metagRoot

F495346

General Info

Members	Datasets	Scaffolds	Average Seq Length
1689	705	1458	341

Family's Representative Sequence

Representative Sequence	3300044673\|Ga0453683_0019366\|Ga0453683_0019366_2188_3198
Length	336
Sequence	MTQKRKIRIMDTTLRDGSHSVRHQYGADHVAKIAAALAKARIDTIEVTHGDGLGGSSIQYGFGKLSDQELLQAAKPVIGNSKLAVLLLPGIGIKEDLEMAYREGARVARIATHVTEADISAQHIELAKKIGMEVVGFLMLAHMVDPPKVLEQAKLMESYGADVVYVVDSAGAMVPDHVKSRVSPLVNQLKIKTGFHAHNNLGLAIGNTLAAIEEGVDVVDGSLAGMGAGAGNTPTEVLVAVLDKMGYETGVDLYAIMDAAEDVVRPLMQRPQVIDKAALSIGYAGVYSSFLLHTAKAAEKYKLDPRDILIELGKRKVVGGQEDMIVDVALELTRVR

Samples

	Sample ID	Description	Type	Environment
1	2506783011	Frankia datiscae Dg1	Isolate	Nodule
2	2508501039	Frankia saprophytica CN3	Isolate	Nodule
3	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
4	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
5	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
6	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
7	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
8	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
9	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
10	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
11	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
12	2513237151	Burkholderia sp. WSM2230	Isolate	Nodule
13	2515154123	Trinickia symbiotica JPY347	Isolate	Nodule
14	2515154189	Paraburkholderia nodosa DSM 21604	Isolate	Unclassified
15	2517572101	Frankia sp. DC12	Isolate	Nodule
16	2524023250	Niveispirillum irakense DSM 11586	Isolate	Unclassified
17	2547132103	Chromobacterium sp. C-61	Isolate	Rhizosphere
18	2547132424	Nocardia nova SH22a	Isolate	Unclassified
19	2558860280	Kutzneria sp. 744	Isolate	Unclassified
20	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
21	2565956761	Rhodococcus qingshengii BKS 20-40	Isolate	Rhizosphere
22	2582581314	Streptomyces mirabilis YR139	Isolate	Rhizosphere
23	2585428157	Microbacterium sp. CF335	Isolate	Rhizosphere
24	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
25	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
26	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
27	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
28	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
29	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
30	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
31	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
32	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
33	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
34	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
35	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
36	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
37	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
38	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
39	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
40	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
41	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
42	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
43	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
44	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
45	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
46	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
47	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
48	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
49	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
50	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
51	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
52	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
53	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
54	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
55	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
56	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
57	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
58	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
59	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
60	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
61	2616644941	Streptomyces atratus OK807	Isolate	Rhizosphere
62	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
63	2622736605	Geodermatophilus ruber DSM 45317	Isolate	Rhizosphere
64	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
65	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
66	2643221549	Agromyces sp. Root1464	Isolate	Unclassified
67	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
68	2643221561	Nocardioides sp. Root151	Isolate	Unclassified
69	2643221566	Microbacterium sp. Root166	Isolate	Unclassified
70	2643221578	Streptomyces sp. Root63	Isolate	Unclassified
71	2643221598	Phenylobacterium sp. Root700	Isolate	Unclassified
72	2643221604	Nocardioides sp. Root190	Isolate	Unclassified
73	2643221605	Sphingomonas sp. Root710	Isolate	Unclassified
74	2643221615	Nocardioides sp. Root224	Isolate	Unclassified
75	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
76	2643221630	Microbacterium sp. Root322	Isolate	Unclassified
77	2643221649	Leifsonia sp. Root4	Isolate	Unclassified
78	2643221657	Nocardioides sp. Root1257	Isolate	Unclassified
79	2643221673	Streptomyces sp. Root1295	Isolate	Unclassified
80	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
81	2643221696	Nocardioides sp. Root140	Isolate	Unclassified
82	2675902999	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
83	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
84	2684623035	Frankia sp. NRRL B-16219	Isolate	Rhizosphere
85	2687453737	Frankia sp. BMG5.36	Isolate	Nodule
86	2687453743	Frankia colletiae Cc1.17	Isolate	Nodule
87	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
88	2721755702	Agromyces sp. AR33	Isolate	Rhizosphere
89	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
90	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
91	2738541272	Promicromonospora sp. AC04	Isolate	Unclassified
92	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
93	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
94	2738541307	Variovorax sp. GV008	Isolate	Unclassified
95	2738541308	Rhodococcus sp. OK551	Isolate	Unclassified
96	2738543005	Rhodococcus sp. OK519	Isolate	Unclassified
97	2738543011	Rhodococcus sp. OK611	Isolate	Unclassified
98	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
99	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
100	2738543034	Rhodococcus sp. OK269	Isolate	Unclassified
101	2744054611	Aldersonia kunmingensis DSM 45001	Isolate	Rhizosphere
102	2751185725	Microbispora sp. NRRL B-24597	Isolate	Unclassified
103	2751185792	Kitasatospora arboriphila NRRL B-24581	Isolate	Unclassified
104	2751185846	Paraburkholderia ribeironis STM 7296	Isolate	Unclassified
105	2751185897	Sphingomonas panacis DCY99	Isolate	Unclassified
106	2773857762	Nocardioides sp. SAI-095	Isolate	Unclassified
107	2773857921	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
108	2773857933	Frankia sp. BMG5.30	Isolate	Nodule
109	2775506735	Arthrobacter sp. S95 1704	Isolate	Unclassified
110	2775506925	Saccharopolyspora phatthalungensis NRRL B-24798	Isolate	Rhizosphere
111	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
112	2784746763	Streptomyces ossamyceticus SAI-001	Isolate	Unclassified
113	2786546132	Streptomyces sp. W SAI-097	Isolate	Unclassified
114	2791355137	Paraburkholderia piptadeniae STM7183	Isolate	Unclassified
115	2791355199
116	2808606359	Streptomyces sp. RJA2910	Isolate	Unclassified
117	2808606372	Agromyces sp. 23-23	Isolate	Unclassified
118	2808606418	Herbaspirillum sp. SJZ107	Isolate	Rhizosphere
119	2808606439	Nocardioides sp. SLBN-172	Isolate	Unclassified
120	2811994874	Nocardioides sp. SLBN-35	Isolate	Unclassified
121	2811994878	Nocardioides sp. SLBN-169	Isolate	Unclassified
122	2811994879	Streptomyces sp. 4-17	Isolate	Unclassified
123	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
124	2818991462	Terrabacter sp. 3264	Isolate	Rhizosphere
125	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
126	2843690924	Chromobacterium rhizoryzae JP2-74	Isolate	Rhizosphere
127	2852103415	Edaphovirga cremea DSM 105170	Isolate	Rhizosphere
128	2855386786	Nocardioides ferulae EGI 63112	Isolate	Unclassified
129	2858688981	Cupriavidus sp. UYMMa02A	Isolate	Unclassified
130	2862382967	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
131	2862574272	Streptomyces sp. AcE210	Isolate	Nodule
132	2863067949	Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2)	Isolate	Rhizosphere
133	2867346516	Streptomyces radicis AZ1-7	Isolate	Unclassified
134	2870628048	Microbacterium thalassium DSM 12511	Isolate	Rhizosphere
135	2873314349	Sphaerisporangium siamense DSM 45784	Isolate	Rhizosphere
136	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
137	2877676314	Streptomyces griseorubiginosus 3E-1	Isolate	Unclassified
138	2881101125	Ramlibacter rhizophilus CCTCC AB2015357	Isolate	Rhizosphere
139	2885266251	Ralstonia sp. SET104	Isolate	Nodule
140	2889300758	Rhodococcus sp. PvR099	Isolate	Rhizosphere
141	2891048133	Martelella lutilitoris GH2-6	Isolate	Rhizosphere
142	2891968417	Nocardioides luteus SAI-037	Isolate	Unclassified
143	2895427314	Nonomuraea sp. PA05	Isolate	Unclassified
144	2895880812	Frankia sp. BMG5.11	Isolate	Unclassified
145	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
146	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
147	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
148	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
149	2904535858	Rhodococcus erythropolis 2017	Isolate	Unclassified
150	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
151	2904615490	Paraburkholderia franconis CNPSo 3157	Isolate	Unclassified
152	2904765812	Rhodococcus fascians 1590	Isolate	Rhizosphere
153	2904770941	Rhodococcus fascians 1339	Isolate	Rhizosphere
154	2908811453	Rhodococcus sp. 1R11	Isolate	Unclassified
155	2912723979	Streptomyces sp. NEAU-sy36	Isolate	Rhizosphere
156	2915358134	Pseudonocardia pini CAP47R	Isolate	Unclassified
157	2919051321	Sinomonas atrocyanea 1003	Isolate	Rhizosphere
158	2919138771	Novosphingobium sp. 1748	Isolate	Rhizosphere
159	2919155634	Pseudomonas fulva 1992	Isolate	Unclassified
160	2919420072	Rhodococcus fascians 3241	Isolate	Rhizosphere
161	2919432681	Rhodococcus sp. 3258	Isolate	Rhizosphere
162	2919713450	Nocardia kruczakiae 4272	Isolate	Rhizosphere
163	2922554459	Rhodococcus sp. 66b	Isolate	Unclassified
164	2928142448	Prescottella equi DPS 2018	Isolate	Unclassified
165	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
166	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
167	2935390628	Streptomyces sp. PvR034	Isolate	Rhizosphere
168	2935409751	Agromyces sp. PvR057	Isolate	Rhizosphere
169	2939573065	Citrobacter sp. 506	Isolate	Rhizosphere
170	2939674588	Arthrobacter bambusae 3552	Isolate	Rhizosphere
171	2939743619	Rhodococcus sp. PvR044	Isolate	Rhizosphere
172	2941485952	Brevundimonas faecalis 2814	Isolate	Rhizosphere
173	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
174	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
175	2946072368	Streptomyces achromogenes W4I19-2	Isolate	Rhizosphere
176	2954673503	Streptomyces sp. SAI-119	Isolate	Rhizosphere
177	2954682443	Streptomyces sp. SAI-149	Isolate	Rhizosphere
178	2954711539	Streptomyces sp. SAI-090	Isolate	Rhizosphere
179	2954721474	Streptomyces sp. SAI-117	Isolate	Rhizosphere
180	2954731030	Streptomyces sp. SAI-133	Isolate	Rhizosphere
181	2954740390	Streptomyces sp. SAI-041	Isolate	Rhizosphere
182	2954749733	Streptomyces sp. SAI-135	Isolate	Rhizosphere
183	2954759201	Streptomyces sp. SAI-208	Isolate	Rhizosphere
184	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
185	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
186	2984576629	Nocardioides zeae SORGH_AS913	Isolate	Aerial Root
187	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
188	2990059506	Streptomyces sp. CAP261	Isolate	Unclassified
189	2990256926	Nocardioides zeae SORGH_AS885	Isolate	Aerial Root
190	3002998708	Actinomadura barringtoniae GKU 128	Isolate	Unclassified
191	3006493962	Streptomyces grisecoloratus TRM S81-3	Isolate	Rhizosphere
192	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
193	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
194	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
195	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
196	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
197	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
198	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
199	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
200	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
201	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
202	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
203	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
204	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
205	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
206	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
207	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
208	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
209	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
210	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
211	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
212	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
213	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
214	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
215	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
216	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
217	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
218	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
219	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
220	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
221	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
222	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
223	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
224	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
225	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
226	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
227	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
228	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
229	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
230	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
231	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
232	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
233	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
234	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
235	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
236	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
237	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
238	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
239	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
240	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
241	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
242	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
243	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
244	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
245	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
246	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
247	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
248	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
249	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
250	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
251	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
252	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
253	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
254	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
255	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
256	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
257	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
258	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
259	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
260	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
261	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
262	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
263	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
264	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
265	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
266	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
267	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
268	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
269	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
270	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
271	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
272	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
273	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
274	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
275	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
276	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
277	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
278	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
279	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
280	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
281	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
282	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
283	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
284	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
285	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
286	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
287	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
288	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
289	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
290	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
291	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
292	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
293	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
294	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
295	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
296	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
297	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
298	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
299	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
300	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
301	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
302	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
303	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
304	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
305	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
306	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
307	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
308	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
309	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
310	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
311	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
312	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
313	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
314	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
315	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
316	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
317	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
318	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
319	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
320	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
321	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
322	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
323	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
324	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
325	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
326	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
327	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
328	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
329	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
330	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
331	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
332	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
333	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
334	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
335	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
336	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
337	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
338	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
391	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
393	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
394	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
395	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
399	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
400	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
401	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
402	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
403	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
404	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
405	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
406	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
407	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
408	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
409	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
410	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
411	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
412	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
413	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
414	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
415	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
416	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
417	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
418	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
419	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
420	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
421	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
422	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
423	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
424	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
425	3300033545	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4	Metagenome	Unclassified
426	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
427	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
428	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
429	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
430	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
431	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
432	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
433	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
434	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
435	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
436	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
437	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
438	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
439	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
440	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
441	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
