207707_10002563	3300025912	Bacteria	16290
672	Ga0207707_10078608	3300025912	Bacteria	2881
673	Ga0207707_10176459	3300025912	Bacteria	1866
674	Ga0207707_10529490	3300025912	Bacteria	1003
675	Ga0207707_10772269	3300025912	Unclassified	802
676	Ga0207695_10025991	3300025913	Bacteria	6542
677	Ga0207695_10043173	3300025913	Bacteria	4807
678	Ga0207695_10065868	3300025913	Bacteria	3723
679	Ga0207695_10354968	3300025913	Bacteria	1353
680	Ga0207671_10006034	3300025914	Bacteria	10939
681	Ga0207671_10040022	3300025914	Bacteria	3470
682	Ga0207671_10118785	3300025914	Bacteria	2019
683	Ga0207671_10788372	3300025914	Bacteria	754
684	Ga0207693_10061984	3300025915	Bacteria	2929
685	Ga0207693_10448950	3300025915	Unclassified	1008
686	Ga0207693_10461586	3300025915	Bacteria	992
687	Ga0207663_10421691	3300025916	Bacteria	1024
688	Ga0207660_10033235	3300025917	Bacteria	3566
689	Ga0207660_10095087	3300025917	Bacteria	2216
690	Ga0207660_10331851	3300025917	Bacteria	1216
691	Ga0207662_10142406	3300025918	Bacteria	1519
692	Ga0207662_10647713	3300025918	Bacteria	738
693	Ga0207657_10034309	3300025919	Bacteria	4566
694	Ga0207657_10062069	3300025919	Bacteria	3201
695	Ga0207657_10094700	3300025919	Bacteria	2486
696	Ga0207657_10358752	3300025919	Bacteria	1149
697	Ga0207649_10001323	3300025920	Bacteria	14731
698	Ga0207649_10122954	3300025920	Bacteria	1752
699	Ga0207649_10186377	3300025920	Bacteria	1456
700	Ga0207649_10789743	3300025920	Bacteria	740
701	Ga0207652_10156540	3300025921	Bacteria	2041
702	Ga0207652_10334427	3300025921	Bacteria	1367
703	Ga0207646_10022087	3300025922	Bacteria	5869
704	Ga0207646_10731365	3300025922	Bacteria	884
705	Ga0207681_10000819	3300025923	Bacteria	20485
706	Ga0207681_10014662	3300025923	Bacteria	4878
707	Ga0207681_10032915	3300025923	Bacteria	3397
708	Ga0207681_10224280	3300025923	Bacteria	1455
709	Ga0207681_10753890	3300025923	Bacteria	812
710	Ga0207681_10795349	3300025923	Bacteria	790
711	Ga0207681_11504552	3300025923	Bacteria	564
712	Ga0207694_10028662	3300025924	Bacteria	4245
713	Ga0207694_10059195	3300025924	Bacteria	2979
714	Ga0207694_10090675	3300025924	Bacteria	2412
715	Ga0207694_10183514	3300025924	Bacteria	1697
716	Ga0207694_10997260	3300025924	Bacteria	709
717	Ga0207650_10001268	3300025925	Bacteria	18324
718	Ga0207650_10005261	3300025925	Bacteria	8826
719	Ga0207650_10040024	3300025925	Bacteria	3428
720	Ga0207650_10064135	3300025925	Bacteria	2749
721	Ga0207650_10182010	3300025925	Bacteria	1675
722	Ga0207650_10500826	3300025925	Bacteria	1015
723	Ga0207650_11165107	3300025925	Bacteria	656
724	Ga0207659_10001423	3300025926	Bacteria	14256
725	Ga0207659_10003128	3300025926	Bacteria	9889
726	Ga0207659_10038727	3300025926	Bacteria	3319
727	Ga0207659_10082489	3300025926	Bacteria	2380
728	Ga0207659_10507491	3300025926	Bacteria	1021
729	Ga0207659_10827396	3300025926	Bacteria	796
730	Ga0207659_11065387	3300025926	Bacteria	696
731	Ga0207687_10111231	3300025927	Bacteria	2033
732	Ga0207687_10524916	3300025927	Bacteria	991
733	Ga0207700_10001011	3300025928	Bacteria	16240
734	Ga0207700_10147485	3300025928	Bacteria	1941
735	Ga0207700_10387519	3300025928	Bacteria	1223
736	Ga0207664_10489841	3300025929	Bacteria	1100
737	Ga0207664_11067131	3300025929	Bacteria	723
738	Ga0207644_10004489	3300025931	Bacteria	9062
739	Ga0207644_10004958	3300025931	Bacteria	8685
740	Ga0207644_10022737	3300025931	Bacteria	4286
741	Ga0207644_10052099	3300025931	Bacteria	2940
742	Ga0207644_10075325	3300025931	Bacteria	2480
743	Ga0207644_10077977	3300025931	Bacteria	2441
744	Ga0207644_10096958	3300025931	Bacteria	2208
745	Ga0207644_10435136	3300025931	Bacteria	1076
746	Ga0207644_11029242	3300025931	Bacteria	691
747	Ga0207690_10004800	3300025932	Bacteria	7976
748	Ga0207690_10187909	3300025932	Bacteria	1560
749	Ga0207690_10464084	3300025932	Bacteria	1019
750	Ga0207706_10002276	3300025933	Bacteria	18747
751	Ga0207706_10026649	3300025933	Bacteria	5174
752	Ga0207706_10027008	3300025933	Bacteria	5135
753	Ga0207706_10032086	3300025933	Bacteria	4678
754	Ga0207706_10039929	3300025933	Bacteria	4160
755	Ga0207706_10164864	3300025933	Bacteria	1948
756	Ga0207706_10822153	3300025933	Bacteria	788
757	Ga0207706_10871904	3300025933	Bacteria	761
758	Ga0207686_10173253	3300025934	Bacteria	1524
759	Ga0207686_10246698	3300025934	Bacteria	1302
760	Ga0207686_10302986	3300025934	Bacteria	1187
761	Ga0207686_10390103	3300025934	Bacteria	1058
762	Ga0207709_10001678	3300025935	Bacteria	14925
763	Ga0207709_10010988	3300025935	Bacteria	4990
764	Ga0207709_10079035	3300025935	Bacteria	2113
765	Ga0207709_10874614	3300025935	Bacteria	729
766	Ga0207670_10099553	3300025936	Bacteria	2074
767	Ga0207670_10307801	3300025936	Bacteria	1243
768	Ga0207669_10003846	3300025937	Bacteria	6543
769	Ga0207669_10010270	3300025937	Bacteria	4501
770	Ga0207669_10012607	3300025937	Bacteria	4163
771	Ga0207669_10085268	3300025937	Bacteria	2038
772	Ga0207669_10235698	3300025937	Bacteria	1353
773	Ga0207669_10239937	3300025937	Bacteria	1343
774	Ga0207669_10615124	3300025937	Bacteria	884
775	Ga0207704_10006026	3300025938	Bacteria	5620
776	Ga0207704_10014210	3300025938	Bacteria	4013
777	Ga0207704_10017503	3300025938	Bacteria	3718
778	Ga0207704_10681021	3300025938	Bacteria	850
779	Ga0207704_11373056	3300025938	Bacteria	605
780	Ga0207691_10001131	3300025940	Bacteria	26484
781	Ga0207691_10001663	3300025940	Bacteria	21997
782	Ga0207691_10012709	3300025940	Bacteria	8063
783	Ga0207691_10022785	3300025940	Bacteria	5905
784	Ga0207691_10023069	3300025940	Bacteria	5861
785	Ga0207691_10033026	3300025940	Bacteria	4820
786	Ga0207691_10035543	3300025940	Bacteria	4623
787	Ga0207691_10059029	3300025940	Bacteria	3489
788	Ga0207691_10222012	3300025940	Bacteria	1638
789	Ga0207691_10419274	3300025940	Bacteria	1141
790	Ga0207691_10513620	3300025940	Bacteria	1017
791	Ga0207691_10632706	3300025940	Bacteria	905
792	Ga0207691_10717664	3300025940	Bacteria	843
793	Ga0207711_10003690	3300025941	Bacteria	13225
794	Ga0207711_10036823	3300025941	Bacteria	4153
795	Ga0207711_10049870	3300025941	Bacteria	3584
796	Ga0207711_10131852	3300025941	Bacteria	2242
797	Ga0207711_10154234	3300025941	Bacteria	2074
798	Ga0207689_10006291	3300025942	Bacteria	10520
799	Ga0207689_10026446	3300025942	Bacteria	4858
800	Ga0207689_10164403	3300025942	Bacteria	1829
801	Ga0207689_10479955	3300025942	Bacteria	1041
802	Ga0207689_10481973	3300025942	Bacteria	1038
803	Ga0207689_10935714	3300025942	Bacteria	731
804	Ga0207661_10034192	3300025944	Bacteria	3951
805	Ga0207661_11098916	3300025944	Bacteria	732
806	Ga0207679_10000201	3300025945	Bacteria	48099
807	Ga0207679_10156225	3300025945	Bacteria	1863
808	Ga0207679_10205136	3300025945	Bacteria	1649
809	Ga0207679_11014935	3300025945	Bacteria	761
810	Ga0207679_11330367	3300025945	Bacteria	659
811	Ga0207667_10002059	3300025949	Bacteria	25205
812	Ga0207667_10751256	3300025949	Bacteria	975
813	Ga0207667_11647900	3300025949	Bacteria	609
814	Ga0207651_10000562	3300025960	Bacteria	15636
815	Ga0207651_10007162	3300025960	Bacteria	5927
816	Ga0207651_10066265	3300025960	Bacteria	2536
817	Ga0207651_10239047	3300025960	Bacteria	1479
818	Ga0207651_10271290	3300025960	Bacteria	1397
819	Ga0207651_10613907	3300025960	Bacteria	952
820	Ga0207651_10897019	3300025960	Bacteria	789
821	Ga0207712_10014803	3300025961	Bacteria	5021
822	Ga0207712_10142390	3300025961	Bacteria	1842
823	Ga0207712_10188629	3300025961	Bacteria	1626
824	Ga0207712_10284826	3300025961	Bacteria	1350
825	Ga0207712_10793933	3300025961	Bacteria	832
826	Ga0207668_10001789	3300025972	Bacteria	12552
827	Ga0207668_10002933	3300025972	Bacteria	10010
828	Ga0207668_10158500	3300025972	Bacteria	1761
829	Ga0207640_10055882	3300025981	Bacteria	2588
830	Ga0207640_10518385	3300025981	Bacteria	996
831	Ga0207640_11196877	3300025981	Bacteria	675
832	Ga0207640_11383352	3300025981	Bacteria	630
833	Ga0207658_10000336	3300025986	Bacteria	47108
834	Ga0207658_10002766	3300025986	Bacteria	12635
835	Ga0207658_10009362	3300025986	Bacteria	6645
836	Ga0207658_10051764	3300025986	Bacteria	3027
837	Ga0207658_10174954	3300025986	Bacteria	1772
838	Ga0207658_10252584	3300025986	Bacteria	1499
839	Ga0207658_10492893	3300025986	Bacteria	1090
840	Ga0207658_10670323	3300025986	Bacteria	936
841	Ga0207677_10376693	3300026023	Bacteria	1197
842	Ga0207677_10654372	3300026023	Bacteria	928
843	Ga0207677_10948795	3300026023	Bacteria	778
844	Ga0207677_11042000	3300026023	Bacteria	743
845	Ga0207703_10000277	3300026035	Bacteria	56761
846	Ga0207703_10000866	3300026035	Bacteria	29661
847	Ga0207703_10031615	3300026035	Bacteria	4186
848	Ga0207703_10042191	3300026035	Bacteria	3659
849	Ga0207703_10983484	3300026035	Bacteria	809
850	Ga0207639_10013995	3300026041	Bacteria	5629
851	Ga0207639_10046007	3300026041	Bacteria	3290
852	Ga0207639_10051308	3300026041	Bacteria	3137
853	Ga0207639_10213011	3300026041	Bacteria	1664
854	Ga0207639_10623822	3300026041	Bacteria	996
855	Ga0207678_10007848	3300026067	Bacteria	9417
856	Ga0207678_10009214	3300026067	Bacteria	8685
857	Ga0207678_10253384	3300026067	Bacteria	1508
858	Ga0207678_10492475	3300026067	Bacteria	1068
859	Ga0207678_10516914	3300026067	Bacteria	1042
860	Ga0207678_10563073	3300026067	Bacteria	997
861	Ga0207678_11487702	3300026067	Bacteria	598
862	Ga0207708_10104075	3300026075	Bacteria	2199
863	Ga0207708_10990513	3300026075	Bacteria	730
864	Ga0207702_10117957	3300026078	Bacteria	2371
865	Ga0207702_10230662	3300026078	Bacteria	1730
866	Ga0207702_10871672	3300026078	Bacteria	892
867	Ga0207641_10001090	3300026088	Bacteria	27309
868	Ga0207641_10002663	3300026088	Bacteria	16308
869	Ga0207641_10007781	3300026088	Bacteria	8905
870	Ga0207641_10049730	3300026088	Bacteria	3544
871	Ga0207641_10269052	3300026088	Bacteria	1598
872	Ga0207641_10576301	3300026088	Bacteria	1100
873	Ga0207648_10000193	3300026089	Bacteria	64119
874	Ga0207648_10000512	3300026089	Bacteria	43350
875	Ga0207648_10015267	3300026089	Bacteria	7065
876	Ga0207648_10026488	3300026089	Bacteria	5151
877	Ga0207648_10080813	3300026089	Bacteria	2836
878	Ga0207648_10083200	3300026089	Bacteria	2791
879	Ga0207648_10147787	3300026089	Bacteria	2073
880	Ga0207648_10193541	3300026089	Bacteria	1803
881	Ga0207648_10234269	3300026089	Bacteria	1634
882	Ga0207648_10238932	3300026089	Bacteria	1617
883	Ga0207648_10428686	3300026089	Bacteria	1202
884	Ga0207648_10857208	3300026089	Bacteria	847
885	Ga0207676_10001342	3300026095	Bacteria	18294
886	Ga0207676_10017194	3300026095	Bacteria	5240
887	Ga0207676_10028849	3300026095	Bacteria	4150
888	Ga0207676_10040743	3300026095	Bacteria	3561
889	Ga0207676_10089162	3300026095	Bacteria	2527
890	Ga0207676_10165480	3300026095	Bacteria	1921
891	Ga0207676_10203090	3300026095	Bacteria	1753
892	Ga0207676_10318130	3300026095	Bacteria	1427
893	Ga0207676_10557604	3300026095	Bacteria	1095
894	Ga0207674_10038832	3300026116	Bacteria	4939
895	Ga0207674_10047553	3300026116	Bacteria	4396
896	Ga0207674_10117981	3300026116	Bacteria	2624
897	Ga0207674_10411923	3300026116	Bacteria	1306
898	Ga0207675_100004491	3300026118	Bacteria	13479
899	Ga0207675_100007449	3300026118	Bacteria	10340
900	Ga0207675_100024043	3300026118	Bacteria	5664
901	Ga0207675_100109797	3300026118	Bacteria	2603
902	Ga0207675_100789046	3300026118	Bacteria	963
903	Ga0207683_10003565	3300026121	Bacteria	13573
904	Ga0207683_10011473	3300026121	Bacteria	7562
905	Ga0207683_10026198	3300026121	Bacteria	5033
906	Ga0207683_10054273	3300026121	Bacteria	3514
907	Ga0207683_10058630	3300026121	Bacteria	3381
908	Ga0207683_10063497	3300026121	Bacteria	3253
909	Ga0207683_10069534	3300026121	Bacteria	3109
910	Ga0207683_10102073	3300026121	Bacteria	2561
911	Ga0207683_10177091	3300026121	Bacteria	1933
912	Ga0207683_10241812	3300026121	Bacteria	1647
913	Ga0207683_10328446	3300026121	Bacteria	1402
914	Ga0207683_10465256	3300026121	Bacteria	1166
915	Ga0207698_10014969	3300026142	Bacteria	5178
916	Ga0207698_10026945	3300026142	Bacteria	4073
917	Ga0207698_10031774	3300026142	Bacteria	3815
918	Ga0207698_10057062	3300026142	Bacteria	3018
919	Ga0207698_10218218	3300026142	Bacteria	1721
920	Ga0207698_10356318	3300026142	Bacteria	1384
921	Ga0207698_10426945	3300026142	Bacteria	1273
922	Ga0207698_11044887	3300026142	Bacteria	828
923	Ga0209281_1000084	3300027111	Bacteria	254215
924	Ga0209281_1026166	3300027111	Bacteria	1081
925	Ga0209389_1038266	3300027296	Bacteria	3781
926	Ga0209974_10005575	3300027876	Bacteria	4423
927	Ga0209974_10082990	3300027876	Bacteria	1105
928	Ga0209974_10129742	3300027876	Bacteria	898
929	Ga0209974_10347476	3300027876	Bacteria	575
930	Ga0207428_10112389	3300027907	Bacteria	2095
931	Ga0207428_10598606	3300027907	Bacteria	794
932	Ga0268266_10003010	3300028379	Bacteria	17318
933	Ga0268266_10319051	3300028379	Bacteria	1454
934	Ga0268266_10422883	3300028379	Bacteria	1263
935	Ga0268266_11609399	3300028379	Bacteria	625
936	Ga0268265_10054074	3300028380	Bacteria	3044
937	Ga0268265_10096117	3300028380	Bacteria	2380
938	Ga0268265_10232084	3300028380	Bacteria	1622
939	Ga0268265_10970838	3300028380	Bacteria	838
940	Ga0268265_11083685	3300028380	Bacteria	795
941	Ga0268265_11084055	3300028380	Bacteria	794
942	Ga0268265_12360000	3300028380	Bacteria	538
943	Ga0268264_10003687	3300028381	Bacteria	13142
944	Ga0268264_10064917	3300028381	Bacteria	3073
945	Ga0268264_10371228	3300028381	Bacteria	1367
946	Ga0268264_10610115	3300028381	Bacteria	1076
947	Ga0265326_10027167	3300028558	Bacteria	1632
948	Ga0265319_1169895	3300028563	Bacteria	672
949	Ga0265334_10025101	3300028573	Bacteria	2415
950	Ga0265318_10000347	3300028577	Bacteria	36774
951	Ga0307517_10137926	3300028786	Bacteria	1726
952	Ga0307517_10149902	3300028786	Bacteria	1604
953	Ga0307515_10000093	3300028794	Bacteria	212053
954	Ga0307515_10001261	3300028794	Bacteria	57708
955	Ga0307515_10001283	3300028794	Bacteria	57022
956	Ga0307515_10002007	3300028794	Bacteria	45041
957	Ga0307515_10004636	3300028794	Bacteria	28226
958	Ga0307515_10009359	3300028794	Bacteria	18952
959	Ga0307515_10020687	3300028794	Bacteria	11721
960	Ga0307515_10026101	3300028794	Bacteria	10069
961	Ga0307515_10033140	3300028794	Bacteria	8518
962	Ga0307515_10097581	3300028794	Bacteria	3590
963	Ga0307515_10601201	3300028794	Bacteria	710
964	Ga0265324_10056156	3300029957	Bacteria	1349
965	Ga0268256_1046721	3300030500	Bacteria	936
966	Ga0307511_10023720	3300030521	Bacteria	5711
967	Ga0265330_10001084	3300031235	Bacteria	16403
968	Ga0265332_10000920	3300031238	Bacteria	17618
969	Ga0265332_10032003	3300031238	Bacteria	2293
970	Ga0265332_10037720	3300031238	Bacteria	2095
971	Ga0265328_10000034	3300031239	Bacteria	99505
972	Ga0265328_10007066	3300031239	Bacteria	4703
973	Ga0265328_10047051	3300031239	Bacteria	1585
974	Ga0265320_10000726	3300031240	Bacteria	25199
975	Ga0265329_10002112	3300031242	Bacteria	9220
976	Ga0265329_10009738	3300031242	Bacteria	3564
977	Ga0265340_10053639	3300031247	Bacteria	1947
978	Ga0265339_10140775	3300031249	Bacteria	1227
979	Ga0265331_10000024	3300031250	Bacteria	235118
980	Ga0265331_10001289	3300031250	Bacteria	18660
981	Ga0265331_10170948	3300031250	Bacteria	983
982	Ga0265327_10000079	3300031251	Bacteria	206892
983	Ga0265327_10001928	3300031251	Bacteria	23964
984	Ga0265327_10003163	3300031251	Bacteria	16124
985	Ga0265316_10000181	3300031344	Bacteria	71764
986	Ga0265316_10003160	3300031344	Bacteria	16764
987	Ga0265316_10276769	3300031344	Bacteria	1227
988	Ga0307513_10000054	3300031456	Bacteria	148887
989	Ga0307513_10006568	3300031456	Bacteria	15190
990	Ga0307513_10018646	3300031456	Bacteria	8286
991	Ga0307513_10042813	3300031456	Bacteria	4980
992	Ga0307513_10044622	3300031456	Bacteria	4854
993	Ga0307513_10044801	3300031456	Bacteria	4842
994	Ga0307513_10402559	3300031456	Bacteria	1103
995	Ga0307513_10539573	3300031456	Bacteria	880
996	Ga0307513_10693937	3300031456	Bacteria	724
997	Ga0307509_10095877	3300031507	Bacteria	3021
998	Ga0307509_10459073	3300031507	Bacteria	966
999	Ga0307408_100000086	3300031548	Bacteria	101944
1000	Ga0307408_100022993	3300031548	Bacteria	4242
1001	Ga0307408_100046888	3300031548	Bacteria	3092
1002	Ga0307408_100067163	3300031548	Bacteria	2636
1003	Ga0307408_100160787	3300031548	Bacteria	1784
1004	Ga0307408_100187706	3300031548	Bacteria	1663
1005	Ga0307408_100378949	3300031548	Bacteria	1209
1006	Ga0307408_100803196	3300031548	Bacteria	854
1007	Ga0307508_10003350	3300031616	Bacteria	16262
1008	Ga0307508_10192655	3300031616	Bacteria	1640
1009	Ga0307514_10000795	3300031649	Bacteria	52015
1010	Ga0307514_10001506	3300031649	Bacteria	27927
1011	Ga0307514_10019015	3300031649	Bacteria	5624
1012	Ga0316575_10011595	3300031665	Bacteria	3264
1013	Ga0316575_10021874	3300031665	Bacteria	2465
1014	Ga0316575_10229925	3300031665	Bacteria	775
1015	Ga0316579_10101236	3300031691	Bacteria	1380
1016	Ga0265314_10002818	3300031711	Bacteria	17343
1017	Ga0265314_10030007	3300031711	Bacteria	4031
1018	Ga0265314_10038203	3300031711	Bacteria	3471
1019	Ga0265342_10013145	3300031712	Bacteria	5568
1020	Ga0265342_10161854	3300031712	Bacteria	1236
1021	Ga0265342_10179830	3300031712	Bacteria	1159
1022	Ga0316576_10056045	3300031727	Bacteria	2878
1023	Ga0316576_10056950	3300031727	Bacteria	2856
1024	Ga0316576_10062960	3300031727	Bacteria	2722
1025	Ga0316576_10133008	3300031727	Bacteria	1871
1026	Ga0316576_10349662	3300031727	Bacteria	1100
1027	Ga0316576_10369636	3300031727	Bacteria	1066
1028	Ga0316576_10737003	3300031727	Bacteria	712
1029	Ga0316578_10035518	3300031728	Bacteria	2866
1030	Ga0316578_10043091	3300031728	Bacteria	2619
1031	Ga0316578_10309484	3300031728	Bacteria	944
1032	Ga0307516_10000383	3300031730	Bacteria	57684
1033	Ga0307516_10004457	3300031730	Bacteria	17254
1034	Ga0307516_10011720	3300031730	Bacteria	9515
1035	Ga0307516_10017724	3300031730	Bacteria	7419
1036	Ga0307405_10005414	3300031731	Bacteria	6156
1037	Ga0307405_10461688	3300031731	Bacteria	1009
1038	Ga0316577_10028286	3300031733	Bacteria	3126
1039	Ga0316577_10092948	3300031733	Bacteria	1689
1040	Ga0307413_10020005	3300031824	Bacteria	3550
1041	Ga0307413_10445499	3300031824	Bacteria	1026
1042	Ga0307413_10735437	3300031824	Bacteria	823
1043	Ga0307410_10023516	3300031852	Bacteria	3832
1044	Ga0307410_10270386	3300031852	Bacteria	1329
1045	Ga0307410_10656781	3300031852	Bacteria	880
1046	Ga0307406_10025180	3300031901	Bacteria	3560
1047	Ga0307406_10086465	3300031901	Bacteria	2099
1048	Ga0307406_10244742	3300031901	Bacteria	1347
1049	Ga0307407_10034140	3300031903	Bacteria	2782
1050	Ga0307407_11071374	3300031903	Bacteria	625
1051	Ga0307412_10113378	3300031911	Bacteria	1940
1052	Ga0307409_100009342	3300031995	Bacteria	6018
1053	Ga0307409_100399816	3300031995	Bacteria	1312
1054	Ga0307409_100539592	3300031995	Bacteria	1143
1055	Ga0307409_100950063	3300031995	Bacteria	875
1056	Ga0307409_101072765	3300031995	Bacteria	826
1057	Ga0307416_100003992	3300032002	Bacteria	8796
1058	Ga0307416_100909977	3300032002	Bacteria	980
1059	Ga0307414_10148718	3300032004	Bacteria	1844
1060	Ga0307414_10812751	3300032004	Bacteria	853
1061	Ga0307414_11196898	3300032004	Bacteria	703
1062	Ga0307414_11417309	3300032004	Bacteria	646
1063	Ga0307414_11708164	3300032004	Bacteria	587
1064	Ga0307411_10001320	3300032005	Bacteria	9982
1065	Ga0307411_10005005	3300032005	Bacteria	6447
1066	Ga0307411_10228908	3300032005	Bacteria	1447
1067	Ga0307411_11399808	3300032005	Bacteria	640
1068	Ga0307415_100006691	3300032126	Bacteria	6240
1069	Ga0307415_100339325	3300032126	Bacteria	1260
1070	Ga0307415_101042866	3300032126	Bacteria	762
1071	Ga0316580_10012176	3300032139	Bacteria	2618
1072	Ga0307507_10157523	3300033179	Bacteria	1688
1073	Ga0307510_10113907	3300033180	Bacteria	2435
1074	Ga0373948_0002019	3300034817	Bacteria	2929
1075	Ga0373959_0051324	3300034820	Bacteria	891
1076	Ga0373938_0101796	3300034957	Bacteria	722
1077	Ga0373928_0096224	3300035084	Bacteria	766
1078	Ga0373940_0019893	3300035088	Bacteria	1700