442	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
443	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
444	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
445	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
446	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
447	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
448	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
449	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
450	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
451	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
452	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
453	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
454	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
455	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
456	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
457	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
458	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
459	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
460	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
461	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
462	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
463	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
464	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
465	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
466	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
467	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
468	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
469	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
470	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
471	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
472	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
473	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
474	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
475	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
476	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
477	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
478	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
479	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
480	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
481	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
482	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
483	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
484	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
485	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
486	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
487	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
488	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
489	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
490	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
491	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
492	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
493	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
494	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
495	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
496	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
497	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
498	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
499	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
500	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
501	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
502	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
503	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
504	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
505	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
506	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
507	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
508	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
509	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
510	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
511	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
512	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
513	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
514	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
515	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
516	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
517	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
518	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
519	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
520	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
521	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
522	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
523	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
524	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
525	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
526	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
527	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
528	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
529	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
530	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
531	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
532	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
533	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
534	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
535	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
536	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
537	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
538	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
539	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
540	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
541	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
542	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
543	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
544	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
545	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
546	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
547	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
548	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
549	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
550	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
551	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
552	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
553	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
554	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
555	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
556	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
557	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
558	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
559	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
560	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
561	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
562	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
563	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
564	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
565	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
566	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
567	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
568	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
569	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
570	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
571	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
572	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
573	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
574	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
575	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
576	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
577	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
578	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
579	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
580	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
581	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
582	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
583	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
584	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
585	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
586	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
587	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
588	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
589	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
590	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
591	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
592	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
593	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
594	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
595	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
596	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
597	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
598	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
599	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
600	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
601	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
602	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
603	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
604	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
605	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
606	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
607	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
608	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
609	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
610	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
611	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
612	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
613	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
614	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
615	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
616	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
617	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
618	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
619	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
620	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
621	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
622	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
623	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
624	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
625	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
626	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
627	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
628	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
629	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
630	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
631	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
632	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
633	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
634	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
635	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
636	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
637	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
638	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
639	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
640	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
641	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
642	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
643	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
644	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
645	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
646	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
647	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
648	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
649	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
650	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
651	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
652	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
653	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
654	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
655	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
656	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
657	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
658	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
659	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
660	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
661	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
662	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
663	3300053100	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere	Metagenome	Endosphere
664	3300053101	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere	Metagenome	Endosphere
665	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
666	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
667	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
668	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
669	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
670	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
671	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
672	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
673	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
674	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
675	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
676	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
677	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
678	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
679	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
680	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
681	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
682	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
683	3300053734	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere	Metagenome	Endosphere
684	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
685	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
686	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
687	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
688	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
689	642555112	Paraburkholderia phymatum STM815	Isolate	Nodule
690	8002784119	Frankia sp. AgB1.9	Isolate	Nodule
691	8004212874	Microbacterium sp. NC79	Isolate	Rhizosphere
692	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
693	8008558824	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
694	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
695	8033684223	Streptomyces phytophilus PIP175	Isolate	Unclassified
696	8047710418	Umezawaea endophytica DSM 103496	Isolate	Unclassified
697	8048356638	Streptomyces rhizosphaericus DSM 41760	Isolate	Rhizosphere
698	8048369669	Streptomyces indonesiensis DSM 41759	Isolate	Rhizoplane
699	8048379754	Streptomyces asiaticus DSM 41761	Isolate	Rhizosphere
700	8048406513	Streptomyces heilongjiangensis NEAU-W2	Isolate	Unclassified
701	8048746797	Alcaligenes endophyticus DSM 100498	Isolate	Unclassified
702	8054002106	Azospirillum lipoferum 59b	Isolate	Unclassified
703	8054609563	Nocardioides astragali CGMCC 4.7327	Isolate	Nodule
704	8055878733	Pseudomonas palmensis BBB001	Isolate	Rhizosphere
705	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	86.08
Metatranscriptomes	0.18
Isolates	13.74

Biome Distribution

Category	Percentage (%)
Aerial Root	0.24
Bulb	0
Endosphere	8.41
Nodule	2.25
Rhizoplane	5.33
Rhizosphere	71.94
Stem	0
Stem Tuber	0
Unclassified	11.84

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJQas_1006075	3300000549	Bacteria	1512
2	JGI24736J21556_1001110	3300001904	Bacteria	4918
3	JGI24741J21665_1000113	3300001915	Bacteria	21885
4	JGI24740J21852_10000711	3300001979	Bacteria	14441
5	JGI24740J21852_10002626	3300001979	Bacteria	8094
6	JGI24740J21852_10002683	3300001979	Bacteria	7986
7	JGI24740J21852_10004751	3300001979	Bacteria	5804
8	JGI24740J21852_10009903	3300001979	Bacteria	3700
9	JGI24739J22299_10004028	3300001989	Bacteria	5620
10	JGI24739J22299_10004360	3300001989	Bacteria	5420
11	JGI24739J22299_10014764	3300001989	Bacteria	2840
12	JGI24737J22298_10007873	3300001990	Bacteria	3589
13	JGI24737J22298_10013837	3300001990	Bacteria	2624
14	JGI24735J21928_10011021	3300002067	Bacteria	2871
15	JGI24735J21928_10017697	3300002067	Bacteria	2202
16	JGI24750J21931_1002100	3300002070	Bacteria	2422
17	JGI24745J21846_1001283	3300002073	Bacteria	2427
18	JGI24738J21930_10000132	3300002075	Bacteria	18200
19	JGI24738J21930_10004974	3300002075	Bacteria	3217
20	JGI24749J21850_1004251	3300002076	Bacteria	2001
21	JGI24749J21850_1006511	3300002076	Bacteria	1627
22	JGI24744J21845_10000214	3300002077	Bacteria	9078
23	JGI24742J22300_10000517	3300002244	Bacteria	5750
24	JGI24751J29686_10012933	3300002459	Bacteria	1723
25	JGI24751J29686_10017101	3300002459	Bacteria	1498
26	JGI25154J39366_1000680	3300002738	Bacteria	15719
27	JGI25151J46595_10006212	3300003187	Bacteria	6044
28	JGI25406J46586_10004639	3300003203	Bacteria	6397
29	rootH1_10005611	3300003316	Bacteria	17859
30	rootH1_10005611	3300003323	Bacteria	26216
31	rootL2_10011255	3300003322	Bacteria	1538
32	rootL2_10024094	3300003322	Bacteria	17301
33	rootH1_10007244	3300003316	Bacteria	1760
34	rootH1_10007244	3300003323	Bacteria	12965
35	rootH1_10018354	3300003323	Bacteria	16678
36	Ga0006562J51391_1047977	3300003578	Bacteria	3722
37	Ga0006562J51391_1047978	3300003578	Bacteria	3020
38	Ga0055534_1008400	3300003784	Bacteria	2341
39	Ga0055530_10000093	3300003791	Bacteria	77624
40	Ga0055530_10000104	3300003791	Bacteria	72163
41	Ga0055530_10006899	3300003791	Bacteria	4921
42	Ga0055530_10013286	3300003791	Bacteria	2818
43	Ga0055540_1000104	3300003792	Bacteria	93795
44	Ga0055540_1000335	3300003792	Bacteria	40623
45	Ga0055540_1000374	3300003792	Bacteria	37462
46	Ga0055531_10000432	3300003794	Bacteria	39735
47	Ga0055531_10000475	3300003794	Bacteria	37156
48	Ga0055531_10000798	3300003794	Bacteria	26114
49	Ga0065714_10002253	3300005288	Bacteria	35579
50	Ga0065714_10002318	3300005288	Bacteria	24919
51	Ga0065714_10071256	3300005288	Bacteria	3624
52	Ga0065714_10072687	3300005288	Bacteria	3324
53	Ga0065707_10158656	3300005295	Bacteria	1584
54	Ga0070658_10002591	3300005327	Bacteria	15066
55	Ga0070658_10006024	3300005327	Bacteria	9839
56	Ga0070658_10085040	3300005327	Bacteria	2601
57	Ga0070683_100058031	3300005329	Bacteria	3596
58	Ga0070670_100035314	3300005331	Bacteria	4304
59	Ga0068869_100058671	3300005334	Bacteria	2815
60	Ga0070666_10038372	3300005335	Bacteria	3187
61	Ga0070680_100089435	3300005336	Bacteria	2548
62	Ga0070682_100177234	3300005337	Bacteria	1486
63	Ga0068868_100096800	3300005338	Bacteria	2384
64	Ga0068868_100211149	3300005338	Bacteria	1622
65	Ga0070660_100019900	3300005339	Bacteria	4925
66	Ga0070660_100068276	3300005339	Bacteria	2770
67	Ga0070687_100036621	3300005343	Bacteria	2446
68	Ga0070661_100017643	3300005344	Bacteria	5065
69	Ga0070661_100037246	3300005344	Bacteria	3538
70	Ga0070692_10040316	3300005345	Bacteria	2388
71	Ga0070668_100012270	3300005347	Bacteria	6384
72	Ga0070668_100298556	3300005347	Bacteria	1350
73	Ga0070669_100153879	3300005353	Bacteria	1782
74	Ga0070673_100066340	3300005364	Bacteria	2882
75	Ga0070659_100014358	3300005366	Bacteria	5917
76	Ga0070659_100016108	3300005366	Bacteria	5609
77	Ga0070659_100040971	3300005366	Bacteria	3619
78	Ga0070659_100097415	3300005366	Bacteria	2364
79	Ga0070667_100001179	3300005367	Bacteria	23784
80	Ga0070667_100143708	3300005367	Bacteria	2091
81	Ga0070667_100459785	3300005367	Bacteria	1164
82	Ga0070709_10013047	3300005434	Bacteria	4665
83	Ga0070709_10039557	3300005434	Bacteria	2894
84	Ga0070709_10074903	3300005434	Bacteria	2194
85	Ga0070714_100010158	3300005435	Bacteria	7430
86	Ga0070714_100061288	3300005435	Bacteria	3230
87	Ga0070714_100126052	3300005435	Bacteria	2283
88	Ga0070713_100086281	3300005436	Bacteria	2691
89	Ga0070713_100091314	3300005436	Bacteria	2620
90	Ga0070711_100017440	3300005439	Bacteria	4572
91	Ga0070711_100196943	3300005439	Bacteria	1552
92	Ga0070700_100233018	3300005441	Bacteria	1311
93	Ga0070708_100109310	3300005445	Bacteria	2540
94	Ga0070663_100001457	3300005455	Bacteria	12998
95	Ga0070663_100005366	3300005455	Bacteria	7611
96	Ga0070663_100171543	3300005455	Bacteria	1677
97	Ga0070662_100002546	3300005457	Bacteria	11224
98	Ga0070662_100040010	3300005457	Bacteria	3336
99	Ga0070662_100068871	3300005457	Bacteria	2603
100	Ga0070662_100109535	3300005457	Bacteria	2102
101	Ga0070662_100127245	3300005457	Bacteria	1960
102	Ga0070681_10023386	3300005458	Bacteria	6214
103	Ga0070706_100017747	3300005467	Bacteria	6567
104	Ga0070698_100024948	3300005471	Bacteria	6232
105	Ga0070698_100052415	3300005471	Bacteria	4150
106	Ga0070698_100094493	3300005471	Bacteria	2969
107	Ga0070679_100005894	3300005530	Bacteria	11386
108	Ga0070679_100389841	3300005530	Bacteria	1339
109	Ga0070679_100441610	3300005530	Bacteria	1246
110	Ga0070684_100042291	3300005535	Bacteria	3933
111	Ga0068853_100034643	3300005539	Bacteria	4286
112	Ga0068853_100094831	3300005539	Bacteria	2630
113	Ga0068853_100101111	3300005539	Bacteria	2549
114	Ga0068853_100120002	3300005539	Bacteria	2344
115	Ga0068853_100496487	3300005539	Bacteria	1152
116	Ga0070672_100240562	3300005543	Bacteria	1522
117	Ga0070686_100068812	3300005544	Bacteria	2310
118	Ga0070695_100022082	3300005545	Bacteria	3900
119	Ga0070665_100005167	3300005548	Bacteria	13507
120	Ga0070665_100096194	3300005548	Bacteria	2966
121	Ga0070665_100405076	3300005548	Bacteria	1372
122	Ga0070704_100052742	3300005549	Bacteria	2871
123	Ga0068855_100017817	3300005563	Bacteria	8538
124	Ga0068855_100073278	3300005563	Bacteria	3979
125	Ga0068855_100178472	3300005563	Bacteria	2402
126	Ga0068855_100639185	3300005563	Bacteria	1144
127	Ga0068857_100010913	3300005577	Bacteria	7908
128	Ga0068857_100070185	3300005577	Bacteria	3120
129	Ga0068854_100001955	3300005578	Bacteria	12590
130	Ga0068854_100010954	3300005578	Bacteria	5884
131	Ga0068854_100209882	3300005578	Bacteria	1535
132	Ga0068856_100001670	3300005614	Bacteria	23234
133	Ga0068856_100001903	3300005614	Bacteria	21771
134	Ga0068856_100004825	3300005614	Bacteria	13365
135	Ga0068856_100031379	3300005614	Bacteria	5198
136	Ga0068856_100124584	3300005614	Bacteria	2579
137	Ga0068852_100004005	3300005616	Bacteria	10362
138	Ga0068852_100010518	3300005616	Bacteria	6920
139	Ga0068852_100062126	3300005616	Bacteria	3248
140	Ga0068859_100062248	3300005617	Bacteria	3761
141	Ga0068859_100410724	3300005617	Bacteria	1450
142	Ga0068861_100162040	3300005719	Bacteria	1846
143	Ga0068851_10012360	3300005834	Bacteria	4023
144	Ga0068851_10014265	3300005834	Bacteria	3771
145	Ga0068851_10015819	3300005834	Bacteria	3600
146	Ga0068851_10046099	3300005834	Bacteria	2205
147	Ga0068863_100000884	3300005841	Bacteria	30131
148	Ga0068858_100000071	3300005842	Bacteria	105192
149	Ga0068858_100194908	3300005842	Bacteria	1914
150	Ga0068860_100002624	3300005843	Bacteria	18691
151	Ga0068862_100001916	3300005844	Bacteria	18895
152	Ga0068862_100081877	3300005844	Bacteria	2800
153	Ga0068862_100518719	3300005844	Bacteria	1134
154	Ga0081455_10000072	3300005937	Bacteria	108040
155	Ga0081455_10000942	3300005937	Bacteria	37176
156	Ga0081455_10049061	3300005937	Bacteria	3641
157	Ga0081455_10061316	3300005937	Bacteria	3165
158	Ga0081538_10005332	3300005981	Bacteria	11574
159	Ga0081540_1000803	3300005983	Bacteria	28862
160	Ga0081540_1056346	3300005983	Bacteria	1908
161	Ga0081540_1063790	3300005983	Bacteria	1742
162	Ga0081539_10000926	3300005985	Bacteria	55157
163	Ga0081539_10001862	3300005985	Bacteria	33219
164	Ga0081539_10002207	3300005985	Bacteria	28464
165	Ga0081539_10057026	3300005985	Bacteria	2164
166	Ga0081539_10102173	3300005985	Bacteria	1459
167	Ga0070717_10003368	3300006028	Bacteria	11417
168	Ga0075365_10000382	3300006038	Bacteria	16205
169	Ga0075365_10007998	3300006038	Bacteria	5968
170	Ga0075365_10009039	3300006038	Bacteria	5699
171	Ga0075365_10021267	3300006038	Bacteria	4044
172	Ga0075365_10024844	3300006038	Bacteria	3786
173	Ga0075365_10048223	3300006038	Bacteria	2803
174	Ga0075365_10240302	3300006038	Bacteria	1272
175	Ga0075368_10029108	3300006042	Bacteria	2135
176	Ga0075363_100019796	3300006048	Bacteria	3369
177	Ga0075363_100028448	3300006048	Bacteria	2875
178	Ga0075363_100033837	3300006048	Bacteria	2665
179	Ga0075363_100062426	3300006048	Bacteria	2009
180	Ga0075364_10001406	3300006051	Bacteria	13032
181	Ga0075364_10027911	3300006051	Bacteria	3609
182	Ga0075364_10033429	3300006051	Bacteria	3312
183	Ga0075364_10035089	3300006051	Bacteria	3240
184	Ga0075364_10050527	3300006051	Bacteria	2714
185	Ga0075364_10086976	3300006051	Bacteria	2071
186	Ga0075364_10137730	3300006051	Bacteria	1641
187	Ga0075432_10000250	3300006058	Bacteria	14598
188	Ga0075432_10064286	3300006058	Bacteria	1310
189	Ga0070715_10001319	3300006163	Bacteria	7149
190	Ga0070716_100002397	3300006173	Bacteria	8633
191	Ga0070712_100005544	3300006175	Bacteria	7809
192	Ga0070712_100022764	3300006175	Bacteria	4130
193	Ga0070712_100079503	3300006175	Bacteria	2370
194	Ga0075362_10000258	3300006177	Bacteria	14780
195	Ga0075362_10033344	3300006177	Bacteria	2239
196	Ga0075362_10037781	3300006177	Bacteria	2119
197	Ga0075362_10053428	3300006177	Bacteria	1813
198	Ga0075362_10094356	3300006177	Bacteria	1392
199	Ga0075367_10000249	3300006178	Bacteria	18331
200	Ga0075367_10000257	3300006178	Bacteria	18119
201	Ga0075367_10003322	3300006178	Bacteria	7637
202	Ga0075367_10053919	3300006178	Bacteria	2383
203	Ga0075367_10164293	3300006178	Bacteria	1381
204	Ga0075369_10003467	3300006186	Bacteria	5743
205	Ga0075369_10027436	3300006186	Bacteria	2380
206	Ga0075369_10051857	3300006186	Bacteria	1777
207	Ga0075369_10079529	3300006186	Bacteria	1452
208	Ga0075369_10083844	3300006186	Bacteria	1416
209	Ga0075366_10000691	3300006195	Bacteria	15970
210	Ga0075366_10002546	3300006195	Bacteria	9373
211	Ga0075366_10108758	3300006195	Bacteria	1667
212	Ga0075370_10000455	3300006353	Bacteria	15290
213	Ga0075370_10000589	3300006353	Bacteria	14025
214	Ga0075370_10000848	3300006353	Bacteria	12388
215	Ga0075370_10001354	3300006353	Bacteria	10555
216	Ga0075428_100000014	3300006844	Bacteria	166411
217	Ga0075430_100032200	3300006846	Bacteria	4451
218	Ga0075430_100090235	3300006846	Bacteria	2564
219	Ga0075430_100094610	3300006846	Bacteria	2498
220	Ga0075434_100010087	3300006871	Bacteria	8845
221	Ga0075434_100220638	3300006871	Bacteria	1916
222	Ga0075429_100203733	3300006880	Unclassified	1734
223	Ga0075436_100021640	3300006914	Bacteria	4414
224	Ga0097620_100062248	3300006931	Bacteria	3761
225	Ga0097620_100410757	3300006931	Bacteria	1450
226	Ga0079104_1002857	3300006946	Bacteria	8652
227	Ga0079104_1003799	3300006946	Bacteria	6791
228	Ga0079104_1023539	3300006946	Bacteria	1637
229	Ga0099826_10011905	3300006948	Bacteria	6553
230	Ga0075435_100015300	3300007076	Bacteria	5765
231	Ga0105251_10046942	3300009011	Bacteria	2076
232	Ga0105251_10066983	3300009011	Bacteria	1678
233	Ga0105244_10000488	3300009036	Bacteria	35867
234	Ga0105244_10009031	3300009036	Bacteria	6167
235	Ga0105244_10023365	3300009036	Bacteria	3390
236	Ga0105250_10000052	3300009092	Bacteria	116382
237	Ga0105250_10030697	3300009092	Bacteria	2160
238	Ga0105240_10001140	3300009093	Bacteria	46522
239	Ga0105240_10018798	3300009093	Bacteria	9258
240	Ga0105240_10021903	3300009093	Bacteria	8489
241	Ga0105240_10023949	3300009093	Bacteria	8064
242	Ga0105240_10076538	3300009093	Bacteria	4124
243	Ga0105240_10077435	3300009093	Bacteria	4097
244	Ga0105240_10086545	3300009093	Bacteria	3838
245	Ga0105240_10093850	3300009093	Bacteria	3662
246	Ga0105240_10100206	3300009093	Bacteria	3525
247	Ga0105240_10103573	3300009093	Bacteria	3457
248	Ga0105240_10144154	3300009093	Bacteria	2844
249	Ga0105240_10160150	3300009093	Bacteria	2674
250	Ga0105240_10326952	3300009093	Bacteria	1746
251	Ga0111539_10000019	3300009094	Bacteria	266927
252	Ga0111539_10275603	3300009094	Bacteria	1958
253	Ga0105245_10603499	3300009098	Bacteria	1124
254	Ga0114129_10019234	3300009147	Bacteria	9728
255	Ga0105243_10003676	3300009148	Bacteria	12326
256	Ga0105243_10013641	3300009148	Bacteria	6147
257	Ga0105243_10224913	3300009148	Bacteria	1661
258	Ga0105241_10000004	3300009174	Bacteria	803007
259	Ga0105241_10000897	3300009174	Bacteria	22503
260	Ga0105241_10004450	3300009174	Bacteria	10363
261	Ga0105241_10023205	3300009174	Bacteria	4599
262	Ga0105241_10103152	3300009174	Bacteria	2271
263	Ga0105241_10111705	3300009174	Bacteria	2188
264	Ga0105242_10128315	3300009176	Bacteria	2185
265	Ga0105248_10000450	3300009177	Bacteria	46809
266	Ga0105237_10000874	3300009545	Bacteria	40867
267	Ga0105237_10001013	3300009545	Bacteria	37790
268	Ga0105237_10001636	3300009545	Bacteria	29088
269	Ga0105237_10019441	3300009545	Bacteria	7014
270	Ga0105237_10028483	3300009545	Bacteria	5689
271	Ga0105237_10036578	3300009545	Bacteria	4969
272	Ga0105237_10042233	3300009545	Bacteria	4599
273	Ga0105237_10055888	3300009545	Bacteria	3952
274	Ga0105237_10168910	3300009545	Bacteria	2187
275	Ga0105237_10329919	3300009545	Bacteria	1530
276	Ga0105238_10000514	3300009551	Bacteria	40634
277	Ga0105238_10011534	3300009551	Bacteria	8903
278	Ga0105238_10019463	3300009551	Bacteria	6914
279	Ga0105238_10022891	3300009551	Bacteria	6369
280	Ga0105238_10030906	3300009551	Bacteria	5450
281	Ga0105238_10056949	3300009551	Bacteria	3920
282	Ga0105238_10159496	3300009551	Bacteria	2231
283	Ga0105238_10168284	3300009551	Bacteria	2168
284	Ga0105249_10000439	3300009553	Bacteria	39200
285	Ga0105249_10014870	3300009553	Bacteria	6883
286	Ga0105249_10019951	3300009553	Bacteria	5985
287	Ga0105249_10132765	3300009553	Bacteria	2379
288	Ga0105239_10000113	3300010375	Bacteria	114562
289	Ga0105239_10000626	3300010375	Bacteria	50329
290	Ga0105239_10001157	3300010375	Bacteria	36242
291	Ga0105239_10003283	3300010375	Bacteria	19951
292	Ga0105239_10006533	3300010375	Bacteria	13509
293	Ga0105239_10007549	3300010375	Bacteria	12474
294	Ga0105239_10011168	3300010375	Bacteria	10022
295	Ga0105239_10019695	3300010375	Bacteria	7447
296	Ga0105239_10021350	3300010375	Bacteria	7140
297	Ga0105239_10031465	3300010375	Bacteria	5835
298	Ga0105239_10037487	3300010375	Bacteria	5313
299	Ga0105239_10040307	3300010375	Bacteria	5117
300	Ga0105239_10153076	3300010375	Bacteria	2574
301	Ga0105239_10166869	3300010375	Bacteria	2462
302	Ga0105239_10360114	3300010375	Bacteria	1643
303	Ga0105246_10033362	3300011119	Bacteria	3422
304	Ga0105246_10062811	3300011119	Bacteria	2588
305	Ga0157373_10002444	3300013100	Bacteria	14139
306	Ga0157373_10004285	3300013100	Bacteria	10736
307	Ga0157371_10000776	3300013102	Bacteria	36737
308	Ga0157371_10006002	3300013102	Bacteria	10126
309	Ga0157370_10004423	3300013104	Bacteria	16103
310	Ga0157370_10009299	3300013104	Bacteria	10522
311	Ga0157370_10016479	3300013104	Bacteria	7479
312	Ga0157370_10017127	3300013104	Bacteria	7317
313	Ga0157369_10008980	3300013105	Bacteria	11450
314	Ga0157369_10073351	3300013105	Bacteria	3672
315	Ga0157369_10264853	3300013105	Bacteria	1792
316	Ga0157374_10142773	3300013296	Bacteria	2324
317	Ga0163162_10319926	3300013306	Bacteria	1684
318	Ga0157372_10002002	3300013307	Bacteria	22134
319	Ga0157372_10004609	3300013307	Bacteria	14656
320	Ga0157372_10021286	3300013307	Bacteria	7004
321	Ga0157372_10045106	3300013307	Bacteria	4888
322	Ga0157372_10653592	3300013307	Bacteria	1224
323	Ga0157375_10000312	3300013308	Bacteria	43933
324	Ga0157375_10107544	3300013308	Bacteria	2883
325	Ga0157375_10145300	3300013308	Bacteria	2502
326	Ga0163163_10000004	3300014325	Bacteria	416569
327	Ga0163163_10171930	3300014325	Bacteria	2213
328	Ga0163163_10300813	3300014325	Bacteria	1657
329	Ga0157380_10266818	3300014326	Bacteria	1558
330	Ga0157380_10339860	3300014326	Bacteria	1400
331	Ga0182008_10000353	3300014497	Bacteria	35789
332	Ga0182008_10001321	3300014497	Bacteria	16896
333	Ga0157379_10000015	3300014968	Bacteria	104289
334	Ga0157379_10000284	3300014968	Bacteria	40135
335	Ga0157379_10106140	3300014968	Bacteria	2521
336	Ga0157376_10044652	3300014969	Bacteria	3644
337	Ga0182006_1001200	3300015261	Bacteria	16189
338	Ga0163161_10000201	3300017792	Bacteria	54704
339	Ga0163161_10002299	3300017792	Bacteria	13707
340	Ga0163161_10018606	3300017792	Bacteria	4868
341	Ga0163161_10024418	3300017792	Bacteria	4270
342	Ga0163161_10048305	3300017792	Bacteria	3073
343	Ga0163161_10055743	3300017792	Bacteria	2869
344	Ga0206354_11589331	3300020081	Bacteria	1377
345	Ga0213872_10004853	3300021361	Bacteria	7016
346	Ga0209147_100156	3300025229	Bacteria	93105
347	Ga0209147_100430	3300025229	Bacteria	27091
348	Ga0209646_1000049	3300025246	Bacteria	301924
349	Ga0209673_1028864	3300025273	Bacteria	1778
350	Ga0209675_1000132	3300025291	Bacteria	102062
351	Ga0209676_1000118	3300025292	Bacteria	201939
352	Ga0209676_1000779	3300025292	Bacteria	42577
353	Ga0209676_1006141	3300025292	Bacteria	6023
354	Ga0209676_1035842	3300025292	Bacteria	1450
355	Ga0209025_1000029	3300025294	Bacteria	488571
356	Ga0209050_1000115	3300025298	Bacteria	204622
357	Ga0209050_1000148	3300025298	Bacteria	164093
358	Ga0209050_1000412	3300025298	Bacteria	79647
359	Ga0209050_1001181	3300025298	Bacteria	30804
360	Ga0207426_1006425	3300025302	Bacteria	5119
361	Ga0209051_1000150	3300025303	Bacteria	132005
362	Ga0209051_1000231	3300025303	Bacteria	93859
363	Ga0209051_1000294	3300025303	Bacteria	79686
364	Ga0209051_1005966	3300025303	Bacteria	6967
365	Ga0209051_1013164	3300025303	Bacteria	3953
366	Ga0209051_1045640	3300025303	Bacteria	1514
367	Ga0209257_1000160	3300025304	Bacteria	177175
368	Ga0209257_1000275	3300025304	Bacteria	116952
369	Ga0207656_10002772	3300025321	Bacteria	5949
370	Ga0207656_10010781	3300025321	Bacteria	3435
371	Ga0207696_1000003	3300025711	Bacteria	860639
372	Ga0207655_1000022	3300025728	Bacteria	483933
373	Ga0207655_1006740	3300025728	Bacteria	7561
374	Ga0207655_1022408	3300025728	Bacteria	3167
375	Ga0207655_1029269	3300025728	Bacteria	2581
376	Ga0207655_1035585	3300025728	Bacteria	2221
377	Ga0207713_1000093	3300025735	Bacteria	146199
378	Ga0207692_10023138	3300025898	Bacteria	2869
379	Ga0207642_10038024	3300025899	Bacteria	2079
380	Ga0207710_10039827	3300025900	Bacteria	2081
381	Ga0207688_10015128	3300025901	Bacteria	4185
382	Ga0207688_10016838	3300025901	Bacteria	3969
383	Ga0207680_10017843	3300025903	Bacteria	3758
384	Ga0207647_10001831	3300025904	Bacteria	16309
385	Ga0207647_10003420	3300025904	Bacteria	11902
386	Ga0207647_10015326	3300025904	Bacteria	5259
387	Ga0207647_10023664	3300025904	Bacteria	4059
388	Ga0207685_10014285	3300025905	Bacteria	2482
389	Ga0207699_10023992	3300025906	Bacteria	3328
390	Ga0207699_10024826	3300025906	Bacteria	3283
391	Ga0207699_10115784	3300025906	Bacteria	1725
392	Ga0207645_10006008	3300025907	Bacteria	8732
393	Ga0207643_10088240	3300025908	Bacteria	1805
394	Ga0207705_10008265	3300025909	Bacteria	7604
395	Ga0207705_10070773	3300025909	Bacteria	2528
396	Ga0207684_10055485	3300025910	Bacteria	3361
397	Ga0207654_10000006	3300025911	Bacteria	815027
398	Ga0207654_10000069	3300025911	Bacteria	67460
399	Ga0207654_10000383	3300025911	Bacteria	25754
400	Ga0207654_10006919	3300025911	Bacteria	5712
401	Ga0207654_10028403	3300025911	Bacteria	3049
402	Ga0207654_10045006	3300025911	Bacteria	2510
403	Ga0207707_10077753	3300025912	Bacteria	2897
404	Ga0207695_10000936	3300025913	Bacteria	52151
405	Ga0207695_10008781	3300025913	Bacteria	12600
406	Ga0207695_10008866	3300025913	Bacteria	12526
407	Ga0207695_10020466	3300025913	Bacteria	7576
408	Ga0207695_10032104	3300025913	Bacteria	5750
409	Ga0207695_10055228	3300025913	Bacteria	4140
410	Ga0207695_10056256	3300025913	Bacteria	4094
411	Ga0207695_10255339	3300025913	Bacteria	1652
412	Ga0207671_10000702	3300025914	Bacteria	43116
413	Ga0207671_10000759	3300025914	Bacteria	40972
414	Ga0207671_10001691	3300025914	Bacteria	24991
415	Ga0207671_10010953	3300025914	Bacteria	7430
416	Ga0207671_10156617	3300025914	Bacteria	1762
417	Ga0207693_10004892	3300025915	Bacteria	11257
418	Ga0207693_10004935	3300025915	Bacteria	11209
419	Ga0207693_10005274	3300025915	Bacteria	10809
420	Ga0207693_10106318	3300025915	Bacteria	2201
421	Ga0207663_10081169	3300025916	Bacteria	2123
422	Ga0207660_10046905	3300025917	Bacteria	3052
423	Ga0207662_10000254	3300025918	Bacteria	24692
424	Ga0207657_10013359	3300025919	Bacteria	8056
425	Ga0207657_10034449	3300025919	Bacteria	4552
426	Ga0207657_10036394	3300025919	Bacteria	4405
427	Ga0207657_10041494	3300025919	Bacteria	4068
428	Ga0207649_10039932	3300025920	Bacteria	2848
429	Ga0207694_10000120	3300025924	Bacteria	83624
430	Ga0207694_10000933	3300025924	Bacteria	25869
431	Ga0207694_10056955	3300025924	Bacteria	3037
432	Ga0207694_10091331	3300025924	Bacteria	2403
433	Ga0207694_10348615	3300025924	Bacteria	1225
434	Ga0207700_10004057	3300025928	Bacteria	8581
435	Ga0207700_10031541	3300025928	Bacteria	3766
436	Ga0207700_10048466	3300025928	Bacteria	3155
437	Ga0207664_10032588	3300025929	Bacteria	3996
438	Ga0207690_10036892	3300025932	Bacteria	3169
439	Ga0207690_10118527	3300025932	Bacteria	1918
440	Ga0207690_10149493	3300025932	Bacteria	1730
441	Ga0207706_10002971	3300025933	Bacteria	16353
442	Ga0207706_10005299	3300025933	Bacteria	12024
443	Ga0207706_10015662	3300025933	Bacteria	6852
444	Ga0207706_10028246	3300025933	Bacteria	5011
445	Ga0207706_10035172	3300025933	Bacteria	4456
446	Ga0207706_10059270	3300025933	Bacteria	3371
447	Ga0207706_10065155	3300025933	Bacteria	3208
448	Ga0207686_10003225	3300025934	Bacteria	8768
449	Ga0207709_10003334	3300025935	Bacteria	9619
450	Ga0207709_10009590	3300025935	Bacteria	5329
451	Ga0207709_10037084	3300025935	Bacteria	2894
452	Ga0207709_10055055	3300025935	Bacteria	2456
453	Ga0207709_10156514	3300025935	Bacteria	1584
454	Ga0207665_10000636	3300025939	Bacteria	23620
455	Ga0207665_10003419	3300025939	Bacteria	10622
456	Ga0207665_10055951	3300025939	Bacteria	2663
457	Ga0207691_10013126	3300025940	Bacteria	7930
458	Ga0207711_10001827	3300025941	Bacteria	19417
459	Ga0207689_10022570	3300025942	Bacteria	5288
460	Ga0207689_10284814	3300025942	Bacteria	1368
461	Ga0207679_10062252	3300025945	Bacteria	2780
462	Ga0207679_10288493	3300025945	Bacteria	1410
463	Ga0207667_10006732	3300025949	Bacteria	13882
464	Ga0207667_10007448	3300025949	Bacteria	13151
465	Ga0207667_10050218	3300025949	Bacteria	4401
466	Ga0207667_10169458	3300025949	Bacteria	2244
467	Ga0207712_10000334	3300025961	Bacteria	43010
468	Ga0207668_10035999	3300025972	Bacteria	3302
469	Ga0207640_10005679	3300025981	Bacteria	6798
470	Ga0207640_10007022	3300025981	Bacteria	6199
471	Ga0207640_10373902	3300025981	Bacteria	1153
472	Ga0207658_10000947	3300025986	Bacteria	23931
473	Ga0207658_10004952	3300025986	Bacteria	9189
474	Ga0207703_10000094	3300026035	Bacteria	104297
475	Ga0207639_10000438	3300026041	Bacteria	28804
476	Ga0207639_10001071	3300026041	Bacteria	18579
477	Ga0207639_10003561	3300026041	Bacteria	10462
478	Ga0207639_10013881	3300026041	Bacteria	5650
479	Ga0207639_10046183	3300026041	Bacteria	3285
480	Ga0207639_10443242	3300026041	Bacteria	1177
481	Ga0207678_10000022	3300026067	Bacteria	129767
482	Ga0207678_10000116	3300026067	Bacteria	65805
483	Ga0207678_10003208	3300026067	Bacteria	14783
484	Ga0207678_10012246	3300026067	Bacteria	7531
485	Ga0207678_10075496	3300026067	Bacteria	2887
486	Ga0207678_10180867	3300026067	Bacteria	1801
487	Ga0207708_10011471	3300026075	Bacteria	6604
488	Ga0207702_10000019	3300026078	Bacteria	211843
489	Ga0207702_10002429	3300026078	Bacteria	17702
490	Ga0207702_10003041	3300026078	Bacteria	15589
491	Ga0207702_10004744	3300026078	Bacteria	12004
492	Ga0207702_10012384	3300026078	Bacteria	7102
493	Ga0207702_10173590	3300026078	Bacteria	1979
494	Ga0207641_10002649	3300026088	Bacteria	16364
495	Ga0207641_10100637	3300026088	Bacteria	2546
496	Ga0207648_10015533	3300026089	Bacteria	6998
497	Ga0207674_10004606	3300026116	Bacteria	16555
498	Ga0207674_10151585	3300026116	Bacteria	2275
499	Ga0207674_10478449	3300026116	Bacteria	1204
500	Ga0207675_100018468	3300026118	Bacteria	6504
501	Ga0207675_100019177	3300026118	Bacteria	6383
502	Ga0207675_100062339	3300026118	Bacteria	3482
503	Ga0207683_10013203	3300026121	Bacteria	7046
504	Ga0207683_10100938	3300026121	Bacteria	2576
505	Ga0207683_10199936	3300026121	Bacteria	1816
506	Ga0207698_10002072	3300026142	Bacteria	11824
507	Ga0207698_10003380	3300026142	Bacteria	9609
508	Ga0209281_1000008	3300027111	Bacteria	867470
509	Ga0209371_1001588	3300027312	Bacteria	14807
510	Ga0207428_10004342	3300027907	Bacteria	13543
511	Ga0207428_10008192	3300027907	Bacteria	9454
512	Ga0207428_10028732	3300027907	Bacteria	4617
513	Ga0268266_10000948	3300028379	Bacteria	36942
514	Ga0268266_10020341	3300028379	Bacteria	5658
515	Ga0268266_10331744	3300028379	Bacteria	1426
516	Ga0268265_10000962	3300028380	Bacteria	26448
517	Ga0268265_10054223	3300028380	Bacteria	3041
518	Ga0268265_10224900	3300028380	Bacteria	1645
519	Ga0268264_10001094	3300028381	Bacteria	26758
520	Ga0268264_10001384	3300028381	Bacteria	22721
521	Ga0307517_10002656	3300028786	Bacteria	28559
522	Ga0307517_10078648	3300028786	Bacteria	2849
523	Ga0307517_10099582	3300028786	Bacteria	2303
524	Ga0307515_10003461	3300028794	Bacteria	33183
525	Ga0307515_10042191	3300028794	Bacteria	7146
526	Ga0307515_10100958	3300028794	Bacteria	3488
527	Ga0307515_10157547	3300028794	Bacteria	2334
528	Ga0307515_10264390	3300028794	Bacteria	1451
529	Ga0307515_10265026	3300028794	Bacteria	1448
530	Ga0307515_10279768	3300028794	Bacteria	1377
531	Ga0265338_10139736	3300028800	Bacteria	1899
532	Ga0268256_1001370	3300030500	Bacteria	14807
533	Ga0307511_10000050	3300030521	Bacteria	97101
534	Ga0307511_10000401	3300030521	Bacteria	46025
535	Ga0307511_10026796	3300030521	Bacteria	5280
536	Ga0307511_10034094	3300030521	Bacteria	4478
537	Ga0307512_10008551	3300030522	Bacteria	9961
538	Ga0307512_10022005	3300030522	Bacteria	5740
539	Ga0307512_10055026	3300030522	Bacteria	3143
540	Ga0316181_1154916	3300030744	Bacteria	3410
541	Ga0316182_1153087	3300030745	Bacteria	1080
542	Ga0265316_10005411	3300031344	Bacteria	12404
543	Ga0307513_10000219	3300031456	Bacteria	82663
544	Ga0307513_10001108	3300031456	Bacteria	38970
545	Ga0307513_10023992	3300031456	Bacteria	7107
546	Ga0307513_10037999	3300031456	Bacteria	5351
547	Ga0307513_10126960	3300031456	Bacteria	2504
548	Ga0307509_10001929	3300031507	Bacteria	34257
549	Ga0307509_10019317	3300031507	Bacteria	7778
550	Ga0307509_10028803	3300031507	Bacteria	6171
551	Ga0307509_10101119	3300031507	Bacteria	2918
552	Ga0307509_10102176	3300031507	Bacteria	2899
553	Ga0307408_100002141	3300031548	Bacteria	14149
554	Ga0307408_100012250	3300031548	Bacteria	5677
555	Ga0307408_100165109	3300031548	Bacteria	1762
556	Ga0307508_10001419	3300031616	Bacteria	26970
557	Ga0307508_10001653	3300031616	Bacteria	24829
558	Ga0307508_10002660	3300031616	Bacteria	18747
559	Ga0307508_10004136	3300031616	Bacteria	14290
560	Ga0307508_10030043	3300031616	Bacteria	4911
561	Ga0307508_10041918	3300031616	Bacteria	4108
562	Ga0307508_10089809	3300031616	Bacteria	2658
563	Ga0307514_10043511	3300031649	Bacteria	3525
564	Ga0307514_10070607	3300031649	Bacteria	2622
565	Ga0265314_10037140	3300031711	Bacteria	3532
566	Ga0307516_10004179	3300031730	Bacteria	17982
567	Ga0307516_10005739	3300031730	Bacteria	14707
568	Ga0307516_10026058	3300031730	Bacteria	5944
569	Ga0307516_10030738	3300031730	Bacteria	5417
570	Ga0307516_10105779	3300031730	Bacteria	2625
571	Ga0307405_10087645	3300031731	Bacteria	2052
572	Ga0307405_10349870	3300031731	Bacteria	1139
573	Ga0307413_10118980	3300031824	Bacteria	1785
574	Ga0307518_10001376	3300031838	Bacteria	18082
575	Ga0307518_10023205	3300031838	Bacteria	4468
576	Ga0307406_10003739	3300031901	Bacteria	8275
577	Ga0307412_10000304	3300031911	Bacteria	31110
578	Ga0307412_10040867	3300031911	Bacteria	3002
579	Ga0307412_10063625	3300031911	Bacteria	2489
580	Ga0307412_10109468	3300031911	Bacteria	1969
581	Ga0307412_10226929	3300031911	Bacteria	1435
582	Ga0307412_10232468	3300031911	Bacteria	1420
583	Ga0307409_100015488	3300031995	Bacteria	5007
584	Ga0307409_100359717	3300031995	Bacteria	1376
585	Ga0307409_100404966	3300031995	Bacteria	1304
586	Ga0307409_100415053	3300031995	Bacteria	1290
587	Ga0307416_100544319	3300032002	Bacteria	1233
588	Ga0307414_10002087	3300032004	Bacteria	10400
589	Ga0307414_10015307	3300032004	Bacteria	4630
590	Ga0307414_10015942	3300032004	Bacteria	4553
591	Ga0307414_10172545	3300032004	Bacteria	1730
592	Ga0307411_10064143	3300032005	Bacteria	2458
593	Ga0307411_10102079	3300032005	Bacteria	2031
594	Ga0307507_10000003	3300033179	Bacteria	371707
595	Ga0307507_10000031	3300033179	Bacteria	195619
596	Ga0307507_10011820	3300033179	Bacteria	10931
597	Ga0307510_10003088	3300033180	Bacteria	19248
598	Ga0307510_10009123	3300033180	Bacteria	11807
599	Ga0307510_10027972	3300033180	Bacteria	6448
600	Ga0316214_1001712	3300033545	Bacteria	2612
601	Ga0373952_0017907	3300035092	Bacteria	1460
602	Ga0373946_0024183	3300035171	Bacteria	2378
603	Ga0373931_0003665	3300035691	Bacteria	6946
604	Ga0373927_0000410	3300035695	Bacteria	33006
605	Ga0373947_0009173	3300035725	Bacteria	5687
606	Ga0373925_0000730	3300037068	Bacteria	30523
607	Ga0395899_0013724	3300037312	Bacteria	6195
608	Ga0395899_0023133	3300037312	Bacteria	4710
609	Ga0395899_0026758	3300037312	Bacteria	4352
610	Ga0395899_0102359	3300037312	Bacteria	2067
611	Ga0395900_0000474	3300037418	Bacteria	57230
612	Ga0395900_0001603	3300037418	Bacteria	26692
613	Ga0395900_0004209	3300037418	Bacteria	15268
614	Ga0395900_0074799	3300037418	Bacteria	3482
615	Ga0395900_0102275	3300037418	Bacteria	2944
616	Ga0395900_0153446	3300037418	Bacteria	2353
617	Ga0395900_0440889	3300037418	Bacteria	1260
618	Ga0395898_0000751	3300037466	Bacteria	56660
619	Ga0395898_0004678	3300037466	Bacteria	14915
620	Ga0395898_0012071	3300037466	Bacteria	8943
621	Ga0395898_0012419	3300037466	Bacteria	8805
622	Ga0395898_0019940	3300037466	Bacteria	6817
623	Ga0395898_0035174	3300037466	Bacteria	4985
624	Ga0395898_0164832	3300037466	Bacteria	2120
625	Ga0395898_0445558	3300037466	Bacteria	1233
626	Ga0395905_0005858	3300037471	Bacteria	12491
627	Ga0395905_0018917	3300037471	Bacteria	6532
628	Ga0395905_0050569	3300037471	Bacteria	3893
629	Ga0395905_0062684	3300037471	Bacteria	3477
630	Ga0395905_0066056	3300037471	Bacteria	3387
631	Ga0395905_0085393	3300037471	Bacteria	2957
632	Ga0395905_0212001	3300037471	Bacteria	1814
633	Ga0395901_0000077	3300038443	Bacteria	135073
634	Ga0395901_0000246	3300038443	Bacteria	67512
635	Ga0395901_0000908	3300038443	Bacteria	32498
636	Ga0395901_0026128	3300038443	Bacteria	5994
637	Ga0395901_0030832	3300038443	Bacteria	5526