1079	Ga0373940_0298720	3300035088	Bacteria	554
1080	Ga0373949_0112347	3300035090	Bacteria	757
1081	Ga0373951_0047822	3300035091	Bacteria	1046
1082	Ga0373932_0187236	3300035112	Bacteria	729
1083	Ga0373932_0226077	3300035112	Bacteria	674
1084	Ga0373936_0108705	3300035113	Bacteria	1176
1085	Ga0373939_0000017	3300035114	Bacteria	61924
1086	Ga0373941_0085831	3300035115	Bacteria	1071
1087	Ga0373945_0451096	3300035116	Bacteria	569
1088	Ga0373960_0000109	3300035121	Bacteria	13152
1089	Ga0373943_0130231	3300035170	Bacteria	1346
1090	Ga0373943_0287586	3300035170	Bacteria	931
1091	Ga0373943_0414377	3300035170	Bacteria	779
1092	Ga0373946_0073518	3300035171	Bacteria	1482
1093	Ga0373946_0227840	3300035171	Bacteria	902
1094	Ga0373946_0283561	3300035171	Bacteria	815
1095	Ga0373955_0006739	3300035172	Bacteria	5244
1096	Ga0373955_0311201	3300035172	Bacteria	951
1097	Ga0373955_0360841	3300035172	Bacteria	881
1098	Ga0373955_0727802	3300035172	Bacteria	609
1099	Ga0373961_0195318	3300035241	Bacteria	711
1100	Ga0316574_0002109	3300035398	Bacteria	9863
1101	Ga0316574_0004706	3300035398	Bacteria	7195
1102	Ga0316574_0006307	3300035398	Bacteria	6398
1103	Ga0316574_0106501	3300035398	Bacteria	1796
1104	Ga0316574_0167217	3300035398	Bacteria	1416
1105	Ga0316574_0280514	3300035398	Bacteria	1061
1106	Ga0316574_0783821	3300035398	Bacteria	581
1107	Ga0373924_0166644	3300035410	Bacteria	967
1108	Ga0373924_0194584	3300035410	Bacteria	894
1109	Ga0373924_0245055	3300035410	Bacteria	793
1110	Ga0373931_0000641	3300035691	Bacteria	14534
1111	Ga0373931_0014924	3300035691	Bacteria	3806
1112	Ga0373935_0302056	3300035692	Bacteria	1132
1113	Ga0373927_0286813	3300035695	Bacteria	1083
1114	Ga0373933_0018395	3300035724	Bacteria	3929
1115	Ga0373947_0215560	3300035725	Bacteria	1260
1116	Ga0373937_0005971	3300036401	Bacteria	10483
1117	Ga0373937_0052497	3300036401	Bacteria	3738
1118	Ga0373937_0075221	3300036401	Bacteria	3117
1119	Ga0373937_0150570	3300036401	Bacteria	2179
1120	Ga0373937_0224658	3300036401	Bacteria	1767
1121	Ga0373937_0293183	3300036401	Bacteria	1537
1122	Ga0373937_0901458	3300036401	Bacteria	833
1123	Ga0316582_0001870	3300036647	Bacteria	9560
1124	Ga0316582_0034461	3300036647	Bacteria	3118
1125	Ga0316582_0134775	3300036647	Bacteria	1661
1126	Ga0316584_0027762	3300036712	Bacteria	4167
1127	Ga0316584_0050235	3300036712	Bacteria	3117
1128	Ga0316584_0127724	3300036712	Bacteria	1899
1129	Ga0316584_0194067	3300036712	Bacteria	1500
1130	Ga0373925_0100843	3300037068	Bacteria	2219
1131	Ga0373925_0231330	3300037068	Bacteria	1478
1132	Ga0373925_0521850	3300037068	Bacteria	976
1133	Ga0373925_0801770	3300037068	Bacteria	776
1134	Ga0373925_0954722	3300037068	Bacteria	706
1135	Ga0373925_1242065	3300037068	Bacteria	612
1136	Ga0395899_0000010	3300037312	Bacteria	523837
1137	Ga0395899_0018492	3300037312	Bacteria	5297
1138	Ga0395899_0235742	3300037312	Bacteria	1261
1139	Ga0395900_0000005	3300037418	Bacteria	523836
1140	Ga0395900_0008244	3300037418	Bacteria	10728
1141	Ga0395900_0010948	3300037418	Bacteria	9276
1142	Ga0395900_0105001	3300037418	Bacteria	2902
1143	Ga0395900_0128127	3300037418	Bacteria	2602
1144	Ga0395900_0139094	3300037418	Bacteria	2487
1145	Ga0395900_0181050	3300037418	Bacteria	2142
1146	Ga0395900_0229277	3300037418	Bacteria	1869
1147	Ga0395900_0404011	3300037418	Bacteria	1329
1148	Ga0395900_1492503	3300037418	Bacteria	588
1149	Ga0395898_0013534	3300037466	Bacteria	8399
1150	Ga0395898_0018082	3300037466	Bacteria	7192
1151	Ga0395898_0109116	3300037466	Bacteria	2653
1152	Ga0395898_0418814	3300037466	Bacteria	1277
1153	Ga0395905_0000653	3300037471	Bacteria	46132
1154	Ga0395905_0000733	3300037471	Bacteria	43190
1155	Ga0395905_0000895	3300037471	Bacteria	38905
1156	Ga0395905_0003480	3300037471	Bacteria	16823
1157	Ga0395905_0018268	3300037471	Bacteria	6657
1158	Ga0395905_0073034	3300037471	Bacteria	3215
1159	Ga0395905_0102588	3300037471	Bacteria	2685
1160	Ga0395905_0123164	3300037471	Bacteria	2438
1161	Ga0395905_0203231	3300037471	Bacteria	1857
1162	Ga0395905_0303223	3300037471	Bacteria	1485
1163	Ga0395905_0355915	3300037471	Bacteria	1356
1164	Ga0436364_0528735	3300037853	Bacteria	840
1165	Ga0436364_0667041	3300037853	Bacteria	2536
1166	Ga0436364_1043221	3300037853	Bacteria	42769
1167	Ga0395901_0051281	3300038443	Bacteria	4289
1168	Ga0395901_0052453	3300038443	Bacteria	4239
1169	Ga0395901_0065113	3300038443	Bacteria	3794
1170	Ga0395901_0081508	3300038443	Bacteria	3380
1171	Ga0395901_0136710	3300038443	Bacteria	2575
1172	Ga0395901_0175988	3300038443	Bacteria	2244
1173	Ga0395901_0277755	3300038443	Bacteria	1741
1174	Ga0395901_0529523	3300038443	Bacteria	1196
1175	Ga0400490_35404	3300038726	Bacteria	4845
1176	Ga0400488_10414	3300038741	Bacteria	1515
1177	Ga0400483_115564	3300039062	Bacteria	1608
1178	Ga0400483_167120	3300039062	Bacteria	1856
1179	Ga0400489_77120	3300039093	Bacteria	1269
1180	Ga0237816_00148	3300039145	Bacteria	5547
1181	Ga0436365_0308506	3300039437	Bacteria	1267
1182	Ga0436365_0805618	3300039437	Bacteria	2672
1183	Ga0436365_0960828	3300039437	Bacteria	636
1184	Ga0436365_1149228	3300039437	Bacteria	1437
1185	Ga0436365_1378466	3300039437	Bacteria	1244
1186	Ga0436361_0932343	3300039447	Bacteria	25287
1187	Ga0436363_0998404	3300039450	Bacteria	907
1188	Ga0439438_000268	3300041405	Bacteria	23335
1189	Ga0439461_0020382	3300041410	Bacteria	1312
1190	Ga0451787_664484	3300041441	Bacteria	1570
1191	Ga0451789_0205740	3300041443	Bacteria	1201
1192	Ga0451789_0668546	3300041443	Bacteria	777
1193	Ga0451791_0533597	3300041451	Bacteria	2737
1194	Ga0451793_0259988	3300041452	Bacteria	764
1195	Ga0451793_0300321	3300041452	Bacteria	1572
1196	Ga0451793_0779431	3300041452	Bacteria	589
1197	Ga0451793_1098328	3300041452	Bacteria	1729
1198	Ga0451797_0814064	3300041453	Bacteria	979
1199	Ga0451797_0960381	3300041453	Bacteria	834
1200	Ga0451797_1287132	3300041453	Bacteria	622
1201	Ga0451795_0037673	3300041456	Bacteria	1169
1202	Ga0451795_0302360	3300041456	Bacteria	632
1203	Ga0451795_1093367	3300041456	Bacteria	773
1204	Ga0451800_0531416	3300041459	Bacteria	707
1205	Ga0451800_1143563	3300041459	Bacteria	861
1206	Ga0451800_1336356	3300041459	Bacteria	716
1207	Ga0451800_1347080	3300041459	Bacteria	1140
1208	Ga0451800_1453629	3300041459	Bacteria	867
1209	Ga0451802_0737550	3300041460	Bacteria	2476
1210	Ga0451802_1791109	3300041460	Bacteria	1088
1211	Ga0451807_0109086	3300041486	Bacteria	1433
1212	Ga0451807_1015374	3300041486	Bacteria	4853
1213	Ga0451807_2127931	3300041486	Unclassified	986
1214	Ga0451833_0875683	3300041491	Bacteria	4595
1215	Ga0451833_1495386	3300041491	Bacteria	2204
1216	Ga0451837_0954212	3300041494	Bacteria	2847
1217	Ga0451841_0278424	3300041498	Bacteria	942
1218	Ga0451841_0659571	3300041498	Bacteria	861
1219	Ga0451851_1274973	3300041507	Bacteria	1302
1220	Ga0451843_0108815	3300041509	Bacteria	655
1221	Ga0451853_1190134	3300041512	Bacteria	2455
1222	Ga0451853_3865866	3300041512	Bacteria	1056
1223	Ga0451853_4036164	3300041512	Bacteria	1608
1224	Ga0439437_002898	3300042000	Bacteria	1848
1225	Ga0439442_050139	3300042002	Bacteria	880
1226	Ga0439463_000609	3300042016	Bacteria	9928
1227	Ga0450911_020803	3300042115	Bacteria	856
1228	Ga0450913_017850	3300042117	Bacteria	630
1229	Ga0450917_002467	3300042120	Bacteria	1320
1230	Ga0450888_000480	3300042126	Bacteria	3773
1231	Ga0450890_000295	3300042127	Bacteria	7255
1232	Ga0450890_039658	3300042127	Bacteria	693
1233	Ga0450892_001087	3300042130	Bacteria	2844
1234	Ga0450903_027492	3300042138	Bacteria	865
1235	Ga0450904_014358	3300042139	Bacteria	790
1236	Ga0450889_009573	3300042144	Bacteria	993
1237	Ga0439446_0004039	3300042156	Bacteria	3691
1238	Ga0450893_0021574	3300042532	Bacteria	1112
1239	Ga0451577_0000013	3300042876	Bacteria	550689
1240	Ga0451577_0003554	3300042876	Bacteria	17210
1241	Ga0451577_0003789	3300042876	Bacteria	16461
1242	Ga0451577_0005413	3300042876	Bacteria	13094
1243	Ga0451577_0036543	3300042876	Bacteria	4421
1244	Ga0451577_0143508	3300042876	Bacteria	2146
1245	Ga0451577_0537562	3300042876	Bacteria	1061
1246	Ga0451577_1964921	3300042876	Bacteria	512
1247	Ga0466969_0000036	3300044656	Bacteria	75718
1248	Ga0466969_0006230	3300044656	Bacteria	6352
1249	Ga0466969_0025156	3300044656	Bacteria	3063
1250	Ga0466969_0032912	3300044656	Bacteria	2634
1251	Ga0466969_0039565	3300044656	Bacteria	2367
1252	Ga0466972_0000282	3300044658	Bacteria	31733
1253	Ga0466972_0267270	3300044658	Bacteria	799
1254	Ga0453683_0000059	3300044673	Bacteria	187158
1255	Ga0453683_0004047	3300044673	Bacteria	10564
1256	Ga0453683_1236468	3300044673	Bacteria	501
1257	Ga0466965_0049757	3300044683	Bacteria	2077
1258	Ga0466965_0091575	3300044683	Bacteria	1547
1259	Ga0466965_0195039	3300044683	Bacteria	1072
1260	Ga0466965_0223023	3300044683	Bacteria	1005
1261	Ga0466965_0231324	3300044683	Bacteria	987
1262	Ga0466966_0026011	3300044684	Bacteria	3821
1263	Ga0466966_0224184	3300044684	Bacteria	1134
1264	Ga0466961_0000406	3300044693	Bacteria	27671
1265	Ga0466961_0003921	3300044693	Bacteria	9308
1266	Ga0466961_0015938	3300044693	Bacteria	4823
1267	Ga0466961_0027523	3300044693	Bacteria	3657
1268	Ga0466961_0231567	3300044693	Bacteria	1137
1269	Ga0466963_0008785	3300044694	Bacteria	6068
1270	Ga0466963_0355516	3300044694	Bacteria	1032
1271	Ga0466963_1240527	3300044694	Bacteria	524
1272	Ga0466964_0261218	3300044706	Bacteria	858
1273	Ga0453684_0000040	3300044712	Bacteria	690210
1274	Ga0453684_0000085	3300044712	Bacteria	397817
1275	Ga0453684_0070718	3300044712	Bacteria	4417
1276	Ga0453684_1221549	3300044712	Bacteria	788
1277	Ga0453684_1418603	3300044712	Bacteria	719
1278	Ga0453684_1703371	3300044712	Bacteria	644
1279	Ga0466971_0034131	3300044719	Bacteria	2280
1280	Ga0466970_0023540	3300044765	Bacteria	3218
1281	Ga0466970_0025771	3300044765	Bacteria	3080
1282	Ga0466970_0046693	3300044765	Bacteria	2307
1283	Ga0466970_0401824	3300044765	Bacteria	782
1284	Ga0466957_0238191	3300044842	Bacteria	1207
1285	Ga0466959_0032407	3300045049	Bacteria	3868
1286	Ga0466959_0038662	3300045049	Bacteria	3526
1287	Ga0466959_0042728	3300045049	Bacteria	3343
1288	Ga0466959_0306609	3300045049	Bacteria	1087
1289	Ga0466959_0767138	3300045049	Bacteria	645
1290	Ga0451576_0000018	3300045051	Bacteria	550689
1291	Ga0451576_0006036	3300045051	Bacteria	14958
1292	Ga0451576_0046314	3300045051	Bacteria	4580
1293	Ga0451576_0062742	3300045051	Bacteria	3873
1294	Ga0451576_0147519	3300045051	Bacteria	2453
1295	Ga0451576_0625897	3300045051	Bacteria	1131
1296	Ga0451576_1084978	3300045051	Bacteria	838
1297	Ga0451576_1689404	3300045051	Bacteria	656
1298	Ga0466967_1225235	3300045976	Bacteria	748
1299	Ga0495617_171111	3300046452	Bacteria	686
1300	Ga0495627_008265	3300046453	Bacteria	3915
1301	Ga0495592_0059971	3300046454	Bacteria	2800
1302	Ga0495590_0169163	3300046457	Bacteria	796
1303	Ga0495591_002740	3300046458	Bacteria	9543
1304	Ga0495629_0016220	3300046459	Bacteria	5348
1305	Ga0495629_0107860	3300046459	Bacteria	1942
1306	Ga0495629_0252120	3300046459	Bacteria	1214
1307	Ga0495629_0480371	3300046459	Bacteria	839
1308	Ga0495638_0060421	3300046460	Bacteria	2344
1309	Ga0495638_0088234	3300046460	Bacteria	1872
1310	Ga0495638_0115806	3300046460	Bacteria	1588
1311	Ga0495638_0550317	3300046460	Bacteria	574
1312	Ga0495653_0019297	3300046463	Bacteria	5528
1313	Ga0495650_0008829	3300046471	Bacteria	5823
1314	Ga0495650_0059084	3300046471	Bacteria	1545
1315	Ga0495580_0100343	3300046472	Bacteria	2014
1316	Ga0495580_0206695	3300046472	Bacteria	1352
1317	Ga0495580_0210191	3300046472	Bacteria	1339
1318	Ga0495580_0234349	3300046472	Bacteria	1260
1319	Ga0495580_0365861	3300046472	Bacteria	975
1320	Ga0495580_0383443	3300046472	Bacteria	949
1321	Ga0495580_0468007	3300046472	Bacteria	844
1322	Ga0495582_0014361	3300046473	Bacteria	4354
1323	Ga0495582_0117472	3300046473	Bacteria	1497
1324	Ga0495582_0355075	3300046473	Bacteria	844
1325	Ga0495605_0000079	3300046474	Bacteria	126756
1326	Ga0495605_0010273	3300046474	Bacteria	5242
1327	Ga0495664_0023776	3300046477	Bacteria	3557
1328	Ga0495664_0098878	3300046477	Bacteria	1757
1329	Ga0495584_0053064	3300046491	Bacteria	2040
1330	Ga0495594_0002116	3300046499	Bacteria	10340
1331	Ga0495596_0116045	3300046500	Bacteria	1040
1332	Ga0495607_0005948	3300046501	Bacteria	8652
1333	Ga0495607_0024242	3300046501	Bacteria	3785
1334	Ga0495607_0027845	3300046501	Bacteria	3490
1335	Ga0495607_0187075	3300046501	Bacteria	1034
1336	Ga0495607_0191961	3300046501	Bacteria	1017
1337	Ga0495583_0006278	3300046506	Bacteria	7812
1338	Ga0495583_0138597	3300046506	Bacteria	1014
1339	Ga0495606_0000018	3300046507	Bacteria	281058
1340	Ga0495606_0001693	3300046507	Bacteria	28471
1341	Ga0495606_0004808	3300046507	Bacteria	13263
1342	Ga0495606_0012829	3300046507	Bacteria	6677
1343	Ga0495606_0086766	3300046507	Bacteria	1933
1344	Ga0495608_0532451	3300046511	Bacteria	709
1345	Ga0495610_0039322	3300046512	Bacteria	2393
1346	Ga0495610_0063754	3300046512	Bacteria	1744
1347	Ga0495610_0112226	3300046512	Bacteria	1206
1348	Ga0495610_0151459	3300046512	Bacteria	989
1349	Ga0495610_0237895	3300046512	Bacteria	727
1350	Ga0495618_0690362	3300046514	Bacteria	601
1351	Ga0495620_0013339	3300046515	Bacteria	4210
1352	Ga0495620_0048024	3300046515	Bacteria	1834
1353	Ga0495620_0092085	3300046515	Bacteria	1215
1354	Ga0495620_0300239	3300046515	Bacteria	610
1355	Ga0495628_0245793	3300046516	Bacteria	1337
1356	Ga0495631_0048144	3300046518	Bacteria	1870
1357	Ga0495632_0004573	3300046519	Bacteria	9377
1358	Ga0495632_0005877	3300046519	Bacteria	8013
1359	Ga0495632_0019284	3300046519	Bacteria	3720
1360	Ga0495632_0055251	3300046519	Bacteria	1944
1361	Ga0495632_0067376	3300046519	Bacteria	1726
1362	Ga0495632_0146319	3300046519	Bacteria	1094
1363	Ga0495643_0004561	3300046522	Bacteria	9647
1364	Ga0495643_0277504	3300046522	Bacteria	772
1365	Ga0495644_0040888	3300046523	Bacteria	1747
1366	Ga0495644_0187454	3300046523	Bacteria	796
1367	Ga0495642_0010968	3300046528	Bacteria	3474
1368	Ga0495642_0126278	3300046528	Bacteria	1100
1369	Ga0495652_0474867	3300046529	Bacteria	871
1370	Ga0495654_0091204	3300046530	Bacteria	1414
1371	Ga0495640_0152833	3300046533	Bacteria	1482
1372	Ga0495586_0199579	3300046535	Bacteria	1134
1373	Ga0495598_0126453	3300046537	Bacteria	872
1374	Ga0495598_0273086	3300046537	Bacteria	632
1375	Ga0495598_0363899	3300046537	Bacteria	559
1376	Ga0495609_0124522	3300046538	Bacteria	1107
1377	Ga0495621_0064902	3300046539	Bacteria	1333
1378	Ga0495597_0092634	3300046542	Bacteria	1281
1379	Ga0495597_0278207	3300046542	Bacteria	652
1380	Ga0495645_0074164	3300046543	Bacteria	2451
1381	Ga0495645_0245104	3300046543	Bacteria	1193
1382	Ga0495622_0027086	3300046557	Bacteria	2675
1383	Ga0495656_0124763	3300046615	Bacteria	1219
1384	Ga0495668_0026531	3300046616	Bacteria	3287
1385	Ga0495668_0273037	3300046616	Bacteria	926
1386	Ga0495668_0291160	3300046616	Bacteria	895
1387	Ga0495668_0603867	3300046616	Bacteria	606
1388	Ga0495611_0001249	3300046648	Bacteria	13066
1389	Ga0495611_0063900	3300046648	Bacteria	1676
1390	Ga0495611_0088526	3300046648	Bacteria	1429
1391	Ga0495611_0270890	3300046648	Bacteria	785
1392	Ga0495625_0010777	3300046660	Bacteria	7524
1393	Ga0495625_0128312	3300046660	Bacteria	1719
1394	Ga0495625_0180493	3300046660	Bacteria	1404
1395	Ga0495625_0609068	3300046660	Bacteria	655
1396	Ga0495635_0074733	3300046663	Bacteria	2322
1397	Ga0495635_0115894	3300046663	Bacteria	1829
1398	Ga0495659_0338654	3300046664	Bacteria	641
1399	Ga0495661_0025068	3300046665	Bacteria	3858
1400	Ga0495661_0226445	3300046665	Bacteria	966
1401	Ga0495657_0082973	3300046675	Bacteria	2070
1402	Ga0495599_0161085	3300046678	Bacteria	1387
1403	Ga0495646_0073389	3300046680	Bacteria	2010
1404	Ga0495647_0021435	3300046681	Bacteria	2326
1405	Ga0495647_0021548	3300046681	Bacteria	2321
1406	Ga0495658_0018582	3300046683	Bacteria	3616
1407	Ga0495658_0032930	3300046683	Bacteria	2834
1408	Ga0495658_0254946	3300046683	Bacteria	1104
1409	Ga0495658_0263091	3300046683	Bacteria	1086
1410	Ga0495669_0015535	3300046684	Bacteria	3261
1411	Ga0495613_0339900	3300046689	Bacteria	1033
1412	Ga0495613_0420755	3300046689	Bacteria	909
1413	Ga0495670_0007900	3300046691	Bacteria	5230
1414	Ga0495671_0020895	3300046692	Bacteria	3445
1415	Ga0495671_0053956	3300046692	Bacteria	1994
1416	Ga0495671_0397257	3300046692	Bacteria	660
1417	Ga0495649_0003794	3300046694	Bacteria	10019
1418	Ga0495649_0222559	3300046694	Bacteria	976
1419	Ga0495589_0017714	3300046794	Bacteria	3655
1420	Ga0495589_0272469	3300046794	Bacteria	788
1421	Ga0495600_0286469	3300046809	Bacteria	1042
1422	Ga0495660_0025217	3300046810	Bacteria	3378
1423	Ga0495660_0394460	3300046810	Bacteria	607
1424	Ga0495604_0192249	3300047317	Bacteria	1421
1425	Ga0495636_0060240	3300047318	Bacteria	1603
1426	Ga0495674_0111820	3300047319	Bacteria	2315
1427	Ga0495672_0009983	3300047320	Bacteria	6811
1428	Ga0495680_0255245	3300047322	Bacteria	1241
1429	Ga0495687_000912	3300047443	Bacteria	30787
1430	Ga0495687_011633	3300047443	Bacteria	4715
1431	Ga0495677_0019763	3300047445	Bacteria	2441
1432	Ga0495679_066707	3300047446	Bacteria	1044
1433	Ga0495673_0010730	3300047469	Bacteria	4964
1434	Ga0495673_0021951	3300047469	Bacteria	3138
1435	Ga0495681_0145242	3300047470	Bacteria	999
1436	Ga0495684_0163503	3300047471	Bacteria	1659
1437	Ga0495686_0337769	3300047472	Bacteria	822
1438	Ga0495686_0549571	3300047472	Bacteria	603
1439	Ga0495614_0242387	3300048089	Bacteria	823
1440	Ga0495626_0111959	3300048091	Bacteria	1181
1441	Ga0495626_0124367	3300048091	Bacteria	1106
1442	Ga0496100_0832195	3300048903	Bacteria	724
1443	Ga0496101_0024961	3300048904	Bacteria	4143
1444	Ga0496101_0297444	3300048904	Bacteria	1264
1445	Ga0496101_0364831	3300048904	Bacteria	1136
1446	Ga0496102_0021149	3300048905	Bacteria	5753
1447	Ga0496102_0039318	3300048905	Bacteria	4274
1448	Ga0496102_0079561	3300048905	Bacteria	3019
1449	Ga0496102_0136772	3300048905	Bacteria	2296
1450	Ga0496102_0439587	3300048905	Bacteria	1224
1451	Ga0496102_1093602	3300048905	Bacteria	717
1452	Ga0496104_0013206	3300048907	Bacteria	7445
1453	Ga0496104_0085647	3300048907	Bacteria	3008
1454	Ga0496104_0124767	3300048907	Bacteria	2472
1455	Ga0496105_0745533	3300048908	Bacteria	748
1456	Ga0496106_0057379	3300048909	Bacteria	2944
1457	Ga0496106_0084887	3300048909	Bacteria	2437
1458	Ga0496106_0185495	3300048909	Bacteria	1653
1459	Ga0496106_0299452	3300048909	Bacteria	1289
1460	Ga0496107_0088189	3300048910	Bacteria	2265
1461	Ga0496108_0543160	3300048911	Bacteria	1014
1462	Ga0496108_1625881	3300048911	Bacteria	534
1463	Ga0496108_1737401	3300048911	Bacteria	512
1464	Ga0496109_0125768	3300048912	Bacteria	2390
1465	Ga0496109_0520052	3300048912	Bacteria	1123
1466	Ga0496109_0592397	3300048912	Bacteria	1045
1467	Ga0496109_0940342	3300048912	Bacteria	802
1468	Ga0496110_0069135	3300048913	Bacteria	3127
1469	Ga0496110_0132413	3300048913	Bacteria	2252
1470	Ga0496110_0218016	3300048913	Bacteria	1735
1471	Ga0496110_0262072	3300048913	Bacteria	1573
1472	Ga0496110_0546433	3300048913	Bacteria	1053
1473	Ga0496110_1333805	3300048913	Bacteria	627
1474	Ga0496112_0005059	3300048915	Bacteria	11325
1475	Ga0496113_0007024	3300048916	Bacteria	7202
1476	Ga0496114_0001047	3300048917	Bacteria	20785
1477	Ga0496114_0008159	3300048917	Bacteria	8300
1478	Ga0496114_0028612	3300048917	Bacteria	4575
1479	Ga0496114_0061024	3300048917	Bacteria	3153
1480	Ga0496114_0352539	3300048917	Bacteria	1302
1481	Ga0496115_0204471	3300048918	Bacteria	1631
1482	Ga0496115_0375720	3300048918	Bacteria	1156
1483	Ga0496116_0020148	3300048919	Bacteria	5075
1484	Ga0496117_0056774	3300048920	Bacteria	2724
1485	Ga0496118_0142551	3300048921	Bacteria	1516
1486	Ga0496119_0000834	3300048922	Bacteria	41096
1487	Ga0496120_0000718	3300048923	Bacteria	48575
1488	Ga0496121_0026934	3300048924	Bacteria	5396
1489	Ga0496122_0000592	3300048925	Bacteria	74496
1490	Ga0496122_0016985	3300048925	Bacteria	6837