638	Ga0395901_0043177	3300038443	Bacteria	4677
639	Ga0395901_0123752	3300038443	Bacteria	2717
640	Ga0395901_0130622	3300038443	Bacteria	2639
641	Ga0395901_0288605	3300038443	Bacteria	1703
642	Ga0237819_01112	3300038705	Bacteria	7847
643	Ga0400483_108750	3300039062	Bacteria	3354
644	Ga0400483_135484	3300039062	Bacteria	7954
645	Ga0400483_180197	3300039062	Bacteria	7396
646	Ga0400483_243671	3300039062	Bacteria	5670
647	Ga0436361_0108407	3300039447	Bacteria	32994
648	Ga0436361_0659434	3300039447	Bacteria	4276
649	Ga0436361_1220162	3300039447	Bacteria	2895
650	Ga0436363_1150514	3300039450	Bacteria	5432
651	Ga0439436_0013263	3300041404	Bacteria	2494
652	Ga0439436_0028606	3300041404	Bacteria	1626
653	Ga0439466_0003736	3300041411	Bacteria	5880
654	Ga0439465_0030638	3300041413	Bacteria	1712
655	Ga0451795_0226724	3300041456	Bacteria	2470
656	Ga0451839_0426667	3300041496	Bacteria	1693
657	Ga0439445_0024077	3300042004	Bacteria	1545
658	Ga0439448_0010380	3300042005	Bacteria	2762
659	Ga0439448_0019533	3300042005	Bacteria	2087
660	Ga0439448_0025958	3300042005	Bacteria	1840
661	Ga0439432_004797	3300042006	Bacteria	4915
662	Ga0439449_0018184	3300042007	Bacteria	2637
663	Ga0439449_0040347	3300042007	Bacteria	1735
664	Ga0439450_009204	3300042008	Bacteria	1868
665	Ga0439451_000125	3300042009	Bacteria	14064
666	Ga0439451_000134	3300042009	Bacteria	13696
667	Ga0439452_000130	3300042010	Bacteria	57394
668	Ga0439452_009390	3300042010	Bacteria	2883
669	Ga0439457_000234	3300042014	Bacteria	14914
670	Ga0439457_003788	3300042014	Bacteria	4060
671	Ga0439463_013229	3300042016	Bacteria	2031
672	Ga0450911_003786	3300042115	Bacteria	2596
673	Ga0450920_008457	3300042122	Bacteria	1881
674	Ga0450923_003270	3300042125	Bacteria	2427
675	Ga0450894_000475	3300042131	Bacteria	6845
676	Ga0450898_002595	3300042134	Bacteria	2532
677	Ga0450902_009804	3300042137	Bacteria	1511
678	Ga0450906_000347	3300042145	Bacteria	9410
679	Ga0450907_002519	3300042146	Bacteria	3476
680	Ga0439458_0003190	3300042157	Bacteria	3886
681	Ga0450908_000522	3300042184	Bacteria	7425
682	Ga0439434_0003886	3300042435	Bacteria	4365
683	Ga0439464_0005925	3300042439	Bacteria	3176
684	Ga0439460_0008127	3300042461	Bacteria	2646
685	Ga0451577_0089587	3300042876	Bacteria	2745
686	Ga0466969_0009500	3300044656	Bacteria	5157
687	Ga0466969_0018605	3300044656	Bacteria	3618
688	Ga0466969_0039455	3300044656	Bacteria	2371
689	Ga0466972_0000462	3300044658	Bacteria	20710
690	Ga0466972_0007761	3300044658	Bacteria	5386
691	Ga0466972_0015619	3300044658	Bacteria	3797
692	Ga0466972_0111947	3300044658	Bacteria	1290
693	Ga0453683_0019366	3300044673	Bacteria	4361
694	Ga0466965_0004793	3300044683	Bacteria	6033
695	Ga0466965_0010740	3300044683	Bacteria	4281
696	Ga0466965_0017187	3300044683	Bacteria	3454
697	Ga0466965_0038068	3300044683	Bacteria	2362
698	Ga0466966_0000927	3300044684	Bacteria	18684
699	Ga0466966_0001156	3300044684	Bacteria	16964
700	Ga0466966_0001664	3300044684	Bacteria	14332
701	Ga0466966_0009048	3300044684	Bacteria	6598
702	Ga0466966_0075818	3300044684	Bacteria	2100
703	Ga0466966_0109047	3300044684	Bacteria	1708
704	Ga0466961_0005318	3300044693	Bacteria	8101
705	Ga0466961_0012135	3300044693	Bacteria	5508
706	Ga0466961_0034753	3300044693	Bacteria	3236
707	Ga0466963_0001264	3300044694	Bacteria	13403
708	Ga0466963_0002989	3300044694	Bacteria	9560
709	Ga0466964_0006530	3300044706	Bacteria	4350
710	Ga0453684_0259954	3300044712	Bacteria	1989
711	Ga0453684_0297449	3300044712	Bacteria	1835
712	Ga0466971_0001070	3300044719	Bacteria	11373
713	Ga0466971_0024430	3300044719	Bacteria	2696
714	Ga0466971_0098252	3300044719	Bacteria	1344
715	Ga0466968_0013336	3300044735	Bacteria	3231
716	Ga0466970_0004934	3300044765	Bacteria	6591
717	Ga0466970_0026319	3300044765	Bacteria	3049
718	Ga0466957_0000029	3300044842	Bacteria	52517
719	Ga0466957_0001270	3300044842	Bacteria	13146
720	Ga0466957_0123522	3300044842	Bacteria	1652
721	Ga0466957_0143405	3300044842	Bacteria	1540
722	Ga0466960_0024039	3300044901	Bacteria	2744
723	Ga0466959_0006518	3300045049	Bacteria	8094
724	Ga0466959_0007787	3300045049	Bacteria	7536
725	Ga0466959_0019614	3300045049	Bacteria	4973
726	Ga0466959_0077580	3300045049	Bacteria	2397
727	Ga0451576_0008986	3300045051	Bacteria	11641
728	Ga0451576_0027926	3300045051	Bacteria	6053
729	Ga0466958_0000352	3300045836	Bacteria	18502
730	Ga0466958_0004427	3300045836	Bacteria	7418
731	Ga0466958_0020230	3300045836	Bacteria	3881
732	Ga0466958_0114456	3300045836	Bacteria	1685
733	Ga0466967_0022489	3300045976	Bacteria	5146
734	Ga0466967_0040101	3300045976	Bacteria	4030
735	Ga0466967_0378902	3300045976	Bacteria	1373
736	Ga0495617_000642	3300046452	Bacteria	17510
737	Ga0495617_006827	3300046452	Bacteria	3988
738	Ga0495617_010652	3300046452	Bacteria	3150
739	Ga0495617_014761	3300046452	Bacteria	2653
740	Ga0495617_028167	3300046452	Bacteria	1888
741	Ga0495617_052606	3300046452	Bacteria	1353
742	Ga0495627_000254	3300046453	Bacteria	54795
743	Ga0495627_001072	3300046453	Bacteria	18018
744	Ga0495627_026424	3300046453	Bacteria	1872
745	Ga0495592_0012672	3300046454	Bacteria	6407
746	Ga0495592_0015756	3300046454	Bacteria	5735
747	Ga0495603_0002962	3300046455	Bacteria	10043
748	Ga0495603_0007336	3300046455	Bacteria	6629
749	Ga0495603_0015983	3300046455	Bacteria	4537
750	Ga0495603_0019131	3300046455	Bacteria	4145
751	Ga0495590_0000965	3300046457	Bacteria	12679
752	Ga0495590_0007568	3300046457	Bacteria	4179
753	Ga0495590_0015204	3300046457	Bacteria	2797
754	Ga0495590_0044467	3300046457	Bacteria	1548
755	Ga0495591_000005	3300046458	Bacteria	394092
756	Ga0495591_000088	3300046458	Bacteria	102486
757	Ga0495591_003293	3300046458	Bacteria	8451
758	Ga0495591_009522	3300046458	Bacteria	3849
759	Ga0495629_0008564	3300046459	Bacteria	7532
760	Ga0495629_0010005	3300046459	Bacteria	6921
761	Ga0495629_0019619	3300046459	Bacteria	4829
762	Ga0495629_0072821	3300046459	Bacteria	2399
763	Ga0495629_0124042	3300046459	Bacteria	1799
764	Ga0495638_0001071	3300046460	Bacteria	26689
765	Ga0495638_0003500	3300046460	Bacteria	12329
766	Ga0495638_0004007	3300046460	Bacteria	11309
767	Ga0495638_0011558	3300046460	Bacteria	6082
768	Ga0495638_0017740	3300046460	Bacteria	4739
769	Ga0495638_0040011	3300046460	Bacteria	2972
770	Ga0495638_0042721	3300046460	Bacteria	2863
771	Ga0495638_0064128	3300046460	Bacteria	2263
772	Ga0495638_0110876	3300046460	Bacteria	1630
773	Ga0495653_0001089	3300046463	Bacteria	20969
774	Ga0495653_0004894	3300046463	Bacteria	10865
775	Ga0495653_0036548	3300046463	Bacteria	3867
776	Ga0495653_0045911	3300046463	Bacteria	3384
777	Ga0495650_0001499	3300046471	Bacteria	22259
778	Ga0495650_0001536	3300046471	Bacteria	21887
779	Ga0495650_0001808	3300046471	Bacteria	19256
780	Ga0495650_0002221	3300046471	Bacteria	16296
781	Ga0495650_0002985	3300046471	Bacteria	12811
782	Ga0495650_0005447	3300046471	Bacteria	8262
783	Ga0495650_0019653	3300046471	Bacteria	3315
784	Ga0495580_0010092	3300046472	Bacteria	7379
785	Ga0495580_0015860	3300046472	Bacteria	5670
786	Ga0495605_0000195	3300046474	Bacteria	75899
787	Ga0495605_0000199	3300046474	Bacteria	74613
788	Ga0495605_0000257	3300046474	Bacteria	62503
789	Ga0495605_0001546	3300046474	Bacteria	14942
790	Ga0495605_0007942	3300046474	Bacteria	6008
791	Ga0495605_0019276	3300046474	Bacteria	3648
792	Ga0495639_0003285	3300046475	Bacteria	7015
793	Ga0495662_0008243	3300046476	Bacteria	5133
794	Ga0495664_0003557	3300046477	Bacteria	8499
795	Ga0495664_0032744	3300046477	Bacteria	3052
796	Ga0495664_0097429	3300046477	Bacteria	1770
797	Ga0495584_0001017	3300046491	Bacteria	17518
798	Ga0495584_0002370	3300046491	Bacteria	10719
799	Ga0495584_0024427	3300046491	Bacteria	3065
800	Ga0495584_0030071	3300046491	Bacteria	2752
801	Ga0495584_0118609	3300046491	Bacteria	1340
802	Ga0495585_0000142	3300046492	Bacteria	79060
803	Ga0495585_0000577	3300046492	Bacteria	34550
804	Ga0495585_0000795	3300046492	Bacteria	27671
805	Ga0495585_0002260	3300046492	Bacteria	13931
806	Ga0495585_0012745	3300046492	Bacteria	4947
807	Ga0495585_0035019	3300046492	Bacteria	2839
808	Ga0495585_0080431	3300046492	Bacteria	1766
809	Ga0495585_0092144	3300046492	Bacteria	1631
810	Ga0495594_0091268	3300046499	Bacteria	1707
811	Ga0495596_0000061	3300046500	Bacteria	79205
812	Ga0495596_0001643	3300046500	Bacteria	12706
813	Ga0495607_0000138	3300046501	Bacteria	77180
814	Ga0495607_0000394	3300046501	Bacteria	44392
815	Ga0495607_0001084	3300046501	Bacteria	24861
816	Ga0495607_0001219	3300046501	Bacteria	23108
817	Ga0495607_0001489	3300046501	Bacteria	20785
818	Ga0495607_0003744	3300046501	Bacteria	11500
819	Ga0495607_0006485	3300046501	Bacteria	8228
820	Ga0495607_0013896	3300046501	Bacteria	5260
821	Ga0495607_0025057	3300046501	Bacteria	3714
822	Ga0495607_0033723	3300046501	Bacteria	3113
823	Ga0495607_0035928	3300046501	Bacteria	2992
824	Ga0495583_0002568	3300046506	Bacteria	15282
825	Ga0495583_0071013	3300046506	Bacteria	1530
826	Ga0495583_0084457	3300046506	Bacteria	1375
827	Ga0495606_0000081	3300046507	Bacteria	160491
828	Ga0495606_0000525	3300046507	Bacteria	61969
829	Ga0495606_0005029	3300046507	Bacteria	12873
830	Ga0495606_0005176	3300046507	Bacteria	12615
831	Ga0495606_0005506	3300046507	Bacteria	12103
832	Ga0495606_0009409	3300046507	Bacteria	8272
833	Ga0495606_0025173	3300046507	Bacteria	4269
834	Ga0495606_0028965	3300046507	Bacteria	3896
835	Ga0495606_0034505	3300046507	Bacteria	3473
836	Ga0495608_0073290	3300046511	Bacteria	2233
837	Ga0495610_0000198	3300046512	Bacteria	67337
838	Ga0495610_0000963	3300046512	Bacteria	26633
839	Ga0495610_0008811	3300046512	Bacteria	6470
840	Ga0495610_0057593	3300046512	Bacteria	1863
841	Ga0495610_0068188	3300046512	Bacteria	1668
842	Ga0495616_0002680	3300046513	Bacteria	11668
843	Ga0495616_0006038	3300046513	Bacteria	7380
844	Ga0495616_0008012	3300046513	Bacteria	6292
845	Ga0495616_0014248	3300046513	Bacteria	4459
846	Ga0495616_0024064	3300046513	Bacteria	3270
847	Ga0495616_0033012	3300046513	Bacteria	2700
848	Ga0495616_0037408	3300046513	Bacteria	2497
849	Ga0495620_0000035	3300046515	Bacteria	115562
850	Ga0495620_0031909	3300046515	Bacteria	2406
851	Ga0495628_0046359	3300046516	Bacteria	3452
852	Ga0495628_0064348	3300046516	Bacteria	2871
853	Ga0495630_0002568	3300046517	Bacteria	12585
854	Ga0495630_0006537	3300046517	Bacteria	8302
855	Ga0495630_0063736	3300046517	Bacteria	2769
856	Ga0495631_0000063	3300046518	Bacteria	66560
857	Ga0495631_0000122	3300046518	Bacteria	52205
858	Ga0495631_0001230	3300046518	Bacteria	15793
859	Ga0495631_0017620	3300046518	Bacteria	3375
860	Ga0495632_0000058	3300046519	Bacteria	122648
861	Ga0495632_0000395	3300046519	Bacteria	41002
862	Ga0495632_0000518	3300046519	Bacteria	36310
863	Ga0495632_0000908	3300046519	Bacteria	25958
864	Ga0495632_0000983	3300046519	Bacteria	24906
865	Ga0495632_0003288	3300046519	Bacteria	11546
866	Ga0495632_0005029	3300046519	Bacteria	8853
867	Ga0495632_0008756	3300046519	Bacteria	6168
868	Ga0495632_0014772	3300046519	Bacteria	4405
869	Ga0495632_0019335	3300046519	Bacteria	3713
870	Ga0495632_0027861	3300046519	Bacteria	2953
871	Ga0495637_0000113	3300046520	Bacteria	58600
872	Ga0495637_0000315	3300046520	Bacteria	37537
873	Ga0495637_0000473	3300046520	Bacteria	29387
874	Ga0495637_0001685	3300046520	Bacteria	12767
875	Ga0495637_0007094	3300046520	Bacteria	5580
876	Ga0495637_0023097	3300046520	Bacteria	2830
877	Ga0495637_0023593	3300046520	Bacteria	2793
878	Ga0495637_0046766	3300046520	Bacteria	1829
879	Ga0495643_0000044	3300046522	Bacteria	226211
880	Ga0495643_0000880	3300046522	Bacteria	31960
881	Ga0495643_0002862	3300046522	Bacteria	13117
882	Ga0495643_0003493	3300046522	Bacteria	11453
883	Ga0495643_0006532	3300046522	Bacteria	7670
884	Ga0495643_0018596	3300046522	Bacteria	4035
885	Ga0495643_0021770	3300046522	Bacteria	3669
886	Ga0495643_0070273	3300046522	Bacteria	1839
887	Ga0495644_0001098	3300046523	Bacteria	11173
888	Ga0495644_0021452	3300046523	Bacteria	2464
889	Ga0495648_0000241	3300046524	Bacteria	61991
890	Ga0495648_0002312	3300046524	Bacteria	17749
891	Ga0495648_0016866	3300046524	Bacteria	5248
892	Ga0495648_0017766	3300046524	Bacteria	5071
893	Ga0495648_0026949	3300046524	Bacteria	3857
894	Ga0495648_0031424	3300046524	Bacteria	3495
895	Ga0495663_0000394	3300046525	Bacteria	16143
896	Ga0495666_0000069	3300046526	Bacteria	40652
897	Ga0495666_0000092	3300046526	Bacteria	36757
898	Ga0495666_0002984	3300046526	Bacteria	8492
899	Ga0495666_0004604	3300046526	Bacteria	6974
900	Ga0495666_0005780	3300046526	Bacteria	6230
901	Ga0495666_0009363	3300046526	Bacteria	4901
902	Ga0495666_0038050	3300046526	Bacteria	2340
903	Ga0495666_0062478	3300046526	Bacteria	1778
904	Ga0495642_0000003	3300046528	Bacteria	185425
905	Ga0495642_0076951	3300046528	Bacteria	1401
906	Ga0495642_0090933	3300046528	Bacteria	1292
907	Ga0495652_0000784	3300046529	Bacteria	36623
908	Ga0495652_0034602	3300046529	Bacteria	4402
909	Ga0495654_0000799	3300046530	Bacteria	24142
910	Ga0495654_0001139	3300046530	Bacteria	19069
911	Ga0495654_0002457	3300046530	Bacteria	11922
912	Ga0495654_0002606	3300046530	Bacteria	11494
913	Ga0495654_0002865	3300046530	Bacteria	10838
914	Ga0495654_0017248	3300046530	Bacteria	3799
915	Ga0495654_0064580	3300046530	Bacteria	1749
916	Ga0495665_0002959	3300046531	Bacteria	9171
917	Ga0495665_0033485	3300046531	Bacteria	2748
918	Ga0495640_0016046	3300046533	Bacteria	5614
919	Ga0495586_0014575	3300046535	Bacteria	4177
920	Ga0495586_0042300	3300046535	Bacteria	2454
921	Ga0495587_0001318	3300046536	Bacteria	16481
922	Ga0495609_0000490	3300046538	Bacteria	31718
923	Ga0495597_0000216	3300046542	Bacteria	52708
924	Ga0495597_0000253	3300046542	Bacteria	48591
925	Ga0495597_0002240	3300046542	Bacteria	12617
926	Ga0495597_0002886	3300046542	Bacteria	10479
927	Ga0495597_0007992	3300046542	Bacteria	5322
928	Ga0495645_0011206	3300046543	Bacteria	6303
929	Ga0495645_0017315	3300046543	Bacteria	5161
930	Ga0495622_0006141	3300046557	Bacteria	5582
931	Ga0495622_0011238	3300046557	Bacteria	4134
932	Ga0495622_0019278	3300046557	Bacteria	3177
933	Ga0495633_0006427	3300046558	Bacteria	6966
934	Ga0495633_0010354	3300046558	Bacteria	5095
935	Ga0495633_0067193	3300046558	Bacteria	1674
936	Ga0495667_0059961	3300046559	Bacteria	2496
937	Ga0495656_0000104	3300046615	Bacteria	35209
938	Ga0495656_0003267	3300046615	Bacteria	5471
939	Ga0495668_0000140	3300046616	Bacteria	109138
940	Ga0495668_0001118	3300046616	Bacteria	27674
941	Ga0495668_0043700	3300046616	Bacteria	2491
942	Ga0495668_0080318	3300046616	Bacteria	1789
943	Ga0495634_0016136	3300046642	Bacteria	5346
944	Ga0495634_0239724	3300046642	Bacteria	1113
945	Ga0495611_0001324	3300046648	Bacteria	12567
946	Ga0495611_0025688	3300046648	Bacteria	2568
947	Ga0495625_0000056	3300046660	Bacteria	186024
948	Ga0495625_0000095	3300046660	Bacteria	143468
949	Ga0495625_0001135	3300046660	Bacteria	34436
950	Ga0495625_0001678	3300046660	Bacteria	25843
951	Ga0495625_0012504	3300046660	Bacteria	6874
952	Ga0495625_0014369	3300046660	Bacteria	6323
953	Ga0495625_0018924	3300046660	Bacteria	5360
954	Ga0495625_0031487	3300046660	Bacteria	3944
955	Ga0495625_0032310	3300046660	Bacteria	3883
956	Ga0495625_0059375	3300046660	Bacteria	2714
957	Ga0495659_0000116	3300046664	Bacteria	35444
958	Ga0495661_0000010	3300046665	Bacteria	284261
959	Ga0495661_0000049	3300046665	Bacteria	144060
960	Ga0495661_0000085	3300046665	Bacteria	114501
961	Ga0495661_0013544	3300046665	Bacteria	5474
962	Ga0495661_0017164	3300046665	Bacteria	4783
963	Ga0495661_0031376	3300046665	Bacteria	3374
964	Ga0495661_0060608	3300046665	Bacteria	2247
965	Ga0495588_0023820	3300046674	Bacteria	3035
966	Ga0495657_0059057	3300046675	Bacteria	2545
967	Ga0495599_0001037	3300046678	Bacteria	15615
968	Ga0495623_0001804	3300046679	Bacteria	14390
969	Ga0495623_0003834	3300046679	Bacteria	9910
970	Ga0495623_0030607	3300046679	Bacteria	3463
971	Ga0495623_0202603	3300046679	Bacteria	1140
972	Ga0495646_0000390	3300046680	Bacteria	22972
973	Ga0495669_0000263	3300046684	Bacteria	30264
974	Ga0495669_0002053	3300046684	Bacteria	8256
975	Ga0495613_0005666	3300046689	Bacteria	9357
976	Ga0495613_0109142	3300046689	Bacteria	1995
977	Ga0495613_0111465	3300046689	Bacteria	1971
978	Ga0495613_0128580	3300046689	Bacteria	1815
979	Ga0495613_0283440	3300046689	Bacteria	1150
980	Ga0495624_0011630	3300046690	Bacteria	6045
981	Ga0495624_0063046	3300046690	Bacteria	2318
982	Ga0495670_0008981	3300046691	Bacteria	4916
983	Ga0495670_0024495	3300046691	Bacteria	2983
984	Ga0495671_0001083	3300046692	Bacteria	18831
985	Ga0495671_0001728	3300046692	Bacteria	14176
986	Ga0495671_0001868	3300046692	Bacteria	13535
987	Ga0495671_0002038	3300046692	Bacteria	12929
988	Ga0495671_0005199	3300046692	Bacteria	7654
989	Ga0495671_0034418	3300046692	Bacteria	2575
990	Ga0495671_0103777	3300046692	Bacteria	1388
991	Ga0495649_0000039	3300046694	Bacteria	126399
992	Ga0495649_0000083	3300046694	Bacteria	81883
993	Ga0495649_0005034	3300046694	Bacteria	8498
994	Ga0495649_0013467	3300046694	Bacteria	4716
995	Ga0495649_0019649	3300046694	Bacteria	3795
996	Ga0495649_0022739	3300046694	Bacteria	3506
997	Ga0495649_0029073	3300046694	Bacteria	3061
998	Ga0495649_0066989	3300046694	Bacteria	1926
999	Ga0495589_0000549	3300046794	Bacteria	25906
1000	Ga0495589_0005805	3300046794	Bacteria	6509
1001	Ga0495589_0006501	3300046794	Bacteria	6165
1002	Ga0495589_0025127	3300046794	Bacteria	3024
1003	Ga0495589_0034424	3300046794	Bacteria	2543
1004	Ga0495600_0001254	3300046809	Bacteria	13970
1005	Ga0495600_0006329	3300046809	Bacteria	7197
1006	Ga0495660_0000287	3300046810	Bacteria	46709
1007	Ga0495660_0000388	3300046810	Bacteria	38112
1008	Ga0495660_0000392	3300046810	Bacteria	37864
1009	Ga0495660_0000454	3300046810	Bacteria	34113
1010	Ga0495660_0000517	3300046810	Bacteria	31676
1011	Ga0495660_0002257	3300046810	Bacteria	12400
1012	Ga0495660_0020177	3300046810	Bacteria	3820
1013	Ga0495660_0021034	3300046810	Bacteria	3739
1014	Ga0495660_0026115	3300046810	Bacteria	3313
1015	Ga0495660_0027303	3300046810	Bacteria	3231
1016	Ga0495660_0045561	3300046810	Bacteria	2407
1017	Ga0495660_0051545	3300046810	Bacteria	2239
1018	Ga0495581_0016932	3300047315	Bacteria	4236
1019	Ga0495581_0069012	3300047315	Bacteria	2044
1020	Ga0495581_0103882	3300047315	Bacteria	1651
1021	Ga0495581_0104411	3300047315	Bacteria	1647
1022	Ga0495604_0001552	3300047317	Bacteria	18929
1023	Ga0495604_0003658	3300047317	Bacteria	12253
1024	Ga0495604_0034809	3300047317	Bacteria	3982
1025	Ga0495604_0075169	3300047317	Bacteria	2544
1026	Ga0495604_0108577	3300047317	Bacteria	2027
1027	Ga0495636_0002723	3300047318	Bacteria	6815
1028	Ga0495636_0005002	3300047318	Bacteria	5200
1029	Ga0495636_0066331	3300047318	Bacteria	1534
1030	Ga0495636_0083151	3300047318	Bacteria	1381
1031	Ga0495674_0006435	3300047319	Bacteria	11264
1032	Ga0495674_0007194	3300047319	Bacteria	10645
1033	Ga0495674_0023541	3300047319	Bacteria	5674
1034	Ga0495674_0070938	3300047319	Bacteria	3009
1035	Ga0495672_0000006	3300047320	Bacteria	589807
1036	Ga0495672_0000190	3300047320	Bacteria	88698
1037	Ga0495672_0000213	3300047320	Bacteria	82925
1038	Ga0495672_0000442	3300047320	Bacteria	49513
1039	Ga0495672_0001989	3300047320	Bacteria	19308
1040	Ga0495672_0002680	3300047320	Bacteria	16016
1041	Ga0495672_0003117	3300047320	Bacteria	14464
1042	Ga0495672_0007520	3300047320	Bacteria	8182
1043	Ga0495672_0080258	3300047320	Bacteria	1820
1044	Ga0495676_0000393	3300047321	Bacteria	35418
1045	Ga0495676_0007316	3300047321	Bacteria	10128
1046	Ga0495676_0010140	3300047321	Bacteria	8555
1047	Ga0495676_0030011	3300047321	Bacteria	4621
1048	Ga0495676_0036507	3300047321	Bacteria	4102
1049	Ga0495676_0067182	3300047321	Bacteria	2775
1050	Ga0495680_0000543	3300047322	Bacteria	42425
1051	Ga0495680_0000608	3300047322	Bacteria	40455
1052	Ga0495680_0000992	3300047322	Bacteria	31598
1053	Ga0495680_0001350	3300047322	Bacteria	26630
1054	Ga0495680_0002710	3300047322	Bacteria	17882
1055	Ga0495680_0004753	3300047322	Bacteria	12899
1056	Ga0495680_0046210	3300047322	Bacteria	3434
1057	Ga0495683_0000245	3300047323	Bacteria	48819
1058	Ga0495683_0000253	3300047323	Bacteria	48373
1059	Ga0495683_0000416	3300047323	Bacteria	34093
1060	Ga0495683_0003035	3300047323	Bacteria	9872
1061	Ga0495683_0003458	3300047323	Bacteria	9215
1062	Ga0495683_0014751	3300047323	Bacteria	4070
1063	Ga0495683_0018717	3300047323	Bacteria	3578
1064	Ga0495687_000308	3300047443	Bacteria	64153
1065	Ga0495687_000389	3300047443	Bacteria	54468
1066	Ga0495687_000495	3300047443	Bacteria	47456
1067	Ga0495687_000724	3300047443	Bacteria	36493
1068	Ga0495687_000845	3300047443	Bacteria	32633
1069	Ga0495687_002228	3300047443	Bacteria	16011
1070	Ga0495687_003776	3300047443	Bacteria	10697
1071	Ga0495687_003894	3300047443	Bacteria	10467
1072	Ga0495687_029428	3300047443	Bacteria	2542
1073	Ga0495687_036191	3300047443	Bacteria	2211
1074	Ga0495687_036601	3300047443	Bacteria	2195
1075	Ga0495687_039781	3300047443	Bacteria	2077
1076	Ga0495675_0000123	3300047444	Bacteria	55312
1077	Ga0495675_0001415	3300047444	Bacteria	14536
1078	Ga0495675_0001577	3300047444	Bacteria	13745
1079	Ga0495675_0007815	3300047444	Bacteria	6602
1080	Ga0495675_0024018	3300047444	Bacteria	3884
1081	Ga0495675_0230393	3300047444	Bacteria	1118
1082	Ga0495677_0000047	3300047445	Bacteria	72197
1083	Ga0495679_000672	3300047446	Bacteria	22404
1084	Ga0495679_021500	3300047446	Bacteria	2226
1085	Ga0495685_000850	3300047447	Bacteria	9302
1086	Ga0495685_007619	3300047447	Bacteria	3579
1087	Ga0495685_041402	3300047447	Bacteria	1574
1088	Ga0495673_0000025	3300047469	Bacteria	512352
1089	Ga0495673_0000155	3300047469	Bacteria	120879
1090	Ga0495673_0000178	3300047469	Bacteria	102182
1091	Ga0495673_0000221	3300047469	Bacteria	84565
1092	Ga0495673_0000922	3300047469	Bacteria	26684
1093	Ga0495673_0001024	3300047469	Bacteria	24647
1094	Ga0495673_0001183	3300047469	Bacteria	21964
1095	Ga0495673_0002914	3300047469	Bacteria	11602
1096	Ga0495673_0008706	3300047469	Bacteria	5671
1097	Ga0495673_0016529	3300047469	Bacteria	3771
1098	Ga0495673_0018987	3300047469	Bacteria	3452
1099	Ga0495681_0000026	3300047470	Bacteria	144911
1100	Ga0495681_0000198	3300047470	Bacteria	50496
1101	Ga0495681_0002726	3300047470	Bacteria	12496
1102	Ga0495681_0003820	3300047470	Bacteria	10425
1103	Ga0495681_0004705	3300047470	Bacteria	9254
1104	Ga0495681_0012414	3300047470	Bacteria	5006
1105	Ga0495681_0014290	3300047470	Bacteria	4558
1106	Ga0495684_0002582	3300047471	Bacteria	14390
1107	Ga0495686_0098785	3300047472	Bacteria	1763
1108	Ga0495593_0002886	3300047673	Bacteria	10361
1109	Ga0495593_0004344	3300047673	Bacteria	8434
1110	Ga0495602_0005230	3300048088	Bacteria	13597
1111	Ga0495602_0006180	3300048088	Bacteria	12560
1112	Ga0495614_0005431	3300048089	Bacteria	5747
1113	Ga0495614_0005865	3300048089	Bacteria	5533
1114	Ga0495614_0020059	3300048089	Bacteria	2891
1115	Ga0495626_0000033	3300048091	Bacteria	184008
1116	Ga0495626_0000132	3300048091	Bacteria	94157
1117	Ga0495626_0000522	3300048091	Bacteria	38417
1118	Ga0495626_0000528	3300048091	Bacteria	38040
1119	Ga0495626_0000760	3300048091	Bacteria	29752
1120	Ga0495626_0002344	3300048091	Bacteria	13348
1121	Ga0495626_0005636	3300048091	Bacteria	7253
1122	Ga0495626_0014908	3300048091	Bacteria	3991
1123	Ga0496100_0008351	3300048903	Bacteria	5770
1124	Ga0496100_0009196	3300048903	Bacteria	5544
1125	Ga0496100_0063090	3300048903	Bacteria	2448
1126	Ga0496100_0154789	3300048903	Bacteria	1638
1127	Ga0496101_0006713	3300048904	Bacteria	7421
1128	Ga0496101_0052905	3300048904	Bacteria	2928
1129	Ga0496102_0000640	3300048905	Bacteria	35507
1130	Ga0496102_0001362	3300048905	Bacteria	21888
1131	Ga0496102_0004150	3300048905	Bacteria	12274
1132	Ga0496102_0017432	3300048905	Bacteria	6291
1133	Ga0496102_0046800	3300048905	Bacteria	3930
1134	Ga0496102_0115949	3300048905	Bacteria	2499
1135	Ga0496103_0000197	3300048906	Bacteria	60344
1136	Ga0496103_0003193	3300048906	Bacteria	10065
1137	Ga0496103_0004050	3300048906	Bacteria	8907
1138	Ga0496103_0008193	3300048906	Bacteria	6203
1139	Ga0496104_0016732	3300048907	Bacteria	6666
1140	Ga0496104_0020106	3300048907	Bacteria	6117
1141	Ga0496104_0034365	3300048907	Bacteria	4728
1142	Ga0496104_0078834	3300048907	Bacteria	3139
1143	Ga0496104_0276725	3300048907	Bacteria	1591
1144	Ga0496105_0005813	3300048908	Bacteria	9409
1145	Ga0496105_0043486	3300048908	Bacteria	3705
1146	Ga0496105_0063948	3300048908	Bacteria	3036
1147	Ga0496105_0128627	3300048908	Bacteria	2088
1148	Ga0496106_0048984	3300048909	Bacteria	3182
1149	Ga0496106_0100261	3300048909	Bacteria	2246
1150	Ga0496106_0135009	3300048909	Bacteria	1937
1151	Ga0496106_0142053	3300048909	Bacteria	1889
1152	Ga0496108_0147251	3300048911	Bacteria	2030
1153	Ga0496109_0128879	3300048912	Bacteria	2360
1154	Ga0496109_0160594	3300048912	Bacteria	2106
1155	Ga0496109_0207237	3300048912	Bacteria	1843
1156	Ga0496109_0444592	3300048912	Bacteria	1225
1157	Ga0496110_0004506	3300048913	Bacteria	10805
1158	Ga0496110_0019584	3300048913	Bacteria	5699
1159	Ga0496110_0042373	3300048913	Bacteria	3973
1160	Ga0496110_0291118	3300048913	Bacteria	1487
1161	Ga0496111_0049764	3300048914	Bacteria	3022
1162	Ga0496111_0168151	3300048914	Bacteria	1629
1163	Ga0496111_0295995	3300048914	Bacteria	1200
1164	Ga0496112_0019536	3300048915	Bacteria	6396
1165	Ga0496113_0000915	3300048916	Bacteria	15596
1166	Ga0496113_0006120	3300048916	Bacteria	7595
1167	Ga0496113_0019641	3300048916	Bacteria	4731
1168	Ga0496113_0027368	3300048916	Bacteria	4088
1169	Ga0496113_0072833	3300048916	Bacteria	2616
1170	Ga0496114_0008420	3300048917	Bacteria	8167
1171	Ga0496114_0051083	3300048917	Bacteria	3442
1172	Ga0496114_0169692	3300048917	Bacteria	1901
1173	Ga0496114_0327104	3300048917	Bacteria	1355
1174	Ga0496116_0000014	3300048919	Bacteria	569049
1175	Ga0496116_0001609	3300048919	Bacteria	24823
1176	Ga0496117_0000467	3300048920	Bacteria	67483
1177	Ga0496117_0008128	3300048920	Bacteria	10029
1178	Ga0496118_0000459	3300048921	Bacteria	67483
1179	Ga0496118_0003112	3300048921	Bacteria	21269
1180	Ga0496118_0008803	3300048921	Bacteria	10342
1181	Ga0496118_0029338	3300048921	Bacteria	4615
1182	Ga0496118_0109992	3300048921	Bacteria	1832
1183	Ga0496119_0000119	3300048922	Bacteria	110434
1184	Ga0496119_0000346	3300048922	Bacteria	65007
1185	Ga0496119_0051837	3300048922	Bacteria	2518
1186	Ga0496120_0031371	3300048923	Bacteria	3218
1187	Ga0496121_0000079	3300048924	Bacteria	232653
1188	Ga0496121_0000382	3300048924	Bacteria	90517
1189	Ga0496121_0000511	3300048924	Bacteria	73863
1190	Ga0496121_0002155	3300048924	Bacteria	30799
1191	Ga0496121_0009162	3300048924	Bacteria	11442
1192	Ga0496122_0000310	3300048925	Bacteria	107506
1193	Ga0496122_0000552	3300048925	Bacteria	77275
1194	Ga0496122_0000662	3300048925	Bacteria	69323
1195	Ga0496122_0001487	3300048925	Bacteria	37655
1196	Ga0496122_0027018	3300048925	Bacteria	4924
1197	Ga0496122_0085809	3300048925	Bacteria	2170
1198	Ga0496123_0000478	3300048926	Bacteria	69650
1199	Ga0496123_0000815	3300048926	Bacteria	50251
1200	Ga0496123_0001031	3300048926	Bacteria	42310
1201	Ga0496123_0007781	3300048926	Bacteria	9984
1202	Ga0496123_0060403	3300048926	Bacteria	2444
1203	Ga0496123_0126229	3300048926	Bacteria	1427
1204	Ga0496124_0000499	3300048927	Bacteria	67483
1205	Ga0496124_0000569	3300048927	Bacteria	62485
1206	Ga0496124_0006777	3300048927	Bacteria	12374
1207	Ga0496124_0008365	3300048927	Bacteria	10832
1208	Ga0496124_0043380	3300048927	Bacteria	3867
1209	Ga0496124_0278695	3300048927	Bacteria	1220
1210	Ga0496125_0000122	3300048928	Bacteria	174898
1211	Ga0496125_0000395	3300048928	Bacteria	81224
1212	Ga0496125_0001860	3300048928	Bacteria	29047
1213	Ga0496125_0003943	3300048928	Bacteria	17516
1214	Ga0496125_0005275	3300048928	Bacteria	14467
1215	Ga0496125_0008770	3300048928	Bacteria	10515
1216	Ga0496125_0029798	3300048928	Bacteria	4896
1217	Ga0496125_0202191	3300048928	Bacteria	1299
1218	Ga0496126_0006618	3300048929	Bacteria	12898
1219	Ga0496126_0020454	3300048929	Bacteria	6486
1220	Ga0496126_0151825	3300048929	Bacteria	1985
1221	Ga0496126_0186830	3300048929	Bacteria	1757
1222	Ga0495678_001207	3300049459	Bacteria	21222
1223	Ga0495678_002246	3300049459	Bacteria	13448
1224	Ga0495678_003338	3300049459	Bacteria	9996
1225	Ga0495678_009079	3300049459	Bacteria	4960
1226	Ga0495678_015185	3300049459	Bacteria	3554
1227	Ga0495678_015883	3300049459	Bacteria	3455
1228	Ga0495678_036129	3300049459	Bacteria	2019
1229	Ga0495678_052718	3300049459	Bacteria	1565
1230	Ga0495678_073908	3300049459	Bacteria	1241
1231	Ga0495682_0000039	3300049460	Bacteria	119714
1232	Ga0495682_0000410	3300049460	Bacteria	30462
1233	Ga0495682_0000749	3300049460	Bacteria	20952
1234	Ga0495682_0000926	3300049460	Bacteria	17782
1235	Ga0495682_0013509	3300049460	Bacteria	3106
1236	Ga0501031_0010394	3300049568	Bacteria	6061
1237	Ga0501031_0010803	3300049568	Bacteria	5947
1238	Ga0501031_0013109	3300049568	Bacteria	5407
1239	Ga0501031_0024216	3300049568	Bacteria	3957
1240	Ga0501031_0092593	3300049568	Bacteria	1972
1241	Ga0501031_0147415	3300049568	Bacteria	1537
1242	Ga0501031_0168856	3300049568	Bacteria	1429
1243	Ga0501032_0002092	3300049569	Bacteria	15735
1244	Ga0501032_0003209	3300049569	Bacteria	12570
1245	Ga0501032_0006722	3300049569	Bacteria	8439
1246	Ga0501032_0010214	3300049569	Bacteria	6776
1247	Ga0501032_0014996	3300049569	Bacteria	5480
1248	Ga0501032_0093180	3300049569	Bacteria	1998
1249	Ga0501033_0001171	3300049570	Bacteria	23655
1250	Ga0501033_0002171	3300049570	Bacteria	16930
1251	Ga0501033_0022401	3300049570	Bacteria	4766
1252	Ga0501033_0042082	3300049570	Unclassified	3406
1253	Ga0501033_0162376	3300049570	Bacteria	1608
1254	Ga0501034_0000106	3300049571	Bacteria	153523
1255	Ga0501034_0008467	3300049571	Bacteria	10864
1256	Ga0501034_0020595	3300049571	Bacteria	6736
1257	Ga0501034_0055155	3300049571	Bacteria	4000
1258	Ga0501034_0121765	3300049571	Bacteria	2595
1259	Ga0501036_0003079	3300049572	Bacteria	13298
1260	Ga0501036_0012260	3300049572	Bacteria	7101
1261	Ga0501036_0021057	3300049572	Bacteria	5477
1262	Ga0501036_0044297	3300049572	Bacteria	3769
1263	Ga0501036_0075491	3300049572	Bacteria	2850
1264	Ga0501036_0188381	3300049572	Bacteria	1736
1265	Ga0501037_0007407	3300049573	Bacteria	8023
1266	Ga0501037_0010386	3300049573	Bacteria	6831
1267	Ga0501037_0019972	3300049573	Bacteria	4944
1268	Ga0501037_0110019	3300049573	Bacteria	1985
1269	Ga0501037_0122942	3300049573	Bacteria	1865
1270	Ga0501037_0253784	3300049573	Bacteria	1230
1271	Ga0501037_0347067	3300049573	Bacteria	1024
1272	Ga0501038_0002634	3300049574	Bacteria	16782
1273	Ga0501038_0003415	3300049574	Bacteria	14802
1274	Ga0501038_0010728	3300049574	Bacteria	8375
1275	Ga0501038_0014617	3300049574	Bacteria	7152
1276	Ga0501038_0018815	3300049574	Bacteria	6234
1277	Ga0501038_0072181	3300049574	Bacteria	2926
1278	Ga0501038_0094812	3300049574	Bacteria	2494
1279	Ga0501038_0196611	3300049574	Bacteria	1620
1280	Ga0501038_0243660	3300049574	Bacteria	1426
1281	Ga0501038_0261647	3300049574	Bacteria	1367
1282	Ga0501039_0000282	3300049575	Bacteria	36301
1283	Ga0501039_0002340	3300049575	Bacteria	14096
1284	Ga0501039_0024041	3300049575	Bacteria	4679
1285	Ga0501039_0109677	3300049575	Bacteria	2157
1286	Ga0501040_0004628	3300049576	Bacteria	8924
1287	Ga0501040_0011583	3300049576	Bacteria	5772
1288	Ga0501040_0116572	3300049576	Bacteria	1871
1289	Ga0501041_0020186	3300049577	Bacteria	3980
1290	Ga0501041_0027866	3300049577	Bacteria	3406
1291	Ga0501042_0017244	3300049578	Bacteria	4978
1292	Ga0501042_0163828	3300049578	Bacteria	1604
1293	Ga0501043_0011878	3300049579	Bacteria	6821
1294	Ga0501043_0015353	3300049579	Bacteria	5998
1295	Ga0501043_0027415	3300049579	Bacteria	4472
1296	Ga0501043_0045241	3300049579	Bacteria	3462
1297	Ga0501043_0106392	3300049579	Bacteria	2203
1298	Ga0501043_0198016	3300049579	Bacteria	1560
1299	Ga0501046_0001006	3300049580	Bacteria	27557
1300	Ga0501046_0007593	3300049580	Bacteria	9511
1301	Ga0501046_0031213	3300049580	Bacteria	4321
1302	Ga0501046_0155916	3300049580	Bacteria	1720
1303	Ga0501047_0000036	3300049581	Bacteria	195504
1304	Ga0501047_0003625	3300049581	Bacteria	14548
1305	Ga0501047_0009898	3300049581	Bacteria	9012
1306	Ga0501047_0031744	3300049581	Bacteria	5095
1307	Ga0501047_0040722	3300049581	Bacteria	4492
1308	Ga0501047_0075216	3300049581	Bacteria	3250
1309	Ga0501047_0288475	3300049581	Bacteria	1485
1310	Ga0501047_0295781	3300049581	Bacteria	1462
1311	Ga0501048_0019782	3300049582	Bacteria	4937
1312	Ga0501048_0053301	3300049582	Bacteria	2877
1313	Ga0501048_0240324	3300049582	Bacteria	1285
1314	Ga0501067_0001886	3300049583	Bacteria	11508
1315	Ga0501068_0007938	3300049584	Bacteria	5884
1316	Ga0501068_0032522	3300049584	Bacteria	3103
1317	Ga0501069_0003811	3300049585	Bacteria	7758
1318	Ga0501070_0038723	3300049586	Bacteria	3978
1319	Ga0501071_0024811	3300049587	Bacteria	4194
1320	Ga0501071_0071954	3300049587	Bacteria	2521
1321	Ga0501072_0024579	3300049588	Bacteria	4688
1322	Ga0501073_0003630	3300049589	Bacteria	11602
1323	Ga0501073_0011234	3300049589	Bacteria	6550
1324	Ga0501073_0036317	3300049589	Bacteria	3502
1325	Ga0501073_0172633	3300049589	Bacteria	1497
1326	Ga0501073_0239640	3300049589	Bacteria	1253
1327	Ga0501073_0240221	3300049589	Bacteria	1251
1328	Ga0501074_0002288	3300049590	Bacteria	13324
1329	Ga0501074_0005080	3300049590	Bacteria	9445
1330	Ga0501074_0089514	3300049590	Bacteria	2204
1331	Ga0501075_0020312	3300049591	Bacteria	4830
1332	Ga0501076_0022686	3300049592	Bacteria	4826
1333	Ga0501076_0112372	3300049592	Bacteria	2203
1334	Ga0501076_0370151	3300049592	Bacteria	1177
1335	Ga0501243_001464	3300049675	Bacteria	3384
1336	Ga0501257_001732	3300049686	Bacteria	4549
1337	Ga0501079_0020833	3300049741	Bacteria	5013
1338	Ga0501080_0016873	3300049742	Bacteria	6744
1339	Ga0501080_0071579	3300049742	Bacteria	3225
1340	Ga0501080_0203779	3300049742	Bacteria	1815
1341	Ga0501081_0025728	3300049743	Bacteria	3962
1342	Ga0501081_0252980	3300049743	Bacteria	1286
1343	Ga0501083_0003958	3300049744	Bacteria	10404
1344	Ga0501083_0016958	3300049744	Bacteria	5086
1345	Ga0501241_000061	3300049758	Bacteria	27062
1346	Ga0501269_001275	3300049766	Bacteria	3375
1347	Ga0501280_001356	3300049776	Bacteria	4644
1348	Ga0501035_0001192	3300049822	Bacteria	27078
1349	Ga0501035_0003108	3300049822	Bacteria	15951
1350	Ga0501035_0028985	3300049822	Bacteria	5049
1351	Ga0501035_0039087	3300049822	Bacteria	4295
1352	Ga0501035_0040698	3300049822	Bacteria	4198
1353	Ga0501035_0373541	3300049822	Bacteria	1190
1354	Ga0501044_0000915	3300049823	Bacteria	35537
1355	Ga0501044_0009480	3300049823	Bacteria	10601
1356	Ga0501044_0025273	3300049823	Bacteria	6294
1357	Ga0501044_0055998	3300049823	Bacteria	4048
1358	Ga0501044_0075136	3300049823	Bacteria	3431
1359	Ga0501044_0093884	3300049823	Bacteria	3025
1360	Ga0501044_0107928	3300049823	Bacteria	2794
1361	Ga0501044_0139614	3300049823	Bacteria	2412
1362	Ga0501044_0215945	3300049823	Bacteria	1870
1363	Ga0501044_0227518	3300049823	Bacteria	1814
1364	Ga0501044_0236557	3300049823	Bacteria	1772
1365	Ga0501044_0240447	3300049823	Bacteria	1754
1366	Ga0501044_0428002	3300049823	Bacteria	1233
1367	Ga0501044_0487492	3300049823	Bacteria	1135
1368	Ga0501045_0035056	3300049824	Bacteria	3643
1369	Ga0501045_0081085	3300049824	Bacteria	2392
1370	Ga0501045_0160260	3300049824	Bacteria	1674
1371	nmdc:mga03683_12240_c1	3300050489	Bacteria	3129
1372	nmdc:mga03683_174_c1	3300050489	Bacteria	15592
1373	nmdc:mga03683_9790_c1	3300050489	Bacteria	3419
1374	nmdc:mga03n38_11270_c1	3300050490	Bacteria	3324
1375	nmdc:mga03n38_155138_c1	3300050490	Bacteria	1155
1376	nmdc:mga03n38_265_c1	3300050490	Bacteria	12400
1377	nmdc:mga00v17_11359_c1	3300050491	Bacteria	4894
1378	nmdc:mga00v17_141113_c1	3300050491	Bacteria	1545
1379	nmdc:mga00v17_195_c1	3300050491	Bacteria	36325
1380	nmdc:mga00v17_2323_c1	3300050491	Bacteria	9739
1381	nmdc:mga00v17_37683_c1	3300050491	Bacteria	2888
1382	nmdc:mga00v17_6863_c1	3300050491	Bacteria	6052
1383	nmdc:mga00v17_6918_c1	3300050491	Bacteria	6029
1384	nmdc:mga00v17_85329_c1	3300050491	Bacteria	1977
1385	nmdc:mga0yw44_1997_c1	3300050492	Bacteria	8478
1386	nmdc:mga0yw44_21739_c1	3300050492	Bacteria	3585
1387	nmdc:mga0yw44_224_c1	3300050492	Bacteria	19415
1388	nmdc:mga0yw44_32929_c1	3300050492	Bacteria	3024
1389	nmdc:mga0yw44_48330_c1	3300050492	Bacteria	2565
1390	nmdc:mga0k408_2031_c1	3300050493	Bacteria	10832
1391	nmdc:mga0k408_29312_c1	3300050493	Bacteria	3132
1392	nmdc:mga0k408_3752_c1	3300050493	Bacteria	8057
1393	nmdc:mga06z11_23022_c1	3300050494	Bacteria	2920
1394	nmdc:mga06z11_27245_c1	3300050494	Bacteria	2731
1395	nmdc:mga06z11_566_c1	3300050494	Bacteria	13548
1396	nmdc:mga06z11_66994_c1	3300050494	Bacteria	1889
1397	nmdc:mga04h51_16705_c1	3300050495	Bacteria	2134
1398	nmdc:mga07m45_1348_c1	3300050496	Bacteria	11186
1399	nmdc:mga07m45_28397_c1	3300050496	Bacteria	3088
1400	nmdc:mga07m45_4378_c1	3300050496	Bacteria	6912
1401	nmdc:mga0qj67_247037_c1	3300050509	Bacteria	1448
1402	nmdc:mga0n895_7312_c1	3300050512	Bacteria	9465
1403	nmdc:mga0rr50_23734_c1	3300050513	Bacteria	4236
1404	nmdc:mga08x19_16585_c1	3300050514	Bacteria	4494
1405	nmdc:mga0sz30_10786_c1	3300050516	Bacteria	3509
1406	nmdc:mga0sz30_46130_c1	3300050516	Bacteria	1839
1407	Ga0495601_0000136	3300053077	Bacteria	41775
1408	Ga0495601_0000631	3300053077	Bacteria	18818
1409	Ga0495601_0039665	3300053077	Bacteria	2949
1410	Ga0495601_0107814	3300053077	Bacteria	1802
1411	Ga0495612_0009485	3300053078	Bacteria	3947
1412	Ga0500610_0000020	3300053079	Bacteria	68771
1413	Ga0495655_0005623	3300053083	Bacteria	2226
1414	Ga0495655_0024373	3300053083	Bacteria	1405
1415	Ga0500643_000006	3300053087	Bacteria	479605
1416	Ga0500643_000288	3300053087	Bacteria	43145
1417	Ga0500643_000806	3300053087	Bacteria	20226
1418	Ga0500643_047016	3300053087	Bacteria	1245
1419	Ga0500644_0024613	3300053088	Bacteria	1843
1420	Ga0500646_0000243	3300053090	Bacteria	16708
1421	Ga0500583_0004080	3300053092	Bacteria	4705
1422	Ga0500660_058423	3300053100	Bacteria	1870
1423	Ga0500553_077520	3300053101	Bacteria	1507
1424	Ga0500556_0000694	3300053104	Bacteria	20691
1425	Ga0500556_0001563	3300053104	Bacteria	9298
1426	Ga0500562_000274	3300053108	Bacteria	12749
1427	Ga0500593_000390	3300053117	Bacteria	17526
1428	Ga0500628_001979	3300053129	Bacteria	3443
1429	Ga0500658_0011791	3300053134	Bacteria	3221
1430	Ga0500559_0000539	3300053136	Bacteria	26232
1431	Ga0500559_0088021	3300053136	Bacteria	1419
1432	Ga0500561_0004018	3300053137	Bacteria	2625
1433	Ga0500579_047035	3300053143	Bacteria	2666
1434	Ga0500588_0017800	3300053146	Bacteria	1862
1435	Ga0500588_0029193	3300053146	Bacteria	1571
1436	Ga0500600_0036492	3300053149	Bacteria	2857
1437	Ga0500616_0000090	3300053153	Bacteria	187734
1438	Ga0500616_0000366	3300053153	Bacteria	63761
1439	Ga0500616_0006429	3300053153	Bacteria	7695
1440	Ga0500624_003000	3300053157	Bacteria	2229
1441	Ga0500627_0097501	3300053158	Bacteria	1318
1442	Ga0500633_0003880	3300053160	Bacteria	3340
1443	Ga0500638_000052	3300053162	Bacteria	26431
1444	Ga0500636_0053914	3300053177	Bacteria	2359
1445	Ga0500645_013100	3300053730	Bacteria	2668
1446	Ga0500656_000664	3300053732	Bacteria	2661
1447	Ga0500565_000835	3300053734	Bacteria	1860
1448	Ga0500587_001296	3300053739	Bacteria	3503
1449	Ga0501084_0003841	3300054114	Bacteria	12227
1450	Ga0501084_0006423	3300054114	Bacteria	9662
1451	Ga0501084_0153371	3300054114	Unclassified	1942
1452	Ga0501082_0007219	3300060353	Bacteria	9578
1453	Ga0501082_0077527	3300060353	Bacteria	2865
1454	Ga0466962_0002590	3300061719	Bacteria	8589
1455	Ga0466962_0003058	3300061719	Bacteria	7970
1456	Ga0466962_0065263	3300061719	Bacteria	1738
1457	Ga0466962_0103894	3300061719	Bacteria	1365
1458	Ga0530510_0034331	3300061734	Bacteria	3653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009545	Ga0105237_10168910	Ga0105237_101689102	310
2	3300003322	rootL2_10011255	rootL2_100112552	311
3	3300049573	Ga0501037_0347067	Ga0501037_0347067_17_967	316
4	iso_pu_bacteria	2687453743	2689996405	319
5	3300046506	Ga0495583_0084457	Ga0495583_0084457_399_1361	320
6	3300053090	Ga0500646_0000243	Ga0500646_0000243_15255_16217	320
7	3300053092	Ga0500583_0004080	Ga0500583_0004080_768_1730	320
8	3300053146	Ga0500588_0017800	Ga0500588_0017800_622_1584	320
9	3300046471	Ga0495650_0002221	Ga0495650_0002221_11697_12662	321
10	3300050490	nmdc:mga03n38_11270_c1	nmdc:mga03n38_11270_c1_2298_3305	321
11	3300050494	nmdc:mga06z11_27245_c1	nmdc:mga06z11_27245_c1_64_1029	321
12	3300003792	Ga0055540_1000335	Ga0055540_100033520	322
13	3300025303	Ga0209051_1000294	Ga0209051_100029463	322
14	3300005471	Ga0070698_100094493	Ga0070698_1000944931	323
15	3300038443	Ga0395901_0130622	Ga0395901_0130622_1637_2611	324
16	3300049568	Ga0501031_0013109	Ga0501031_0013109_3827_4855	324
17	3300049568	Ga0501031_0147415	Ga0501031_0147415_503_1477	324
18	3300049570	Ga0501033_0162376	Ga0501033_0162376_61_1035	324
19	3300049573	Ga0501037_0122942	Ga0501037_0122942_292_1266	324
20	3300049573	Ga0501037_0253784	Ga0501037_0253784_220_1197	324
21	3300049580	Ga0501046_0155916	Ga0501046_0155916_634_1608	324
22	3300049587	Ga0501071_0071954	Ga0501071_0071954_493_1467	324
23	3300049591	Ga0501075_0020312	Ga0501075_0020312_178_1152	324
24	3300049592	Ga0501076_0022686	Ga0501076_0022686_3724_4698	324
25	3300049743	Ga0501081_0252980	Ga0501081_0252980_174_1148	324
26	3300049823	Ga0501044_0000915	Ga0501044_0000915_29528_30505	324
27	3300031730	Ga0307516_10004179	Ga0307516_1000417911	325
28	3300046501	Ga0495607_0035928	Ga0495607_0035928_1999_2976	325
29	3300046689	Ga0495613_0283440	Ga0495613_0283440_151_1128	325
30	3300049572	Ga0501036_0044297	Ga0501036_0044297_2650_3681	325
31	3300049574	Ga0501038_0003415	Ga0501038_0003415_2747_3778	325
32	3300049576	Ga0501040_0004628	Ga0501040_0004628_2429_3460	325
33	3300049577	Ga0501041_0027866	Ga0501041_0027866_212_1243	325
34	3300049579	Ga0501043_0045241	Ga0501043_0045241_155_1186	325
35	3300049584	Ga0501068_0032522	Ga0501068_0032522_258_1289	325
36	3300049587	Ga0501071_0024811	Ga0501071_0024811_1792_2823	325
37	3300049590	Ga0501074_0005080	Ga0501074_0005080_5468_6499	325
38	3300049592	Ga0501076_0112372	Ga0501076_0112372_961_1992	325
39	3300054114	Ga0501084_0006423	Ga0501084_0006423_8265_9296	325
40	3300046455	Ga0495603_0015983	Ga0495603_0015983_2949_3929	326
41	3300046459	Ga0495629_0010005	Ga0495629_0010005_2583_3563	326
42	3300046689	Ga0495613_0005666	Ga0495613_0005666_2844_3824	326
43	3300047321	Ga0495676_0036507	Ga0495676_0036507_2839_3819	326
44	3300048089	Ga0495614_0020059	Ga0495614_0020059_1791_2771	326
45	3300048917	Ga0496114_0169692	Ga0496114_0169692_907_1887	326
46	3300061734	Ga0530510_0034331	Ga0530510_0034331_323_1351	326
47	3300009093	Ga0105240_10001140	Ga0105240_100011408	327
48	3300013307	Ga0157372_10002002	Ga0157372_100020027	327
49	3300048909	Ga0496106_0135009	Ga0496106_0135009_12_995	327
50	3300049569	Ga0501032_0093180	Ga0501032_0093180_44_1027	327
51	3300046524	Ga0495648_0026949	Ga0495648_0026949_906_1913	329
52	iso_pu_bacteria	2643221615	2644092067	329
53	iso_pu_bacteria	2643221657	2644321870	329
54	3300025908	Ga0207643_10088240	Ga0207643_100882402	330
55	3300042008	Ga0439450_009204	Ga0439450_009204_32_1024	330
56	3300048908	Ga0496105_0128627	Ga0496105_0128627_230_1222	330
57	3300050491	nmdc:mga00v17_141113_c1	nmdc:mga00v17_141113_c1_27_1019	330
58	iso_pu_bacteria	2547132103	2547374727	330
59	iso_pu_bacteria	2900634093	2900642698	330
60	3300013307	Ga0157372_10021286	Ga0157372_100212862	331
61	3300042145	Ga0450906_000347	Ga0450906_000347_5845_6843	331
62	iso_pu_bacteria	2582581314	2585312308	331
63	iso_pu_bacteria	2684623035	2686539124	331
64	iso_pu_bacteria	2687453743	2689994600	331
65	iso_pu_bacteria	2791355137	2792837774	331
66	iso_pu_bacteria	2895880812	2895887647	331
67	iso_pu_bacteria	2929212328	2929214030	331
68	iso_pu_bacteria	3002998708	3003002588	331
69	3300005937	Ga0081455_10000942	Ga0081455_1000094217	332
70	3300005981	Ga0081538_10005332	Ga0081538_100053326	332
71	3300005983	Ga0081540_1063790	Ga0081540_10637901	332
72	3300006038	Ga0075365_10007998	Ga0075365_100079985	332
73	3300006880	Ga0075429_100203733	Ga0075429_1002037332	332
74	3300009011	Ga0105251_10046942	Ga0105251_100469422	332
75	3300009011	Ga0105251_10066983	Ga0105251_100669831	332
76	3300009036	Ga0105244_10023365	Ga0105244_100233652	332
77	3300009147	Ga0114129_10019234	Ga0114129_100192346	332
78	3300025728	Ga0207655_1000022	Ga0207655_1000022293	332
79	3300027907	Ga0207428_10028732	Ga0207428_100287323	332
80	3300044712	Ga0453684_0259954	Ga0453684_0259954_464_1474	332
81	3300045836	Ga0466958_0114456	Ga0466958_0114456_159_1166	332
82	3300046452	Ga0495617_028167	Ga0495617_028167_788_1798	332
83	3300046457	Ga0495590_0007568	Ga0495590_0007568_599_1609	332
84	3300046457	Ga0495590_0015204	Ga0495590_0015204_803_1813	332
85	3300046458	Ga0495591_000088	Ga0495591_000088_69275_70285	332
86	3300046460	Ga0495638_0001071	Ga0495638_0001071_5530_6540	332
87	3300046471	Ga0495650_0001808	Ga0495650_0001808_14359_15369	332
88	3300046474	Ga0495605_0000195	Ga0495605_0000195_62513_63523	332
89	3300046491	Ga0495584_0001017	Ga0495584_0001017_3082_4092	332
90	3300046491	Ga0495584_0002370	Ga0495584_0002370_4167_5180	332
91	3300046500	Ga0495596_0000061	Ga0495596_0000061_46015_47025	332
92	3300046501	Ga0495607_0001084	Ga0495607_0001084_18098_19108	332
93	3300046501	Ga0495607_0033723	Ga0495607_0033723_1862_2872	332
94	3300046507	Ga0495606_0005506	Ga0495606_0005506_7348_8358	332
95	3300046513	Ga0495616_0033012	Ga0495616_0033012_1664_2674	332
96	3300046519	Ga0495632_0000908	Ga0495632_0000908_5611_6621	332
97	3300046520	Ga0495637_0000113	Ga0495637_0000113_25764_26774	332
98	3300046522	Ga0495643_0018596	Ga0495643_0018596_2792_3802	332
99	3300046522	Ga0495643_0021770	Ga0495643_0021770_2571_3581	332
100	3300046523	Ga0495644_0021452	Ga0495644_0021452_1157_2167	332
101	3300046524	Ga0495648_0031424	Ga0495648_0031424_754_1764	332
102	3300046530	Ga0495654_0000799	Ga0495654_0000799_19494_20504	332
103	3300046530	Ga0495654_0017248	Ga0495654_0017248_345_1355	332
104	3300046530	Ga0495654_0064580	Ga0495654_0064580_160_1170	332
105	3300046542	Ga0495597_0002886	Ga0495597_0002886_2552_3562	332
106	3300046616	Ga0495668_0001118	Ga0495668_0001118_1732_2742	332
107	3300046660	Ga0495625_0014369	Ga0495625_0014369_2002_3012	332
108	3300046665	Ga0495661_0060608	Ga0495661_0060608_1033_2043	332
109	3300046692	Ga0495671_0005199	Ga0495671_0005199_2845_3858	332
110	3300046692	Ga0495671_0103777	Ga0495671_0103777_263_1273	332
111	3300046694	Ga0495649_0005034	Ga0495649_0005034_4358_5368	332
112	3300046794	Ga0495589_0005805	Ga0495589_0005805_4554_5564	332
113	3300046810	Ga0495660_0027303	Ga0495660_0027303_32_1042	332
114	3300047320	Ga0495672_0000190	Ga0495672_0000190_80952_81962	332
115	3300047320	Ga0495672_0000442	Ga0495672_0000442_30223_31233	332
116	3300047322	Ga0495680_0000992	Ga0495680_0000992_24979_25989	332
117	3300047322	Ga0495680_0046210	Ga0495680_0046210_1301_2311	332
118	3300047323	Ga0495683_0000253	Ga0495683_0000253_14574_15584	332