1491	Ga0496123_0000656	3300048926	Bacteria	57313
1492	Ga0496123_0030819	3300048926	Bacteria	3917
1493	Ga0496124_0003362	3300048927	Bacteria	19661
1494	Ga0496124_0010223	3300048927	Bacteria	9532
1495	Ga0496124_0022120	3300048927	Bacteria	5837
1496	Ga0496124_0078596	3300048927	Bacteria	2718
1497	Ga0496124_0079168	3300048927	Bacteria	2707
1498	Ga0496124_0091501	3300048927	Bacteria	2479
1499	Ga0496124_0437474	3300048927	Bacteria	896
1500	Ga0496125_0022697	3300048928	Bacteria	5819
1501	Ga0496125_0062565	3300048928	Bacteria	2975
1502	Ga0496125_0137894	3300048928	Bacteria	1702
1503	Ga0496126_0011307	3300048929	Bacteria	9260
1504	Ga0496126_0047047	3300048929	Bacteria	3951
1505	Ga0496126_0293202	3300048929	Bacteria	1345
1506	Ga0501309_010432	3300049129	Bacteria	1198
1507	Ga0495678_023711	3300049459	Bacteria	2662
1508	Ga0495678_036235	3300049459	Bacteria	2014
1509	Ga0495678_119543	3300049459	Bacteria	887
1510	Ga0495682_0002074	3300049460	Bacteria	9792
1511	Ga0495682_0340000	3300049460	Bacteria	529
1512	Ga0501299_012430	3300049522	Bacteria	1453
1513	Ga0501299_040320	3300049522	Bacteria	935
1514	Ga0501314_003354	3300049530	Bacteria	1289
1515	Ga0501031_0001649	3300049568	Bacteria	14009
1516	Ga0501031_1003052	3300049568	Bacteria	534
1517	Ga0501032_0125464	3300049569	Bacteria	1696
1518	Ga0501032_0142264	3300049569	Bacteria	1580
1519	Ga0501032_0750232	3300049569	Bacteria	617
1520	Ga0501033_0082237	3300049570	Bacteria	2362
1521	Ga0501034_0130008	3300049571	Bacteria	2502
1522	Ga0501034_0172250	3300049571	Bacteria	2131
1523	Ga0501034_0199961	3300049571	Bacteria	1957
1524	Ga0501034_0364902	3300049571	Bacteria	1371
1525	Ga0501036_0245252	3300049572	Bacteria	1502
1526	Ga0501036_0640592	3300049572	Bacteria	880
1527	Ga0501036_0820355	3300049572	Bacteria	765
1528	Ga0501037_0013659	3300049573	Bacteria	5983
1529	Ga0501038_0120063	3300049574	Bacteria	2169
1530	Ga0501038_0348001	3300049574	Bacteria	1155
1531	Ga0501038_0891020	3300049574	Bacteria	657
1532	Ga0501039_0032761	3300049575	Bacteria	4008
1533	Ga0501039_0052269	3300049575	Bacteria	3162
1534	Ga0501039_0188149	3300049575	Bacteria	1624
1535	Ga0501040_0103737	3300049576	Bacteria	1985
1536	Ga0501040_0165251	3300049576	Bacteria	1566
1537	Ga0501040_0675638	3300049576	Bacteria	747
1538	Ga0501040_0735400	3300049576	Bacteria	714
1539	Ga0501042_1075571	3300049578	Bacteria	586
1540	Ga0501043_0000004	3300049579	Bacteria	291085
1541	Ga0501043_0088959	3300049579	Bacteria	2427
1542	Ga0501046_0000016	3300049580	Bacteria	234374
1543	Ga0501046_0201970	3300049580	Bacteria	1479
1544	Ga0501046_0218551	3300049580	Bacteria	1412
1545	Ga0501047_0000012	3300049581	Bacteria	368824
1546	Ga0501047_0002537	3300049581	Bacteria	17406
1547	Ga0501047_0122948	3300049581	Bacteria	2476
1548	Ga0501047_0287570	3300049581	Bacteria	1488
1549	Ga0501047_0293404	3300049581	Bacteria	1470
1550	Ga0501047_0335198	3300049581	Bacteria	1351
1551	Ga0501047_0335504	3300049581	Bacteria	1350
1552	Ga0501047_0625024	3300049581	Bacteria	898
1553	Ga0501047_1051994	3300049581	Bacteria	627
1554	Ga0501048_0010438	3300049582	Bacteria	6935
1555	Ga0501068_0275027	3300049584	Bacteria	1075
1556	Ga0501069_0011816	3300049585	Bacteria	4630
1557	Ga0501070_0013166	3300049586	Bacteria	6971
1558	Ga0501070_0050947	3300049586	Bacteria	3436
1559	Ga0501070_0734822	3300049586	Bacteria	779
1560	Ga0501071_0008835	3300049587	Bacteria	6679
1561	Ga0501071_0410886	3300049587	Bacteria	1034
1562	Ga0501073_0025636	3300049589	Bacteria	4225
1563	Ga0501074_0002091	3300049590	Bacteria	13779
1564	Ga0501076_0373427	3300049592	Bacteria	1172
1565	Ga0501199_005273	3300049650	Bacteria	1297
1566	Ga0501202_013977	3300049652	Bacteria	1533
1567	Ga0501211_000722	3300049658	Bacteria	3372
1568	Ga0501222_001247	3300049662	Bacteria	3582
1569	Ga0501249_087284	3300049679	Bacteria	737
1570	Ga0501253_028874	3300049683	Bacteria	1042
1571	Ga0501080_0033654	3300049742	Bacteria	4783
1572	Ga0501080_0047008	3300049742	Bacteria	4018
1573	Ga0501080_0175561	3300049742	Bacteria	1974
1574	Ga0501080_0527557	3300049742	Bacteria	1053
1575	Ga0501080_1094767	3300049742	Bacteria	688
1576	Ga0501081_0217634	3300049743	Bacteria	1388
1577	Ga0501083_0014526	3300049744	Bacteria	5506
1578	Ga0501264_006472	3300049761	Bacteria	1079
1579	Ga0501266_008842	3300049763	Bacteria	1270
1580	Ga0501267_006197	3300049764	Bacteria	1145
1581	Ga0501272_005513	3300049769	Bacteria	1334
1582	Ga0501278_010212	3300049774	Bacteria	746
1583	Ga0501279_003394	3300049775	Bacteria	2079
1584	Ga0501035_0016682	3300049822	Bacteria	6771
1585	Ga0501035_0068118	3300049822	Bacteria	3156
1586	Ga0501035_0103549	3300049822	Bacteria	2497
1587	Ga0501044_0007417	3300049823	Bacteria	12064
1588	Ga0501044_0064676	3300049823	Bacteria	3733
1589	Ga0501044_0139113	3300049823	Bacteria	2417
1590	Ga0501044_0191635	3300049823	Bacteria	2007
1591	Ga0501044_0247169	3300049823	Bacteria	1726
1592	Ga0501045_0009097	3300049824	Bacteria	6937
1593	Ga0501045_0434923	3300049824	Bacteria	976
1594	Ga0501226_004955	3300049853	Bacteria	1528
1595	Ga0501226_006472	3300049853	Bacteria	1327
1596	nmdc:mga03683_102014_c1	3300050489	Bacteria	1262
1597	nmdc:mga03683_115789_c1	3300050489	Bacteria	1189
1598	nmdc:mga03683_307019_c1	3300050489	Bacteria	745
1599	nmdc:mga03683_313614_c1	3300050489	Bacteria	737
1600	nmdc:mga03683_54553_c1	3300050489	Bacteria	1676
1601	nmdc:mga03n38_41237_c1	3300050490	Bacteria	2011
1602	nmdc:mga03n38_827733_c1	3300050490	Bacteria	540
1603	nmdc:mga00v17_127984_c1	3300050491	Bacteria	1621
1604	nmdc:mga00v17_143688_c1	3300050491	Bacteria	1531
1605	nmdc:mga00v17_186953_c1	3300050491	Bacteria	1337
1606	nmdc:mga00v17_828904_c1	3300050491	Bacteria	588
1607	nmdc:mga0yw44_30213_c1	3300050492	Bacteria	3136
1608	nmdc:mga0yw44_459892_c1	3300050492	Bacteria	862
1609	nmdc:mga0k408_109179_c1	3300050493	Bacteria	1635
1610	nmdc:mga0k408_11211_c1	3300050493	Bacteria	4875
1611	nmdc:mga0k408_114833_c1	3300050493	Bacteria	1593
1612	nmdc:mga0k408_136285_c1	3300050493	Bacteria	1459
1613	nmdc:mga0k408_14639_c1	3300050493	Bacteria	4325
1614	nmdc:mga0k408_152829_c1	3300050493	Bacteria	1375
1615	nmdc:mga0k408_15620_c1	3300050493	Bacteria	4201
1616	nmdc:mga0k408_263616_c1	3300050493	Bacteria	1029
1617	nmdc:mga0k408_2673_c1	3300050493	Bacteria	9451
1618	nmdc:mga0k408_47503_c1	3300050493	Bacteria	2481
1619	nmdc:mga0k408_60046_c1	3300050493	Bacteria	2209
1620	nmdc:mga0k408_607146_c1	3300050493	Bacteria	645
1621	nmdc:mga0k408_63531_c1	3300050493	Bacteria	958
1622	nmdc:mga0k408_92973_c1	3300050493	Bacteria	1773
1623	nmdc:mga0k408_96201_c1	3300050493	Bacteria	1743
1624	nmdc:mga06z11_23782_c1	3300050494	Bacteria	2883
1625	nmdc:mga06z11_27127_c1	3300050494	Bacteria	2735
1626	nmdc:mga06z11_51754_c1	3300050494	Bacteria	2104
1627	nmdc:mga06z11_551408_c1	3300050494	Bacteria	700
1628	nmdc:mga06z11_65667_c1	3300050494	Bacteria	1905
1629	nmdc:mga07m45_1019_c1	3300050496	Bacteria	7575
1630	nmdc:mga07m45_103975_c1	3300050496	Bacteria	1633
1631	nmdc:mga07m45_1241_c1	3300050496	Bacteria	11565
1632	nmdc:mga07m45_144604_c1	3300050496	Bacteria	1378
1633	nmdc:mga07m45_215893_c1	3300050496	Bacteria	1116
1634	nmdc:mga07m45_22037_c1	3300050496	Bacteria	3476
1635	nmdc:mga07m45_4444_c1	3300050496	Bacteria	6863
1636	nmdc:mga07m45_46325_c1	3300050496	Bacteria	2443
1637	nmdc:mga07m45_650_c1	3300050496	Bacteria	14760
1638	nmdc:mga07m45_687772_c1	3300050496	Bacteria	589
1639	nmdc:mga05p37_1697299_c1	3300050507	Bacteria	616
1640	nmdc:mga05p37_566117_c1	3300050507	Bacteria	1290
1641	nmdc:mga09592_349395_c1	3300050508	Bacteria	1280
1642	nmdc:mga09592_522300_c1	3300050508	Bacteria	1021
1643	nmdc:mga0qj67_453007_c1	3300050509	Bacteria	1033
1644	nmdc:mga0qj67_639730_c1	3300050509	Bacteria	849
1645	nmdc:mga06r32_352_c1	3300050510	Bacteria	38408
1646	nmdc:mga06r32_77840_c1	3300050510	Bacteria	3222
1647	nmdc:mga08y16_304961_c1	3300050511	Bacteria	1641
1648	nmdc:mga08y16_465913_c1	3300050511	Bacteria	1287
1649	nmdc:mga08y16_674920_c1	3300050511	Bacteria	1035
1650	nmdc:mga0sz30_45120_c1	3300050516	Bacteria	1859
1651	Ga0495601_0057819	3300053077	Bacteria	2457
1652	Ga0495601_0448656	3300053077	Bacteria	834
1653	Ga0495612_0038847	3300053078	Bacteria	1935
1654	Ga0495612_0040355	3300053078	Bacteria	1901
1655	Ga0495619_0119836	3300053085	Bacteria	1804
1656	Ga0495619_0734208	3300053085	Bacteria	670
1657	Ga0500578_0000049	3300053086	Bacteria	124281
1658	Ga0500644_0032189	3300053088	Bacteria	1674
1659	Ga0500644_0099111	3300053088	Bacteria	1104
1660	Ga0500646_0003195	3300053090	Bacteria	4205
1661	Ga0500647_0132189	3300053091	Bacteria	1176
1662	Ga0500583_0389368	3300053092	Bacteria	670
1663	Ga0500583_0532016	3300053092	Bacteria	548
1664	Ga0500651_0097062	3300053093	Bacteria	1810
1665	Ga0500651_0114859	3300053093	Bacteria	1640
1666	Ga0500651_0406196	3300053093	Bacteria	764
1667	Ga0500650_0057076	3300053098	Bacteria	1820
1668	Ga0500650_0183909	3300053098	Bacteria	957
1669	Ga0500660_124303	3300053100	Bacteria	1066
1670	Ga0500555_089260	3300053103	Bacteria	793
1671	Ga0500562_007913	3300053108	Bacteria	2684
1672	Ga0500569_105324	3300053109	Bacteria	928
1673	Ga0500591_075673	3300053115	Bacteria	1512
1674	Ga0500593_000729	3300053117	Bacteria	12456
1675	Ga0500593_030750	3300053117	Bacteria	2399
1676	Ga0500594_0054739	3300053118	Bacteria	1134
1677	Ga0500594_0058307	3300053118	Bacteria	1106
1678	Ga0500628_000439	3300053129	Bacteria	7917
1679	Ga0500642_0006244	3300053130	Bacteria	3906
1680	Ga0500652_000044	3300053131	Bacteria	64309
1681	Ga0500652_023494	3300053131	Bacteria	2345
1682	Ga0500655_029979	3300053133	Bacteria	1045
1683	Ga0500658_0002543	3300053134	Bacteria	7066
1684	Ga0500658_0015441	3300053134	Bacteria	2836
1685	Ga0500658_0074183	3300053134	Bacteria	1442
1686	Ga0500658_0128090	3300053134	Bacteria	1130
1687	Ga0500559_0006184	3300053136	Bacteria	5418
1688	Ga0500559_0327048	3300053136	Bacteria	718
1689	Ga0500561_0058022	3300053137	Bacteria	1076
1690	Ga0500568_0001263	3300053139	Bacteria	16721
1691	Ga0500568_0016548	3300053139	Bacteria	3275
1692	Ga0500568_0027522	3300053139	Bacteria	2376
1693	Ga0500568_0038336	3300053139	Bacteria	1940
1694	Ga0500577_0003546	3300053142	Bacteria	4058
1695	Ga0500577_0347215	3300053142	Bacteria	649
1696	Ga0500588_0033202	3300053146	Bacteria	1504
1697	Ga0500604_0012951	3300053151	Bacteria	2257
1698	Ga0500604_0112477	3300053151	Bacteria	905
1699	Ga0500619_000120	3300053154	Bacteria	20611
1700	Ga0500622_0000002	3300053156	Bacteria	646442
1701	Ga0500622_0000128	3300053156	Bacteria	79659
1702	Ga0500622_0001173	3300053156	Bacteria	21675
1703	Ga0500622_0001549	3300053156	Bacteria	18205
1704	Ga0500622_0007550	3300053156	Bacteria	6162
1705	Ga0500622_0071964	3300053156	Bacteria	1746
1706	Ga0500622_0170851	3300053156	Bacteria	1012
1707	Ga0500645_000413	3300053730	Bacteria	29917
1708	Ga0500645_014269	3300053730	Bacteria	2534
1709	Ga0500565_014417	3300053734	Bacteria	872
1710	Ga0500587_005732	3300053739	Bacteria	1663
1711	Ga0500587_011776	3300053739	Bacteria	1104
1712	Ga0501084_0054143	3300054114	Bacteria	3356
1713	Ga0590071_001980	3300059421	Bacteria	5239
1714	Ga0501082_0821023	3300060353	Bacteria	813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300006880	Ga0075429_100401840	Ga0075429_1004018402	131
2	3300009147	Ga0114129_10491018	Ga0114129_104910182	131
3	3300050507	nmdc:mga05p37_566117_c1	nmdc:mga05p37_566117_c1_161_616	131
4	3300050508	nmdc:mga09592_349395_c1	nmdc:mga09592_349395_c1_612_1067	131
5	3300041452	Ga0451793_0779431	Ga0451793_0779431_74_529	132
6	3300049578	Ga0501042_1075571	Ga0501042_1075571_14_415	132
7	3300006847	Ga0075431_100005587	Ga0075431_1000055876	134
8	3300050510	nmdc:mga06r32_352_c1	nmdc:mga06r32_352_c1_33329_33784	134
9	3300025915	Ga0207693_10448950	Ga0207693_104489502	139
10	3300046511	Ga0495608_0532451	Ga0495608_0532451_153_620	139
11	3300041456	Ga0451795_1093367	Ga0451795_1093367_10_480	140
12	3300028558	Ga0265326_10027167	Ga0265326_100271672	141
13	3300028563	Ga0265319_1169895	Ga0265319_11698951	141
14	3300028573	Ga0265334_10025101	Ga0265334_100251011	141
15	3300028577	Ga0265318_10000347	Ga0265318_1000034721	141
16	3300031235	Ga0265330_10001084	Ga0265330_100010841	141
17	3300031238	Ga0265332_10000920	Ga0265332_100009207	141
18	3300031239	Ga0265328_10007066	Ga0265328_100070664	141
19	3300031240	Ga0265320_10000726	Ga0265320_100007261	141
20	3300031242	Ga0265329_10002112	Ga0265329_100021126	141
21	3300031249	Ga0265339_10140775	Ga0265339_101407751	141
22	3300031250	Ga0265331_10001289	Ga0265331_100012897	141
23	3300031344	Ga0265316_10003160	Ga0265316_100031601	141
24	3300031711	Ga0265314_10038203	Ga0265314_100382031	141
25	3300031712	Ga0265342_10013145	Ga0265342_100131454	141
26	iso_pu_bacteria	2861691609	2861695613	141
27	3300041452	Ga0451793_1098328	Ga0451793_1098328_693_1187	142
28	3300041453	Ga0451797_0960381	Ga0451797_0960381_16_510	142
29	3300041460	Ga0451802_0737550	Ga0451802_0737550_171_665	142
30	3300041491	Ga0451833_0875683	Ga0451833_0875683_11_505	142
31	3300005367	Ga0070667_100088182	Ga0070667_1000881822	143
32	3300005539	Ga0068853_100034477	Ga0068853_1000344773	143
33	3300005578	Ga0068854_100882064	Ga0068854_1008820641	143
34	3300025981	Ga0207640_10518385	Ga0207640_105183852	143
35	3300026041	Ga0207639_10013995	Ga0207639_100139952	143
36	iso_pu_bacteria	3003665799	3003670766	143
37	3300005435	Ga0070714_100940801	Ga0070714_1009408012	144
38	3300005437	Ga0070710_10065129	Ga0070710_100651293	144
39	3300005437	Ga0070710_10506754	Ga0070710_105067542	144
40	3300005439	Ga0070711_100061388	Ga0070711_1000613883	144
41	3300006175	Ga0070712_100133058	Ga0070712_1001330583	144
42	3300025898	Ga0207692_10105491	Ga0207692_101054913	144
43	3300025915	Ga0207693_10061984	Ga0207693_100619843	144
44	3300025915	Ga0207693_10461586	Ga0207693_104615862	144
45	3300025916	Ga0207663_10421691	Ga0207663_104216912	144
46	3300039450	Ga0436363_0998404	Ga0436363_0998404_90_584	144
47	3300049742	Ga0501080_0175561	Ga0501080_0175561_356_808	144
48	3300049744	Ga0501083_0014526	Ga0501083_0014526_518_970	144
49	3300054114	Ga0501084_0054143	Ga0501084_0054143_2408_2860	144
50	iso_pu_bacteria	2643221665	2644363260	144
51	iso_pu_bacteria	2855020534	2855021425	144
52	iso_pu_bacteria	2928515477	2928516354	144
53	3300005437	Ga0070710_10549970	Ga0070710_105499701	145
54	3300005937	Ga0081455_10588779	Ga0081455_105887792	145
55	3300005983	Ga0081540_1012498	Ga0081540_10124983	145
56	3300006173	Ga0070716_101375385	Ga0070716_1013753851	145
57	3300026067	Ga0207678_10516914	Ga0207678_105169142	145
58	3300035241	Ga0373961_0195318	Ga0373961_0195318_29_505	145
59	3300039437	Ga0436365_0308506	Ga0436365_0308506_741_1244	145
60	3300039437	Ga0436365_0805618	Ga0436365_0805618_2110_2610	145
61	3300044694	Ga0466963_0355516	Ga0466963_0355516_515_982	145
62	3300045976	Ga0466967_1225235	Ga0466967_1225235_210_677	145
63	iso_pu_bacteria	2599185307	2599971989	145
64	iso_pu_bacteria	2765235841	2765586689	145
65	iso_pu_bacteria	2919155634	2919156000	145
66	iso_pu_bacteria	8056161164	8056163744	145
67	3300003203	JGI25406J46586_10000015	JGI25406J46586_1000001512	146
68	3300005436	Ga0070713_100276595	Ga0070713_1002765952	146
69	3300005437	Ga0070710_10007341	Ga0070710_100073415	146
70	3300005458	Ga0070681_10239500	Ga0070681_102395002	146
71	3300005471	Ga0070698_100933444	Ga0070698_1009334442	146
72	3300025906	Ga0207699_10030917	Ga0207699_100309172	146
73	3300025912	Ga0207707_10772269	Ga0207707_107722692	146
74	3300025928	Ga0207700_10147485	Ga0207700_101474852	146
75	3300025929	Ga0207664_11067131	Ga0207664_110671311	146
76	3300030521	Ga0307511_10023720	Ga0307511_100237202	146
77	3300037853	Ga0436364_0528735	Ga0436364_0528735_106_615	146
78	3300048929	Ga0496126_0011307	Ga0496126_0011307_5574_6032	146
79	3300049581	Ga0501047_0287570	Ga0501047_0287570_381_887	146
80	3300005290	Ga0065712_10188573	Ga0065712_101885732	147
81	3300005331	Ga0070670_100046533	Ga0070670_1000465332	147
82	3300005333	Ga0070677_10334597	Ga0070677_103345972	147
83	3300005335	Ga0070666_10004166	Ga0070666_100041662	147
84	3300005338	Ga0068868_100019803	Ga0068868_1000198032	147
85	3300005347	Ga0070668_100000411	Ga0070668_10000041120	147
86	3300005353	Ga0070669_100007708	Ga0070669_1000077088	147
87	3300005354	Ga0070675_100003618	Ga0070675_1000036189	147
88	3300005355	Ga0070671_100174389	Ga0070671_1001743891	147
89	3300005356	Ga0070674_100008421	Ga0070674_1000084214	147
90	3300005364	Ga0070673_100008853	Ga0070673_1000088534	147
91	3300005365	Ga0070688_100317323	Ga0070688_1003173232	147
92	3300005367	Ga0070667_100000463	Ga0070667_10000046321	147
93	3300005435	Ga0070714_100085415	Ga0070714_1000854151	147
94	3300005436	Ga0070713_100150212	Ga0070713_1001502122	147
95	3300005436	Ga0070713_100626243	Ga0070713_1006262432	147
96	3300005436	Ga0070713_100753871	Ga0070713_1007538712	147
97	3300005440	Ga0070705_100978965	Ga0070705_1009789651	147
98	3300005456	Ga0070678_100001786	Ga0070678_1000017869	147
99	3300005458	Ga0070681_10675550	Ga0070681_106755502	147
100	3300005458	Ga0070681_10898991	Ga0070681_108989912	147
101	3300005459	Ga0068867_100000932	Ga0068867_1000009328	147
102	3300005543	Ga0070672_100000674	Ga0070672_1000006743	147
103	3300005563	Ga0068855_100077143	Ga0068855_1000771434	147
104	3300005577	Ga0068857_100655455	Ga0068857_1006554552	147
105	3300005617	Ga0068859_100007180	Ga0068859_1000071802	147
106	3300005618	Ga0068864_100055665	Ga0068864_1000556652	147
107	3300005719	Ga0068861_100268015	Ga0068861_1002680152	147
108	3300005840	Ga0068870_10292604	Ga0068870_102926042	147
109	3300005841	Ga0068863_100003312	Ga0068863_10000331210	147
110	3300005842	Ga0068858_100009778	Ga0068858_1000097783	147
111	3300005843	Ga0068860_100085476	Ga0068860_1000854762	147
112	3300005844	Ga0068862_100019197	Ga0068862_1000191974	147
113	3300005844	Ga0068862_100059433	Ga0068862_1000594333	147
114	3300006237	Ga0097621_100006883	Ga0097621_1000068832	147
115	3300006358	Ga0068871_100008710	Ga0068871_1000087108	147
116	3300006880	Ga0075429_100444789	Ga0075429_1004447892	147
117	3300006931	Ga0097620_100007180	Ga0097620_1000071802	147
118	3300009094	Ga0111539_10627877	Ga0111539_106278771	147
119	3300009177	Ga0105248_10056848	Ga0105248_100568482	147
120	3300009553	Ga0105249_10318448	Ga0105249_103184481	147
121	3300013104	Ga0157370_11080649	Ga0157370_110806492	147
122	3300013296	Ga0157374_10025164	Ga0157374_100251646	147
123	3300013308	Ga0157375_10004728	Ga0157375_100047283	147
124	3300014325	Ga0163163_10246292	Ga0163163_102462922	147
125	3300014326	Ga0157380_12702528	Ga0157380_127025281	147
126	3300014969	Ga0157376_10002171	Ga0157376_100021717	147
127	3300017792	Ga0163161_10153661	Ga0163161_101536611	147
128	3300025903	Ga0207680_10003848	Ga0207680_100038487	147
129	3300025912	Ga0207707_10529490	Ga0207707_105294902	147
130	3300025923	Ga0207681_10014662	Ga0207681_100146623	147
131	3300025925	Ga0207650_10040024	Ga0207650_100400244	147
132	3300025926	Ga0207659_10001423	Ga0207659_1000142312	147
133	3300025928	Ga0207700_10001011	Ga0207700_100010118	147
134	3300025931	Ga0207644_10022737	Ga0207644_100227371	147
135	3300025937	Ga0207669_10012607	Ga0207669_100126075	147
136	3300025938	Ga0207704_10017503	Ga0207704_100175033	147
137	3300025940	Ga0207691_10001663	Ga0207691_100016638	147
138	3300025941	Ga0207711_10036823	Ga0207711_100368232	147
139	3300025942	Ga0207689_10481973	Ga0207689_104819732	147
140	3300025960	Ga0207651_10007162	Ga0207651_100071624	147
141	3300025972	Ga0207668_10002933	Ga0207668_100029337	147
142	3300025986	Ga0207658_10002766	Ga0207658_100027669	147
143	3300026023	Ga0207677_10654372	Ga0207677_106543722	147
144	3300026035	Ga0207703_10042191	Ga0207703_100421913	147
145	3300026088	Ga0207641_10001090	Ga0207641_1000109020	147
146	3300026089	Ga0207648_10000512	Ga0207648_1000051222	147
147	3300026095	Ga0207676_10040743	Ga0207676_100407432	147
148	3300026118	Ga0207675_100024043	Ga0207675_1000240436	147
149	3300026121	Ga0207683_10003565	Ga0207683_100035657	147
150	3300028379	Ga0268266_10003010	Ga0268266_100030107	147
151	3300028381	Ga0268264_10064917	Ga0268264_100649173	147
152	3300031548	Ga0307408_100046888	Ga0307408_1000468883	147
153	3300031731	Ga0307405_10005414	Ga0307405_100054147	147
154	3300031824	Ga0307413_10020005	Ga0307413_100200053	147
155	3300031852	Ga0307410_10023516	Ga0307410_100235164	147
156	3300031901	Ga0307406_10025180	Ga0307406_100251803	147
157	3300031903	Ga0307407_10034140	Ga0307407_100341402	147
158	3300031995	Ga0307409_100009342	Ga0307409_1000093423	147
159	3300032002	Ga0307416_100003992	Ga0307416_1000039929	147
160	3300032004	Ga0307414_10812751	Ga0307414_108127511	147
161	3300032005	Ga0307411_10005005	Ga0307411_100050058	147
162	3300032126	Ga0307415_100006691	Ga0307415_1000066917	147
163	3300035170	Ga0373943_0130231	Ga0373943_0130231_373_816	147
164	3300035171	Ga0373946_0073518	Ga0373946_0073518_291_734	147
165	3300035725	Ga0373947_0215560	Ga0373947_0215560_682_1125	147
166	3300037068	Ga0373925_0521850	Ga0373925_0521850_300_743	147
167	3300037312	Ga0395899_0000010	Ga0395899_0000010_82154_82612	147
168	3300037418	Ga0395900_0000005	Ga0395900_0000005_481711_482169	147
169	3300039437	Ga0436365_1378466	Ga0436365_1378466_488_1003	147
170	3300048904	Ga0496101_0364831	Ga0496101_0364831_209_664	147
171	3300049568	Ga0501031_0001649	Ga0501031_0001649_10034_10480	147
172	3300049576	Ga0501040_0103737	Ga0501040_0103737_220_669	147
173	3300049580	Ga0501046_0201970	Ga0501046_0201970_293_742	147
174	3300049586	Ga0501070_0734822	Ga0501070_0734822_41_484	147
175	3300049742	Ga0501080_1094767	Ga0501080_1094767_146_598	147
176	3300049823	Ga0501044_0139113	Ga0501044_0139113_19_468	147
177	3300050508	nmdc:mga09592_522300_c1	nmdc:mga09592_522300_c1_390_839	147
178	3300050511	nmdc:mga08y16_465913_c1	nmdc:mga08y16_465913_c1_548_1111	147
179	3300002704	JGI25155J39150_1000079	JGI25155J39150_100007936	148
180	3300002705	JGI25156J39149_1000125	JGI25156J39149_100012536	148
181	3300002738	JGI25154J39366_1000141	JGI25154J39366_100014118	148
182	3300002741	JGI25157J39369_1000159	JGI25157J39369_100015936	148
183	3300002774	JGI25150J39212_1006333	JGI25150J39212_10063332	148
184	3300002774	JGI25150J39212_1007862	JGI25150J39212_10078622	148
185	3300002987	JGI25159J45721_1000638	JGI25159J45721_10006383	148
186	3300002987	JGI25159J45721_1002502	JGI25159J45721_10025028	148
187	3300003187	JGI25151J46595_10019053	JGI25151J46595_100190532	148
188	3300003354	JGI25160J50197_1000067	JGI25160J50197_100006776	148
189	3300003374	JGI25161J50226_1000035	JGI25161J50226_100003597	148
190	3300003771	Ga0055526_1007532	Ga0055526_10075325	148
191	3300003771	Ga0055526_1007544	Ga0055526_10075445	148
192	3300003773	Ga0055537_1001739	Ga0055537_10017398	148
193	3300003773	Ga0055537_1024062	Ga0055537_10240621	148
194	3300003775	Ga0055524_1000006	Ga0055524_100000673	148
195	3300003781	Ga0055536_1000447	Ga0055536_100044729	148
196	3300003784	Ga0055534_1001178	Ga0055534_10011784	148
197	3300003784	Ga0055534_1003541	Ga0055534_10035414	148
198	3300003790	Ga0055528_1000374	Ga0055528_10003744	148
199	3300003791	Ga0055530_10000346	Ga0055530_1000034637	148
200	3300003791	Ga0055530_10018865	Ga0055530_100188652	148
201	3300003792	Ga0055540_1000005	Ga0055540_1000005241	148
202	3300003794	Ga0055531_10000604	Ga0055531_1000060427	148
203	3300003794	Ga0055531_10000607	Ga0055531_100006075	148
204	3300004625	Ga0055543_1001289	Ga0055543_10012893	148
205	3300005262	Ga0065165_1014561	Ga0065165_10145613	148
206	3300005262	Ga0065165_1018974	Ga0065165_10189743	148
207	3300005262	Ga0065165_1021684	Ga0065165_10216843	148
208	3300005295	Ga0065707_10242902	Ga0065707_102429022	148
209	3300005327	Ga0070658_10165783	Ga0070658_101657832	148
210	3300005336	Ga0070680_100573155	Ga0070680_1005731552	148
211	3300005339	Ga0070660_100019427	Ga0070660_1000194275	148
212	3300005341	Ga0070691_10049116	Ga0070691_100491162	148
213	3300005354	Ga0070675_100304386	Ga0070675_1003043862	148
214	3300005367	Ga0070667_100019707	Ga0070667_1000197073	148
215	3300005440	Ga0070705_100857867	Ga0070705_1008578671	148
216	3300005455	Ga0070663_100003243	Ga0070663_1000032432	148
217	3300005456	Ga0070678_100289859	Ga0070678_1002898592	148
218	3300005467	Ga0070706_100375056	Ga0070706_1003750562	148
219	3300005518	Ga0070699_100232285	Ga0070699_1002322852	148
220	3300005530	Ga0070679_100077785	Ga0070679_1000777852	148
221	3300005530	Ga0070679_100337587	Ga0070679_1003375872	148
222	3300005543	Ga0070672_100693904	Ga0070672_1006939042	148
223	3300005549	Ga0070704_101847512	Ga0070704_1018475121	148
224	3300005563	Ga0068855_100022408	Ga0068855_1000224083	148
225	3300005563	Ga0068855_100092900	Ga0068855_1000929005	148
226	3300005563	Ga0068855_100256710	Ga0068855_1002567102	148
227	3300005577	Ga0068857_100131701	Ga0068857_1001317012	148
228	3300005614	Ga0068856_100447216	Ga0068856_1004472162	148
229	3300005844	Ga0068862_100784788	Ga0068862_1007847881	148
230	3300006038	Ga0075365_10110299	Ga0075365_101102993	148
231	3300006042	Ga0075368_10109207	Ga0075368_101092072	148
232	3300006051	Ga0075364_10154009	Ga0075364_101540093	148
233	3300006177	Ga0075362_10030414	Ga0075362_100304144	148
234	3300006177	Ga0075362_10040413	Ga0075362_100404132	148
235	3300006177	Ga0075362_10131295	Ga0075362_101312952	148
236	3300006177	Ga0075362_10315725	Ga0075362_103157251	148
237	3300006178	Ga0075367_10113141	Ga0075367_101131412	148
238	3300006195	Ga0075366_10087477	Ga0075366_100874772	148
239	3300006195	Ga0075366_10282479	Ga0075366_102824791	148
240	3300006195	Ga0075366_10641719	Ga0075366_106417191	148
241	3300006237	Ga0097621_100800847	Ga0097621_1008008471	148
242	3300006353	Ga0075370_10136023	Ga0075370_101360231	148
243	3300006353	Ga0075370_10490564	Ga0075370_104905642	148
244	3300006946	Ga0079104_1006080	Ga0079104_10060802	148
245	3300006948	Ga0099826_10166791	Ga0099826_101667912	148
246	3300009011	Ga0105251_10098387	Ga0105251_100983872	148
247	3300009036	Ga0105244_10019485	Ga0105244_100194854	148
248	3300009036	Ga0105244_10019533	Ga0105244_100195334	148
249	3300009036	Ga0105244_10176417	Ga0105244_101764172	148
250	3300009092	Ga0105250_10010061	Ga0105250_100100611	148
251	3300009098	Ga0105245_10307238	Ga0105245_103072382	148
252	3300009098	Ga0105245_10856702	Ga0105245_108567022	148
253	3300009101	Ga0105247_10431794	Ga0105247_104317941	148
254	3300009101	Ga0105247_10977890	Ga0105247_109778902	148
255	3300009148	Ga0105243_11957074	Ga0105243_119570742	148
256	3300009174	Ga0105241_10015147	Ga0105241_100151472	148
257	3300009176	Ga0105242_10587584	Ga0105242_105875842	148
258	3300009177	Ga0105248_10245116	Ga0105248_102451162	148
259	3300009551	Ga0105238_10033490	Ga0105238_100334903	148
260	3300009551	Ga0105238_10244541	Ga0105238_102445412	148
261	3300009553	Ga0105249_10000342	Ga0105249_1000034226	148
262	3300012513	Ga0157326_1005406	Ga0157326_10054061	148
263	3300013102	Ga0157371_10005864	Ga0157371_100058645	148
264	3300013297	Ga0157378_10492593	Ga0157378_104925932	148
265	3300013297	Ga0157378_11466363	Ga0157378_114663632	148
266	3300013306	Ga0163162_10000679	Ga0163162_100006792	148
267	3300013306	Ga0163162_10053465	Ga0163162_100534654	148
268	3300013308	Ga0157375_10034066	Ga0157375_100340662	148
269	3300013308	Ga0157375_10275214	Ga0157375_102752143	148
270	3300014497	Ga0182008_10003595	Ga0182008_1000359511	148
271	3300014497	Ga0182008_10366545	Ga0182008_103665452	148
272	3300014969	Ga0157376_10016007	Ga0157376_100160072	148
273	3300015262	Ga0182007_10035004	Ga0182007_100350042	148
274	3300015265	Ga0182005_1095988	Ga0182005_10959882	148
275	3300017792	Ga0163161_10073964	Ga0163161_100739642	148
276	3300021361	Ga0213872_10004955	Ga0213872_100049556	148
277	3300021388	Ga0213875_10000114	Ga0213875_1000011455	148
278	3300021388	Ga0213875_10008122	Ga0213875_100081222	148
279	3300021388	Ga0213875_10255900	Ga0213875_102559002	148
280	3300025206	Ga0209435_100001	Ga0209435_10000117	148
281	3300025208	Ga0209436_113645	Ga0209436_1136451	148
282	3300025245	Ga0207425_1008135	Ga0207425_10081354	148
283	3300025245	Ga0207425_1008784	Ga0207425_10087843	148
284	3300025246	Ga0209646_1000001	Ga0209646_1000001386	148
285	3300025250	Ga0209026_1000003	Ga0209026_100000317	148
286	3300025256	Ga0209759_1000001	Ga0209759_100000117	148
287	3300025258	Ga0209129_1003651	Ga0209129_10036517	148
288	3300025258	Ga0209129_1018536	Ga0209129_10185363	148
289	3300025263	Ga0209565_1000124	Ga0209565_10001244	148
290	3300025263	Ga0209565_1000498	Ga0209565_100049824	148
291	3300025263	Ga0209565_1024593	Ga0209565_10245931	148
292	3300025273	Ga0209673_1000043	Ga0209673_1000043163	148
293	3300025273	Ga0209673_1044280	Ga0209673_10442801	148
294	3300025284	Ga0209130_1000442	Ga0209130_100044235	148
295	3300025284	Ga0209130_1000620	Ga0209130_100062027	148
296	3300025284	Ga0209130_1001702	Ga0209130_10017027	148
297	3300025284	Ga0209130_1055162	Ga0209130_10551621	148
298	3300025291	Ga0209675_1000309	Ga0209675_100030916	148
299	3300025291	Ga0209675_1008560	Ga0209675_10085603	148
300	3300025291	Ga0209675_1031186	Ga0209675_10311863	148
301	3300025291	Ga0209675_1064089	Ga0209675_10640892	148
302	3300025292	Ga0209676_1000007	Ga0209676_1000007458	148
303	3300025292	Ga0209676_1005708	Ga0209676_10057084	148
304	3300025294	Ga0209025_1002427	Ga0209025_100242719	148
305	3300025294	Ga0209025_1004916	Ga0209025_100491613	148
306	3300025294	Ga0209025_1024249	Ga0209025_10242493	148
307	3300025294	Ga0209025_1025283	Ga0209025_10252834	148
308	3300025294	Ga0209025_1095108	Ga0209025_10951081	148
309	3300025295	Ga0209564_1000268	Ga0209564_10002684	148
310	3300025295	Ga0209564_1000476	Ga0209564_10004763	148
311	3300025295	Ga0209564_1003314	Ga0209564_10033143	148
312	3300025297	Ga0209758_1043883	Ga0209758_10438832	148
313	3300025297	Ga0209758_1045258	Ga0209758_10452582	148
314	3300025297	Ga0209758_1061488	Ga0209758_10614882	148
315	3300025298	Ga0209050_1000003	Ga0209050_10000031050	148
316	3300025298	Ga0209050_1004391	Ga0209050_10043913	148
317	3300025298	Ga0209050_1016100	Ga0209050_10161004	148
318	3300025298	Ga0209050_1021541	Ga0209050_10215413	148
319	3300025298	Ga0209050_1096249	Ga0209050_10962491	148
320	3300025299	Ga0209256_1000001	Ga0209256_10000011056	148
321	3300025299	Ga0209256_1017854	Ga0209256_10178543	148
322	3300025299	Ga0209256_1021626	Ga0209256_10216263	148
323	3300025302	Ga0207426_1000247	Ga0207426_100024742	148
324	3300025302	Ga0207426_1009688	Ga0207426_10096884	148
325	3300025302	Ga0207426_1046867	Ga0207426_10468672	148
326	3300025302	Ga0207426_1067929	Ga0207426_10679292	148
327	3300025303	Ga0209051_1000003	Ga0209051_10000031050	148
328	3300025303	Ga0209051_1000320	Ga0209051_100032047	148
329	3300025303	Ga0209051_1012479	Ga0209051_10124791	148
330	3300025304	Ga0209257_1000020	Ga0209257_1000020458	148
331	3300025304	Ga0209257_1000161	Ga0209257_100016188	148
332	3300025304	Ga0209257_1005554	Ga0209257_10055544	148
333	3300025728	Ga0207655_1005008	Ga0207655_10050082	148
334	3300025728	Ga0207655_1005064	Ga0207655_10050642	148
335	3300025728	Ga0207655_1107523	Ga0207655_11075231	148
336	3300025735	Ga0207713_1069190	Ga0207713_10691902	148
337	3300025899	Ga0207642_10115095	Ga0207642_101150952	148
338	3300025908	Ga0207643_10303128	Ga0207643_103031282	148
339	3300025909	Ga0207705_10339781	Ga0207705_103397812	148
340	3300025909	Ga0207705_10551886	Ga0207705_105518861	148
341	3300025911	Ga0207654_10044947	Ga0207654_100449474	148
342	3300025913	Ga0207695_10354968	Ga0207695_103549682	148
343	3300025917	Ga0207660_10331851	Ga0207660_103318512	148
344	3300025919	Ga0207657_10034309	Ga0207657_100343095	148
345	3300025919	Ga0207657_10358752	Ga0207657_103587521	148
346	3300025921	Ga0207652_10334427	Ga0207652_103344272	148
347	3300025922	Ga0207646_10731365	Ga0207646_107313651	148
348	3300025925	Ga0207650_10005261	Ga0207650_1000526110	148
349	3300025927	Ga0207687_10111231	Ga0207687_101112312	148
350	3300025929	Ga0207664_10489841	Ga0207664_104898411	148
351	3300025934	Ga0207686_10302986	Ga0207686_103029862	148
352	3300025935	Ga0207709_10874614	Ga0207709_108746142	148
353	3300025949	Ga0207667_11647900	Ga0207667_116479001	148
354	3300025961	Ga0207712_10142390	Ga0207712_101423902	148
355	3300025981	Ga0207640_11196877	Ga0207640_111968771	148
356	3300025981	Ga0207640_11383352	Ga0207640_113833521	148
357	3300025986	Ga0207658_10051764	Ga0207658_100517642	148
358	3300025986	Ga0207658_10670323	Ga0207658_106703232	148
359	3300026067	Ga0207678_10007848	Ga0207678_100078482	148
360	3300026089	Ga0207648_10857208	Ga0207648_108572081	148
361	3300026116	Ga0207674_10117981	Ga0207674_101179812	148
362	3300026116	Ga0207674_10411923	Ga0207674_104119232	148
363	3300026121	Ga0207683_10328446	Ga0207683_103284462	148
364	3300027111	Ga0209281_1026166	Ga0209281_10261661	148
365	3300027876	Ga0209974_10082990	Ga0209974_100829902	148
366	3300027876	Ga0209974_10129742	Ga0209974_101297422	148
367	3300027907	Ga0207428_10112389	Ga0207428_101123893	148
368	3300028379	Ga0268266_10319051	Ga0268266_103190511	148
369	3300028380	Ga0268265_10970838	Ga0268265_109708382	148
370	3300028794	Ga0307515_10001283	Ga0307515_1000128328	148
371	3300031238	Ga0265332_10032003	Ga0265332_100320032	148
372	3300031242	Ga0265329_10009738	Ga0265329_100097384	148
373	3300031456	Ga0307513_10000054	Ga0307513_10000054104	148
374	3300031456	Ga0307513_10018646	Ga0307513_100186469	148
375	3300031548	Ga0307408_100022993	Ga0307408_1000229935	148
376	3300031548	Ga0307408_100187706	Ga0307408_1001877062	148
377	3300031649	Ga0307514_10000795	Ga0307514_100007953	148
378	3300031711	Ga0265314_10002818	Ga0265314_1000281810	148
379	3300031712	Ga0265342_10161854	Ga0265342_101618541	148
380	3300031712	Ga0265342_10179830	Ga0265342_101798302	148
381	3300031901	Ga0307406_10244742	Ga0307406_102447422	148
382	3300031911	Ga0307412_10113378	Ga0307412_101133781	148
383	3300035116	Ga0373945_0451096	Ga0373945_0451096_26_472	148
384	3300035398	Ga0316574_0280514	Ga0316574_0280514_276_731	148
385	3300035398	Ga0316574_0783821	Ga0316574_0783821_15_461	148
386	3300037312	Ga0395899_0018492	Ga0395899_0018492_2656_3102	148
387	3300037312	Ga0395899_0235742	Ga0395899_0235742_216_662	148
388	3300037418	Ga0395900_0008244	Ga0395900_0008244_2715_3161	148
389	3300037418	Ga0395900_0010948	Ga0395900_0010948_3493_3939	148
390	3300037418	Ga0395900_0105001	Ga0395900_0105001_627_1073	148
391	3300037418	Ga0395900_0128127	Ga0395900_0128127_737_1183	148
392	3300037418	Ga0395900_0139094	Ga0395900_0139094_409_855	148
393	3300037418	Ga0395900_0181050	Ga0395900_0181050_1018_1464	148
394	3300037418	Ga0395900_0229277	Ga0395900_0229277_1015_1506	148
395	3300037418	Ga0395900_0404011	Ga0395900_0404011_395_841	148
396	3300037418	Ga0395900_1492503	Ga0395900_1492503_115_561	148
397	3300037466	Ga0395898_0013534	Ga0395898_0013534_376_822	148
398	3300037466	Ga0395898_0018082	Ga0395898_0018082_5495_5941	148
399	3300037466	Ga0395898_0109116	Ga0395898_0109116_915_1361	148
400	3300037466	Ga0395898_0418814	Ga0395898_0418814_741_1187	148
401	3300037471	Ga0395905_0000653	Ga0395905_0000653_45_491	148
402	3300037471	Ga0395905_0000895	Ga0395905_0000895_37002_37448	148
403	3300037471	Ga0395905_0018268	Ga0395905_0018268_2489_2935	148
404	3300037471	Ga0395905_0102588	Ga0395905_0102588_1620_2066	148
405	3300037471	Ga0395905_0123164	Ga0395905_0123164_86_544	148
406	3300037471	Ga0395905_0203231	Ga0395905_0203231_470_916	148
407	3300037471	Ga0395905_0303223	Ga0395905_0303223_22_468	148
408	3300037471	Ga0395905_0355915	Ga0395905_0355915_784_1230	148
409	3300037853	Ga0436364_0667041	Ga0436364_0667041_1082_1591	148
410	3300037853	Ga0436364_1043221	Ga0436364_1043221_5541_6056	148
411	3300038443	Ga0395901_0051281	Ga0395901_0051281_601_1047	148
412	3300038443	Ga0395901_0052453	Ga0395901_0052453_2380_2826	148
413	3300038443	Ga0395901_0065113	Ga0395901_0065113_2007_2453	148
414	3300038443	Ga0395901_0081508	Ga0395901_0081508_2264_2710	148
415	3300038443	Ga0395901_0136710	Ga0395901_0136710_1533_1979	148
416	3300038443	Ga0395901_0175988	Ga0395901_0175988_1656_2102	148
417	3300038443	Ga0395901_0277755	Ga0395901_0277755_256_702	148
418	3300038443	Ga0395901_0529523	Ga0395901_0529523_290_736	148
419	3300039437	Ga0436365_0960828	Ga0436365_0960828_20_535	148
420	3300039447	Ga0436361_0932343	Ga0436361_0932343_4061_4507	148
421	3300041452	Ga0451793_0259988	Ga0451793_0259988_153_599	148
422	3300041459	Ga0451800_0531416	Ga0451800_0531416_109_558	148
423	3300041459	Ga0451800_1336356	Ga0451800_1336356_174_620	148
424	3300041459	Ga0451800_1453629	Ga0451800_1453629_13_459	148
425	3300041498	Ga0451841_0659571	Ga0451841_0659571_10_456	148
426	3300041512	Ga0451853_1190134	Ga0451853_1190134_1739_2185	148
427	3300042115	Ga0450911_020803	Ga0450911_020803_109_555	148
428	3300042139	Ga0450904_014358	Ga0450904_014358_207_653	148
429	3300042876	Ga0451577_0003789	Ga0451577_0003789_2148_2594	148
430	3300042876	Ga0451577_0005413	Ga0451577_0005413_10153_10602	148
431	3300042876	Ga0451577_0036543	Ga0451577_0036543_1481_1927	148
432	3300042876	Ga0451577_0143508	Ga0451577_0143508_864_1310	148
433	3300042876	Ga0451577_1964921	Ga0451577_1964921_47_493	148
434	3300044656	Ga0466969_0006230	Ga0466969_0006230_1650_2096	148
435	3300044656	Ga0466969_0025156	Ga0466969_0025156_587_1033	148
436	3300044656	Ga0466969_0039565	Ga0466969_0039565_473_919	148
437	3300044673	Ga0453683_0004047	Ga0453683_0004047_7275_7724	148
438	3300044683	Ga0466965_0195039	Ga0466965_0195039_151_597	148
439	3300044684	Ga0466966_0026011	Ga0466966_0026011_668_1114	148
440	3300044693	Ga0466961_0027523	Ga0466961_0027523_753_1199	148
441	3300044693	Ga0466961_0231567	Ga0466961_0231567_541_987	148
442	3300044694	Ga0466963_1240527	Ga0466963_1240527_25_471	148
443	3300044712	Ga0453684_0070718	Ga0453684_0070718_732_1178	148
444	3300044712	Ga0453684_1221549	Ga0453684_1221549_327_773	148
445	3300044712	Ga0453684_1703371	Ga0453684_1703371_175_624	148
446	3300044765	Ga0466970_0023540	Ga0466970_0023540_1368_1814	148
447	3300044842	Ga0466957_0238191	Ga0466957_0238191_149_595	148
448	3300045049	Ga0466959_0038662	Ga0466959_0038662_1164_1610	148
449	3300045049	Ga0466959_0306609	Ga0466959_0306609_98_544	148
450	3300045051	Ga0451576_0006036	Ga0451576_0006036_2301_2750	148
451	3300045051	Ga0451576_0147519	Ga0451576_0147519_1495_1941	148
452	3300045051	Ga0451576_0625897	Ga0451576_0625897_249_698	148
453	3300045051	Ga0451576_1689404	Ga0451576_1689404_15_464	148
454	3300046454	Ga0495592_0059971	Ga0495592_0059971_466_912	148
455	3300046460	Ga0495638_0088234	Ga0495638_0088234_292_738	148
456	3300046471	Ga0495650_0059084	Ga0495650_0059084_896_1342	148
457	3300046477	Ga0495664_0023776	Ga0495664_0023776_233_679	148
458	3300046501	Ga0495607_0187075	Ga0495607_0187075_110_556	148
459	3300046507	Ga0495606_0086766	Ga0495606_0086766_1326_1772	148
460	3300046512	Ga0495610_0112226	Ga0495610_0112226_133_579	148
461	3300046514	Ga0495618_0690362	Ga0495618_0690362_86_532	148
462	3300046516	Ga0495628_0245793	Ga0495628_0245793_29_475	148
463	3300046523	Ga0495644_0040888	Ga0495644_0040888_595_1041	148
464	3300046528	Ga0495642_0010968	Ga0495642_0010968_1139_1585	148
465	3300046530	Ga0495654_0091204	Ga0495654_0091204_599_1045	148
466	3300046542	Ga0495597_0092634	Ga0495597_0092634_524_970	148
467	3300046543	Ga0495645_0245104	Ga0495645_0245104_347_793	148
468	3300046616	Ga0495668_0273037	Ga0495668_0273037_375_821	148
469	3300046648	Ga0495611_0088526	Ga0495611_0088526_743_1189	148
470	3300046660	Ga0495625_0180493	Ga0495625_0180493_148_600	148
471	3300046665	Ga0495661_0226445	Ga0495661_0226445_48_494	148
472	3300046678	Ga0495599_0161085	Ga0495599_0161085_418_864	148
473	3300046680	Ga0495646_0073389	Ga0495646_0073389_785_1231	148
474	3300046684	Ga0495669_0015535	Ga0495669_0015535_708_1154	148
475	3300046691	Ga0495670_0007900	Ga0495670_0007900_837_1283	148