119	3300047323	Ga0495683_0003458	Ga0495683_0003458_5265_6275	332
120	3300047443	Ga0495687_002228	Ga0495687_002228_4275_5288	332
121	3300047469	Ga0495673_0001183	Ga0495673_0001183_20842_21852	332
122	3300047470	Ga0495681_0004705	Ga0495681_0004705_4156_5166	332
123	3300048091	Ga0495626_0000033	Ga0495626_0000033_96181_97191	332
124	3300048928	Ga0496125_0202191	Ga0496125_0202191_125_1171	332
125	3300049459	Ga0495678_073908	Ga0495678_073908_53_1063	332
126	3300049460	Ga0495682_0000039	Ga0495682_0000039_108435_109448	332
127	3300049568	Ga0501031_0010394	Ga0501031_0010394_2820_3866	332
128	3300049569	Ga0501032_0014996	Ga0501032_0014996_2254_3300	332
129	3300049570	Ga0501033_0042082	Ga0501033_0042082_2286_3362	332
130	3300049571	Ga0501034_0055155	Ga0501034_0055155_423_1469	332
131	3300049573	Ga0501037_0007407	Ga0501037_0007407_2367_3413	332
132	3300049574	Ga0501038_0014617	Ga0501038_0014617_3526_4572	332
133	3300049579	Ga0501043_0011878	Ga0501043_0011878_5183_6229	332
134	3300049580	Ga0501046_0031213	Ga0501046_0031213_2286_3332	332
135	3300049581	Ga0501047_0288475	Ga0501047_0288475_182_1228	332
136	3300049584	Ga0501068_0007938	Ga0501068_0007938_2661_3707	332
137	3300049586	Ga0501070_0038723	Ga0501070_0038723_768_1814	332
138	3300049589	Ga0501073_0011234	Ga0501073_0011234_3577_4623	332
139	3300049589	Ga0501073_0239640	Ga0501073_0239640_209_1207	332
140	3300049592	Ga0501076_0370151	Ga0501076_0370151_47_1093	332
141	3300049743	Ga0501081_0025728	Ga0501081_0025728_238_1284	332
142	3300049744	Ga0501083_0016958	Ga0501083_0016958_2058_3104	332
143	3300049822	Ga0501035_0039087	Ga0501035_0039087_493_1539	332
144	3300049823	Ga0501044_0055998	Ga0501044_0055998_844_1890	332
145	3300049824	Ga0501045_0160260	Ga0501045_0160260_391_1437	332
146	3300054114	Ga0501084_0153371	Ga0501084_0153371_45_1121	332
147	3300060353	Ga0501082_0077527	Ga0501082_0077527_252_1298	332
148	iso_pu_bacteria	2511231007	2511271868	332
149	iso_pu_bacteria	2511231010	2511290386	332
150	iso_pu_bacteria	2511231012	2511300026	332
151	iso_pu_bacteria	2511231014	2511314516	332
152	iso_pu_bacteria	2511231015	2511322094	332
153	iso_pu_bacteria	2511231017	2511331900	332
154	iso_pu_bacteria	2511231020	2511347854	332
155	iso_pu_bacteria	2511231021	2511354147	332
156	iso_pu_bacteria	2558860280	2559431727	332
157	iso_pu_bacteria	2599185316	2600023000	332
158	iso_pu_bacteria	2599185325	2600076368	332
159	iso_pu_bacteria	2619619299	2621300473	332
160	iso_pu_bacteria	2623620443	2624479896	332
161	iso_pu_bacteria	2643221558	2643811030	332
162	iso_pu_bacteria	2643221604	2644032370	332
163	iso_pu_bacteria	2738541265	2738673137	332
164	iso_pu_bacteria	2738541282	2738751530	332
165	iso_pu_bacteria	2738541303	2738860571	332
166	iso_pu_bacteria	2738543015	2739257939	332
167	iso_pu_bacteria	2751185897	2753764942	332
168	iso_pu_bacteria	2808606359	2808848596	332
169	iso_pu_bacteria	2808606418	2809145039	332
170	iso_pu_bacteria	2816332298	2817490452	332
171	iso_pu_bacteria	2852103415	2852108231	332
172	iso_pu_bacteria	3007718800	3007719907	332
173	iso_pu_bacteria	8015687852	8015691598	332
174	iso_pu_bacteria	8056172158	8056174141	332
175	iso_pu_bacteria	8056172158	8056174155	332
176	3300005288	Ga0065714_10002318	Ga0065714_100023189	333
177	3300005335	Ga0070666_10038372	Ga0070666_100383723	333
178	3300005436	Ga0070713_100086281	Ga0070713_1000862813	333
179	3300005937	Ga0081455_10049061	Ga0081455_100490612	333
180	3300006028	Ga0070717_10003368	Ga0070717_100033683	333
181	3300006038	Ga0075365_10021267	Ga0075365_100212673	333
182	3300006163	Ga0070715_10001319	Ga0070715_100013197	333
183	3300006186	Ga0075369_10051857	Ga0075369_100518572	333
184	3300009092	Ga0105250_10000052	Ga0105250_1000005234	333
185	3300025711	Ga0207696_1000003	Ga0207696_1000003175	333
186	3300025903	Ga0207680_10017843	Ga0207680_100178432	333
187	3300025906	Ga0207699_10115784	Ga0207699_101157842	333
188	3300025915	Ga0207693_10004935	Ga0207693_1000493512	333
189	3300025928	Ga0207700_10031541	Ga0207700_100315411	333
190	3300025939	Ga0207665_10000636	Ga0207665_1000063618	333
191	3300028786	Ga0307517_10099582	Ga0307517_100995822	333
192	3300028794	Ga0307515_10042191	Ga0307515_100421914	333
193	3300030522	Ga0307512_10008551	Ga0307512_100085514	333
194	3300031456	Ga0307513_10037999	Ga0307513_100379994	333
195	3300031616	Ga0307508_10004136	Ga0307508_100041366	333
196	3300031730	Ga0307516_10105779	Ga0307516_101057792	333
197	3300033179	Ga0307507_10000031	Ga0307507_1000003122	333
198	3300044673	Ga0453683_0019366	Ga0453683_0019366_2188_3198	333
199	3300046460	Ga0495638_0017740	Ga0495638_0017740_2666_3679	333
200	3300046463	Ga0495653_0001089	Ga0495653_0001089_16274_17290	333
201	3300046471	Ga0495650_0002985	Ga0495650_0002985_3232_4245	333
202	3300046474	Ga0495605_0001546	Ga0495605_0001546_4816_5829	333
203	3300046492	Ga0495585_0002260	Ga0495585_0002260_2779_3795	333
204	3300046492	Ga0495585_0092144	Ga0495585_0092144_478_1494	333
205	3300046500	Ga0495596_0001643	Ga0495596_0001643_8490_9503	333
206	3300046507	Ga0495606_0000081	Ga0495606_0000081_146114_147130	333
207	3300046507	Ga0495606_0005029	Ga0495606_0005029_8629_9642	333
208	3300046513	Ga0495616_0002680	Ga0495616_0002680_7625_8638	333
209	3300046518	Ga0495631_0017620	Ga0495631_0017620_2070_3083	333
210	3300046519	Ga0495632_0008756	Ga0495632_0008756_1812_2825	333
211	3300046530	Ga0495654_0002606	Ga0495654_0002606_3076_4089	333
212	3300046542	Ga0495597_0002240	Ga0495597_0002240_8580_9593	333
213	3300046616	Ga0495668_0043700	Ga0495668_0043700_1056_2069	333
214	3300046665	Ga0495661_0000010	Ga0495661_0000010_106507_107523	333
215	3300046678	Ga0495599_0001037	Ga0495599_0001037_14047_15054	333
216	3300046679	Ga0495623_0003834	Ga0495623_0003834_492_1499	333
217	3300046692	Ga0495671_0001728	Ga0495671_0001728_4603_5616	333
218	3300046694	Ga0495649_0013467	Ga0495649_0013467_3142_4155	333
219	3300046810	Ga0495660_0002257	Ga0495660_0002257_8552_9565	333
220	3300047317	Ga0495604_0034809	Ga0495604_0034809_318_1325	333
221	3300047444	Ga0495675_0230393	Ga0495675_0230393_30_1037	333
222	3300047469	Ga0495673_0002914	Ga0495673_0002914_6163_7176	333
223	3300047470	Ga0495681_0003820	Ga0495681_0003820_6621_7634	333
224	3300048088	Ga0495602_0006180	Ga0495602_0006180_10855_11862	333
225	3300048091	Ga0495626_0002344	Ga0495626_0002344_8630_9643	333
226	3300048928	Ga0496125_0000122	Ga0496125_0000122_1902_2915	333
227	3300049459	Ga0495678_002246	Ga0495678_002246_4678_5691	333
228	3300049572	Ga0501036_0188381	Ga0501036_0188381_142_1173	333
229	3300049589	Ga0501073_0036317	Ga0501073_0036317_2286_3293	333
230	3300050491	nmdc:mga00v17_6918_c1	nmdc:mga00v17_6918_c1_2828_3835	333
231	3300050492	nmdc:mga0yw44_32929_c1	nmdc:mga0yw44_32929_c1_1735_2742	333
232	3300050516	nmdc:mga0sz30_10786_c1	nmdc:mga0sz30_10786_c1_1391_2398	333
233	3300053087	Ga0500643_047016	Ga0500643_047016_102_1109	333
234	3300053088	Ga0500644_0024613	Ga0500644_0024613_449_1453	333
235	iso_pu_bacteria	2513237151	2513962115	333
236	iso_pu_bacteria	2515154123	2515687836	333
237	iso_pu_bacteria	2524023250	2524613814	333
238	iso_pu_bacteria	2721755755	2723848337	333
239	iso_pu_bacteria	2738541307	2738886481	333
240	iso_pu_bacteria	2751185846	2753568354	333
241	iso_pu_bacteria	2786546132	2786666593	333
242	iso_pu_bacteria	2791355199	2793080200	333
243	iso_pu_bacteria	2858688981	2858692522	333
244	iso_pu_bacteria	2895427314	2895428621	333
245	iso_pu_bacteria	2904541872	2904549507	333
246	iso_pu_bacteria	2904615490	2904619292	333
247	iso_pu_bacteria	2919138771	2919140844	333
248	iso_pu_bacteria	2939573065	2939575007	333
249	iso_pu_bacteria	2954673503	2954681684	333
250	iso_pu_bacteria	2954711539	2954711922	333
251	iso_pu_bacteria	2954721474	2954721856	333
252	iso_pu_bacteria	2954731030	2954739993	333
253	iso_pu_bacteria	2954740390	2954740752	333
254	iso_pu_bacteria	2954749733	2954758811	333
255	iso_pu_bacteria	2954759201	2954759762	333
256	iso_pu_bacteria	8004212874	8004212912	333
257	iso_pu_bacteria	8006984368	8006989693	333
258	3300003323	rootH1_10007244	rootH1_1000724416	334
259	3300003784	Ga0055534_1008400	Ga0055534_10084002	334
260	3300003791	Ga0055530_10000093	Ga0055530_1000009317	334
261	3300003791	Ga0055530_10000104	Ga0055530_1000010431	334
262	3300003794	Ga0055531_10000432	Ga0055531_1000043231	334
263	3300005288	Ga0065714_10002253	Ga0065714_1000225324	334
264	3300005367	Ga0070667_100001179	Ga0070667_1000011791	334
265	3300005367	Ga0070667_100459785	Ga0070667_1004597851	334
266	3300006048	Ga0075363_100028448	Ga0075363_1000284485	334
267	3300006051	Ga0075364_10050527	Ga0075364_100505272	334
268	3300006058	Ga0075432_10064286	Ga0075432_100642862	334
269	3300006177	Ga0075362_10033344	Ga0075362_100333442	334
270	3300006186	Ga0075369_10083844	Ga0075369_100838442	334
271	3300006195	Ga0075366_10108758	Ga0075366_101087581	334
272	3300009036	Ga0105244_10000488	Ga0105244_1000048830	334
273	3300009036	Ga0105244_10009031	Ga0105244_100090312	334
274	3300009545	Ga0105237_10028483	Ga0105237_100284834	334
275	3300010375	Ga0105239_10003283	Ga0105239_1000328320	334
276	3300010375	Ga0105239_10166869	Ga0105239_101668692	334
277	3300010375	Ga0105239_10360114	Ga0105239_103601141	334
278	3300013100	Ga0157373_10004285	Ga0157373_100042857	334
279	3300013102	Ga0157371_10006002	Ga0157371_100060024	334
280	3300013104	Ga0157370_10004423	Ga0157370_1000442316	334
281	3300013308	Ga0157375_10000312	Ga0157375_1000031212	334
282	3300014325	Ga0163163_10171930	Ga0163163_101719302	334
283	3300015261	Ga0182006_1001200	Ga0182006_100120016	334
284	3300017792	Ga0163161_10002299	Ga0163161_100022996	334
285	3300017792	Ga0163161_10048305	Ga0163161_100483053	334
286	3300017792	Ga0163161_10055743	Ga0163161_100557432	334
287	3300025291	Ga0209675_1000132	Ga0209675_100013262	334
288	3300025292	Ga0209676_1000118	Ga0209676_100011814	334
289	3300025292	Ga0209676_1006141	Ga0209676_10061415	334
290	3300025298	Ga0209050_1000115	Ga0209050_1000115108	334
291	3300025298	Ga0209050_1001181	Ga0209050_100118124	334
292	3300025304	Ga0209257_1000160	Ga0209257_100016082	334
293	3300025728	Ga0207655_1006740	Ga0207655_10067404	334
294	3300025728	Ga0207655_1029269	Ga0207655_10292692	334
295	3300025728	Ga0207655_1035585	Ga0207655_10355852	334
296	3300025986	Ga0207658_10000947	Ga0207658_100009471	334
297	3300027312	Ga0209371_1001588	Ga0209371_10015889	334
298	3300027907	Ga0207428_10008192	Ga0207428_100081927	334
299	3300028786	Ga0307517_10078648	Ga0307517_100786481	334
300	3300028794	Ga0307515_10279768	Ga0307515_102797681	334
301	3300030500	Ga0268256_1001370	Ga0268256_10013709	334
302	3300030522	Ga0307512_10022005	Ga0307512_100220052	334
303	3300031824	Ga0307413_10118980	Ga0307413_101189802	334
304	3300031838	Ga0307518_10001376	Ga0307518_100013765	334
305	3300031911	Ga0307412_10000304	Ga0307412_100003043	334
306	3300032004	Ga0307414_10015307	Ga0307414_100153076	334
307	3300037312	Ga0395899_0023133	Ga0395899_0023133_875_1900	334
308	3300038705	Ga0237819_01112	Ga0237819_01112_1365_2384	334
309	3300039447	Ga0436361_0659434	Ga0436361_0659434_472_1494	334
310	3300039447	Ga0436361_1220162	Ga0436361_1220162_532_1566	334
311	3300041411	Ga0439466_0003736	Ga0439466_0003736_4528_5547	334
312	3300042009	Ga0439451_000134	Ga0439451_000134_4304_5323	334
313	3300042010	Ga0439452_000130	Ga0439452_000130_30667_31686	334
314	3300042115	Ga0450911_003786	Ga0450911_003786_675_1685	334
315	3300046452	Ga0495617_006827	Ga0495617_006827_2651_3670	334
316	3300046452	Ga0495617_014761	Ga0495617_014761_1483_2502	334
317	3300046452	Ga0495617_052606	Ga0495617_052606_172_1203	334
318	3300046455	Ga0495603_0019131	Ga0495603_0019131_2625_3629	334
319	3300046457	Ga0495590_0000965	Ga0495590_0000965_11464_12483	334
320	3300046457	Ga0495590_0044467	Ga0495590_0044467_145_1164	334
321	3300046458	Ga0495591_000005	Ga0495591_000005_61140_62159	334
322	3300046458	Ga0495591_009522	Ga0495591_009522_2720_3739	334
323	3300046459	Ga0495629_0019619	Ga0495629_0019619_2339_3343	334
324	3300046460	Ga0495638_0004007	Ga0495638_0004007_8731_9750	334
325	3300046460	Ga0495638_0040011	Ga0495638_0040011_1332_2351	334
326	3300046471	Ga0495650_0001536	Ga0495650_0001536_19385_20404	334
327	3300046474	Ga0495605_0000199	Ga0495605_0000199_27628_28647	334
328	3300046474	Ga0495605_0007942	Ga0495605_0007942_61_1065	334
329	3300046474	Ga0495605_0019276	Ga0495605_0019276_642_1661	334
330	3300046477	Ga0495664_0032744	Ga0495664_0032744_1304_2317	334
331	3300046477	Ga0495664_0097429	Ga0495664_0097429_134_1156	334
332	3300046491	Ga0495584_0024427	Ga0495584_0024427_1803_2822	334
333	3300046492	Ga0495585_0000142	Ga0495585_0000142_68765_69784	334
334	3300046492	Ga0495585_0000577	Ga0495585_0000577_15140_16159	334
335	3300046501	Ga0495607_0001219	Ga0495607_0001219_12520_13539	334
336	3300046501	Ga0495607_0003744	Ga0495607_0003744_2474_3505	334
337	3300046501	Ga0495607_0006485	Ga0495607_0006485_2331_3350	334
338	3300046506	Ga0495583_0002568	Ga0495583_0002568_12414_13433	334
339	3300046506	Ga0495583_0071013	Ga0495583_0071013_352_1356	334
340	3300046507	Ga0495606_0000525	Ga0495606_0000525_6705_7724	334
341	3300046507	Ga0495606_0005176	Ga0495606_0005176_4068_5072	334
342	3300046512	Ga0495610_0008811	Ga0495610_0008811_3650_4669	334
343	3300046513	Ga0495616_0008012	Ga0495616_0008012_4613_5632	334
344	3300046513	Ga0495616_0014248	Ga0495616_0014248_2742_3746	334
345	3300046517	Ga0495630_0002568	Ga0495630_0002568_6914_7933	334
346	3300046517	Ga0495630_0063736	Ga0495630_0063736_1056_2075	334
347	3300046519	Ga0495632_0000058	Ga0495632_0000058_41867_42886	334
348	3300046519	Ga0495632_0000518	Ga0495632_0000518_9079_10098	334
349	3300046519	Ga0495632_0000983	Ga0495632_0000983_5908_6927	334
350	3300046519	Ga0495632_0019335	Ga0495632_0019335_2162_3181	334
351	3300046520	Ga0495637_0000315	Ga0495637_0000315_18688_19707	334
352	3300046520	Ga0495637_0023593	Ga0495637_0023593_998_2029	334
353	3300046522	Ga0495643_0000044	Ga0495643_0000044_134906_135916	334
354	3300046522	Ga0495643_0000880	Ga0495643_0000880_12529_13548	334
355	3300046522	Ga0495643_0002862	Ga0495643_0002862_5475_6494	334
356	3300046523	Ga0495644_0001098	Ga0495644_0001098_2865_3884	334
357	3300046524	Ga0495648_0000241	Ga0495648_0000241_6703_7722	334
358	3300046524	Ga0495648_0002312	Ga0495648_0002312_14124_15143	334
359	3300046524	Ga0495648_0016866	Ga0495648_0016866_1362_2381	334
360	3300046524	Ga0495648_0017766	Ga0495648_0017766_4029_5033	334
361	3300046526	Ga0495666_0009363	Ga0495666_0009363_1323_2342	334
362	3300046526	Ga0495666_0038050	Ga0495666_0038050_494_1513	334
363	3300046526	Ga0495666_0062478	Ga0495666_0062478_764_1768	334
364	3300046528	Ga0495642_0000003	Ga0495642_0000003_37275_38294	334
365	3300046535	Ga0495586_0042300	Ga0495586_0042300_86_1111	334
366	3300046538	Ga0495609_0000490	Ga0495609_0000490_18285_19304	334
367	3300046542	Ga0495597_0000216	Ga0495597_0000216_28397_29407	334
368	3300046542	Ga0495597_0007992	Ga0495597_0007992_3161_4165	334
369	3300046543	Ga0495645_0011206	Ga0495645_0011206_4447_5469	334
370	3300046557	Ga0495622_0006141	Ga0495622_0006141_3273_4277	334
371	3300046557	Ga0495622_0019278	Ga0495622_0019278_596_1615	334
372	3300046558	Ga0495633_0010354	Ga0495633_0010354_1748_2752	334
373	3300046615	Ga0495656_0000104	Ga0495656_0000104_15799_16818	334
374	3300046642	Ga0495634_0016136	Ga0495634_0016136_2224_3228	334
375	3300046648	Ga0495611_0025688	Ga0495611_0025688_596_1600	334
376	3300046660	Ga0495625_0001678	Ga0495625_0001678_10740_11762	334
377	3300046660	Ga0495625_0031487	Ga0495625_0031487_1170_2174	334
378	3300046660	Ga0495625_0032310	Ga0495625_0032310_1874_2893	334
379	3300046664	Ga0495659_0000116	Ga0495659_0000116_19379_20398	334
380	3300046665	Ga0495661_0000049	Ga0495661_0000049_115226_116239	334
381	3300046665	Ga0495661_0017164	Ga0495661_0017164_2311_3315	334
382	3300046665	Ga0495661_0031376	Ga0495661_0031376_755_1786	334
383	3300046684	Ga0495669_0000263	Ga0495669_0000263_6316_7335	334
384	3300046691	Ga0495670_0008981	Ga0495670_0008981_2196_3215	334
385	3300046692	Ga0495671_0001868	Ga0495671_0001868_5900_6919	334
386	3300046692	Ga0495671_0034418	Ga0495671_0034418_1032_2051	334
387	3300046694	Ga0495649_0000039	Ga0495649_0000039_85132_86154	334
388	3300046694	Ga0495649_0019649	Ga0495649_0019649_2574_3593	334
389	3300046694	Ga0495649_0022739	Ga0495649_0022739_481_1485	334
390	3300046794	Ga0495589_0000549	Ga0495589_0000549_18483_19502	334
391	3300046794	Ga0495589_0034424	Ga0495589_0034424_937_1941	334
392	3300046810	Ga0495660_0000517	Ga0495660_0000517_18285_19304	334
393	3300046810	Ga0495660_0021034	Ga0495660_0021034_2060_3082	334
394	3300046810	Ga0495660_0026115	Ga0495660_0026115_1129_2148	334
395	3300047318	Ga0495636_0005002	Ga0495636_0005002_1429_2448	334
396	3300047319	Ga0495674_0070938	Ga0495674_0070938_1614_2627	334
397	3300047320	Ga0495672_0002680	Ga0495672_0002680_2583_3602	334
398	3300047320	Ga0495672_0080258	Ga0495672_0080258_549_1568	334
399	3300047321	Ga0495676_0000393	Ga0495676_0000393_20942_21973	334
400	3300047321	Ga0495676_0030011	Ga0495676_0030011_3414_4418	334
401	3300047322	Ga0495680_0002710	Ga0495680_0002710_7655_8674	334
402	3300047323	Ga0495683_0003035	Ga0495683_0003035_5530_6549	334
403	3300047443	Ga0495687_029428	Ga0495687_029428_156_1160	334
404	3300047444	Ga0495675_0000123	Ga0495675_0000123_28471_29490	334
405	3300047444	Ga0495675_0007815	Ga0495675_0007815_671_1690	334
406	3300047445	Ga0495677_0000047	Ga0495677_0000047_23232_24251	334
407	3300047447	Ga0495685_041402	Ga0495685_041402_11_1015	334
408	3300047469	Ga0495673_0000178	Ga0495673_0000178_46980_47999	334
409	3300047469	Ga0495673_0018987	Ga0495673_0018987_157_1176	334
410	3300047470	Ga0495681_0000026	Ga0495681_0000026_88960_89979	334
411	3300047470	Ga0495681_0002726	Ga0495681_0002726_8363_9382	334
412	3300047472	Ga0495686_0098785	Ga0495686_0098785_377_1396	334
413	3300047673	Ga0495593_0002886	Ga0495593_0002886_7638_8657	334
414	3300048089	Ga0495614_0005865	Ga0495614_0005865_2018_3022	334
415	3300048091	Ga0495626_0000132	Ga0495626_0000132_38864_39883	334
416	3300048091	Ga0495626_0000522	Ga0495626_0000522_25063_26082	334
417	3300048091	Ga0495626_0014908	Ga0495626_0014908_2793_3797	334
418	3300048907	Ga0496104_0078834	Ga0496104_0078834_660_1685	334
419	3300048913	Ga0496110_0004506	Ga0496110_0004506_444_1463	334
420	3300048914	Ga0496111_0295995	Ga0496111_0295995_141_1148	334
421	3300048916	Ga0496113_0000915	Ga0496113_0000915_7642_8655	334
422	3300048925	Ga0496122_0000552	Ga0496122_0000552_25320_26333	334
423	3300048925	Ga0496122_0027018	Ga0496122_0027018_2924_3955	334
424	3300048926	Ga0496123_0001031	Ga0496123_0001031_25327_26340	334
425	3300048927	Ga0496124_0008365	Ga0496124_0008365_548_1567	334
426	3300048928	Ga0496125_0001860	Ga0496125_0001860_20462_21481	334
427	3300048929	Ga0496126_0151825	Ga0496126_0151825_585_1595	334
428	3300049459	Ga0495678_001207	Ga0495678_001207_3466_4485	334
429	3300049459	Ga0495678_015185	Ga0495678_015185_81_1100	334
430	3300049459	Ga0495678_015883	Ga0495678_015883_1984_3003	334
431	3300049459	Ga0495678_052718	Ga0495678_052718_20_1024	334
432	3300049460	Ga0495682_0000410	Ga0495682_0000410_24534_25553	334
433	3300049460	Ga0495682_0000749	Ga0495682_0000749_6858_7877	334
434	3300049460	Ga0495682_0000926	Ga0495682_0000926_6766_7785	334
435	3300049460	Ga0495682_0013509	Ga0495682_0013509_1803_2822	334
436	3300050489	nmdc:mga03683_9790_c1	nmdc:mga03683_9790_c1_1294_2331	334
437	3300050491	nmdc:mga00v17_37683_c1	nmdc:mga00v17_37683_c1_1289_2308	334
438	3300053104	Ga0500556_0000694	Ga0500556_0000694_12820_13824	334
439	3300053108	Ga0500562_000274	Ga0500562_000274_6431_7435	334
440	3300053117	Ga0500593_000390	Ga0500593_000390_15709_16713	334
441	3300053136	Ga0500559_0000539	Ga0500559_0000539_1777_2781	334
442	3300053136	Ga0500559_0088021	Ga0500559_0088021_210_1232	334
443	3300053153	Ga0500616_0000366	Ga0500616_0000366_18526_19536	334
444	iso_pu_bacteria	2511231006	2511265326	334
445	iso_pu_bacteria	2511231015	2511322662	334
446	iso_pu_bacteria	2511231020	2511348960	334
447	iso_pu_bacteria	2515154189	2516021844	334
448	iso_pu_bacteria	2599185169	2599408945	334
449	iso_pu_bacteria	2600255067	2600815086	334
450	iso_pu_bacteria	2600255254	2601522538	334
451	iso_pu_bacteria	2600255255	2601527565	334
452	iso_pu_bacteria	2600255280	2601614396	334
453	iso_pu_bacteria	2600255281	2601619116	334
454	iso_pu_bacteria	2600255287	2601642264	334
455	iso_pu_bacteria	2600255288	2601647126	334
456	iso_pu_bacteria	2600255289	2601652543	334
457	iso_pu_bacteria	2600255290	2601657869	334
458	iso_pu_bacteria	2600255291	2601662087	334
459	iso_pu_bacteria	2600255298	2601695045	334
460	iso_pu_bacteria	2600255299	2601699717	334
461	iso_pu_bacteria	2600255300	2601706388	334
462	iso_pu_bacteria	2600255301	2601710694	334
463	iso_pu_bacteria	2600255302	2601715708	334
464	iso_pu_bacteria	2600255303	2601720068	334
465	iso_pu_bacteria	2600255304	2601726114	334
466	iso_pu_bacteria	2600255305	2601730655	334
467	iso_pu_bacteria	2600255306	2601735671	334
468	iso_pu_bacteria	2600255307	2601740939	334
469	iso_pu_bacteria	2600255309	2601750869	334
470	iso_pu_bacteria	2600255392	2602018123	334
471	iso_pu_bacteria	2602042052	2603659449	334
472	iso_pu_bacteria	2602042053	2603664724	334
473	iso_pu_bacteria	2602042103	2603838047	334
474	iso_pu_bacteria	2602042104	2603843125	334
475	iso_pu_bacteria	2602042105	2603848198	334
476	iso_pu_bacteria	2602042106	2603853273	334
477	iso_pu_bacteria	2602042110	2603871324	334
478	iso_pu_bacteria	2602042111	2603876255	334
479	iso_pu_bacteria	2603880178	2606048517	334
480	iso_pu_bacteria	2603880184	2606069151	334
481	iso_pu_bacteria	2603880202	2606144973	334
482	iso_pu_bacteria	2603880211	2606175918	334
483	iso_pu_bacteria	2619619299	2621299508	334
484	iso_pu_bacteria	2636415599	2637224820	334
485	iso_pu_bacteria	2675903046	2676406085	334
486	iso_pu_bacteria	2738543015	2739261348	334
487	iso_pu_bacteria	2775507074	2777022155	334
488	iso_pu_bacteria	2808606372	2808900092	334
489	iso_pu_bacteria	2816332298	2817490871	334
490	iso_pu_bacteria	2843690924	2843693297	334
491	iso_pu_bacteria	2862382967	2862385394	334
492	iso_pu_bacteria	2874604998	2874611376	334
493	iso_pu_bacteria	2881101125	2881104882	334
494	iso_pu_bacteria	2885266251	2885267480	334
495	iso_pu_bacteria	2891048133	2891052136	334
496	iso_pu_bacteria	2904513164	2904514292	334
497	iso_pu_bacteria	2969079654	2969081800	334
498	iso_pu_bacteria	2984559226	2984564225	334
499	iso_pu_bacteria	2984595703	2984596960	334
500	iso_pu_bacteria	8008558824	8008559210	334
501	iso_pu_bacteria	8033684223	8033688493	334
502	iso_pu_bacteria	8048406513	8048408705	334
503	iso_pu_bacteria	8055878733	8055883933	334
504	3300005367	Ga0070667_100143708	Ga0070667_1001437082	335
505	3300005435	Ga0070714_100126052	Ga0070714_1001260522	335
506	3300005719	Ga0068861_100162040	Ga0068861_1001620402	335
507	3300005985	Ga0081539_10001862	Ga0081539_1000186233	335
508	3300006038	Ga0075365_10000382	Ga0075365_100003827	335
509	3300006038	Ga0075365_10048223	Ga0075365_100482232	335
510	3300006042	Ga0075368_10029108	Ga0075368_100291082	335
511	3300006048	Ga0075363_100062426	Ga0075363_1000624261	335
512	3300006051	Ga0075364_10033429	Ga0075364_100334292	335
513	3300006177	Ga0075362_10094356	Ga0075362_100943562	335
514	3300006178	Ga0075367_10000249	Ga0075367_1000024917	335
515	3300006178	Ga0075367_10000257	Ga0075367_100002579	335
516	3300006353	Ga0075370_10000455	Ga0075370_1000045513	335
517	3300006846	Ga0075430_100094610	Ga0075430_1000946102	335
518	3300006946	Ga0079104_1002857	Ga0079104_10028576	335
519	3300009545	Ga0105237_10329919	Ga0105237_103299192	335
520	3300009551	Ga0105238_10159496	Ga0105238_101594962	335
521	3300010375	Ga0105239_10031465	Ga0105239_100314654	335
522	3300017792	Ga0163161_10024418	Ga0163161_100244186	335
523	3300025229	Ga0209147_100430	Ga0209147_10043019	335
524	3300025273	Ga0209673_1028864	Ga0209673_10288642	335
525	3300025302	Ga0207426_1006425	Ga0207426_10064251	335
526	3300025303	Ga0209051_1005966	Ga0209051_10059665	335
527	3300025303	Ga0209051_1045640	Ga0209051_10456401	335
528	3300025914	Ga0207671_10156617	Ga0207671_101566172	335
529	3300025920	Ga0207649_10039932	Ga0207649_100399322	335
530	3300025924	Ga0207694_10348615	Ga0207694_103486151	335
531	3300025932	Ga0207690_10149493	Ga0207690_101494932	335
532	3300025986	Ga0207658_10004952	Ga0207658_100049529	335
533	3300026041	Ga0207639_10443242	Ga0207639_104432421	335
534	3300026067	Ga0207678_10003208	Ga0207678_100032086	335
535	3300026118	Ga0207675_100019177	Ga0207675_1000191777	335
536	3300028786	Ga0307517_10002656	Ga0307517_1000265617	335
537	3300028794	Ga0307515_10265026	Ga0307515_102650261	335
538	3300030521	Ga0307511_10000050	Ga0307511_1000005029	335
539	3300030521	Ga0307511_10000401	Ga0307511_1000040121	335
540	3300030521	Ga0307511_10034094	Ga0307511_100340944	335
541	3300030522	Ga0307512_10055026	Ga0307512_100550262	335
542	3300031344	Ga0265316_10005411	Ga0265316_100054117	335
543	3300031456	Ga0307513_10001108	Ga0307513_1000110833	335
544	3300031507	Ga0307509_10019317	Ga0307509_100193171	335
545	3300031507	Ga0307509_10028803	Ga0307509_100288035	335
546	3300031616	Ga0307508_10041918	Ga0307508_100419182	335
547	3300031616	Ga0307508_10089809	Ga0307508_100898093	335
548	3300031649	Ga0307514_10070607	Ga0307514_100706072	335
549	3300031730	Ga0307516_10005739	Ga0307516_1000573913	335
550	3300031730	Ga0307516_10026058	Ga0307516_100260585	335
551	3300031730	Ga0307516_10030738	Ga0307516_100307383	335
552	3300031838	Ga0307518_10023205	Ga0307518_100232055	335
553	3300031911	Ga0307412_10040867	Ga0307412_100408672	335
554	3300031995	Ga0307409_100404966	Ga0307409_1004049662	335
555	3300033179	Ga0307507_10000003	Ga0307507_10000003191	335
556	3300033179	Ga0307507_10011820	Ga0307507_100118202	335
557	3300033180	Ga0307510_10009123	Ga0307510_1000912311	335
558	3300033180	Ga0307510_10027972	Ga0307510_100279725	335
559	3300037418	Ga0395900_0440889	Ga0395900_0440889_104_1117	335
560	3300037466	Ga0395898_0012419	Ga0395898_0012419_4261_5289	335
561	3300038443	Ga0395901_0288605	Ga0395901_0288605_26_1039	335
562	3300041456	Ga0451795_0226724	Ga0451795_0226724_1356_2369	335
563	3300042005	Ga0439448_0010380	Ga0439448_0010380_1467_2480	335
564	3300042137	Ga0450902_009804	Ga0450902_009804_114_1136	335
565	3300042157	Ga0439458_0003190	Ga0439458_0003190_1465_2478	335
566	3300044842	Ga0466957_0143405	Ga0466957_0143405_117_1130	335
567	3300046452	Ga0495617_000642	Ga0495617_000642_6519_7538	335
568	3300046452	Ga0495617_010652	Ga0495617_010652_1053_2063	335
569	3300046453	Ga0495627_000254	Ga0495627_000254_18358_19380	335
570	3300046455	Ga0495603_0002962	Ga0495603_0002962_2433_3443	335
571	3300046458	Ga0495591_003293	Ga0495591_003293_2338_3357	335
572	3300046459	Ga0495629_0008564	Ga0495629_0008564_1121_2131	335
573	3300046460	Ga0495638_0011558	Ga0495638_0011558_341_1363	335
574	3300046460	Ga0495638_0042721	Ga0495638_0042721_548_1558	335
575	3300046460	Ga0495638_0064128	Ga0495638_0064128_1162_2184	335
576	3300046471	Ga0495650_0005447	Ga0495650_0005447_2029_3051	335
577	3300046471	Ga0495650_0019653	Ga0495650_0019653_1298_2320	335
578	3300046472	Ga0495580_0010092	Ga0495580_0010092_5269_6303	335
579	3300046491	Ga0495584_0030071	Ga0495584_0030071_339_1358	335
580	3300046492	Ga0495585_0000795	Ga0495585_0000795_12848_13870	335
581	3300046492	Ga0495585_0012745	Ga0495585_0012745_1064_2077	335
582	3300046492	Ga0495585_0035019	Ga0495585_0035019_1027_2037	335
583	3300046501	Ga0495607_0000394	Ga0495607_0000394_8587_9600	335
584	3300046501	Ga0495607_0001489	Ga0495607_0001489_10396_11415	335
585	3300046501	Ga0495607_0013896	Ga0495607_0013896_3200_4210	335
586	3300046507	Ga0495606_0009409	Ga0495606_0009409_3001_4020	335
587	3300046507	Ga0495606_0025173	Ga0495606_0025173_1108_2118	335
588	3300046512	Ga0495610_0057593	Ga0495610_0057593_157_1176	335
589	3300046513	Ga0495616_0024064	Ga0495616_0024064_999_2009	335
590	3300046515	Ga0495620_0000035	Ga0495620_0000035_83388_84407	335
591	3300046515	Ga0495620_0031909	Ga0495620_0031909_163_1173	335
592	3300046518	Ga0495631_0000122	Ga0495631_0000122_16935_17957	335
593	3300046518	Ga0495631_0001230	Ga0495631_0001230_4867_5886	335
594	3300046519	Ga0495632_0003288	Ga0495632_0003288_3937_4956	335
595	3300046519	Ga0495632_0014772	Ga0495632_0014772_286_1308	335
596	3300046519	Ga0495632_0027861	Ga0495632_0027861_551_1573	335
597	3300046520	Ga0495637_0001685	Ga0495637_0001685_1829_2848	335
598	3300046520	Ga0495637_0046766	Ga0495637_0046766_91_1113	335
599	3300046522	Ga0495643_0070273	Ga0495643_0070273_403_1416	335
600	3300046526	Ga0495666_0000092	Ga0495666_0000092_22674_23696	335
601	3300046526	Ga0495666_0002984	Ga0495666_0002984_5197_6231	335
602	3300046526	Ga0495666_0004604	Ga0495666_0004604_3817_4827	335
603	3300046530	Ga0495654_0001139	Ga0495654_0001139_12768_13787	335
604	3300046530	Ga0495654_0002457	Ga0495654_0002457_6069_7091	335
605	3300046530	Ga0495654_0002865	Ga0495654_0002865_9730_10752	335
606	3300046616	Ga0495668_0080318	Ga0495668_0080318_381_1391	335
607	3300046642	Ga0495634_0239724	Ga0495634_0239724_29_1039	335
608	3300046648	Ga0495611_0001324	Ga0495611_0001324_8683_9693	335
609	3300046660	Ga0495625_0012504	Ga0495625_0012504_604_1614	335
610	3300046660	Ga0495625_0018924	Ga0495625_0018924_3931_4950	335
611	3300046665	Ga0495661_0000085	Ga0495661_0000085_62876_63889	335
612	3300046684	Ga0495669_0002053	Ga0495669_0002053_1876_2889	335
613	3300046689	Ga0495613_0111465	Ga0495613_0111465_460_1470	335
614	3300046691	Ga0495670_0024495	Ga0495670_0024495_613_1623	335
615	3300046692	Ga0495671_0002038	Ga0495671_0002038_4743_5765	335
616	3300046694	Ga0495649_0000083	Ga0495649_0000083_48511_49530	335
617	3300046794	Ga0495589_0006501	Ga0495589_0006501_1040_2050	335
618	3300046810	Ga0495660_0000287	Ga0495660_0000287_11186_12205	335
619	3300046810	Ga0495660_0000454	Ga0495660_0000454_16839_17858	335
620	3300046810	Ga0495660_0020177	Ga0495660_0020177_2178_3188	335
621	3300046810	Ga0495660_0045561	Ga0495660_0045561_935_1945	335
622	3300047317	Ga0495604_0003658	Ga0495604_0003658_7908_8942	335
623	3300047318	Ga0495636_0002723	Ga0495636_0002723_30_1043	335
624	3300047318	Ga0495636_0066331	Ga0495636_0066331_361_1383	335
625	3300047318	Ga0495636_0083151	Ga0495636_0083151_115_1143	335
626	3300047320	Ga0495672_0001989	Ga0495672_0001989_14980_16002	335
627	3300047320	Ga0495672_0003117	Ga0495672_0003117_3404_4426	335
628	3300047321	Ga0495676_0007316	Ga0495676_0007316_1783_2793	335
629	3300047322	Ga0495680_0001350	Ga0495680_0001350_13257_14279	335
630	3300047323	Ga0495683_0000416	Ga0495683_0000416_25587_26606	335
631	3300047443	Ga0495687_000495	Ga0495687_000495_34545_35567	335
632	3300047443	Ga0495687_000845	Ga0495687_000845_18679_19701	335
633	3300047443	Ga0495687_003776	Ga0495687_003776_3491_4501	335
634	3300047443	Ga0495687_003894	Ga0495687_003894_7891_8901	335
635	3300047443	Ga0495687_036191	Ga0495687_036191_832_1842	335
636	3300047443	Ga0495687_039781	Ga0495687_039781_643_1656	335
637	3300047446	Ga0495679_000672	Ga0495679_000672_7550_8563	335
638	3300047446	Ga0495679_021500	Ga0495679_021500_835_1845	335
639	3300047447	Ga0495685_000850	Ga0495685_000850_7473_8483	335
640	3300047447	Ga0495685_007619	Ga0495685_007619_1319_2329	335
641	3300047469	Ga0495673_0000025	Ga0495673_0000025_116547_117575	335
642	3300047469	Ga0495673_0000155	Ga0495673_0000155_52235_53248	335
643	3300047469	Ga0495673_0000221	Ga0495673_0000221_54050_55072	335
644	3300047469	Ga0495673_0000922	Ga0495673_0000922_17340_18353	335
645	3300047469	Ga0495673_0001024	Ga0495673_0001024_21468_22490	335
646	3300047469	Ga0495673_0016529	Ga0495673_0016529_699_1718	335
647	3300047470	Ga0495681_0012414	Ga0495681_0012414_2470_3480	335
648	3300047470	Ga0495681_0014290	Ga0495681_0014290_2619_3638	335
649	3300048091	Ga0495626_0000760	Ga0495626_0000760_6158_7180	335
650	3300048091	Ga0495626_0005636	Ga0495626_0005636_2922_3941	335
651	3300048912	Ga0496109_0444592	Ga0496109_0444592_132_1142	335
652	3300048919	Ga0496116_0000014	Ga0496116_0000014_234957_235985	335
653	3300048922	Ga0496119_0000346	Ga0496119_0000346_45096_46124	335
654	3300048924	Ga0496121_0000511	Ga0496121_0000511_32907_33935	335
655	3300049459	Ga0495678_009079	Ga0495678_009079_1678_2697	335
656	3300049569	Ga0501032_0006722	Ga0501032_0006722_2794_3819	335
657	3300049570	Ga0501033_0002171	Ga0501033_0002171_4380_5405	335
658	3300049572	Ga0501036_0003079	Ga0501036_0003079_748_1773	335
659	3300049573	Ga0501037_0019972	Ga0501037_0019972_2227_3252	335
660	3300049574	Ga0501038_0010728	Ga0501038_0010728_4422_5447	335
661	3300049575	Ga0501039_0024041	Ga0501039_0024041_3430_4455	335
662	3300049578	Ga0501042_0163828	Ga0501042_0163828_276_1295	335
663	3300049581	Ga0501047_0003625	Ga0501047_0003625_12314_13339	335
664	3300049582	Ga0501048_0240324	Ga0501048_0240324_63_1088	335
665	3300049758	Ga0501241_000061	Ga0501241_000061_4638_5657	335
666	3300049766	Ga0501269_001275	Ga0501269_001275_2028_3047	335
667	3300049822	Ga0501035_0001192	Ga0501035_0001192_11498_12523	335
668	3300049823	Ga0501044_0025273	Ga0501044_0025273_763_1788	335
669	3300050489	nmdc:mga03683_12240_c1	nmdc:mga03683_12240_c1_1998_3020	335
670	3300050491	nmdc:mga00v17_11359_c1	nmdc:mga00v17_11359_c1_1036_2046	335
671	3300050492	nmdc:mga0yw44_1997_c1	nmdc:mga0yw44_1997_c1_3594_4604	335
672	3300050492	nmdc:mga0yw44_48330_c1	nmdc:mga0yw44_48330_c1_283_1290	335
673	3300050494	nmdc:mga06z11_566_c1	nmdc:mga06z11_566_c1_6708_7718	335
674	3300050495	nmdc:mga04h51_16705_c1	nmdc:mga04h51_16705_c1_461_1471	335
675	3300050496	nmdc:mga07m45_4378_c1	nmdc:mga07m45_4378_c1_5451_6482	335
676	3300050509	nmdc:mga0qj67_247037_c1	nmdc:mga0qj67_247037_c1_235_1260	335
677	3300050516	nmdc:mga0sz30_46130_c1	nmdc:mga0sz30_46130_c1_166_1176	335
678	3300053077	Ga0495601_0000136	Ga0495601_0000136_3516_4532	335
679	3300053100	Ga0500660_058423	Ga0500660_058423_747_1757	335
680	3300053129	Ga0500628_001979	Ga0500628_001979_1474_2484	335
681	3300053134	Ga0500658_0011791	Ga0500658_0011791_336_1346	335
682	3300053137	Ga0500561_0004018	Ga0500561_0004018_967_1977	335
683	3300053143	Ga0500579_047035	Ga0500579_047035_563_1573	335
684	3300053146	Ga0500588_0029193	Ga0500588_0029193_237_1247	335
685	3300053149	Ga0500600_0036492	Ga0500600_0036492_394_1404	335
686	3300053153	Ga0500616_0006429	Ga0500616_0006429_799_1809	335
687	3300053157	Ga0500624_003000	Ga0500624_003000_664_1677	335
688	3300053160	Ga0500633_0003880	Ga0500633_0003880_649_1659	335
689	3300053732	Ga0500656_000664	Ga0500656_000664_1084_2094	335
690	3300053739	Ga0500587_001296	Ga0500587_001296_336_1346	335
691	iso_pu_bacteria	2508501039	2508676500	335
692	iso_pu_bacteria	2517572101	2517763276	335
693	iso_pu_bacteria	2585428157	2588109337	335
694	iso_pu_bacteria	2643221561	2643824625	335
695	iso_pu_bacteria	2643221605	2644038347	335
696	iso_pu_bacteria	2643221696	2644535877	335
697	iso_pu_bacteria	2675902999	2676200598	335
698	iso_pu_bacteria	2687453737	2689956911	335
699	iso_pu_bacteria	2738543028	2739332531	335
700	iso_pu_bacteria	2738543034	2739363401	335
701	iso_pu_bacteria	2773857921	2774845176	335
702	iso_pu_bacteria	2775506925	2776376818	335
703	iso_pu_bacteria	2818991462	2819689309	335
704	iso_pu_bacteria	2862382967	2862385739	335
705	iso_pu_bacteria	2863067949	2863072772	335
706	iso_pu_bacteria	2904765812	2904770311	335
707	iso_pu_bacteria	2904770941	2904772477	335
708	iso_pu_bacteria	2908811453	2908816357	335
709	iso_pu_bacteria	2919420072	2919422313	335
710	iso_pu_bacteria	2919420072	2919422327	335
711	iso_pu_bacteria	2919432681	2919435420	335
712	iso_pu_bacteria	2919432681	2919435434	335
713	iso_pu_bacteria	2984576629	2984580488	335
714	iso_pu_bacteria	2990059506	2990067775	335
715	iso_pu_bacteria	2990256926	2990258180	335
716	iso_pu_bacteria	8002784119	8002787277	335
717	iso_pu_bacteria	8008558824	8008560778	335
718	3300001904	JGI24736J21556_1001110	JGI24736J21556_10011104	336
719	3300001915	JGI24741J21665_1000113	JGI24741J21665_10001137	336
720	3300001979	JGI24740J21852_10002626	JGI24740J21852_100026268	336
721	3300001989	JGI24739J22299_10004360	JGI24739J22299_100043604	336
722	3300001990	JGI24737J22298_10007873	JGI24737J22298_100078733	336
723	3300002067	JGI24735J21928_10011021	JGI24735J21928_100110213	336
724	3300002075	JGI24738J21930_10004974	JGI24738J21930_100049743	336
725	3300003791	Ga0055530_10013286	Ga0055530_100132862	336
726	3300005327	Ga0070658_10006024	Ga0070658_100060246	336
727	3300005337	Ga0070682_100177234	Ga0070682_1001772342	336
728	3300005339	Ga0070660_100019900	Ga0070660_1000199005	336
729	3300005344	Ga0070661_100017643	Ga0070661_1000176435	336
730	3300005366	Ga0070659_100016108	Ga0070659_1000161083	336
731	3300005436	Ga0070713_100091314	Ga0070713_1000913143	336
732	3300005455	Ga0070663_100001457	Ga0070663_1000014579	336
733	3300005539	Ga0068853_100120002	Ga0068853_1001200022	336
734	3300005577	Ga0068857_100070185	Ga0068857_1000701853	336
735	3300005578	Ga0068854_100209882	Ga0068854_1002098822	336
736	3300005614	Ga0068856_100001903	Ga0068856_1000019033	336
737	3300005834	Ga0068851_10012360	Ga0068851_100123605	336
738	3300005937	Ga0081455_10061316	Ga0081455_100613165	336
739	3300006038	Ga0075365_10009039	Ga0075365_100090397	336
740	3300006048	Ga0075363_100033837	Ga0075363_1000338372	336
741	3300006051	Ga0075364_10001406	Ga0075364_100014068	336
742	3300006051	Ga0075364_10086976	Ga0075364_100869762	336
743	3300006058	Ga0075432_10000250	Ga0075432_100002507	336
744	3300006175	Ga0070712_100079503	Ga0070712_1000795032	336
745	3300006177	Ga0075362_10053428	Ga0075362_100534282	336
746	3300006178	Ga0075367_10053919	Ga0075367_100539192	336
747	3300006846	Ga0075430_100032200	Ga0075430_1000322004	336
748	3300006946	Ga0079104_1003799	Ga0079104_10037996	336
749	3300009093	Ga0105240_10326952	Ga0105240_103269522	336
750	3300009174	Ga0105241_10004450	Ga0105241_100044508	336
751	3300009545	Ga0105237_10036578	Ga0105237_100365782	336
752	3300013102	Ga0157371_10000776	Ga0157371_100007769	336
753	3300013104	Ga0157370_10009299	Ga0157370_100092996	336
754	3300013105	Ga0157369_10073351	Ga0157369_100733512	336
755	3300013307	Ga0157372_10653592	Ga0157372_106535922	336
756	3300013308	Ga0157375_10107544	Ga0157375_101075442	336
757	3300025292	Ga0209676_1035842	Ga0209676_10358422	336
758	3300025298	Ga0209050_1000148	Ga0209050_1000148132	336
759	3300025303	Ga0209051_1013164	Ga0209051_10131642	336
760	3300025321	Ga0207656_10002772	Ga0207656_100027722	336
761	3300025735	Ga0207713_1000093	Ga0207713_1000093119	336
762	3300025909	Ga0207705_10070773	Ga0207705_100707732	336
763	3300025911	Ga0207654_10000006	Ga0207654_10000006310	336
764	3300025911	Ga0207654_10045006	Ga0207654_100450062	336
765	3300025913	Ga0207695_10020466	Ga0207695_100204668	336
766	3300025919	Ga0207657_10013359	Ga0207657_100133596	336
767	3300025924	Ga0207694_10091331	Ga0207694_100913312	336
768	3300025928	Ga0207700_10048466	Ga0207700_100484664	336
769	3300025932	Ga0207690_10036892	Ga0207690_100368922	336
770	3300025933	Ga0207706_10015662	Ga0207706_100156623	336
771	3300025945	Ga0207679_10062252	Ga0207679_100622522	336
772	3300025981	Ga0207640_10005679	Ga0207640_100056796	336
773	3300026041	Ga0207639_10000438	Ga0207639_1000043821	336
774	3300026067	Ga0207678_10000022	Ga0207678_1000002255	336
775	3300026078	Ga0207702_10004744	Ga0207702_100047445	336
776	3300027111	Ga0209281_1000008	Ga0209281_1000008484	336
777	3300027907	Ga0207428_10004342	Ga0207428_1000434212	336
778	3300030744	Ga0316181_1154916	Ga0316181_11549163	336
779	3300031507	Ga0307509_10102176	Ga0307509_101021762	336
780	3300031548	Ga0307408_100002141	Ga0307408_1000021418	336
781	3300031901	Ga0307406_10003739	Ga0307406_100037397	336
782	3300031911	Ga0307412_10063625	Ga0307412_100636251	336
783	3300032004	Ga0307414_10015942	Ga0307414_100159425	336
784	3300032005	Ga0307411_10064143	Ga0307411_100641432	336
785	3300037312	Ga0395899_0013724	Ga0395899_0013724_2163_3200	336
786	3300037418	Ga0395900_0102275	Ga0395900_0102275_1835_2872	336
787	3300037466	Ga0395898_0019940	Ga0395898_0019940_3454_4491	336
788	3300038443	Ga0395901_0000077	Ga0395901_0000077_26626_27678	336
789	3300038443	Ga0395901_0000908	Ga0395901_0000908_29135_30172	336
790	3300042009	Ga0439451_000125	Ga0439451_000125_3847_4875	336
791	3300042016	Ga0439463_013229	Ga0439463_013229_284_1315	336
792	3300042461	Ga0439460_0008127	Ga0439460_0008127_477_1508	336
793	3300046459	Ga0495629_0072821	Ga0495629_0072821_937_1968	336
794	3300046459	Ga0495629_0124042	Ga0495629_0124042_285_1298	336
795	3300046460	Ga0495638_0003500	Ga0495638_0003500_7705_8733	336
796	3300046463	Ga0495653_0004894	Ga0495653_0004894_9635_10669	336
797	3300046474	Ga0495605_0000257	Ga0495605_0000257_29250_30275	336
798	3300046499	Ga0495594_0091268	Ga0495594_0091268_210_1223	336
799	3300046501	Ga0495607_0025057	Ga0495607_0025057_1393_2433	336
800	3300046507	Ga0495606_0028965	Ga0495606_0028965_293_1333	336
801	3300046512	Ga0495610_0068188	Ga0495610_0068188_450_1490	336
802	3300046513	Ga0495616_0006038	Ga0495616_0006038_5231_6256	336
803	3300046519	Ga0495632_0000395	Ga0495632_0000395_30192_31217	336
804	3300046519	Ga0495632_0005029	Ga0495632_0005029_1312_2340	336
805	3300046520	Ga0495637_0000473	Ga0495637_0000473_12705_13730	336
806	3300046520	Ga0495637_0007094	Ga0495637_0007094_959_1984	336
807	3300046520	Ga0495637_0023097	Ga0495637_0023097_1270_2295	336
808	3300046522	Ga0495643_0003493	Ga0495643_0003493_5190_6215	336
809	3300046526	Ga0495666_0000069	Ga0495666_0000069_34337_35362	336
810	3300046542	Ga0495597_0000253	Ga0495597_0000253_27221_28246	336
811	3300046660	Ga0495625_0000056	Ga0495625_0000056_160788_161837	336
812	3300046660	Ga0495625_0001135	Ga0495625_0001135_24246_25274	336
813	3300046665	Ga0495661_0013544	Ga0495661_0013544_279_1304	336
814	3300046692	Ga0495671_0001083	Ga0495671_0001083_9811_10836	336
815	3300046694	Ga0495649_0066989	Ga0495649_0066989_387_1412	336
816	3300046794	Ga0495589_0025127	Ga0495589_0025127_1665_2690	336
817	3300046809	Ga0495600_0006329	Ga0495600_0006329_5942_6976	336
818	3300046810	Ga0495660_0000388	Ga0495660_0000388_9811_10836	336
819	3300046810	Ga0495660_0051545	Ga0495660_0051545_1176_2204	336
820	3300047315	Ga0495581_0104411	Ga0495581_0104411_11_1042	336
821	3300047317	Ga0495604_0108577	Ga0495604_0108577_223_1257	336
822	3300047320	Ga0495672_0000213	Ga0495672_0000213_61625_62650	336
823	3300047322	Ga0495680_0000543	Ga0495680_0000543_34498_35523	336
824	3300047322	Ga0495680_0000608	Ga0495680_0000608_28288_29325	336
825	3300047322	Ga0495680_0004753	Ga0495680_0004753_2518_3552	336
826	3300047323	Ga0495683_0018717	Ga0495683_0018717_1982_3007	336
827	3300047443	Ga0495687_000308	Ga0495687_000308_12083_13111	336
828	3300047443	Ga0495687_000389	Ga0495687_000389_33349_34386	336
829	3300047443	Ga0495687_000724	Ga0495687_000724_3004_4014	336
830	3300047444	Ga0495675_0001415	Ga0495675_0001415_2979_4013	336
831	3300047470	Ga0495681_0000198	Ga0495681_0000198_25702_26730	336
832	3300048091	Ga0495626_0000528	Ga0495626_0000528_9810_10835	336
833	3300048914	Ga0496111_0168151	Ga0496111_0168151_58_1086	336
834	3300049459	Ga0495678_003338	Ga0495678_003338_469_1497	336
835	3300049571	Ga0501034_0008467	Ga0501034_0008467_1184_2203	336
836	3300049589	Ga0501073_0172633	Ga0501073_0172633_34_1062	336
837	3300049589	Ga0501073_0240221	Ga0501073_0240221_151_1176	336
838	3300050490	nmdc:mga03n38_265_c1	nmdc:mga03n38_265_c1_5092_6141	336
839	3300050491	nmdc:mga00v17_195_c1	nmdc:mga00v17_195_c1_28163_29212	336
840	3300050491	nmdc:mga00v17_85329_c1	nmdc:mga00v17_85329_c1_520_1566	336
841	3300050492	nmdc:mga0yw44_224_c1	nmdc:mga0yw44_224_c1_5033_6082	336
842	3300050493	nmdc:mga0k408_2031_c1	nmdc:mga0k408_2031_c1_3545_4594	336
843	iso_pu_bacteria	2751185725	2753040036	336
844	iso_pu_bacteria	2751185792	2753328546	336
845	iso_pu_bacteria	2773857762	2774396166	336
846	iso_pu_bacteria	2808606439	2809197803	336
847	iso_pu_bacteria	2862574272	2862575659	336
848	iso_pu_bacteria	2902792274	2902794389	336
849	iso_pu_bacteria	2919051321	2919054981	336
850	iso_pu_bacteria	2941485952	2941489122	336
851	iso_pu_bacteria	8054002106	8054002910	336
852	iso_pu_bacteria	8054609563	8054609905	336
853	3300002738	JGI25154J39366_1000680	JGI25154J39366_10006809	337
854	3300003316	rootH1_10005611	rootH1_100056114	337
855	3300003322	rootL2_10024094	rootL2_1002409417	337
856	3300003323	rootH1_10018354	rootH1_100183547	337
857	3300005434	Ga0070709_10039557	Ga0070709_100395572	337
858	3300005435	Ga0070714_100010158	Ga0070714_1000101588	337
859	3300005435	Ga0070714_100061288	Ga0070714_1000612882	337
860	3300005844	Ga0068862_100081877	Ga0068862_1000818772	337
861	3300005983	Ga0081540_1056346	Ga0081540_10563462	337
862	3300005985	Ga0081539_10102173	Ga0081539_101021731	337
863	3300006038	Ga0075365_10024844	Ga0075365_100248443	337
864	3300006051	Ga0075364_10035089	Ga0075364_100350892	337
865	3300006175	Ga0070712_100022764	Ga0070712_1000227642	337
866	3300009174	Ga0105241_10111705	Ga0105241_101117053	337
867	3300009551	Ga0105238_10030906	Ga0105238_100309066	337
868	3300009553	Ga0105249_10019951	Ga0105249_100199516	337
869	3300010375	Ga0105239_10153076	Ga0105239_101530762	337
870	3300014325	Ga0163163_10300813	Ga0163163_103008132	337
871	3300025246	Ga0209646_1000049	Ga0209646_100004968	337
872	3300025906	Ga0207699_10024826	Ga0207699_100248264	337
873	3300025915	Ga0207693_10106318	Ga0207693_101063182	337
874	3300025924	Ga0207694_10056955	Ga0207694_100569552	337
875	3300025929	Ga0207664_10032588	Ga0207664_100325886	337
876	3300026067	Ga0207678_10000116	Ga0207678_1000011654	337
877	3300028380	Ga0268265_10054223	Ga0268265_100542232	337
878	3300031548	Ga0307408_100165109	Ga0307408_1001651092	337
879	3300031616	Ga0307508_10030043	Ga0307508_100300435	337
880	3300031731	Ga0307405_10349870	Ga0307405_103498701	337
881	3300031911	Ga0307412_10109468	Ga0307412_101094682	337
882	3300037418	Ga0395900_0000474	Ga0395900_0000474_5088_6113	337
883	3300039062	Ga0400483_108750	Ga0400483_108750_1208_2254	337
884	3300039062	Ga0400483_135484	Ga0400483_135484_1054_2112	337
885	3300039062	Ga0400483_180197	Ga0400483_180197_243_1289	337
886	3300039062	Ga0400483_243671	Ga0400483_243671_2254_3312	337
887	3300041404	Ga0439436_0013263	Ga0439436_0013263_154_1203	337
888	3300042004	Ga0439445_0024077	Ga0439445_0024077_16_1071	337
889	3300042005	Ga0439448_0025958	Ga0439448_0025958_115_1128	337
890	3300042007	Ga0439449_0040347	Ga0439449_0040347_109_1164	337
891	3300042010	Ga0439452_009390	Ga0439452_009390_120_1169	337
892	3300042014	Ga0439457_000234	Ga0439457_000234_3007_4023	337
893	3300042014	Ga0439457_003788	Ga0439457_003788_1591_2640	337
894	3300042125	Ga0450923_003270	Ga0450923_003270_1091_2140	337
895	3300042134	Ga0450898_002595	Ga0450898_002595_1237_2286	337
896	3300042146	Ga0450907_002519	Ga0450907_002519_1935_2948	337
897	3300042435	Ga0439434_0003886	Ga0439434_0003886_1810_2856	337
898	3300042439	Ga0439464_0005925	Ga0439464_0005925_2118_3131	337
899	3300044694	Ga0466963_0002989	Ga0466963_0002989_4294_5307	337