476	3300046692	Ga0495671_0397257	Ga0495671_0397257_155_601	148
477	3300046694	Ga0495649_0222559	Ga0495649_0222559_503_949	148
478	3300046794	Ga0495589_0017714	Ga0495589_0017714_3026_3472	148
479	3300046809	Ga0495600_0286469	Ga0495600_0286469_295_741	148
480	3300047446	Ga0495679_066707	Ga0495679_066707_428_874	148
481	3300048091	Ga0495626_0124367	Ga0495626_0124367_578_1024	148
482	3300048904	Ga0496101_0024961	Ga0496101_0024961_3672_4118	148
483	3300048905	Ga0496102_0021149	Ga0496102_0021149_5149_5595	148
484	3300048909	Ga0496106_0057379	Ga0496106_0057379_1896_2342	148
485	3300048910	Ga0496107_0088189	Ga0496107_0088189_1066_1512	148
486	3300048911	Ga0496108_1737401	Ga0496108_1737401_37_483	148
487	3300048913	Ga0496110_0069135	Ga0496110_0069135_1613_2059	148
488	3300048917	Ga0496114_0352539	Ga0496114_0352539_592_1038	148
489	3300048925	Ga0496122_0000592	Ga0496122_0000592_71834_72280	148
490	3300048926	Ga0496123_0000656	Ga0496123_0000656_37225_37671	148
491	3300048927	Ga0496124_0078596	Ga0496124_0078596_345_791	148
492	3300048927	Ga0496124_0437474	Ga0496124_0437474_190_636	148
493	3300048929	Ga0496126_0293202	Ga0496126_0293202_350_802	148
494	3300049569	Ga0501032_0142264	Ga0501032_0142264_522_968	148
495	3300049570	Ga0501033_0082237	Ga0501033_0082237_1248_1694	148
496	3300049571	Ga0501034_0172250	Ga0501034_0172250_1603_2049	148
497	3300049572	Ga0501036_0245252	Ga0501036_0245252_674_1120	148
498	3300049574	Ga0501038_0348001	Ga0501038_0348001_119_565	148
499	3300049574	Ga0501038_0891020	Ga0501038_0891020_151_597	148
500	3300049575	Ga0501039_0032761	Ga0501039_0032761_3005_3451	148
501	3300049575	Ga0501039_0188149	Ga0501039_0188149_47_493	148
502	3300049576	Ga0501040_0675638	Ga0501040_0675638_204_650	148
503	3300049576	Ga0501040_0735400	Ga0501040_0735400_176_622	148
504	3300049579	Ga0501043_0088959	Ga0501043_0088959_1330_1776	148
505	3300049580	Ga0501046_0218551	Ga0501046_0218551_75_521	148
506	3300049581	Ga0501047_0122948	Ga0501047_0122948_820_1266	148
507	3300049581	Ga0501047_0335198	Ga0501047_0335198_159_605	148
508	3300049582	Ga0501048_0010438	Ga0501048_0010438_5650_6099	148
509	3300049584	Ga0501068_0275027	Ga0501068_0275027_573_1019	148
510	3300049587	Ga0501071_0410886	Ga0501071_0410886_269_715	148
511	3300049592	Ga0501076_0373427	Ga0501076_0373427_28_474	148
512	3300049652	Ga0501202_013977	Ga0501202_013977_89_535	148
513	3300049679	Ga0501249_087284	Ga0501249_087284_57_503	148
514	3300049742	Ga0501080_0047008	Ga0501080_0047008_2593_3039	148
515	3300049742	Ga0501080_0527557	Ga0501080_0527557_396_842	148
516	3300049743	Ga0501081_0217634	Ga0501081_0217634_914_1360	148
517	3300049763	Ga0501266_008842	Ga0501266_008842_411_857	148
518	3300049775	Ga0501279_003394	Ga0501279_003394_602_1048	148
519	3300049822	Ga0501035_0068118	Ga0501035_0068118_201_647	148
520	3300049822	Ga0501035_0103549	Ga0501035_0103549_635_1183	148
521	3300049823	Ga0501044_0064676	Ga0501044_0064676_2540_2986	148
522	3300049823	Ga0501044_0191635	Ga0501044_0191635_1427_1873	148
523	3300049823	Ga0501044_0247169	Ga0501044_0247169_969_1415	148
524	3300049853	Ga0501226_004955	Ga0501226_004955_304_750	148
525	3300050489	nmdc:mga03683_313614_c1	nmdc:mga03683_313614_c1_24_470	148
526	3300050489	nmdc:mga03683_54553_c1	nmdc:mga03683_54553_c1_633_1079	148
527	3300050491	nmdc:mga00v17_186953_c1	nmdc:mga00v17_186953_c1_792_1238	148
528	3300050492	nmdc:mga0yw44_459892_c1	nmdc:mga0yw44_459892_c1_91_537	148
529	3300050493	nmdc:mga0k408_60046_c1	nmdc:mga0k408_60046_c1_1609_2055	148
530	3300050493	nmdc:mga0k408_96201_c1	nmdc:mga0k408_96201_c1_1174_1623	148
531	3300050494	nmdc:mga06z11_65667_c1	nmdc:mga06z11_65667_c1_782_1228	148
532	3300050496	nmdc:mga07m45_215893_c1	nmdc:mga07m45_215893_c1_647_1093	148
533	3300050509	nmdc:mga0qj67_453007_c1	nmdc:mga0qj67_453007_c1_291_737	148
534	3300053103	Ga0500555_089260	Ga0500555_089260_131_577	148
535	3300053108	Ga0500562_007913	Ga0500562_007913_1741_2187	148
536	3300053117	Ga0500593_000729	Ga0500593_000729_10910_11356	148
537	3300053730	Ga0500645_000413	Ga0500645_000413_18696_19142	148
538	3300053730	Ga0500645_014269	Ga0500645_014269_696_1142	148
539	3300053734	Ga0500565_014417	Ga0500565_014417_188_634	148
540	3300060353	Ga0501082_0821023	Ga0501082_0821023_93_539	148
541	iso_pu_bacteria	2952252522	2952254092	148
542	3300003215	JGI25153J46596_10002603	JGI25153J46596_100026035	149
543	3300003215	JGI25153J46596_10002737	JGI25153J46596_100027375	149
544	3300003322	rootL2_10048698	rootL2_100486985	149
545	3300003323	rootH1_10008298	rootH1_1000829812	149
546	3300003323	rootH1_10032418	rootH1_100324184	149
547	3300003323	rootH1_10219628	rootH1_102196282	149
548	3300003323	rootH1_10235640	rootH1_102356402	149
549	3300003771	Ga0055526_1000542	Ga0055526_10005422	149
550	3300003775	Ga0055524_1000079	Ga0055524_10000796	149
551	3300003775	Ga0055524_1001129	Ga0055524_10011293	149
552	3300003791	Ga0055530_10002750	Ga0055530_1000275013	149
553	3300003791	Ga0055530_10013673	Ga0055530_100136733	149
554	3300003792	Ga0055540_1000086	Ga0055540_100008636	149
555	3300003792	Ga0055540_1056259	Ga0055540_10562592	149
556	3300003794	Ga0055531_10002992	Ga0055531_1000299210	149
557	3300003794	Ga0055531_10003346	Ga0055531_100033466	149
558	3300003794	Ga0055531_10005016	Ga0055531_100050163	149
559	3300003794	Ga0055531_10009416	Ga0055531_100094162	149
560	3300005262	Ga0065165_1010114	Ga0065165_10101143	149
561	3300005327	Ga0070658_10178500	Ga0070658_101785002	149
562	3300005327	Ga0070658_10376755	Ga0070658_103767552	149
563	3300005328	Ga0070676_10025454	Ga0070676_100254541	149
564	3300005328	Ga0070676_10075715	Ga0070676_100757151	149
565	3300005329	Ga0070683_100037706	Ga0070683_1000377066	149
566	3300005329	Ga0070683_100121661	Ga0070683_1001216612	149
567	3300005330	Ga0070690_100010662	Ga0070690_1000106622	149
568	3300005331	Ga0070670_101241508	Ga0070670_1012415082	149
569	3300005331	Ga0070670_101617950	Ga0070670_1016179501	149
570	3300005335	Ga0070666_10000910	Ga0070666_1000091011	149
571	3300005335	Ga0070666_10429708	Ga0070666_104297082	149
572	3300005335	Ga0070666_10457645	Ga0070666_104576451	149
573	3300005336	Ga0070680_100056960	Ga0070680_1000569602	149
574	3300005338	Ga0068868_100004895	Ga0068868_1000048954	149
575	3300005338	Ga0068868_100615315	Ga0068868_1006153152	149
576	3300005340	Ga0070689_100103553	Ga0070689_1001035532	149
577	3300005344	Ga0070661_100000925	Ga0070661_10000092521	149
578	3300005347	Ga0070668_100253166	Ga0070668_1002531662	149
579	3300005353	Ga0070669_100197215	Ga0070669_1001972152	149
580	3300005353	Ga0070669_100442007	Ga0070669_1004420072	149
581	3300005354	Ga0070675_100000199	Ga0070675_10000019921	149
582	3300005354	Ga0070675_100063020	Ga0070675_1000630202	149
583	3300005354	Ga0070675_100175593	Ga0070675_1001755932	149
584	3300005354	Ga0070675_100261486	Ga0070675_1002614861	149
585	3300005355	Ga0070671_100068600	Ga0070671_1000686002	149
586	3300005355	Ga0070671_100282123	Ga0070671_1002821232	149
587	3300005355	Ga0070671_100558339	Ga0070671_1005583392	149
588	3300005355	Ga0070671_100577438	Ga0070671_1005774382	149
589	3300005356	Ga0070674_100171882	Ga0070674_1001718822	149
590	3300005356	Ga0070674_100191479	Ga0070674_1001914792	149
591	3300005356	Ga0070674_100224656	Ga0070674_1002246562	149
592	3300005356	Ga0070674_101195863	Ga0070674_1011958632	149
593	3300005364	Ga0070673_100001468	Ga0070673_1000014683	149
594	3300005364	Ga0070673_100070117	Ga0070673_1000701172	149
595	3300005364	Ga0070673_100147698	Ga0070673_1001476982	149
596	3300005364	Ga0070673_100150088	Ga0070673_1001500882	149
597	3300005364	Ga0070673_100177443	Ga0070673_1001774433	149
598	3300005366	Ga0070659_100001694	Ga0070659_10000169411	149
599	3300005366	Ga0070659_100788685	Ga0070659_1007886852	149
600	3300005367	Ga0070667_100044588	Ga0070667_1000445882	149
601	3300005367	Ga0070667_100162405	Ga0070667_1001624052	149
602	3300005367	Ga0070667_100274337	Ga0070667_1002743372	149
603	3300005436	Ga0070713_100473741	Ga0070713_1004737412	149
604	3300005438	Ga0070701_10346409	Ga0070701_103464092	149
605	3300005445	Ga0070708_100104465	Ga0070708_1001044652	149
606	3300005445	Ga0070708_100595274	Ga0070708_1005952742	149
607	3300005455	Ga0070663_100850583	Ga0070663_1008505832	149
608	3300005456	Ga0070678_100025816	Ga0070678_1000258162	149
609	3300005456	Ga0070678_100028458	Ga0070678_1000284582	149
610	3300005456	Ga0070678_101232293	Ga0070678_1012322931	149
611	3300005457	Ga0070662_100034028	Ga0070662_1000340282	149
612	3300005457	Ga0070662_100093049	Ga0070662_1000930492	149
613	3300005457	Ga0070662_100183998	Ga0070662_1001839982	149
614	3300005457	Ga0070662_100509332	Ga0070662_1005093321	149
615	3300005458	Ga0070681_10005119	Ga0070681_1000511915	149
616	3300005458	Ga0070681_10188912	Ga0070681_101889122	149
617	3300005459	Ga0068867_100000077	Ga0068867_10000007712	149
618	3300005459	Ga0068867_100012398	Ga0068867_1000123985	149
619	3300005459	Ga0068867_100054825	Ga0068867_1000548252	149
620	3300005459	Ga0068867_100136111	Ga0068867_1001361112	149
621	3300005459	Ga0068867_100411850	Ga0068867_1004118501	149
622	3300005459	Ga0068867_100569602	Ga0068867_1005696022	149
623	3300005467	Ga0070706_100001777	Ga0070706_10000177722	149
624	3300005467	Ga0070706_100855603	Ga0070706_1008556031	149
625	3300005468	Ga0070707_100036485	Ga0070707_1000364853	149
626	3300005468	Ga0070707_100417757	Ga0070707_1004177572	149
627	3300005530	Ga0070679_100120419	Ga0070679_1001204193	149
628	3300005530	Ga0070679_100128179	Ga0070679_1001281793	149
629	3300005535	Ga0070684_100039305	Ga0070684_1000393053	149
630	3300005539	Ga0068853_100071781	Ga0068853_1000717812	149
631	3300005539	Ga0068853_100078556	Ga0068853_1000785563	149
632	3300005543	Ga0070672_100001496	Ga0070672_10000149610	149
633	3300005543	Ga0070672_100027912	Ga0070672_1000279123	149
634	3300005543	Ga0070672_100112138	Ga0070672_1001121383	149
635	3300005543	Ga0070672_100130914	Ga0070672_1001309142	149
636	3300005543	Ga0070672_100689912	Ga0070672_1006899122	149
637	3300005543	Ga0070672_101302960	Ga0070672_1013029602	149
638	3300005546	Ga0070696_100166665	Ga0070696_1001666653	149
639	3300005548	Ga0070665_101304575	Ga0070665_1013045752	149
640	3300005564	Ga0070664_100000939	Ga0070664_1000009397	149
641	3300005564	Ga0070664_100025855	Ga0070664_1000258552	149
642	3300005564	Ga0070664_100091218	Ga0070664_1000912183	149
643	3300005564	Ga0070664_100532892	Ga0070664_1005328921	149
644	3300005577	Ga0068857_100117060	Ga0068857_1001170604	149
645	3300005577	Ga0068857_101040811	Ga0068857_1010408112	149
646	3300005578	Ga0068854_100069996	Ga0068854_1000699962	149
647	3300005615	Ga0070702_100474759	Ga0070702_1004747592	149
648	3300005616	Ga0068852_100014816	Ga0068852_1000148163	149
649	3300005616	Ga0068852_100046620	Ga0068852_1000466202	149
650	3300005616	Ga0068852_100252895	Ga0068852_1002528952	149
651	3300005616	Ga0068852_100466299	Ga0068852_1004662992	149
652	3300005616	Ga0068852_100526853	Ga0068852_1005268532	149
653	3300005617	Ga0068859_100183101	Ga0068859_1001831013	149
654	3300005617	Ga0068859_100468786	Ga0068859_1004687862	149
655	3300005618	Ga0068864_100000354	Ga0068864_1000003548	149
656	3300005618	Ga0068864_100002399	Ga0068864_10000239914	149
657	3300005618	Ga0068864_102265800	Ga0068864_1022658001	149
658	3300005718	Ga0068866_10456408	Ga0068866_104564082	149
659	3300005834	Ga0068851_10004231	Ga0068851_100042314	149
660	3300005834	Ga0068851_10351275	Ga0068851_103512751	149
661	3300005840	Ga0068870_10029084	Ga0068870_100290842	149
662	3300005841	Ga0068863_100034898	Ga0068863_1000348985	149
663	3300005841	Ga0068863_100037190	Ga0068863_1000371903	149
664	3300005841	Ga0068863_100178913	Ga0068863_1001789132	149
665	3300005842	Ga0068858_100000262	Ga0068858_10000026234	149
666	3300005842	Ga0068858_100044019	Ga0068858_1000440191	149
667	3300005843	Ga0068860_100089805	Ga0068860_1000898054	149
668	3300005844	Ga0068862_100058582	Ga0068862_1000585822	149
669	3300005844	Ga0068862_100094485	Ga0068862_1000944853	149
670	3300005844	Ga0068862_100126510	Ga0068862_1001265103	149
671	3300005937	Ga0081455_10488458	Ga0081455_104884581	149
672	3300006038	Ga0075365_10070149	Ga0075365_100701492	149
673	3300006042	Ga0075368_10029146	Ga0075368_100291462	149
674	3300006042	Ga0075368_10192943	Ga0075368_101929431	149
675	3300006048	Ga0075363_100537181	Ga0075363_1005371812	149
676	3300006051	Ga0075364_10129145	Ga0075364_101291452	149
677	3300006051	Ga0075364_10139836	Ga0075364_101398362	149
678	3300006058	Ga0075432_10154894	Ga0075432_101548942	149
679	3300006058	Ga0075432_10596429	Ga0075432_105964291	149
680	3300006177	Ga0075362_10005748	Ga0075362_100057483	149
681	3300006177	Ga0075362_10015938	Ga0075362_100159382	149
682	3300006177	Ga0075362_10165182	Ga0075362_101651822	149
683	3300006177	Ga0075362_10294084	Ga0075362_102940842	149
684	3300006178	Ga0075367_10008021	Ga0075367_100080215	149
685	3300006178	Ga0075367_10038031	Ga0075367_100380312	149
686	3300006178	Ga0075367_10052397	Ga0075367_100523972	149
687	3300006178	Ga0075367_10309550	Ga0075367_103095502	149
688	3300006186	Ga0075369_10025461	Ga0075369_100254613	149
689	3300006186	Ga0075369_10089557	Ga0075369_100895571	149
690	3300006195	Ga0075366_10001921	Ga0075366_100019217	149
691	3300006195	Ga0075366_10002417	Ga0075366_100024179	149
692	3300006195	Ga0075366_10009102	Ga0075366_100091024	149
693	3300006195	Ga0075366_10022250	Ga0075366_100222504	149
694	3300006195	Ga0075366_10023025	Ga0075366_100230254	149
695	3300006195	Ga0075366_10043968	Ga0075366_100439682	149
696	3300006195	Ga0075366_10099101	Ga0075366_100991012	149
697	3300006195	Ga0075366_10106906	Ga0075366_101069062	149
698	3300006195	Ga0075366_10190494	Ga0075366_101904942	149
699	3300006195	Ga0075366_10194245	Ga0075366_101942452	149
700	3300006195	Ga0075366_10320595	Ga0075366_103205952	149
701	3300006237	Ga0097621_100222507	Ga0097621_1002225072	149
702	3300006353	Ga0075370_10005490	Ga0075370_100054903	149
703	3300006353	Ga0075370_10005571	Ga0075370_100055714	149
704	3300006353	Ga0075370_10008637	Ga0075370_100086375	149
705	3300006353	Ga0075370_10015091	Ga0075370_100150912	149
706	3300006353	Ga0075370_10059640	Ga0075370_100596402	149
707	3300006358	Ga0068871_100065266	Ga0068871_1000652662	149
708	3300006358	Ga0068871_100075803	Ga0068871_1000758032	149
709	3300006358	Ga0068871_100703754	Ga0068871_1007037542	149
710	3300006844	Ga0075428_100036897	Ga0075428_1000368972	149
711	3300006931	Ga0097620_100183102	Ga0097620_1001831023	149
712	3300006931	Ga0097620_100468776	Ga0097620_1004687762	149
713	3300006944	Ga0099823_1002035	Ga0099823_100203515	149
714	3300006946	Ga0079104_1000100	Ga0079104_100010065	149
715	3300009011	Ga0105251_10000309	Ga0105251_1000030946	149
716	3300009011	Ga0105251_10043577	Ga0105251_100435772	149
717	3300009011	Ga0105251_10123778	Ga0105251_101237782	149
718	3300009036	Ga0105244_10121111	Ga0105244_101211112	149
719	3300009036	Ga0105244_10165564	Ga0105244_101655642	149
720	3300009092	Ga0105250_10159959	Ga0105250_101599592	149
721	3300009093	Ga0105240_10007299	Ga0105240_1000729916	149
722	3300009093	Ga0105240_10377581	Ga0105240_103775812	149
723	3300009093	Ga0105240_10432590	Ga0105240_104325902	149
724	3300009098	Ga0105245_11120787	Ga0105245_111207871	149
725	3300009148	Ga0105243_10002591	Ga0105243_100025913	149
726	3300009148	Ga0105243_10075438	Ga0105243_100754382	149
727	3300009148	Ga0105243_10386578	Ga0105243_103865782	149
728	3300009177	Ga0105248_10007009	Ga0105248_100070097	149
729	3300009177	Ga0105248_10088653	Ga0105248_100886533	149
730	3300009177	Ga0105248_10191639	Ga0105248_101916392	149
731	3300009177	Ga0105248_10454797	Ga0105248_104547972	149
732	3300009545	Ga0105237_10000998	Ga0105237_1000099817	149
733	3300009545	Ga0105237_10179800	Ga0105237_101798002	149
734	3300009551	Ga0105238_10012661	Ga0105238_100126612	149
735	3300009551	Ga0105238_10019715	Ga0105238_1001971510	149
736	3300009551	Ga0105238_10046675	Ga0105238_100466752	149
737	3300009551	Ga0105238_10638696	Ga0105238_106386961	149
738	3300009553	Ga0105249_10151394	Ga0105249_101513943	149
739	3300010375	Ga0105239_10000318	Ga0105239_1000031823	149
740	3300010375	Ga0105239_10509498	Ga0105239_105094982	149
741	3300012475	Ga0157317_1000493	Ga0157317_10004932	149
742	3300012497	Ga0157319_1000035	Ga0157319_100003529	149
743	3300012500	Ga0157314_1005544	Ga0157314_10055442	149
744	3300013104	Ga0157370_10815178	Ga0157370_108151782	149
745	3300013105	Ga0157369_10031818	Ga0157369_100318187	149
746	3300013296	Ga0157374_10221280	Ga0157374_102212802	149
747	3300013296	Ga0157374_10646021	Ga0157374_106460212	149
748	3300013297	Ga0157378_10180665	Ga0157378_101806652	149
749	3300013297	Ga0157378_10445647	Ga0157378_104456472	149
750	3300013306	Ga0163162_10012705	Ga0163162_100127059	149
751	3300013306	Ga0163162_10048557	Ga0163162_100485572	149
752	3300013307	Ga0157372_10000718	Ga0157372_1000071835	149
753	3300013307	Ga0157372_10035925	Ga0157372_100359257	149
754	3300013307	Ga0157372_10102543	Ga0157372_101025432	149
755	3300013308	Ga0157375_10056743	Ga0157375_100567432	149
756	3300013308	Ga0157375_10207553	Ga0157375_102075531	149
757	3300013308	Ga0157375_10592298	Ga0157375_105922982	149
758	3300013308	Ga0157375_10746747	Ga0157375_107467472	149
759	3300014325	Ga0163163_10004764	Ga0163163_1000476412	149
760	3300014325	Ga0163163_10107334	Ga0163163_101073342	149
761	3300014325	Ga0163163_10526712	Ga0163163_105267122	149
762	3300014325	Ga0163163_10560854	Ga0163163_105608542	149
763	3300014326	Ga0157380_10022857	Ga0157380_100228573	149
764	3300014326	Ga0157380_10023566	Ga0157380_100235664	149
765	3300014326	Ga0157380_11258212	Ga0157380_112582122	149
766	3300014326	Ga0157380_11438656	Ga0157380_114386561	149
767	3300014745	Ga0157377_10000094	Ga0157377_1000009442	149
768	3300014968	Ga0157379_10004559	Ga0157379_1000455910	149
769	3300014968	Ga0157379_10157624	Ga0157379_101576242	149
770	3300014969	Ga0157376_10098229	Ga0157376_100982292	149
771	3300014969	Ga0157376_10151948	Ga0157376_101519482	149
772	3300014969	Ga0157376_10451251	Ga0157376_104512512	149
773	3300014969	Ga0157376_10803234	Ga0157376_108032342	149
774	3300017792	Ga0163161_10118524	Ga0163161_101185242	149
775	3300021361	Ga0213872_10026335	Ga0213872_100263352	149
776	3300025242	Ga0209258_110482	Ga0209258_1104822	149
777	3300025245	Ga0207425_1002625	Ga0207425_10026255	149
778	3300025258	Ga0209129_1000041	Ga0209129_1000041157	149
779	3300025263	Ga0209565_1009374	Ga0209565_10093743	149
780	3300025273	Ga0209673_1001809	Ga0209673_10018096	149
781	3300025273	Ga0209673_1007730	Ga0209673_10077302	149
782	3300025273	Ga0209673_1010237	Ga0209673_10102374	149
783	3300025273	Ga0209673_1010311	Ga0209673_10103113	149
784	3300025273	Ga0209673_1049602	Ga0209673_10496022	149
785	3300025295	Ga0209564_1000003	Ga0209564_1000003941	149
786	3300025295	Ga0209564_1000029	Ga0209564_1000029303	149
787	3300025297	Ga0209758_1000043	Ga0209758_1000043137	149
788	3300025297	Ga0209758_1000167	Ga0209758_1000167143	149
789	3300025298	Ga0209050_1000467	Ga0209050_100046769	149
790	3300025298	Ga0209050_1000808	Ga0209050_10008088	149
791	3300025298	Ga0209050_1001494	Ga0209050_100149415	149
792	3300025298	Ga0209050_1003886	Ga0209050_10038864	149
793	3300025299	Ga0209256_1000011	Ga0209256_10000117	149
794	3300025299	Ga0209256_1000398	Ga0209256_100039825	149
795	3300025299	Ga0209256_1002559	Ga0209256_10025599	149
796	3300025299	Ga0209256_1043431	Ga0209256_10434311	149
797	3300025303	Ga0209051_1000210	Ga0209051_100021036	149
798	3300025303	Ga0209051_1001335	Ga0209051_100133511	149
799	3300025303	Ga0209051_1007045	Ga0209051_10070452	149
800	3300025303	Ga0209051_1017118	Ga0209051_10171184	149
801	3300025304	Ga0209257_1000017	Ga0209257_1000017522	149
802	3300025304	Ga0209257_1000314	Ga0209257_100031436	149
803	3300025304	Ga0209257_1000799	Ga0209257_100079929	149
804	3300025304	Ga0209257_1005062	Ga0209257_10050628	149
805	3300025304	Ga0209257_1016941	Ga0209257_10169412	149
806	3300025728	Ga0207655_1083830	Ga0207655_10838302	149
807	3300025728	Ga0207655_1105079	Ga0207655_11050791	149
808	3300025735	Ga0207713_1116723	Ga0207713_11167232	149
809	3300025735	Ga0207713_1124951	Ga0207713_11249511	149
810	3300025885	Ga0207653_10200309	Ga0207653_102003091	149
811	3300025893	Ga0207682_10013197	Ga0207682_100131972	149
812	3300025899	Ga0207642_10218813	Ga0207642_102188132	149
813	3300025903	Ga0207680_10025961	Ga0207680_100259612	149
814	3300025907	Ga0207645_10727408	Ga0207645_107274082	149
815	3300025908	Ga0207643_10058785	Ga0207643_100587852	149
816	3300025909	Ga0207705_10106972	Ga0207705_101069722	149
817	3300025910	Ga0207684_10000743	Ga0207684_1000074329	149
818	3300025910	Ga0207684_10726554	Ga0207684_107265541	149
819	3300025912	Ga0207707_10002563	Ga0207707_100025638	149
820	3300025912	Ga0207707_10078608	Ga0207707_100786082	149
821	3300025913	Ga0207695_10025991	Ga0207695_100259913	149
822	3300025914	Ga0207671_10006034	Ga0207671_100060343	149
823	3300025914	Ga0207671_10118785	Ga0207671_101187853	149
824	3300025917	Ga0207660_10033235	Ga0207660_100332353	149
825	3300025918	Ga0207662_10647713	Ga0207662_106477132	149
826	3300025919	Ga0207657_10094700	Ga0207657_100947002	149
827	3300025920	Ga0207649_10001323	Ga0207649_1000132312	149
828	3300025920	Ga0207649_10186377	Ga0207649_101863772	149
829	3300025920	Ga0207649_10789743	Ga0207649_107897432	149
830	3300025921	Ga0207652_10156540	Ga0207652_101565403	149
831	3300025922	Ga0207646_10022087	Ga0207646_100220874	149
832	3300025923	Ga0207681_10032915	Ga0207681_100329154	149
833	3300025923	Ga0207681_10224280	Ga0207681_102242802	149
834	3300025923	Ga0207681_10753890	Ga0207681_107538902	149
835	3300025924	Ga0207694_10059195	Ga0207694_100591953	149
836	3300025924	Ga0207694_10090675	Ga0207694_100906752	149
837	3300025924	Ga0207694_10183514	Ga0207694_101835142	149
838	3300025925	Ga0207650_10064135	Ga0207650_100641352	149
839	3300025925	Ga0207650_10500826	Ga0207650_105008262	149
840	3300025926	Ga0207659_10003128	Ga0207659_100031289	149
841	3300025926	Ga0207659_10082489	Ga0207659_100824892	149
842	3300025926	Ga0207659_11065387	Ga0207659_110653872	149
843	3300025931	Ga0207644_10004958	Ga0207644_1000495810	149
844	3300025931	Ga0207644_10052099	Ga0207644_100520994	149
845	3300025931	Ga0207644_10075325	Ga0207644_100753252	149
846	3300025931	Ga0207644_10077977	Ga0207644_100779772	149
847	3300025931	Ga0207644_10096958	Ga0207644_100969582	149
848	3300025931	Ga0207644_10435136	Ga0207644_104351362	149
849	3300025932	Ga0207690_10004800	Ga0207690_100048005	149
850	3300025932	Ga0207690_10464084	Ga0207690_104640842	149
851	3300025933	Ga0207706_10002276	Ga0207706_100022763	149
852	3300025933	Ga0207706_10026649	Ga0207706_100266493	149
853	3300025933	Ga0207706_10027008	Ga0207706_100270086	149
854	3300025933	Ga0207706_10039929	Ga0207706_100399294	149
855	3300025933	Ga0207706_10164864	Ga0207706_101648642	149
856	3300025933	Ga0207706_10871904	Ga0207706_108719042	149
857	3300025935	Ga0207709_10001678	Ga0207709_100016783	149
858	3300025935	Ga0207709_10079035	Ga0207709_100790352	149
859	3300025936	Ga0207670_10099553	Ga0207670_100995532	149
860	3300025936	Ga0207670_10307801	Ga0207670_103078012	149
861	3300025937	Ga0207669_10235698	Ga0207669_102356982	149
862	3300025937	Ga0207669_10239937	Ga0207669_102399372	149
863	3300025940	Ga0207691_10001131	Ga0207691_100011314	149
864	3300025940	Ga0207691_10023069	Ga0207691_100230695	149
865	3300025940	Ga0207691_10033026	Ga0207691_100330263	149
866	3300025940	Ga0207691_10059029	Ga0207691_100590294	149
867	3300025940	Ga0207691_10513620	Ga0207691_105136202	149
868	3300025941	Ga0207711_10003690	Ga0207711_100036907	149
869	3300025941	Ga0207711_10131852	Ga0207711_101318522	149
870	3300025942	Ga0207689_10164403	Ga0207689_101644031	149
871	3300025942	Ga0207689_10935714	Ga0207689_109357142	149
872	3300025945	Ga0207679_10000201	Ga0207679_1000020117	149
873	3300025945	Ga0207679_10156225	Ga0207679_101562252	149
874	3300025945	Ga0207679_10205136	Ga0207679_102051362	149
875	3300025945	Ga0207679_11014935	Ga0207679_110149351	149
876	3300025949	Ga0207667_10751256	Ga0207667_107512561	149
877	3300025960	Ga0207651_10000562	Ga0207651_1000056210	149
878	3300025960	Ga0207651_10066265	Ga0207651_100662652	149
879	3300025960	Ga0207651_10239047	Ga0207651_102390472	149
880	3300025960	Ga0207651_10613907	Ga0207651_106139072	149
881	3300025961	Ga0207712_10188629	Ga0207712_101886292	149
882	3300025961	Ga0207712_10284826	Ga0207712_102848262	149
883	3300025972	Ga0207668_10158500	Ga0207668_101585002	149
884	3300025981	Ga0207640_10055882	Ga0207640_100558822	149
885	3300025986	Ga0207658_10009362	Ga0207658_100093623	149
886	3300025986	Ga0207658_10174954	Ga0207658_101749542	149
887	3300025986	Ga0207658_10252584	Ga0207658_102525842	149
888	3300026023	Ga0207677_11042000	Ga0207677_110420001	149
889	3300026035	Ga0207703_10000277	Ga0207703_1000027725	149
890	3300026035	Ga0207703_10031615	Ga0207703_100316156	149
891	3300026035	Ga0207703_10983484	Ga0207703_109834841	149
892	3300026041	Ga0207639_10046007	Ga0207639_100460072	149
893	3300026041	Ga0207639_10213011	Ga0207639_102130112	149
894	3300026041	Ga0207639_10623822	Ga0207639_106238222	149
895	3300026067	Ga0207678_10492475	Ga0207678_104924752	149
896	3300026067	Ga0207678_11487702	Ga0207678_114877021	149
897	3300026075	Ga0207708_10990513	Ga0207708_109905132	149
898	3300026078	Ga0207702_10230662	Ga0207702_102306622	149
899	3300026088	Ga0207641_10002663	Ga0207641_100026635	149
900	3300026088	Ga0207641_10049730	Ga0207641_100497304	149
901	3300026088	Ga0207641_10576301	Ga0207641_105763012	149
902	3300026089	Ga0207648_10000193	Ga0207648_1000019342	149
903	3300026089	Ga0207648_10026488	Ga0207648_100264882	149
904	3300026089	Ga0207648_10080813	Ga0207648_100808132	149
905	3300026089	Ga0207648_10083200	Ga0207648_100832002	149
906	3300026089	Ga0207648_10193541	Ga0207648_101935412	149
907	3300026089	Ga0207648_10238932	Ga0207648_102389322	149
908	3300026095	Ga0207676_10001342	Ga0207676_100013428	149
909	3300026095	Ga0207676_10017194	Ga0207676_100171942	149
910	3300026095	Ga0207676_10165480	Ga0207676_101654802	149
911	3300026095	Ga0207676_10203090	Ga0207676_102030902	149
912	3300026095	Ga0207676_10557604	Ga0207676_105576042	149
913	3300026116	Ga0207674_10038832	Ga0207674_100388326	149
914	3300026116	Ga0207674_10047553	Ga0207674_100475532	149
915	3300026118	Ga0207675_100109797	Ga0207675_1001097973	149
916	3300026121	Ga0207683_10011473	Ga0207683_100114738	149
917	3300026121	Ga0207683_10026198	Ga0207683_100261984	149
918	3300026121	Ga0207683_10054273	Ga0207683_100542732	149
919	3300026121	Ga0207683_10058630	Ga0207683_100586302	149
920	3300026142	Ga0207698_10014969	Ga0207698_100149693	149
921	3300026142	Ga0207698_10026945	Ga0207698_100269451	149
922	3300026142	Ga0207698_10426945	Ga0207698_104269452	149
923	3300026142	Ga0207698_11044887	Ga0207698_110448871	149
924	3300027111	Ga0209281_1000084	Ga0209281_100008444	149
925	3300027296	Ga0209389_1038266	Ga0209389_10382662	149
926	3300027876	Ga0209974_10005575	Ga0209974_100055755	149
927	3300027876	Ga0209974_10347476	Ga0209974_103474761	149
928	3300027907	Ga0207428_10598606	Ga0207428_105986062	149
929	3300028379	Ga0268266_11609399	Ga0268266_116093991	149
930	3300028380	Ga0268265_10054074	Ga0268265_100540743	149
931	3300028380	Ga0268265_10232084	Ga0268265_102320844	149
932	3300028380	Ga0268265_11083685	Ga0268265_110836852	149
933	3300028380	Ga0268265_11084055	Ga0268265_110840552	149
934	3300028381	Ga0268264_10371228	Ga0268264_103712282	149
935	3300028786	Ga0307517_10137926	Ga0307517_101379262	149
936	3300028786	Ga0307517_10149902	Ga0307517_101499022	149
937	3300028794	Ga0307515_10000093	Ga0307515_1000009351	149
938	3300028794	Ga0307515_10001261	Ga0307515_1000126121	149
939	3300028794	Ga0307515_10002007	Ga0307515_100020078	149
940	3300028794	Ga0307515_10004636	Ga0307515_1000463619	149
941	3300028794	Ga0307515_10009359	Ga0307515_100093596	149
942	3300028794	Ga0307515_10020687	Ga0307515_100206879	149
943	3300028794	Ga0307515_10026101	Ga0307515_100261012	149
944	3300028794	Ga0307515_10033140	Ga0307515_100331404	149
945	3300028794	Ga0307515_10097581	Ga0307515_100975813	149
946	3300029957	Ga0265324_10056156	Ga0265324_100561562	149
947	3300031238	Ga0265332_10037720	Ga0265332_100377203	149
948	3300031250	Ga0265331_10170948	Ga0265331_101709482	149
949	3300031344	Ga0265316_10000181	Ga0265316_1000018123	149
950	3300031456	Ga0307513_10042813	Ga0307513_100428135	149
951	3300031456	Ga0307513_10402559	Ga0307513_104025592	149
952	3300031456	Ga0307513_10539573	Ga0307513_105395732	149
953	3300031456	Ga0307513_10693937	Ga0307513_106939371	149
954	3300031507	Ga0307509_10095877	Ga0307509_100958773	149
955	3300031507	Ga0307509_10459073	Ga0307509_104590731	149
956	3300031548	Ga0307408_100000086	Ga0307408_10000008666	149
957	3300031548	Ga0307408_100067163	Ga0307408_1000671632	149
958	3300031548	Ga0307408_100160787	Ga0307408_1001607872	149
959	3300031548	Ga0307408_100803196	Ga0307408_1008031962	149
960	3300031616	Ga0307508_10003350	Ga0307508_100033503	149
961	3300031616	Ga0307508_10192655	Ga0307508_101926552	149
962	3300031649	Ga0307514_10001506	Ga0307514_1000150617	149
963	3300031649	Ga0307514_10019015	Ga0307514_100190153	149
964	3300031665	Ga0316575_10011595	Ga0316575_100115953	149
965	3300031665	Ga0316575_10021874	Ga0316575_100218742	149
966	3300031665	Ga0316575_10229925	Ga0316575_102299252	149
967	3300031691	Ga0316579_10101236	Ga0316579_101012362	149
968	3300031711	Ga0265314_10030007	Ga0265314_100300072	149
969	3300031727	Ga0316576_10056045	Ga0316576_100560453	149
970	3300031727	Ga0316576_10056950	Ga0316576_100569502	149
971	3300031727	Ga0316576_10133008	Ga0316576_101330082	149
972	3300031727	Ga0316576_10349662	Ga0316576_103496622	149
973	3300031727	Ga0316576_10369636	Ga0316576_103696362	149
974	3300031727	Ga0316576_10737003	Ga0316576_107370032	149
975	3300031728	Ga0316578_10035518	Ga0316578_100355182	149
976	3300031728	Ga0316578_10043091	Ga0316578_100430912	149
977	3300031728	Ga0316578_10309484	Ga0316578_103094842	149
978	3300031730	Ga0307516_10000383	Ga0307516_1000038316	149
979	3300031730	Ga0307516_10004457	Ga0307516_1000445713	149
980	3300031730	Ga0307516_10011720	Ga0307516_100117206	149
981	3300031730	Ga0307516_10017724	Ga0307516_100177245	149
982	3300031731	Ga0307405_10461688	Ga0307405_104616882	149
983	3300031733	Ga0316577_10092948	Ga0316577_100929482	149
984	3300031824	Ga0307413_10445499	Ga0307413_104454992	149
985	3300031824	Ga0307413_10735437	Ga0307413_107354371	149
986	3300031852	Ga0307410_10270386	Ga0307410_102703861	149
987	3300031852	Ga0307410_10656781	Ga0307410_106567812	149
988	3300031901	Ga0307406_10086465	Ga0307406_100864653	149
989	3300031903	Ga0307407_11071374	Ga0307407_110713741	149
990	3300031995	Ga0307409_100950063	Ga0307409_1009500631	149
991	3300031995	Ga0307409_101072765	Ga0307409_1010727652	149
992	3300032004	Ga0307414_10148718	Ga0307414_101487182	149
993	3300032004	Ga0307414_11196898	Ga0307414_111968982	149
994	3300032004	Ga0307414_11708164	Ga0307414_117081641	149
995	3300032005	Ga0307411_10001320	Ga0307411_100013207	149
996	3300032005	Ga0307411_10228908	Ga0307411_102289082	149
997	3300032005	Ga0307411_11399808	Ga0307411_113998081	149
998	3300032126	Ga0307415_101042866	Ga0307415_1010428662	149
999	3300032139	Ga0316580_10012176	Ga0316580_100121762	149
1000	3300033179	Ga0307507_10157523	Ga0307507_101575233	149
1001	3300033180	Ga0307510_10113907	Ga0307510_101139072	149
1002	3300034817	Ga0373948_0002019	Ga0373948_0002019_365_814	149
1003	3300034820	Ga0373959_0051324	Ga0373959_0051324_430_879	149
1004	3300034957	Ga0373938_0101796	Ga0373938_0101796_204_653	149
1005	3300035084	Ga0373928_0096224	Ga0373928_0096224_92_541	149
1006	3300035088	Ga0373940_0019893	Ga0373940_0019893_224_673	149
1007	3300035088	Ga0373940_0298720	Ga0373940_0298720_74_523	149
1008	3300035090	Ga0373949_0112347	Ga0373949_0112347_259_708	149
1009	3300035091	Ga0373951_0047822	Ga0373951_0047822_421_870	149
1010	3300035112	Ga0373932_0187236	Ga0373932_0187236_135_584	149
1011	3300035112	Ga0373932_0226077	Ga0373932_0226077_212_661	149
1012	3300035114	Ga0373939_0000017	Ga0373939_0000017_19252_19701	149
1013	3300035115	Ga0373941_0085831	Ga0373941_0085831_228_677	149
1014	3300035121	Ga0373960_0000109	Ga0373960_0000109_9645_10094	149
1015	3300035170	Ga0373943_0287586	Ga0373943_0287586_21_488	149
1016	3300035170	Ga0373943_0414377	Ga0373943_0414377_33_482	149
1017	3300035171	Ga0373946_0227840	Ga0373946_0227840_167_616	149
1018	3300035171	Ga0373946_0283561	Ga0373946_0283561_322_771	149
1019	3300035172	Ga0373955_0006739	Ga0373955_0006739_2669_3139	149
1020	3300035172	Ga0373955_0311201	Ga0373955_0311201_48_518	149
1021	3300035172	Ga0373955_0360841	Ga0373955_0360841_283_732	149
1022	3300035172	Ga0373955_0727802	Ga0373955_0727802_123_590	149
1023	3300035398	Ga0316574_0002109	Ga0316574_0002109_6446_6901	149
1024	3300035398	Ga0316574_0004706	Ga0316574_0004706_1571_2041	149
1025	3300035398	Ga0316574_0006307	Ga0316574_0006307_598_1053	149
1026	3300035398	Ga0316574_0167217	Ga0316574_0167217_159_614	149
1027	3300035410	Ga0373924_0245055	Ga0373924_0245055_268_717	149
1028	3300035691	Ga0373931_0000641	Ga0373931_0000641_13697_14146	149
1029	3300035691	Ga0373931_0014924	Ga0373931_0014924_3172_3621	149
1030	3300035692	Ga0373935_0302056	Ga0373935_0302056_629_1099	149
1031	3300035695	Ga0373927_0286813	Ga0373927_0286813_308_757	149
1032	3300035724	Ga0373933_0018395	Ga0373933_0018395_1935_2405	149
1033	3300036401	Ga0373937_0005971	Ga0373937_0005971_6033_6503	149
1034	3300036401	Ga0373937_0052497	Ga0373937_0052497_946_1401	149
1035	3300036401	Ga0373937_0075221	Ga0373937_0075221_2284_2733	149
1036	3300036401	Ga0373937_0224658	Ga0373937_0224658_487_936	149
1037	3300036401	Ga0373937_0293183	Ga0373937_0293183_249_698	149
1038	3300036401	Ga0373937_0901458	Ga0373937_0901458_100_549	149
1039	3300036647	Ga0316582_0034461	Ga0316582_0034461_2444_2899	149
1040	3300036647	Ga0316582_0134775	Ga0316582_0134775_326_781	149
1041	3300036712	Ga0316584_0027762	Ga0316584_0027762_569_1024	149
1042	3300036712	Ga0316584_0050235	Ga0316584_0050235_839_1309	149
1043	3300036712	Ga0316584_0127724	Ga0316584_0127724_105_560	149
1044	3300036712	Ga0316584_0194067	Ga0316584_0194067_213_668	149
1045	3300037068	Ga0373925_0231330	Ga0373925_0231330_961_1428	149
1046	3300037068	Ga0373925_0801770	Ga0373925_0801770_224_673	149
1047	3300037068	Ga0373925_0954722	Ga0373925_0954722_50_505	149
1048	3300037068	Ga0373925_1242065	Ga0373925_1242065_43_492	149
1049	3300037471	Ga0395905_0000733	Ga0395905_0000733_12036_12485	149
1050	3300037471	Ga0395905_0003480	Ga0395905_0003480_11244_11693	149
1051	3300037471	Ga0395905_0073034	Ga0395905_0073034_1709_2161	149
1052	3300038726	Ga0400490_35404	Ga0400490_35404_3535_3990	149
1053	3300038741	Ga0400488_10414	Ga0400488_10414_169_624	149
1054	3300039062	Ga0400483_115564	Ga0400483_115564_62_517	149
1055	3300039062	Ga0400483_167120	Ga0400483_167120_1240_1695	149
1056	3300039093	Ga0400489_77120	Ga0400489_77120_55_510	149
1057	3300039437	Ga0436365_1149228	Ga0436365_1149228_528_977	149
1058	3300041405	Ga0439438_000268	Ga0439438_000268_2657_3112	149
1059	3300041410	Ga0439461_0020382	Ga0439461_0020382_347_796	149
1060	3300041443	Ga0451789_0205740	Ga0451789_0205740_549_998	149
1061	3300041443	Ga0451789_0668546	Ga0451789_0668546_133_582	149
1062	3300041452	Ga0451793_0300321	Ga0451793_0300321_333_782	149
1063	3300041453	Ga0451797_0814064	Ga0451797_0814064_203_652	149
1064	3300041456	Ga0451795_0037673	Ga0451795_0037673_129_578	149
1065	3300041456	Ga0451795_0302360	Ga0451795_0302360_171_620	149
1066	3300041459	Ga0451800_1347080	Ga0451800_1347080_79_528	149
1067	3300041460	Ga0451802_1791109	Ga0451802_1791109_163_612	149
1068	3300041486	Ga0451807_0109086	Ga0451807_0109086_442_891	149
1069	3300041486	Ga0451807_2127931	Ga0451807_2127931_10_474	149
1070	3300041498	Ga0451841_0278424	Ga0451841_0278424_27_476	149
1071	3300041507	Ga0451851_1274973	Ga0451851_1274973_444_893	149
1072	3300041509	Ga0451843_0108815	Ga0451843_0108815_19_468	149
1073	3300041512	Ga0451853_4036164	Ga0451853_4036164_289_738	149
1074	3300042000	Ga0439437_002898	Ga0439437_002898_1135_1584	149
1075	3300042016	Ga0439463_000609	Ga0439463_000609_4080_4535	149
1076	3300042117	Ga0450913_017850	Ga0450913_017850_35_490	149
1077	3300042120	Ga0450917_002467	Ga0450917_002467_642_1091	149
1078	3300042126	Ga0450888_000480	Ga0450888_000480_230_679	149
1079	3300042127	Ga0450890_000295	Ga0450890_000295_3299_3748	149
1080	3300042127	Ga0450890_039658	Ga0450890_039658_39_488	149
1081	3300042130	Ga0450892_001087	Ga0450892_001087_1339_1788	149
1082	3300042138	Ga0450903_027492	Ga0450903_027492_254_703	149
1083	3300042144	Ga0450889_009573	Ga0450889_009573_129_578	149
1084	3300042156	Ga0439446_0004039	Ga0439446_0004039_2074_2529	149
1085	3300042532	Ga0450893_0021574	Ga0450893_0021574_232_681	149
1086	3300042876	Ga0451577_0000013	Ga0451577_0000013_393175_393624	149
1087	3300042876	Ga0451577_0003554	Ga0451577_0003554_8895_9344	149
1088	3300042876	Ga0451577_0537562	Ga0451577_0537562_269_718	149
1089	3300044656	Ga0466969_0000036	Ga0466969_0000036_73612_74061	149
1090	3300044656	Ga0466969_0032912	Ga0466969_0032912_847_1296	149
1091	3300044658	Ga0466972_0267270	Ga0466972_0267270_55_504	149
1092	3300044673	Ga0453683_0000059	Ga0453683_0000059_29644_30093	149
1093	3300044673	Ga0453683_1236468	Ga0453683_1236468_10_459	149
1094	3300044683	Ga0466965_0049757	Ga0466965_0049757_745_1194	149
1095	3300044683	Ga0466965_0091575	Ga0466965_0091575_12_461	149
1096	3300044683	Ga0466965_0223023	Ga0466965_0223023_516_965	149
1097	3300044683	Ga0466965_0231324	Ga0466965_0231324_138_590	149
1098	3300044684	Ga0466966_0224184	Ga0466966_0224184_62_511	149
1099	3300044693	Ga0466961_0000406	Ga0466961_0000406_24902_25354	149
1100	3300044693	Ga0466961_0003921	Ga0466961_0003921_4731_5180	149
1101	3300044693	Ga0466961_0015938	Ga0466961_0015938_1663_2112	149
1102	3300044694	Ga0466963_0008785	Ga0466963_0008785_4346_4795	149
1103	3300044706	Ga0466964_0261218	Ga0466964_0261218_188_640	149
1104	3300044712	Ga0453684_0000040	Ga0453684_0000040_4143_4592	149
1105	3300044712	Ga0453684_0000085	Ga0453684_0000085_4194_4643	149
1106	3300044712	Ga0453684_1418603	Ga0453684_1418603_148_597	149
1107	3300044719	Ga0466971_0034131	Ga0466971_0034131_1756_2205	149
1108	3300044765	Ga0466970_0046693	Ga0466970_0046693_1596_2045	149
1109	3300044765	Ga0466970_0401824	Ga0466970_0401824_44_493	149
1110	3300045049	Ga0466959_0032407	Ga0466959_0032407_223_672	149
1111	3300045049	Ga0466959_0042728	Ga0466959_0042728_2487_2936	149
1112	3300045049	Ga0466959_0767138	Ga0466959_0767138_163_612	149
1113	3300045051	Ga0451576_0000018	Ga0451576_0000018_157066_157515	149
1114	3300045051	Ga0451576_0046314	Ga0451576_0046314_1706_2155	149
1115	3300045051	Ga0451576_0062742	Ga0451576_0062742_952_1401	149
1116	3300046452	Ga0495617_171111	Ga0495617_171111_173_628	149
1117	3300046453	Ga0495627_008265	Ga0495627_008265_2281_2736	149
1118	3300046457	Ga0495590_0169163	Ga0495590_0169163_102_551	149
1119	3300046458	Ga0495591_002740	Ga0495591_002740_5053_5508	149
1120	3300046459	Ga0495629_0016220	Ga0495629_0016220_1346_1795	149
1121	3300046459	Ga0495629_0252120	Ga0495629_0252120_346_807	149
1122	3300046459	Ga0495629_0480371	Ga0495629_0480371_324_776	149
1123	3300046460	Ga0495638_0115806	Ga0495638_0115806_484_933	149
1124	3300046460	Ga0495638_0550317	Ga0495638_0550317_12_461	149
1125	3300046463	Ga0495653_0019297	Ga0495653_0019297_4180_4635	149
1126	3300046472	Ga0495580_0206695	Ga0495580_0206695_195_656	149
1127	3300046472	Ga0495580_0210191	Ga0495580_0210191_575_1027	149
1128	3300046472	Ga0495580_0234349	Ga0495580_0234349_277_729	149
1129	3300046472	Ga0495580_0365861	Ga0495580_0365861_142_597	149
1130	3300046472	Ga0495580_0383443	Ga0495580_0383443_376_825	149
1131	3300046472	Ga0495580_0468007	Ga0495580_0468007_355_816	149
1132	3300046473	Ga0495582_0014361	Ga0495582_0014361_2049_2501	149
1133	3300046474	Ga0495605_0000079	Ga0495605_0000079_1287_1742	149
1134	3300046474	Ga0495605_0010273	Ga0495605_0010273_4057_4512	149
1135	3300046477	Ga0495664_0098878	Ga0495664_0098878_759_1208	149
1136	3300046491	Ga0495584_0053064	Ga0495584_0053064_986_1438	149
1137	3300046499	Ga0495594_0002116	Ga0495594_0002116_7191_7643	149
1138	3300046501	Ga0495607_0005948	Ga0495607_0005948_5076_5531	149
1139	3300046501	Ga0495607_0024242	Ga0495607_0024242_2208_2663	149
1140	3300046501	Ga0495607_0027845	Ga0495607_0027845_2178_2633	149
1141	3300046501	Ga0495607_0191961	Ga0495607_0191961_504_959	149
1142	3300046506	Ga0495583_0006278	Ga0495583_0006278_3287_3742	149
1143	3300046506	Ga0495583_0138597	Ga0495583_0138597_65_514	149
1144	3300046507	Ga0495606_0000018	Ga0495606_0000018_245439_245906	149
1145	3300046507	Ga0495606_0001693	Ga0495606_0001693_3971_4426	149
1146	3300046507	Ga0495606_0004808	Ga0495606_0004808_4194_4649	149
1147	3300046507	Ga0495606_0012829	Ga0495606_0012829_1880_2335	149
1148	3300046512	Ga0495610_0039322	Ga0495610_0039322_552_1001	149
1149	3300046512	Ga0495610_0151459	Ga0495610_0151459_74_523	149
1150	3300046512	Ga0495610_0237895	Ga0495610_0237895_171_620	149
1151	3300046515	Ga0495620_0013339	Ga0495620_0013339_1287_1742	149
1152	3300046515	Ga0495620_0048024	Ga0495620_0048024_1020_1469	149
1153	3300046515	Ga0495620_0092085	Ga0495620_0092085_580_1035	149
1154	3300046515	Ga0495620_0300239	Ga0495620_0300239_33_482	149
1155	3300046518	Ga0495631_0048144	Ga0495631_0048144_806_1258	149
1156	3300046519	Ga0495632_0004573	Ga0495632_0004573_5486_5935	149
1157	3300046519	Ga0495632_0005877	Ga0495632_0005877_1020_1469	149
1158	3300046519	Ga0495632_0019284	Ga0495632_0019284_174_629	149
1159	3300046519	Ga0495632_0067376	Ga0495632_0067376_663_1112	149
1160	3300046519	Ga0495632_0146319	Ga0495632_0146319_114_569	149
1161	3300046522	Ga0495643_0004561	Ga0495643_0004561_4059_4514	149
1162	3300046522	Ga0495643_0277504	Ga0495643_0277504_265_714	149
1163	3300046528	Ga0495642_0126278	Ga0495642_0126278_507_959	149
1164	3300046529	Ga0495652_0474867	Ga0495652_0474867_233_682	149
1165	3300046533	Ga0495640_0152833	Ga0495640_0152833_465_914	149
1166	3300046537	Ga0495598_0363899	Ga0495598_0363899_27_479	149
1167	3300046538	Ga0495609_0124522	Ga0495609_0124522_288_737	149
1168	3300046542	Ga0495597_0278207	Ga0495597_0278207_112_561	149
1169	3300046557	Ga0495622_0027086	Ga0495622_0027086_131_583	149
1170	3300046616	Ga0495668_0026531	Ga0495668_0026531_85_540	149
1171	3300046616	Ga0495668_0291160	Ga0495668_0291160_409_858	149
1172	3300046648	Ga0495611_0001249	Ga0495611_0001249_11153_11605	149
1173	3300046648	Ga0495611_0063900	Ga0495611_0063900_93_542	149
1174	3300046648	Ga0495611_0270890	Ga0495611_0270890_304_753	149
1175	3300046660	Ga0495625_0128312	Ga0495625_0128312_383_832	149
1176	3300046663	Ga0495635_0074733	Ga0495635_0074733_202_651	149
1177	3300046664	Ga0495659_0338654	Ga0495659_0338654_132_581	149
1178	3300046665	Ga0495661_0025068	Ga0495661_0025068_106_561	149
1179	3300046675	Ga0495657_0082973	Ga0495657_0082973_47_496	149
1180	3300046681	Ga0495647_0021435	Ga0495647_0021435_1742_2203	149
1181	3300046681	Ga0495647_0021548	Ga0495647_0021548_343_804	149
1182	3300046683	Ga0495658_0018582	Ga0495658_0018582_2485_2934	149
1183	3300046683	Ga0495658_0032930	Ga0495658_0032930_1291_1752	149
1184	3300046683	Ga0495658_0254946	Ga0495658_0254946_454_903	149
1185	3300046689	Ga0495613_0339900	Ga0495613_0339900_184_639	149
1186	3300046689	Ga0495613_0420755	Ga0495613_0420755_358_807	149
1187	3300046692	Ga0495671_0020895	Ga0495671_0020895_629_1084	149
1188	3300046692	Ga0495671_0053956	Ga0495671_0053956_907_1356	149
1189	3300046694	Ga0495649_0003794	Ga0495649_0003794_2464_2913	149
1190	3300046810	Ga0495660_0025217	Ga0495660_0025217_2275_2730	149
1191	3300046810	Ga0495660_0394460	Ga0495660_0394460_99_554	149
1192	3300047317	Ga0495604_0192249	Ga0495604_0192249_774_1223	149
1193	3300047318	Ga0495636_0060240	Ga0495636_0060240_368_820	149
1194	3300047319	Ga0495674_0111820	Ga0495674_0111820_985_1434	149
1195	3300047320	Ga0495672_0009983	Ga0495672_0009983_6233_6688	149
1196	3300047322	Ga0495680_0255245	Ga0495680_0255245_94_543	149
1197	3300047443	Ga0495687_000912	Ga0495687_000912_18425_18874	149
1198	3300047443	Ga0495687_011633	Ga0495687_011633_545_994	149
1199	3300047445	Ga0495677_0019763	Ga0495677_0019763_1232_1684	149
1200	3300047469	Ga0495673_0010730	Ga0495673_0010730_3122_3577	149
1201	3300047469	Ga0495673_0021951	Ga0495673_0021951_2524_2979	149
1202	3300047470	Ga0495681_0145242	Ga0495681_0145242_44_496	149
1203	3300047471	Ga0495684_0163503	Ga0495684_0163503_157_606	149
1204	3300047472	Ga0495686_0337769	Ga0495686_0337769_112_561	149
1205	3300047472	Ga0495686_0549571	Ga0495686_0549571_85_534	149
1206	3300048089	Ga0495614_0242387	Ga0495614_0242387_112_564	149
1207	3300048091	Ga0495626_0111959	Ga0495626_0111959_667_1116	149
1208	3300048904	Ga0496101_0297444	Ga0496101_0297444_800_1249	149
1209	3300048905	Ga0496102_0039318	Ga0496102_0039318_816_1271	149
1210	3300048905	Ga0496102_0079561	Ga0496102_0079561_940_1389	149
1211	3300048905	Ga0496102_0136772	Ga0496102_0136772_1128_1577	149
1212	3300048905	Ga0496102_0439587	Ga0496102_0439587_268_738	149
1213	3300048905	Ga0496102_1093602	Ga0496102_1093602_34_483	149
1214	3300048907	Ga0496104_0013206	Ga0496104_0013206_1499_1969	149
1215	3300048907	Ga0496104_0124767	Ga0496104_0124767_453_914	149
1216	3300048908	Ga0496105_0745533	Ga0496105_0745533_22_474	149
1217	3300048909	Ga0496106_0084887	Ga0496106_0084887_1724_2176	149
1218	3300048909	Ga0496106_0185495	Ga0496106_0185495_588_1058	149
1219	3300048909	Ga0496106_0299452	Ga0496106_0299452_618_1067	149
1220	3300048911	Ga0496108_1625881	Ga0496108_1625881_28_480	149
1221	3300048912	Ga0496109_0125768	Ga0496109_0125768_1594_2043	149
1222	3300048912	Ga0496109_0520052	Ga0496109_0520052_97_549	149
1223	3300048912	Ga0496109_0940342	Ga0496109_0940342_212_673	149
1224	3300048913	Ga0496110_0132413	Ga0496110_0132413_1604_2056	149
1225	3300048913	Ga0496110_0218016	Ga0496110_0218016_1136_1591	149
1226	3300048913	Ga0496110_0262072	Ga0496110_0262072_686_1141	149
1227	3300048913	Ga0496110_0546433	Ga0496110_0546433_171_620	149
1228	3300048915	Ga0496112_0005059	Ga0496112_0005059_8031_8492	149
1229	3300048916	Ga0496113_0007024	Ga0496113_0007024_568_1029	149
1230	3300048917	Ga0496114_0001047	Ga0496114_0001047_9151_9621	149
1231	3300048917	Ga0496114_0008159	Ga0496114_0008159_2524_2973	149
1232	3300048918	Ga0496115_0204471	Ga0496115_0204471_1014_1484	149
1233	3300048918	Ga0496115_0375720	Ga0496115_0375720_73_522	149
1234	3300048919	Ga0496116_0020148	Ga0496116_0020148_906_1361	149
1235	3300048920	Ga0496117_0056774	Ga0496117_0056774_1882_2337	149
1236	3300048921	Ga0496118_0142551	Ga0496118_0142551_32_487	149
1237	3300048922	Ga0496119_0000834	Ga0496119_0000834_7970_8425	149
1238	3300048923	Ga0496120_0000718	Ga0496120_0000718_6714_7169	149
1239	3300048924	Ga0496121_0026934	Ga0496121_0026934_816_1271	149
1240	3300048925	Ga0496122_0016985	Ga0496122_0016985_4042_4497	149
1241	3300048926	Ga0496123_0030819	Ga0496123_0030819_3026_3481	149
1242	3300048927	Ga0496124_0003362	Ga0496124_0003362_10208_10657	149
1243	3300048927	Ga0496124_0010223	Ga0496124_0010223_4930_5385	149
1244	3300048927	Ga0496124_0022120	Ga0496124_0022120_1711_2160	149
1245	3300048927	Ga0496124_0079168	Ga0496124_0079168_990_1445	149
1246	3300048927	Ga0496124_0091501	Ga0496124_0091501_460_915	149
1247	3300048928	Ga0496125_0022697	Ga0496125_0022697_1574_2023	149
1248	3300048928	Ga0496125_0062565	Ga0496125_0062565_2296_2745	149
1249	3300048928	Ga0496125_0137894	Ga0496125_0137894_1104_1559	149
1250	3300048929	Ga0496126_0047047	Ga0496126_0047047_2042_2497	149
1251	3300049129	Ga0501309_010432	Ga0501309_010432_210_659	149
1252	3300049459	Ga0495678_023711	Ga0495678_023711_223_678	149
1253	3300049459	Ga0495678_036235	Ga0495678_036235_96_551	149
1254	3300049459	Ga0495678_119543	Ga0495678_119543_93_542	149
1255	3300049460	Ga0495682_0002074	Ga0495682_0002074_4221_4676	149
1256	3300049460	Ga0495682_0340000	Ga0495682_0340000_34_483	149
1257	3300049522	Ga0501299_012430	Ga0501299_012430_857_1306	149
1258	3300049530	Ga0501314_003354	Ga0501314_003354_301_750	149
1259	3300049569	Ga0501032_0750232	Ga0501032_0750232_102_551	149
1260	3300049571	Ga0501034_0130008	Ga0501034_0130008_353_802	149
1261	3300049572	Ga0501036_0640592	Ga0501036_0640592_404_853	149
1262	3300049575	Ga0501039_0052269	Ga0501039_0052269_2186_2635	149
1263	3300049576	Ga0501040_0165251	Ga0501040_0165251_481_948	149
1264	3300049579	Ga0501043_0000004	Ga0501043_0000004_196053_196502	149
1265	3300049580	Ga0501046_0000016	Ga0501046_0000016_95334_95783	149
1266	3300049581	Ga0501047_0000012	Ga0501047_0000012_95014_95463	149
1267	3300049581	Ga0501047_0293404	Ga0501047_0293404_468_944	149
1268	3300049581	Ga0501047_0335504	Ga0501047_0335504_867_1316	149
1269	3300049581	Ga0501047_1051994	Ga0501047_1051994_18_470	149
1270	3300049650	Ga0501199_005273	Ga0501199_005273_206_655	149
1271	3300049658	Ga0501211_000722	Ga0501211_000722_2191_2640	149
1272	3300049662	Ga0501222_001247	Ga0501222_001247_2707_3156	149
1273	3300049683	Ga0501253_028874	Ga0501253_028874_401_850	149
1274	3300049761	Ga0501264_006472	Ga0501264_006472_200_649	149
1275	3300049764	Ga0501267_006197	Ga0501267_006197_449_898	149
1276	3300049769	Ga0501272_005513	Ga0501272_005513_56_505	149
1277	3300049774	Ga0501278_010212	Ga0501278_010212_40_489	149
1278	3300049824	Ga0501045_0009097	Ga0501045_0009097_601_1050	149
1279	3300049824	Ga0501045_0434923	Ga0501045_0434923_286_735	149
1280	3300049853	Ga0501226_006472	Ga0501226_006472_237_686	149
1281	3300050489	nmdc:mga03683_102014_c1	nmdc:mga03683_102014_c1_685_1134	149
1282	3300050489	nmdc:mga03683_115789_c1	nmdc:mga03683_115789_c1_236_685	149
1283	3300050489	nmdc:mga03683_307019_c1	nmdc:mga03683_307019_c1_216_665	149
1284	3300050490	nmdc:mga03n38_41237_c1	nmdc:mga03n38_41237_c1_884_1333	149
1285	3300050490	nmdc:mga03n38_827733_c1	nmdc:mga03n38_827733_c1_80_529	149
1286	3300050491	nmdc:mga00v17_127984_c1	nmdc:mga00v17_127984_c1_133_582	149
1287	3300050491	nmdc:mga00v17_143688_c1	nmdc:mga00v17_143688_c1_255_704	149
1288	3300050491	nmdc:mga00v17_828904_c1	nmdc:mga00v17_828904_c1_60_509	149
1289	3300050492	nmdc:mga0yw44_30213_c1	nmdc:mga0yw44_30213_c1_967_1416	149
1290	3300050493	nmdc:mga0k408_109179_c1	nmdc:mga0k408_109179_c1_347_796	149
1291	3300050493	nmdc:mga0k408_11211_c1	nmdc:mga0k408_11211_c1_2411_2860	149
1292	3300050493	nmdc:mga0k408_114833_c1	nmdc:mga0k408_114833_c1_258_707	149
1293	3300050493	nmdc:mga0k408_136285_c1	nmdc:mga0k408_136285_c1_795_1244	149
1294	3300050493	nmdc:mga0k408_14639_c1	nmdc:mga0k408_14639_c1_3104_3553	149
1295	3300050493	nmdc:mga0k408_152829_c1	nmdc:mga0k408_152829_c1_869_1318	149
1296	3300050493	nmdc:mga0k408_15620_c1	nmdc:mga0k408_15620_c1_334_783	149
1297	3300050493	nmdc:mga0k408_263616_c1	nmdc:mga0k408_263616_c1_83_532	149
1298	3300050493	nmdc:mga0k408_2673_c1	nmdc:mga0k408_2673_c1_6523_6972	149
1299	3300050493	nmdc:mga0k408_47503_c1	nmdc:mga0k408_47503_c1_779_1228	149
1300	3300050493	nmdc:mga0k408_607146_c1	nmdc:mga0k408_607146_c1_146_595	149
1301	3300050493	nmdc:mga0k408_63531_c1	nmdc:mga0k408_63531_c1_334_783	149
1302	3300050494	nmdc:mga06z11_23782_c1	nmdc:mga06z11_23782_c1_116_565	149
1303	3300050494	nmdc:mga06z11_27127_c1	nmdc:mga06z11_27127_c1_975_1424	149
1304	3300050494	nmdc:mga06z11_51754_c1	nmdc:mga06z11_51754_c1_275_724	149
1305	3300050494	nmdc:mga06z11_551408_c1	nmdc:mga06z11_551408_c1_230_679	149
1306	3300050496	nmdc:mga07m45_1019_c1	nmdc:mga07m45_1019_c1_4914_5363	149
1307	3300050496	nmdc:mga07m45_103975_c1	nmdc:mga07m45_103975_c1_345_794	149
1308	3300050496	nmdc:mga07m45_1241_c1	nmdc:mga07m45_1241_c1_3379_3828	149
1309	3300050496	nmdc:mga07m45_144604_c1	nmdc:mga07m45_144604_c1_49_498	149
1310	3300050496	nmdc:mga07m45_22037_c1	nmdc:mga07m45_22037_c1_200_649	149
1311	3300050496	nmdc:mga07m45_4444_c1	nmdc:mga07m45_4444_c1_2193_2642	149
1312	3300050496	nmdc:mga07m45_46325_c1	nmdc:mga07m45_46325_c1_559_1008	149
1313	3300050496	nmdc:mga07m45_650_c1	nmdc:mga07m45_650_c1_6720_7169	149
1314	3300050496	nmdc:mga07m45_687772_c1	nmdc:mga07m45_687772_c1_68_517	149
1315	3300050511	nmdc:mga08y16_674920_c1	nmdc:mga08y16_674920_c1_574_1023	149
1316	3300050516	nmdc:mga0sz30_45120_c1	nmdc:mga0sz30_45120_c1_419_868	149
1317	3300053077	Ga0495601_0057819	Ga0495601_0057819_187_636	149
1318	3300053078	Ga0495612_0038847	Ga0495612_0038847_36_485	149
1319	3300053085	Ga0495619_0119836	Ga0495619_0119836_1151_1600	149
1320	3300053086	Ga0500578_0000049	Ga0500578_0000049_97594_98043	149
1321	3300053088	Ga0500644_0032189	Ga0500644_0032189_839_1288	149
1322	3300053088	Ga0500644_0099111	Ga0500644_0099111_349_798	149
1323	3300053090	Ga0500646_0003195	Ga0500646_0003195_2670_3119	149
1324	3300053091	Ga0500647_0132189	Ga0500647_0132189_59_514	149
1325	3300053092	Ga0500583_0532016	Ga0500583_0532016_23_472	149
1326	3300053093	Ga0500651_0097062	Ga0500651_0097062_601_1050	149
1327	3300053093	Ga0500651_0114859	Ga0500651_0114859_683_1132	149
1328	3300053093	Ga0500651_0406196	Ga0500651_0406196_248_697	149
1329	3300053098	Ga0500650_0057076	Ga0500650_0057076_423_872	149
1330	3300053098	Ga0500650_0183909	Ga0500650_0183909_373_822	149
1331	3300053109	Ga0500569_105324	Ga0500569_105324_214_663	149
1332	3300053115	Ga0500591_075673	Ga0500591_075673_619_1098	149
1333	3300053117	Ga0500593_030750	Ga0500593_030750_1500_1949	149
1334	3300053118	Ga0500594_0058307	Ga0500594_0058307_354_803	149
1335	3300053129	Ga0500628_000439	Ga0500628_000439_2838_3287	149
1336	3300053130	Ga0500642_0006244	Ga0500642_0006244_272_721	149
1337	3300053131	Ga0500652_000044	Ga0500652_000044_17649_18098	149
1338	3300053133	Ga0500655_029979	Ga0500655_029979_412_861	149
1339	3300053134	Ga0500658_0002543	Ga0500658_0002543_3433_3882	149
1340	3300053134	Ga0500658_0128090	Ga0500658_0128090_642_1091	149
1341	3300053136	Ga0500559_0006184	Ga0500559_0006184_1271_1720	149
1342	3300053136	Ga0500559_0327048	Ga0500559_0327048_184_663	149
1343	3300053137	Ga0500561_0058022	Ga0500561_0058022_131_580	149
1344	3300053139	Ga0500568_0001263	Ga0500568_0001263_13055_13510	149
1345	3300053139	Ga0500568_0038336	Ga0500568_0038336_952_1401	149
1346	3300053142	Ga0500577_0003546	Ga0500577_0003546_3315_3764	149
1347	3300053151	Ga0500604_0012951	Ga0500604_0012951_1770_2219	149
1348	3300053151	Ga0500604_0112477	Ga0500604_0112477_146_595	149
1349	3300053154	Ga0500619_000120	Ga0500619_000120_14256_14705	149
1350	3300053156	Ga0500622_0000128	Ga0500622_0000128_40469_40918	149
1351	3300053156	Ga0500622_0001173	Ga0500622_0001173_12782_13231	149
1352	3300053156	Ga0500622_0001549	Ga0500622_0001549_1131_1580	149
1353	3300053156	Ga0500622_0170851	Ga0500622_0170851_344_793	149
1354	3300053739	Ga0500587_005732	Ga0500587_005732_483_932	149
1355	3300053739	Ga0500587_011776	Ga0500587_011776_340_789	149
1356	3300059421	Ga0590071_001980	Ga0590071_001980_4387_4839	149
1357	3300005336	Ga0070680_100157655	Ga0070680_1001576552	150
1358	3300005539	Ga0068853_100006065	Ga0068853_1000060658	150
1359	3300005614	Ga0068856_100289670	Ga0068856_1002896701	150
1360	3300005616	Ga0068852_100018603	Ga0068852_1000186033	150
1361	3300006237	Ga0097621_100034883	Ga0097621_1000348835	150
1362	3300009093	Ga0105240_10031265	Ga0105240_100312655	150
1363	3300009093	Ga0105240_10079757	Ga0105240_100797572	150
1364	3300009174	Ga0105241_10434571	Ga0105241_104345712	150
1365	3300010375	Ga0105239_11138897	Ga0105239_111388972	150
1366	3300011119	Ga0105246_12327865	Ga0105246_123278651	150
1367	3300013100	Ga0157373_10486659	Ga0157373_104866592	150
1368	3300013105	Ga0157369_10037600	Ga0157369_100376003	150
1369	3300013105	Ga0157369_11072985	Ga0157369_110729852	150
1370	3300013306	Ga0163162_10871690	Ga0163162_108716901	150
1371	3300013307	Ga0157372_10117708	Ga0157372_101177082	150
1372	3300013307	Ga0157372_10699447	Ga0157372_106994472	150
1373	3300025321	Ga0207656_10005941	Ga0207656_100059415	150
1374	3300025913	Ga0207695_10043173	Ga0207695_100431732	150
1375	3300025919	Ga0207657_10062069	Ga0207657_100620692	150
1376	3300025920	Ga0207649_10122954	Ga0207649_101229542	150
1377	3300025923	Ga0207681_11504552	Ga0207681_115045521	150
1378	3300025932	Ga0207690_10187909	Ga0207690_101879092	150
1379	3300026041	Ga0207639_10051308	Ga0207639_100513082	150
1380	3300026067	Ga0207678_10563073	Ga0207678_105630732	150
1381	3300031239	Ga0265328_10000034	Ga0265328_1000003412	150
1382	3300031239	Ga0265328_10047051	Ga0265328_100470511	150
1383	3300031250	Ga0265331_10000024	Ga0265331_1000002466	150
1384	3300031251	Ga0265327_10000079	Ga0265327_10000079178	150
1385	3300031251	Ga0265327_10001928	Ga0265327_100019286	150
1386	3300031251	Ga0265327_10003163	Ga0265327_100031638	150
1387	3300031344	Ga0265316_10276769	Ga0265316_102767692	150
1388	3300039145	Ga0237816_00148	Ga0237816_00148_797_1276	150
1389	3300044658	Ga0466972_0000282	Ga0466972_0000282_9528_10022	150
1390	3300044765	Ga0466970_0025771	Ga0466970_0025771_361_855	150
1391	3300046519	Ga0495632_0055251	Ga0495632_0055251_114_584	150
1392	3300046660	Ga0495625_0609068	Ga0495625_0609068_25_510	150
1393	3300049568	Ga0501031_1003052	Ga0501031_1003052_31_504	150
1394	3300049569	Ga0501032_0125464	Ga0501032_0125464_1166_1639	150
1395	3300049571	Ga0501034_0199961	Ga0501034_0199961_1259_1732	150
1396	3300049572	Ga0501036_0820355	Ga0501036_0820355_224_697	150
1397	3300049573	Ga0501037_0013659	Ga0501037_0013659_561_1034	150
1398	3300049574	Ga0501038_0120063	Ga0501038_0120063_266_739	150
1399	3300049581	Ga0501047_0002537	Ga0501047_0002537_16136_16609	150
1400	3300049585	Ga0501069_0011816	Ga0501069_0011816_1735_2208	150
1401	3300049586	Ga0501070_0013166	Ga0501070_0013166_4932_5405	150
1402	3300049586	Ga0501070_0050947	Ga0501070_0050947_2886_3359	150
1403	3300049587	Ga0501071_0008835	Ga0501071_0008835_3965_4438	150
1404	3300049589	Ga0501073_0025636	Ga0501073_0025636_487_960	150
1405	3300049590	Ga0501074_0002091	Ga0501074_0002091_8972_9445	150
1406	3300049742	Ga0501080_0033654	Ga0501080_0033654_3266_3739	150
1407	3300049822	Ga0501035_0016682	Ga0501035_0016682_4222_4695	150
1408	3300049823	Ga0501044_0007417	Ga0501044_0007417_4503_4976	150
1409	3300050493	nmdc:mga0k408_92973_c1	nmdc:mga0k408_92973_c1_52_504	150
1410	3300050507	nmdc:mga05p37_1697299_c1	nmdc:mga05p37_1697299_c1_101_574	150
1411	3300053100	Ga0500660_124303	Ga0500660_124303_540_1010	150
1412	3300053142	Ga0500577_0347215	Ga0500577_0347215_19_489	150
1413	3300053146	Ga0500588_0033202	Ga0500588_0033202_660_1151	150
1414	3300053156	Ga0500622_0000002	Ga0500622_0000002_18755_19207	150
1415	3300053156	Ga0500622_0071964	Ga0500622_0071964_171_641	150
1416	3300001979	JGI24740J21852_10012529	JGI24740J21852_100125293	151
1417	3300005328	Ga0070676_10002509	Ga0070676_100025097	151
1418	3300005328	Ga0070676_10224705	Ga0070676_102247052	151
1419	3300005330	Ga0070690_100239905	Ga0070690_1002399052	151
1420	3300005331	Ga0070670_100024964	Ga0070670_1000249646	151
1421	3300005331	Ga0070670_100949901	Ga0070670_1009499012	151
1422	3300005333	Ga0070677_10006749	Ga0070677_100067494	151
1423	3300005333	Ga0070677_10012615	Ga0070677_100126152	151
1424	3300005333	Ga0070677_10017639	Ga0070677_100176393	151
1425	3300005333	Ga0070677_10092265	Ga0070677_100922651	151
1426	3300005334	Ga0068869_100012500	Ga0068869_1000125003	151
1427	3300005334	Ga0068869_100096147	Ga0068869_1000961472	151
1428	3300005335	Ga0070666_10241796	Ga0070666_102417962	151
1429	3300005338	Ga0068868_101493088	Ga0068868_1014930881	151
1430	3300005340	Ga0070689_101208455	Ga0070689_1012084551	151
1431	3300005343	Ga0070687_100107854	Ga0070687_1001078542	151
1432	3300005353	Ga0070669_100005882	Ga0070669_1000058824	151
1433	3300005353	Ga0070669_100153600	Ga0070669_1001536002	151
1434	3300005354	Ga0070675_100016158	Ga0070675_1000161583	151
1435	3300005354	Ga0070675_100025060	Ga0070675_1000250604	151
1436	3300005354	Ga0070675_100059825	Ga0070675_1000598252	151
1437	3300005354	Ga0070675_100129478	Ga0070675_1001294782	151
1438	3300005354	Ga0070675_100234314	Ga0070675_1002343142	151
1439	3300005354	Ga0070675_100605865	Ga0070675_1006058652	151
1440	3300005355	Ga0070671_100082092	Ga0070671_1000820923	151
1441	3300005355	Ga0070671_100119592	Ga0070671_1001195922	151
1442	3300005355	Ga0070671_100751456	Ga0070671_1007514562	151
1443	3300005356	Ga0070674_100009710	Ga0070674_1000097104	151
1444	3300005356	Ga0070674_100076188	Ga0070674_1000761882	151
1445	3300005356	Ga0070674_100803409	Ga0070674_1008034092	151
1446	3300005364	Ga0070673_100028271	Ga0070673_1000282712	151
1447	3300005364	Ga0070673_100319302	Ga0070673_1003193022	151
1448	3300005367	Ga0070667_100003988	Ga0070667_1000039888	151
1449	3300005367	Ga0070667_100857417	Ga0070667_1008574172	151
1450	3300005436	Ga0070713_100495254	Ga0070713_1004952542	151
1451	3300005441	Ga0070700_100054257	Ga0070700_1000542572	151
1452	3300005441	Ga0070700_100081321	Ga0070700_1000813212	151
1453	3300005455	Ga0070663_100003886	Ga0070663_1000038869	151
1454	3300005455	Ga0070663_101262511	Ga0070663_1012625111	151
1455	3300005456	Ga0070678_100087358	Ga0070678_1000873582	151
1456	3300005456	Ga0070678_100338210	Ga0070678_1003382102	151
1457	3300005456	Ga0070678_101284639	Ga0070678_1012846392	151
1458	3300005457	Ga0070662_100182623	Ga0070662_1001826232	151
1459	3300005459	Ga0068867_100038819	Ga0068867_1000388193	151
1460	3300005459	Ga0068867_100213688	Ga0068867_1002136882	151
1461	3300005466	Ga0070685_10111492	Ga0070685_101114921	151
1462	3300005543	Ga0070672_100029785	Ga0070672_1000297854	151
1463	3300005544	Ga0070686_100089925	Ga0070686_1000899252	151
1464	3300005544	Ga0070686_100533423	Ga0070686_1005334232	151
1465	3300005547	Ga0070693_100220427	Ga0070693_1002204272	151
1466	3300005563	Ga0068855_100039828	Ga0068855_1000398286	151
1467	3300005564	Ga0070664_100063541	Ga0070664_1000635413	151
1468	3300005614	Ga0068856_100012917	Ga0068856_1000129173	151
1469	3300005616	Ga0068852_100027821	Ga0068852_1000278213	151
1470	3300005616	Ga0068852_100044259	Ga0068852_1000442592	151
1471	3300005616	Ga0068852_100198851	Ga0068852_1001988512	151
1472	3300005617	Ga0068859_100032232	Ga0068859_1000322322	151
1473	3300005618	Ga0068864_100037250	Ga0068864_1000372502	151
1474	3300005618	Ga0068864_100115684	Ga0068864_1001156843	151
1475	3300005618	Ga0068864_101070786	Ga0068864_1010707862	151
1476	3300005718	Ga0068866_10002910	Ga0068866_100029104	151
1477	3300005719	Ga0068861_100003227	Ga0068861_10000322710	151
1478	3300005719	Ga0068861_100026530	Ga0068861_1000265304	151
1479	3300005834	Ga0068851_10065962	Ga0068851_100659622	151
1480	3300005840	Ga0068870_10012786	Ga0068870_100127865	151
1481	3300005841	Ga0068863_100044132	Ga0068863_1000441322	151
1482	3300005841	Ga0068863_100100578	Ga0068863_1001005782	151
1483	3300005841	Ga0068863_100206566	Ga0068863_1002065662	151
1484	3300005842	Ga0068858_100005749	Ga0068858_1000057494	151
1485	3300005842	Ga0068858_101045860	Ga0068858_1010458602	151
1486	3300005843	Ga0068860_100006843	Ga0068860_1000068439	151
1487	3300005844	Ga0068862_100023970	Ga0068862_1000239705	151
1488	3300005844	Ga0068862_100028761	Ga0068862_1000287613	151
1489	3300005937	Ga0081455_10004966	Ga0081455_1000496610	151
1490	3300006163	Ga0070715_10036873	Ga0070715_100368732	151
1491	3300006173	Ga0070716_100270348	Ga0070716_1002703482	151
1492	3300006237	Ga0097621_100016215	Ga0097621_1000162152	151
1493	3300006237	Ga0097621_100133582	Ga0097621_1001335822	151
1494	3300006237	Ga0097621_100207916	Ga0097621_1002079162	151
1495	3300006358	Ga0068871_100400827	Ga0068871_1004008272	151
1496	3300006358	Ga0068871_101192775	Ga0068871_1011927752	151
1497	3300006846	Ga0075430_100496766	Ga0075430_1004967662	151
1498	3300006881	Ga0068865_100010698	Ga0068865_1000106984	151
1499	3300006881	Ga0068865_100015466	Ga0068865_1000154666	151
1500	3300006881	Ga0068865_100418978	Ga0068865_1004189782	151
1501	3300006931	Ga0097620_100032233	Ga0097620_1000322332	151
1502	3300009093	Ga0105240_10034862	Ga0105240_100348622	151
1503	3300009093	Ga0105240_10041587	Ga0105240_100415872	151
1504	3300009094	Ga0111539_10322283	Ga0111539_103222832	151
1505	3300009094	Ga0111539_10558638	Ga0111539_105586382	151
1506	3300009147	Ga0114129_11031304	Ga0114129_110313042	151
1507	3300009148	Ga0105243_10068864	Ga0105243_100688642	151
1508	3300009176	Ga0105242_11152775	Ga0105242_111527751	151
1509	3300009177	Ga0105248_10064841	Ga0105248_100648413	151
1510	3300009177	Ga0105248_10130214	Ga0105248_101302143	151
1511	3300009177	Ga0105248_10387556	Ga0105248_103875562	151
1512	3300009177	Ga0105248_10958676	Ga0105248_109586761	151
1513	3300009545	Ga0105237_10105952	Ga0105237_101059523	151
1514	3300009545	Ga0105237_11091736	Ga0105237_110917362	151
1515	3300009551	Ga0105238_10018725	Ga0105238_100187257	151
1516	3300009553	Ga0105249_10044280	Ga0105249_100442804	151
1517	3300009553	Ga0105249_10104287	Ga0105249_101042872	151
1518	3300013102	Ga0157371_10650304	Ga0157371_106503042	151
1519	3300013104	Ga0157370_10438793	Ga0157370_104387932	151
1520	3300013296	Ga0157374_10125887	Ga0157374_101258873	151
1521	3300013297	Ga0157378_10308886	Ga0157378_103088862	151
1522	3300013306	Ga0163162_10025634	Ga0163162_100256343	151
1523	3300013306	Ga0163162_10086236	Ga0163162_100862363	151
1524	3300013307	Ga0157372_10743795	Ga0157372_107437952	151
1525	3300013308	Ga0157375_10018087	Ga0157375_100180878	151
1526	3300013308	Ga0157375_10019246	Ga0157375_100192463	151
1527	3300013308	Ga0157375_10261577	Ga0157375_102615772	151
1528	3300013308	Ga0157375_10308210	Ga0157375_103082101	151
1529	3300013308	Ga0157375_11075442	Ga0157375_110754422	151
1530	3300014325	Ga0163163_10098591	Ga0163163_100985913	151
1531	3300014325	Ga0163163_11979705	Ga0163163_119797052	151
1532	3300014326	Ga0157380_10048088	Ga0157380_100480883	151
1533	3300014326	Ga0157380_10062916	Ga0157380_100629162	151
1534	3300014326	Ga0157380_10069002	Ga0157380_100690022	151
1535	3300014326	Ga0157380_10148857	Ga0157380_101488572	151
1536	3300014326	Ga0157380_10202571	Ga0157380_102025712	151
1537	3300014326	Ga0157380_10205600	Ga0157380_102056002	151
1538	3300014326	Ga0157380_11222749	Ga0157380_112227492	151
1539	3300014745	Ga0157377_10521026	Ga0157377_105210262	151
1540	3300014968	Ga0157379_10091048	Ga0157379_100910484	151
1541	3300014969	Ga0157376_10285856	Ga0157376_102858563	151
1542	3300014969	Ga0157376_10374167	Ga0157376_103741672	151
1543	3300014969	Ga0157376_10420659	Ga0157376_104206592	151
1544	3300014969	Ga0157376_10556812	Ga0157376_105568122	151
1545	3300017792	Ga0163161_10041756	Ga0163161_100417562	151
1546	3300020081	Ga0206354_11363812	Ga0206354_113638122	151
1547	3300025893	Ga0207682_10001767	Ga0207682_1000176716	151
1548	3300025893	Ga0207682_10001984	Ga0207682_100019849	151
1549	3300025893	Ga0207682_10009729	Ga0207682_100097292	151
1550	3300025899	Ga0207642_10006842	Ga0207642_100068422	151
1551	3300025899	Ga0207642_10080122	Ga0207642_100801223	151
1552	3300025903	Ga0207680_10024370	Ga0207680_100243703	151
1553	3300025907	Ga0207645_10012039	Ga0207645_100120394	151
1554	3300025907	Ga0207645_10032364	Ga0207645_100323642	151
1555	3300025908	Ga0207643_10003782	Ga0207643_100037829	151
1556	3300025908	Ga0207643_10028009	Ga0207643_100280093	151
1557	3300025912	Ga0207707_10176459	Ga0207707_101764592	151
1558	3300025913	Ga0207695_10065868	Ga0207695_100658684	151
1559	3300025914	Ga0207671_10040022	Ga0207671_100400223	151
1560	3300025914	Ga0207671_10788372	Ga0207671_107883722	151
1561	3300025917	Ga0207660_10095087	Ga0207660_100950872	151
1562	3300025918	Ga0207662_10142406	Ga0207662_101424062	151
1563	3300025923	Ga0207681_10000819	Ga0207681_1000081913	151
1564	3300025923	Ga0207681_10795349	Ga0207681_107953492	151
1565	3300025924	Ga0207694_10028662	Ga0207694_100286623	151
1566	3300025924	Ga0207694_10997260	Ga0207694_109972601	151
1567	3300025925	Ga0207650_10001268	Ga0207650_100012682	151
1568	3300025925	Ga0207650_10182010	Ga0207650_101820102	151
1569	3300025925	Ga0207650_11165107	Ga0207650_111651072	151
1570	3300025926	Ga0207659_10038727	Ga0207659_100387274	151
1571	3300025926	Ga0207659_10507491	Ga0207659_105074912	151
1572	3300025926	Ga0207659_10827396	Ga0207659_108273962	151
1573	3300025927	Ga0207687_10524916	Ga0207687_105249162	151
1574	3300025928	Ga0207700_10387519	Ga0207700_103875192	151
1575	3300025931	Ga0207644_10004489	Ga0207644_100044896	151
1576	3300025931	Ga0207644_11029242	Ga0207644_110292422	151
1577	3300025933	Ga0207706_10032086	Ga0207706_100320862	151
1578	3300025933	Ga0207706_10822153	Ga0207706_108221531	151
1579	3300025934	Ga0207686_10173253	Ga0207686_101732532	151
1580	3300025934	Ga0207686_10246698	Ga0207686_102466982	151
1581	3300025934	Ga0207686_10390103	Ga0207686_103901032	151
1582	3300025935	Ga0207709_10010988	Ga0207709_100109884	151
1583	3300025937	Ga0207669_10003846	Ga0207669_100038462	151
1584	3300025937	Ga0207669_10010270	Ga0207669_100102702	151
1585	3300025937	Ga0207669_10085268	Ga0207669_100852682	151
1586	3300025937	Ga0207669_10615124	Ga0207669_106151242	151
1587	3300025938	Ga0207704_10006026	Ga0207704_100060262	151
1588	3300025938	Ga0207704_10014210	Ga0207704_100142102	151
1589	3300025938	Ga0207704_10681021	Ga0207704_106810212	151
1590	3300025938	Ga0207704_11373056	Ga0207704_113730561	151
1591	3300025940	Ga0207691_10012709	Ga0207691_100127095	151
1592	3300025940	Ga0207691_10022785	Ga0207691_100227852	151
1593	3300025940	Ga0207691_10035543	Ga0207691_100355432	151
1594	3300025940	Ga0207691_10222012	Ga0207691_102220123	151
1595	3300025940	Ga0207691_10419274	Ga0207691_104192742	151
1596	3300025940	Ga0207691_10632706	Ga0207691_106327062	151
1597	3300025940	Ga0207691_10717664	Ga0207691_107176642	151
1598	3300025941	Ga0207711_10049870	Ga0207711_100498702	151
1599	3300025941	Ga0207711_10154234	Ga0207711_101542342	151
1600	3300025942	Ga0207689_10006291	Ga0207689_100062914	151
1601	3300025942	Ga0207689_10026446	Ga0207689_100264463	151
1602	3300025942	Ga0207689_10479955	Ga0207689_104799552	151
1603	3300025944	Ga0207661_10034192	Ga0207661_100341925	151
1604	3300025944	Ga0207661_11098916	Ga0207661_110989161	151
1605	3300025945	Ga0207679_11330367	Ga0207679_113303671	151
1606	3300025949	Ga0207667_10002059	Ga0207667_100020594	151
1607	3300025960	Ga0207651_10271290	Ga0207651_102712902	151
1608	3300025960	Ga0207651_10897019	Ga0207651_108970192	151
1609	3300025961	Ga0207712_10014803	Ga0207712_100148033	151
1610	3300025961	Ga0207712_10793933	Ga0207712_107939332	151
1611	3300025972	Ga0207668_10001789	Ga0207668_1000178911	151
1612	3300025986	Ga0207658_10000336	Ga0207658_1000033628	151
1613	3300025986	Ga0207658_10492893	Ga0207658_104928932	151
1614	3300026023	Ga0207677_10376693	Ga0207677_103766932	151
1615	3300026023	Ga0207677_10948795	Ga0207677_109487951	151
1616	3300026035	Ga0207703_10000866	Ga0207703_1000086623	151
1617	3300026067	Ga0207678_10009214	Ga0207678_100092149	151
1618	3300026067	Ga0207678_10253384	Ga0207678_102533842	151
1619	3300026075	Ga0207708_10104075	Ga0207708_101040752	151
1620	3300026078	Ga0207702_10117957	Ga0207702_101179572	151
1621	3300026078	Ga0207702_10871672	Ga0207702_108716722	151
1622	3300026088	Ga0207641_10007781	Ga0207641_100077819	151
1623	3300026088	Ga0207641_10269052	Ga0207641_102690522	151
1624	3300026089	Ga0207648_10015267	Ga0207648_100152672	151
1625	3300026089	Ga0207648_10147787	Ga0207648_101477872	151
1626	3300026089	Ga0207648_10234269	Ga0207648_102342692	151
1627	3300026089	Ga0207648_10428686	Ga0207648_104286862	151
1628	3300026095	Ga0207676_10028849	Ga0207676_100288492	151
1629	3300026095	Ga0207676_10089162	Ga0207676_100891623	151
1630	3300026095	Ga0207676_10318130	Ga0207676_103181302	151
1631	3300026118	Ga0207675_100004491	Ga0207675_1000044919	151
1632	3300026118	Ga0207675_100007449	Ga0207675_1000074493	151
1633	3300026118	Ga0207675_100789046	Ga0207675_1007890461	151
1634	3300026121	Ga0207683_10063497	Ga0207683_100634971	151
1635	3300026121	Ga0207683_10069534	Ga0207683_100695341	151
1636	3300026121	Ga0207683_10102073	Ga0207683_101020732	151
1637	3300026121	Ga0207683_10177091	Ga0207683_101770912	151
1638	3300026121	Ga0207683_10241812	Ga0207683_102418122	151
1639	3300026121	Ga0207683_10465256	Ga0207683_104652562	151
1640	3300026142	Ga0207698_10031774	Ga0207698_100317742	151
1641	3300026142	Ga0207698_10057062	Ga0207698_100570622	151
1642	3300026142	Ga0207698_10218218	Ga0207698_102182182	151
1643	3300026142	Ga0207698_10356318	Ga0207698_103563182	151
1644	3300028379	Ga0268266_10422883	Ga0268266_104228832	151
1645	3300028380	Ga0268265_10096117	Ga0268265_100961172	151
1646	3300028380	Ga0268265_12360000	Ga0268265_123600001	151
1647	3300028381	Ga0268264_10003687	Ga0268264_100036879	151
1648	3300028381	Ga0268264_10610115	Ga0268264_106101152	151
1649	3300028794	Ga0307515_10601201	Ga0307515_106012011	151
1650	3300030500	Ga0268256_1046721	Ga0268256_10467212	151
1651	3300031247	Ga0265340_10053639	Ga0265340_100536392	151
1652	3300031456	Ga0307513_10006568	Ga0307513_1000656811	151
1653	3300031456	Ga0307513_10044622	Ga0307513_100446222	151
1654	3300031456	Ga0307513_10044801	Ga0307513_100448014	151
1655	3300031548	Ga0307408_100378949	Ga0307408_1003789491	151
1656	3300031727	Ga0316576_10062960	Ga0316576_100629603	151
1657	3300031733	Ga0316577_10028286	Ga0316577_100282862	151
1658	3300031995	Ga0307409_100399816	Ga0307409_1003998162	151
1659	3300031995	Ga0307409_100539592	Ga0307409_1005395922	151
1660	3300032002	Ga0307416_100909977	Ga0307416_1009099771	151
1661	3300032004	Ga0307414_11417309	Ga0307414_114173091	151
1662	3300032126	Ga0307415_100339325	Ga0307415_1003393252	151
1663	3300035113	Ga0373936_0108705	Ga0373936_0108705_424_897	151
1664	3300035398	Ga0316574_0106501	Ga0316574_0106501_209_694	151
1665	3300035410	Ga0373924_0166644	Ga0373924_0166644_429_902	151
1666	3300035410	Ga0373924_0194584	Ga0373924_0194584_97_588	151
1667	3300036401	Ga0373937_0150570	Ga0373937_0150570_1542_2015	151
1668	3300036647	Ga0316582_0001870	Ga0316582_0001870_7555_8031	151
1669	3300037068	Ga0373925_0100843	Ga0373925_0100843_372_845	151
1670	3300041441	Ga0451787_664484	Ga0451787_664484_529_1026	151
1671	3300041451	Ga0451791_0533597	Ga0451791_0533597_1208_1705	151
1672	3300041453	Ga0451797_1287132	Ga0451797_1287132_112_609	151
1673	3300041459	Ga0451800_1143563	Ga0451800_1143563_231_728	151
1674	3300041486	Ga0451807_1015374	Ga0451807_1015374_3672_4169	151
1675	3300041491	Ga0451833_1495386	Ga0451833_1495386_523_1020	151
1676	3300041494	Ga0451837_0954212	Ga0451837_0954212_1148_1645	151
1677	3300041512	Ga0451853_3865866	Ga0451853_3865866_74_544	151
1678	3300042002	Ga0439442_050139	Ga0439442_050139_93_578	151
1679	3300045051	Ga0451576_1084978	Ga0451576_1084978_227_697	151
1680	3300046459	Ga0495629_0107860	Ga0495629_0107860_42_515	151
1681	3300046460	Ga0495638_0060421	Ga0495638_0060421_885_1367	151
1682	3300046471	Ga0495650_0008829	Ga0495650_0008829_4878_5372	151
1683	3300046472	Ga0495580_0100343	Ga0495580_0100343_162_635	151
1684	3300046473	Ga0495582_0117472	Ga0495582_0117472_918_1385	151
1685	3300046473	Ga0495582_0355075	Ga0495582_0355075_272_745	151
1686	3300046500	Ga0495596_0116045	Ga0495596_0116045_546_1013	151
1687	3300046512	Ga0495610_0063754	Ga0495610_0063754_302_787	151
1688	3300046523	Ga0495644_0187454	Ga0495644_0187454_238_723	151
1689	3300046535	Ga0495586_0199579	Ga0495586_0199579_486_959	151
1690	3300046537	Ga0495598_0126453	Ga0495598_0126453_224_694	151
1691	3300046537	Ga0495598_0273086	Ga0495598_0273086_13_498	151
1692	3300046539	Ga0495621_0064902	Ga0495621_0064902_40_525	151
1693	3300046543	Ga0495645_0074164	Ga0495645_0074164_140_613	151
1694	3300046615	Ga0495656_0124763	Ga0495656_0124763_594_1079	151
1695	3300046616	Ga0495668_0603867	Ga0495668_0603867_17_502	151
1696	3300046660	Ga0495625_0010777	Ga0495625_0010777_6526_7008	151
1697	3300046663	Ga0495635_0115894	Ga0495635_0115894_87_560	151
1698	3300046683	Ga0495658_0263091	Ga0495658_0263091_313_804	151
1699	3300046794	Ga0495589_0272469	Ga0495589_0272469_166_636	151
1700	3300048903	Ga0496100_0832195	Ga0496100_0832195_26_493	151
1701	3300048907	Ga0496104_0085647	Ga0496104_0085647_2002_2511	151
1702	3300048911	Ga0496108_0543160	Ga0496108_0543160_188_655	151
1703	3300048912	Ga0496109_0592397	Ga0496109_0592397_61_528	151
1704	3300048913	Ga0496110_1333805	Ga0496110_1333805_41_508	151
1705	3300048917	Ga0496114_0028612	Ga0496114_0028612_2549_3058	151
1706	3300048917	Ga0496114_0061024	Ga0496114_0061024_1679_2149	151
1707	3300049522	Ga0501299_040320	Ga0501299_040320_156_644	151
1708	3300049571	Ga0501034_0364902	Ga0501034_0364902_779_1276	151
1709	3300049581	Ga0501047_0625024	Ga0501047_0625024_205_702	151
1710	3300050509	nmdc:mga0qj67_639730_c1	nmdc:mga0qj67_639730_c1_239_727	151
1711	3300050510	nmdc:mga06r32_77840_c1	nmdc:mga06r32_77840_c1_2457_2945	151
1712	3300050511	nmdc:mga08y16_304961_c1	nmdc:mga08y16_304961_c1_1131_1619	151
1713	3300053077	Ga0495601_0448656	Ga0495601_0448656_41_514	151
1714	3300053078	Ga0495612_0040355	Ga0495612_0040355_664_1137	151
1715	3300053085	Ga0495619_0734208	Ga0495619_0734208_50_523	151
1716	3300053092	Ga0500583_0389368	Ga0500583_0389368_89_583	151
1717	3300053118	Ga0500594_0054739	Ga0500594_0054739_542_1033	151
1718	3300053131	Ga0500652_023494	Ga0500652_023494_461_952	151
1719	3300053134	Ga0500658_0015441	Ga0500658_0015441_1622_2092	151
1720	3300053134	Ga0500658_0074183	Ga0500658_0074183_352_837	151
1721	3300053139	Ga0500568_0016548	Ga0500568_0016548_2566_3066	151
1722	3300053139	Ga0500568_0027522	Ga0500568_0027522_769_1260	151
1723	3300053156	Ga0500622_0007550	Ga0500622_0007550_2654_3142	151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

15

158

0.88 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4lhr-assembly1.cif.gz_A	crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis	0.9693	2	135
4lhr-assembly1.cif.gz_A	crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis	0.9623	2	135
1dup-assembly1.cif.gz_A	deoxyuridine 5'-triphosphate nucleotido hydrolase (d-utpase)	0.9611	2	135
1rnj-assembly1.cif.gz_A	crystal structure of inactive mutant dutpase complexed with substrate analogue imido-dutp	0.9586	2	135
6mai-assembly1.cif.gz_A	crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1	0.9553	3	137

ID	Description	Score	Start	End	Superfamily
3tqzA00	Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase)	0.9468	3	137	2.70.40.10
1snfC00	Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase)	0.9402	3	135	2.70.40.10
3tqzA00	Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase)	0.9334	3	137	2.70.40.10
1snfC00	Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase)	0.9332	3	135	2.70.40.10
3mbqA00	Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase)	0.9118	3	136	2.70.40.10

ID	Description	Score	Start	End	GO Terms
AF-A0A259EVG0-F1-model_v4	dUTP diphosphatase (EC 3.6.1.23)	0.9941	5	118	GO:0000287 GO:0004170 GO:0006226 GO:0046081
AF-A0A534E2N6-F1-model_v4	deleted	0.9899	19	118
AF-A0A661CKF5-F1-model_v4	dUTP diphosphatase (EC 3.6.1.23)	0.9846	3	126	GO:0000287 GO:0004170 GO:0006226 GO:0046081
AF-A0A356SLM4-F1-model_v4	deleted	0.9808	2	135
AF-A0A447QL67-F1-model_v4	dUTP diphosphatase (EC 3.6.1.23)	0.9788	2	122	GO:0000287 GO:0004170 GO:0006226 GO:0046081

Feature Viewer

pLDDT	pTM	Quality
88.99	0.79	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495478

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00692

dUTPase

dUTPase

15

158

0.88

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map