900	3300044706	Ga0466964_0006530	Ga0466964_0006530_3202_4218	337
901	3300044719	Ga0466971_0001070	Ga0466971_0001070_8655_9671	337
902	3300046460	Ga0495638_0110876	Ga0495638_0110876_249_1271	337
903	3300046492	Ga0495585_0080431	Ga0495585_0080431_391_1413	337
904	3300046516	Ga0495628_0064348	Ga0495628_0064348_1024_2043	337
905	3300046615	Ga0495656_0003267	Ga0495656_0003267_3624_4649	337
906	3300047317	Ga0495604_0075169	Ga0495604_0075169_1208_2251	337
907	3300047444	Ga0495675_0024018	Ga0495675_0024018_1996_3039	337
908	3300048905	Ga0496102_0000640	Ga0496102_0000640_27814_28845	337
909	3300048906	Ga0496103_0000197	Ga0496103_0000197_27814_28845	337
910	3300048913	Ga0496110_0042373	Ga0496110_0042373_721_1734	337
911	3300048917	Ga0496114_0008420	Ga0496114_0008420_2531_3544	337
912	3300048917	Ga0496114_0327104	Ga0496114_0327104_39_1052	337
913	3300048919	Ga0496116_0001609	Ga0496116_0001609_17105_18136	337
914	3300048920	Ga0496117_0000467	Ga0496117_0000467_27814_28845	337
915	3300048921	Ga0496118_0000459	Ga0496118_0000459_38639_39670	337
916	3300048922	Ga0496119_0051837	Ga0496119_0051837_839_1870	337
917	3300048927	Ga0496124_0000499	Ga0496124_0000499_27814_28845	337
918	3300049568	Ga0501031_0092593	Ga0501031_0092593_173_1186	337
919	3300049568	Ga0501031_0168856	Ga0501031_0168856_306_1331	337
920	3300049569	Ga0501032_0010214	Ga0501032_0010214_2789_3802	337
921	3300049571	Ga0501034_0020595	Ga0501034_0020595_2689_3702	337
922	3300049572	Ga0501036_0021057	Ga0501036_0021057_1727_2740	337
923	3300049574	Ga0501038_0018815	Ga0501038_0018815_4074_5087	337
924	3300049574	Ga0501038_0094812	Ga0501038_0094812_1061_2074	337
925	3300049574	Ga0501038_0261647	Ga0501038_0261647_31_1050	337
926	3300049575	Ga0501039_0109677	Ga0501039_0109677_499_1512	337
927	3300049577	Ga0501041_0020186	Ga0501041_0020186_2216_3241	337
928	3300049579	Ga0501043_0106392	Ga0501043_0106392_751_1764	337
929	3300049581	Ga0501047_0031744	Ga0501047_0031744_988_2001	337
930	3300049590	Ga0501074_0089514	Ga0501074_0089514_650_1675	337
931	3300049822	Ga0501035_0028985	Ga0501035_0028985_2824_3837	337
932	3300049823	Ga0501044_0215945	Ga0501044_0215945_825_1844	337
933	3300049823	Ga0501044_0240447	Ga0501044_0240447_190_1203	337
934	3300049823	Ga0501044_0487492	Ga0501044_0487492_27_1052	337
935	3300050491	nmdc:mga00v17_6863_c1	nmdc:mga00v17_6863_c1_602_1621	337
936	3300050492	nmdc:mga0yw44_21739_c1	nmdc:mga0yw44_21739_c1_1170_2189	337
937	3300050494	nmdc:mga06z11_66994_c1	nmdc:mga06z11_66994_c1_421_1434	337
938	3300053077	Ga0495601_0000631	Ga0495601_0000631_738_1757	337
939	3300053078	Ga0495612_0009485	Ga0495612_0009485_1207_2226	337
940	3300053083	Ga0495655_0005623	Ga0495655_0005623_753_1784	337
941	3300053083	Ga0495655_0024373	Ga0495655_0024373_212_1225	337
942	3300053087	Ga0500643_000006	Ga0500643_000006_349121_350152	337
943	iso_pu_bacteria	2547132424	2548697399	337
944	iso_pu_bacteria	2562617112	2563057937	337
945	iso_pu_bacteria	2643221687	2644489758	337
946	iso_pu_bacteria	2711768613	2713473360	337
947	iso_pu_bacteria	2744054611	2744957679	337
948	iso_pu_bacteria	2775506735	2775658984	337
949	iso_pu_bacteria	2811994878	2812347706	337
950	iso_pu_bacteria	2834641062	2834645108	337
951	iso_pu_bacteria	2873314349	2873315454	337
952	iso_pu_bacteria	2891968417	2891968884	337
953	iso_pu_bacteria	2902837492	2902838784	337
954	iso_pu_bacteria	2904765812	2904766414	337
955	iso_pu_bacteria	2904765812	2904770426	337
956	iso_pu_bacteria	2912723979	2912728671	337
957	iso_pu_bacteria	2919155634	2919156355	337
958	iso_pu_bacteria	2919420072	2919421155	337
959	iso_pu_bacteria	2919432681	2919433087	337
960	iso_pu_bacteria	2919713450	2919720169	337
961	iso_pu_bacteria	3006493962	3006494426	337
962	3300001979	JGI24740J21852_10009903	JGI24740J21852_100099033	338
963	3300005327	Ga0070658_10002591	Ga0070658_100025917	338
964	3300005329	Ga0070683_100058031	Ga0070683_1000580312	338
965	3300005339	Ga0070660_100068276	Ga0070660_1000682762	338
966	3300005530	Ga0070679_100005894	Ga0070679_1000058946	338
967	3300005563	Ga0068855_100017817	Ga0068855_1000178177	338
968	3300005614	Ga0068856_100001670	Ga0068856_1000016703	338
969	3300005614	Ga0068856_100124584	Ga0068856_1001245843	338
970	3300005616	Ga0068852_100004005	Ga0068852_1000040056	338
971	3300005985	Ga0081539_10057026	Ga0081539_100570263	338
972	3300006846	Ga0075430_100090235	Ga0075430_1000902353	338
973	3300006871	Ga0075434_100010087	Ga0075434_1000100879	338
974	3300006914	Ga0075436_100021640	Ga0075436_1000216402	338
975	3300007076	Ga0075435_100015300	Ga0075435_1000153006	338
976	3300009093	Ga0105240_10021903	Ga0105240_100219035	338
977	3300009093	Ga0105240_10086545	Ga0105240_100865454	338
978	3300009148	Ga0105243_10224913	Ga0105243_102249132	338
979	3300009174	Ga0105241_10000004	Ga0105241_10000004293	338
980	3300009174	Ga0105241_10000897	Ga0105241_100008979	338
981	3300009174	Ga0105241_10103152	Ga0105241_101031522	338
982	3300009176	Ga0105242_10128315	Ga0105242_101283152	338
983	3300009545	Ga0105237_10000874	Ga0105237_1000087411	338
984	3300009545	Ga0105237_10001636	Ga0105237_100016366	338
985	3300009545	Ga0105237_10055888	Ga0105237_100558882	338
986	3300009551	Ga0105238_10022891	Ga0105238_100228912	338
987	3300010375	Ga0105239_10000113	Ga0105239_1000011350	338
988	3300010375	Ga0105239_10006533	Ga0105239_1000653314	338
989	3300010375	Ga0105239_10007549	Ga0105239_100075498	338
990	3300013100	Ga0157373_10002444	Ga0157373_1000244411	338
991	3300014497	Ga0182008_10001321	Ga0182008_100013212	338
992	3300014968	Ga0157379_10106140	Ga0157379_101061402	338
993	3300017792	Ga0163161_10018606	Ga0163161_100186064	338
994	3300025909	Ga0207705_10008265	Ga0207705_100082654	338
995	3300025911	Ga0207654_10006919	Ga0207654_100069196	338
996	3300025911	Ga0207654_10028403	Ga0207654_100284032	338
997	3300025913	Ga0207695_10056256	Ga0207695_100562562	338
998	3300025914	Ga0207671_10000759	Ga0207671_1000075936	338
999	3300025914	Ga0207671_10001691	Ga0207671_100016916	338
1000	3300025917	Ga0207660_10046905	Ga0207660_100469052	338
1001	3300025935	Ga0207709_10156514	Ga0207709_101565141	338
1002	3300025949	Ga0207667_10006732	Ga0207667_100067325	338
1003	3300026078	Ga0207702_10003041	Ga0207702_1000304112	338
1004	3300026116	Ga0207674_10478449	Ga0207674_104784492	338
1005	3300026142	Ga0207698_10002072	Ga0207698_100020726	338
1006	3300028379	Ga0268266_10000948	Ga0268266_1000094817	338
1007	3300028794	Ga0307515_10157547	Ga0307515_101575473	338
1008	3300030521	Ga0307511_10026796	Ga0307511_100267962	338
1009	3300031456	Ga0307513_10023992	Ga0307513_100239926	338
1010	3300031507	Ga0307509_10101119	Ga0307509_101011192	338
1011	3300031616	Ga0307508_10001419	Ga0307508_1000141910	338
1012	3300033545	Ga0316214_1001712	Ga0316214_10017122	338
1013	3300037418	Ga0395900_0001603	Ga0395900_0001603_19074_20108	338
1014	3300037466	Ga0395898_0000751	Ga0395898_0000751_9497_10531	338
1015	3300038443	Ga0395901_0000246	Ga0395901_0000246_8336_9370	338
1016	3300041404	Ga0439436_0028606	Ga0439436_0028606_42_1100	338
1017	3300041413	Ga0439465_0030638	Ga0439465_0030638_352_1371	338
1018	3300042122	Ga0450920_008457	Ga0450920_008457_306_1364	338
1019	3300042184	Ga0450908_000522	Ga0450908_000522_4361_5419	338
1020	3300044683	Ga0466965_0017187	Ga0466965_0017187_49_1083	338
1021	3300046471	Ga0495650_0001499	Ga0495650_0001499_17779_18813	338
1022	3300046660	Ga0495625_0000095	Ga0495625_0000095_20972_22015	338
1023	3300046690	Ga0495624_0011630	Ga0495624_0011630_1053_2072	338
1024	3300047315	Ga0495581_0069012	Ga0495581_0069012_515_1534	338
1025	3300047321	Ga0495676_0010140	Ga0495676_0010140_2780_3799	338
1026	3300047673	Ga0495593_0004344	Ga0495593_0004344_1756_2775	338
1027	3300048089	Ga0495614_0005431	Ga0495614_0005431_1734_2753	338
1028	3300048924	Ga0496121_0000079	Ga0496121_0000079_152041_153075	338
1029	3300048927	Ga0496124_0043380	Ga0496124_0043380_1359_2375	338
1030	3300048929	Ga0496126_0020454	Ga0496126_0020454_2752_3786	338
1031	3300049570	Ga0501033_0022401	Ga0501033_0022401_1609_2643	338
1032	3300049571	Ga0501034_0121765	Ga0501034_0121765_1377_2396	338
1033	3300049574	Ga0501038_0072181	Ga0501038_0072181_1456_2472	338
1034	3300049574	Ga0501038_0243660	Ga0501038_0243660_204_1238	338
1035	3300049579	Ga0501043_0015353	Ga0501043_0015353_65_1099	338
1036	3300049581	Ga0501047_0075216	Ga0501047_0075216_1125_2159	338
1037	3300049822	Ga0501035_0040698	Ga0501035_0040698_923_1957	338
1038	3300049823	Ga0501044_0075136	Ga0501044_0075136_779_1813	338
1039	3300049823	Ga0501044_0227518	Ga0501044_0227518_409_1443	338
1040	3300050512	nmdc:mga0n895_7312_c1	nmdc:mga0n895_7312_c1_6123_7142	338
1041	3300050513	nmdc:mga0rr50_23734_c1	nmdc:mga0rr50_23734_c1_1775_2794	338
1042	3300050514	nmdc:mga08x19_16585_c1	nmdc:mga08x19_16585_c1_1389_2408	338
1043	3300053153	Ga0500616_0000090	Ga0500616_0000090_85901_86920	338
1044	3300053158	Ga0500627_0097501	Ga0500627_0097501_164_1198	338
1045	3300053730	Ga0500645_013100	Ga0500645_013100_181_1200	338
1046	iso_pu_bacteria	2565956761	2566997100	338
1047	iso_pu_bacteria	2643221598	2643999425	338
1048	iso_pu_bacteria	2643221630	2644172031	338
1049	iso_pu_bacteria	2738541308	2738893014	338
1050	iso_pu_bacteria	2738543005	2739205899	338
1051	iso_pu_bacteria	2904535858	2904536690	338
1052	iso_pu_bacteria	2922554459	2922555139	338
1053	iso_pu_bacteria	2928142448	2928143647	338
1054	3300003792	Ga0055540_1000104	Ga0055540_100010420	339
1055	3300005288	Ga0065714_10071256	Ga0065714_100712564	339
1056	3300005334	Ga0068869_100058671	Ga0068869_1000586711	339
1057	3300005366	Ga0070659_100014358	Ga0070659_1000143584	339
1058	3300005439	Ga0070711_100196943	Ga0070711_1001969432	339
1059	3300005455	Ga0070663_100005366	Ga0070663_1000053663	339
1060	3300005457	Ga0070662_100068871	Ga0070662_1000688712	339
1061	3300005985	Ga0081539_10002207	Ga0081539_1000220720	339
1062	3300006038	Ga0075365_10240302	Ga0075365_102403021	339
1063	3300006051	Ga0075364_10137730	Ga0075364_101377302	339
1064	3300006177	Ga0075362_10000258	Ga0075362_100002584	339
1065	3300006178	Ga0075367_10003322	Ga0075367_100033221	339
1066	3300006353	Ga0075370_10000848	Ga0075370_100008483	339
1067	3300011119	Ga0105246_10033362	Ga0105246_100333622	339
1068	3300021361	Ga0213872_10004853	Ga0213872_100048532	339
1069	3300025303	Ga0209051_1000231	Ga0209051_100023119	339
1070	3300025913	Ga0207695_10000936	Ga0207695_1000093637	339
1071	3300025933	Ga0207706_10002971	Ga0207706_100029712	339
1072	3300025935	Ga0207709_10037084	Ga0207709_100370843	339
1073	3300030745	Ga0316182_1153087	Ga0316182_11530871	339
1074	3300031995	Ga0307409_100415053	Ga0307409_1004150532	339
1075	3300032004	Ga0307414_10172545	Ga0307414_101725452	339
1076	3300032005	Ga0307411_10102079	Ga0307411_101020792	339
1077	3300037312	Ga0395899_0102359	Ga0395899_0102359_187_1284	339
1078	3300037418	Ga0395900_0074799	Ga0395900_0074799_1086_2183	339
1079	3300037466	Ga0395898_0004678	Ga0395898_0004678_1339_2436	339
1080	3300037471	Ga0395905_0085393	Ga0395905_0085393_1703_2731	339
1081	3300038443	Ga0395901_0123752	Ga0395901_0123752_907_2004	339
1082	3300039447	Ga0436361_0108407	Ga0436361_0108407_6157_7188	339
1083	3300042006	Ga0439432_004797	Ga0439432_004797_489_1541	339
1084	3300042007	Ga0439449_0018184	Ga0439449_0018184_1324_2376	339
1085	3300042131	Ga0450894_000475	Ga0450894_000475_3786_4808	339
1086	3300044656	Ga0466969_0018605	Ga0466969_0018605_97_1119	339
1087	3300044658	Ga0466972_0007761	Ga0466972_0007761_2842_3864	339
1088	3300044658	Ga0466972_0015619	Ga0466972_0015619_505_1530	339
1089	3300044683	Ga0466965_0004793	Ga0466965_0004793_1637_2659	339
1090	3300044683	Ga0466965_0010740	Ga0466965_0010740_2455_3495	339
1091	3300044684	Ga0466966_0009048	Ga0466966_0009048_2851_3873	339
1092	3300044684	Ga0466966_0075818	Ga0466966_0075818_424_1446	339
1093	3300044684	Ga0466966_0109047	Ga0466966_0109047_155_1180	339
1094	3300044694	Ga0466963_0001264	Ga0466963_0001264_1085_2107	339
1095	3300044719	Ga0466971_0024430	Ga0466971_0024430_717_1739	339
1096	3300044765	Ga0466970_0026319	Ga0466970_0026319_655_1677	339
1097	3300044842	Ga0466957_0000029	Ga0466957_0000029_15641_16663	339
1098	3300044842	Ga0466957_0001270	Ga0466957_0001270_2918_3940	339
1099	3300045049	Ga0466959_0006518	Ga0466959_0006518_2781_3803	339
1100	3300045836	Ga0466958_0000352	Ga0466958_0000352_4001_5023	339
1101	3300045976	Ga0466967_0040101	Ga0466967_0040101_558_1580	339
1102	3300046501	Ga0495607_0000138	Ga0495607_0000138_52738_53775	339
1103	3300046512	Ga0495610_0000963	Ga0495610_0000963_9558_10598	339
1104	3300046522	Ga0495643_0006532	Ga0495643_0006532_507_1544	339
1105	3300046810	Ga0495660_0000392	Ga0495660_0000392_26656_27693	339
1106	3300047323	Ga0495683_0000245	Ga0495683_0000245_16899_17933	339
1107	3300048903	Ga0496100_0063090	Ga0496100_0063090_346_1377	339
1108	3300048925	Ga0496122_0001487	Ga0496122_0001487_4073_5098	339
1109	3300048925	Ga0496122_0085809	Ga0496122_0085809_781_1809	339
1110	3300048926	Ga0496123_0000815	Ga0496123_0000815_32586_33611	339
1111	3300048926	Ga0496123_0007781	Ga0496123_0007781_4438_5463	339
1112	3300048926	Ga0496123_0060403	Ga0496123_0060403_1191_2219	339
1113	3300048927	Ga0496124_0278695	Ga0496124_0278695_130_1155	339
1114	3300049568	Ga0501031_0010803	Ga0501031_0010803_4703_5728	339
1115	3300049568	Ga0501031_0024216	Ga0501031_0024216_1907_2944	339
1116	3300049569	Ga0501032_0002092	Ga0501032_0002092_13872_14897	339
1117	3300049569	Ga0501032_0003209	Ga0501032_0003209_1735_2772	339
1118	3300049570	Ga0501033_0001171	Ga0501033_0001171_12400_13425	339
1119	3300049572	Ga0501036_0012260	Ga0501036_0012260_1754_2791	339
1120	3300049572	Ga0501036_0075491	Ga0501036_0075491_44_1069	339
1121	3300049574	Ga0501038_0002634	Ga0501038_0002634_14911_15936	339
1122	3300049575	Ga0501039_0000282	Ga0501039_0000282_1379_2416	339
1123	3300049575	Ga0501039_0002340	Ga0501039_0002340_10739_11764	339
1124	3300049576	Ga0501040_0011583	Ga0501040_0011583_3908_4963	339
1125	3300049576	Ga0501040_0116572	Ga0501040_0116572_340_1377	339
1126	3300049578	Ga0501042_0017244	Ga0501042_0017244_2936_3961	339
1127	3300049579	Ga0501043_0027415	Ga0501043_0027415_407_1432	339
1128	3300049580	Ga0501046_0001006	Ga0501046_0001006_16337_17374	339
1129	3300049580	Ga0501046_0007593	Ga0501046_0007593_2972_3997	339
1130	3300049581	Ga0501047_0040722	Ga0501047_0040722_247_1284	339
1131	3300049582	Ga0501048_0019782	Ga0501048_0019782_942_1967	339
1132	3300049582	Ga0501048_0053301	Ga0501048_0053301_1509_2564	339
1133	3300049583	Ga0501067_0001886	Ga0501067_0001886_10407_11444	339
1134	3300049585	Ga0501069_0003811	Ga0501069_0003811_1326_2363	339
1135	3300049588	Ga0501072_0024579	Ga0501072_0024579_2873_3910	339
1136	3300049589	Ga0501073_0003630	Ga0501073_0003630_9002_10039	339
1137	3300049590	Ga0501074_0002288	Ga0501074_0002288_11289_12326	339
1138	3300049741	Ga0501079_0020833	Ga0501079_0020833_3337_4374	339
1139	3300049742	Ga0501080_0071579	Ga0501080_0071579_189_1214	339
1140	3300049742	Ga0501080_0203779	Ga0501080_0203779_66_1103	339
1141	3300049744	Ga0501083_0003958	Ga0501083_0003958_8778_9815	339
1142	3300049823	Ga0501044_0107928	Ga0501044_0107928_1737_2762	339
1143	3300049823	Ga0501044_0139614	Ga0501044_0139614_1344_2381	339
1144	3300049823	Ga0501044_0428002	Ga0501044_0428002_30_1055	339
1145	3300049824	Ga0501045_0035056	Ga0501045_0035056_1385_2422	339
1146	3300049824	Ga0501045_0081085	Ga0501045_0081085_474_1529	339
1147	3300050489	nmdc:mga03683_174_c1	nmdc:mga03683_174_c1_2229_3278	339
1148	3300050494	nmdc:mga06z11_23022_c1	nmdc:mga06z11_23022_c1_649_1671	339
1149	3300053104	Ga0500556_0001563	Ga0500556_0001563_5574_6599	339
1150	3300053162	Ga0500638_000052	Ga0500638_000052_13883_14908	339
1151	3300053177	Ga0500636_0053914	Ga0500636_0053914_449_1474	339
1152	3300054114	Ga0501084_0003841	Ga0501084_0003841_1912_2949	339
1153	3300060353	Ga0501082_0007219	Ga0501082_0007219_8476_9513	339
1154	3300061719	Ga0466962_0003058	Ga0466962_0003058_543_1565	339
1155	iso_pu_bacteria	2616644941	2616900590	339
1156	iso_pu_bacteria	2643221566	2643846924	339
1157	iso_pu_bacteria	2643221628	2644158927	339
1158	iso_pu_bacteria	2811994874	2812330890	339
1159	iso_pu_bacteria	2855386786	2855387397	339
1160	iso_pu_bacteria	642555112	642595293	339
1161	iso_pu_bacteria	8048746797	8048747391	339
1162	3300001979	JGI24740J21852_10004751	JGI24740J21852_100047515	340
1163	3300001989	JGI24739J22299_10014764	JGI24739J22299_100147642	340
1164	3300001990	JGI24737J22298_10013837	JGI24737J22298_100138373	340
1165	3300002067	JGI24735J21928_10017697	JGI24735J21928_100176972	340
1166	3300002076	JGI24749J21850_1006511	JGI24749J21850_10065112	340
1167	3300002459	JGI24751J29686_10012933	JGI24751J29686_100129332	340
1168	3300003203	JGI25406J46586_10004639	JGI25406J46586_100046394	340
1169	3300005295	Ga0065707_10158656	Ga0065707_101586562	340
1170	3300005366	Ga0070659_100040971	Ga0070659_1000409715	340
1171	3300005366	Ga0070659_100097415	Ga0070659_1000974152	340
1172	3300005457	Ga0070662_100109535	Ga0070662_1001095352	340
1173	3300005471	Ga0070698_100052415	Ga0070698_1000524152	340
1174	3300005539	Ga0068853_100101111	Ga0068853_1001011112	340
1175	3300005544	Ga0070686_100068812	Ga0070686_1000688122	340
1176	3300005549	Ga0070704_100052742	Ga0070704_1000527422	340
1177	3300005563	Ga0068855_100178472	Ga0068855_1001784722	340
1178	3300005578	Ga0068854_100010954	Ga0068854_1000109542	340
1179	3300005617	Ga0068859_100062248	Ga0068859_1000622484	340
1180	3300005834	Ga0068851_10015819	Ga0068851_100158193	340
1181	3300005841	Ga0068863_100000884	Ga0068863_10000088423	340
1182	3300005843	Ga0068860_100002624	Ga0068860_10000262411	340
1183	3300005844	Ga0068862_100001916	Ga0068862_1000019165	340
1184	3300005844	Ga0068862_100518719	Ga0068862_1005187192	340
1185	3300005985	Ga0081539_10000926	Ga0081539_1000092612	340
1186	3300006844	Ga0075428_100000014	Ga0075428_100000014102	340
1187	3300006931	Ga0097620_100062248	Ga0097620_1000622484	340
1188	3300009093	Ga0105240_10018798	Ga0105240_100187982	340
1189	3300009093	Ga0105240_10023949	Ga0105240_100239495	340
1190	3300009093	Ga0105240_10093850	Ga0105240_100938502	340
1191	3300009094	Ga0111539_10000019	Ga0111539_1000001980	340
1192	3300009551	Ga0105238_10000514	Ga0105238_100005143	340
1193	3300009551	Ga0105238_10019463	Ga0105238_100194632	340
1194	3300009551	Ga0105238_10168284	Ga0105238_101682842	340
1195	3300009553	Ga0105249_10000439	Ga0105249_1000043930	340
1196	3300009553	Ga0105249_10014870	Ga0105249_100148703	340
1197	3300010375	Ga0105239_10011168	Ga0105239_100111683	340
1198	3300010375	Ga0105239_10040307	Ga0105239_100403075	340
1199	3300013105	Ga0157369_10008980	Ga0157369_100089804	340
1200	3300013307	Ga0157372_10045106	Ga0157372_100451064	340
1201	3300025321	Ga0207656_10010781	Ga0207656_100107812	340
1202	3300025900	Ga0207710_10039827	Ga0207710_100398272	340
1203	3300025904	Ga0207647_10001831	Ga0207647_100018314	340
1204	3300025911	Ga0207654_10000069	Ga0207654_100000693	340
1205	3300025913	Ga0207695_10008866	Ga0207695_100088668	340
1206	3300025913	Ga0207695_10032104	Ga0207695_100321044	340
1207	3300025919	Ga0207657_10041494	Ga0207657_100414944	340
1208	3300025924	Ga0207694_10000120	Ga0207694_1000012056	340
1209	3300025942	Ga0207689_10284814	Ga0207689_102848142	340
1210	3300025949	Ga0207667_10050218	Ga0207667_100502182	340
1211	3300025961	Ga0207712_10000334	Ga0207712_1000033433	340
1212	3300026041	Ga0207639_10013881	Ga0207639_100138812	340
1213	3300026067	Ga0207678_10075496	Ga0207678_100754962	340
1214	3300026078	Ga0207702_10000019	Ga0207702_10000019148	340
1215	3300026088	Ga0207641_10002649	Ga0207641_100026495	340
1216	3300028380	Ga0268265_10000962	Ga0268265_1000096211	340
1217	3300028380	Ga0268265_10224900	Ga0268265_102249002	340
1218	3300028381	Ga0268264_10001094	Ga0268264_1000109411	340
1219	3300031731	Ga0307405_10087645	Ga0307405_100876452	340
1220	3300031995	Ga0307409_100015488	Ga0307409_1000154884	340
1221	3300035171	Ga0373946_0024183	Ga0373946_0024183_823_1851	340
1222	3300035695	Ga0373927_0000410	Ga0373927_0000410_29322_30350	340
1223	3300035725	Ga0373947_0009173	Ga0373947_0009173_145_1173	340
1224	3300037068	Ga0373925_0000730	Ga0373925_0000730_7873_8901	340
1225	3300038443	Ga0395901_0043177	Ga0395901_0043177_1228_2265	340
1226	3300039450	Ga0436363_1150514	Ga0436363_1150514_2794_3831	340
1227	3300044656	Ga0466969_0039455	Ga0466969_0039455_1285_2310	340
1228	3300044658	Ga0466972_0111947	Ga0466972_0111947_239_1264	340
1229	3300044684	Ga0466966_0001156	Ga0466966_0001156_8923_9948	340
1230	3300045049	Ga0466959_0007787	Ga0466959_0007787_4692_5717	340
1231	3300046531	Ga0495665_0033485	Ga0495665_0033485_1301_2329	340
1232	3300046616	Ga0495668_0000140	Ga0495668_0000140_57332_58360	340
1233	3300046690	Ga0495624_0063046	Ga0495624_0063046_381_1409	340
1234	3300048905	Ga0496102_0004150	Ga0496102_0004150_445_1473	340
1235	3300048905	Ga0496102_0115949	Ga0496102_0115949_1352_2386	340
1236	3300048906	Ga0496103_0003193	Ga0496103_0003193_1648_2676	340
1237	3300048912	Ga0496109_0160594	Ga0496109_0160594_51_1079	340
1238	3300048916	Ga0496113_0027368	Ga0496113_0027368_61_1104	340
1239	3300048925	Ga0496122_0000310	Ga0496122_0000310_93200_94234	340
1240	3300048928	Ga0496125_0003943	Ga0496125_0003943_12653_13687	340
1241	3300048928	Ga0496125_0008770	Ga0496125_0008770_6194_7222	340
1242	3300049573	Ga0501037_0110019	Ga0501037_0110019_712_1752	340
1243	3300049574	Ga0501038_0196611	Ga0501038_0196611_43_1083	340
1244	3300049579	Ga0501043_0198016	Ga0501043_0198016_375_1415	340
1245	3300049581	Ga0501047_0009898	Ga0501047_0009898_5612_6652	340
1246	3300049742	Ga0501080_0016873	Ga0501080_0016873_2072_3112	340
1247	3300049822	Ga0501035_0003108	Ga0501035_0003108_5490_6530	340
1248	3300049823	Ga0501044_0009480	Ga0501044_0009480_5397_6437	340
1249	3300049823	Ga0501044_0236557	Ga0501044_0236557_357_1382	340
1250	3300050490	nmdc:mga03n38_155138_c1	nmdc:mga03n38_155138_c1_83_1111	340
1251	3300061719	Ga0466962_0002590	Ga0466962_0002590_1237_2262	340
1252	iso_pu_bacteria	2562617112	2563056847	340
1253	iso_pu_bacteria	2622736605	2623498752	340
1254	iso_pu_bacteria	2711768613	2713481141	340
1255	iso_pu_bacteria	2738541272	2738694628	340
1256	iso_pu_bacteria	2738543011	2739236131	340
1257	iso_pu_bacteria	2786546132	2786675103	340
1258	iso_pu_bacteria	2877676314	2877684670	340
1259	iso_pu_bacteria	2889300758	2889304499	340
1260	iso_pu_bacteria	2939743619	2939745103	340
1261	iso_pu_bacteria	2954673503	2954680273	340
1262	iso_pu_bacteria	2954682443	2954683878	340
1263	3300001979	JGI24740J21852_10002683	JGI24740J21852_100026837	341
1264	3300001989	JGI24739J22299_10004028	JGI24739J22299_100040284	341
1265	3300002075	JGI24738J21930_10000132	JGI24738J21930_100001324	341
1266	3300005327	Ga0070658_10085040	Ga0070658_100850402	341
1267	3300005338	Ga0068868_100211149	Ga0068868_1002111492	341
1268	3300005344	Ga0070661_100037246	Ga0070661_1000372462	341
1269	3300005457	Ga0070662_100040010	Ga0070662_1000400102	341
1270	3300005535	Ga0070684_100042291	Ga0070684_1000422912	341
1271	3300005539	Ga0068853_100034643	Ga0068853_1000346432	341
1272	3300005563	Ga0068855_100073278	Ga0068855_1000732782	341
1273	3300005577	Ga0068857_100010913	Ga0068857_1000109137	341
1274	3300005578	Ga0068854_100001955	Ga0068854_1000019552	341
1275	3300005614	Ga0068856_100004825	Ga0068856_1000048254	341
1276	3300005616	Ga0068852_100062126	Ga0068852_1000621262	341
1277	3300005834	Ga0068851_10014265	Ga0068851_100142652	341
1278	3300005842	Ga0068858_100000071	Ga0068858_10000007131	341
1279	3300005983	Ga0081540_1000803	Ga0081540_100080321	341
1280	3300006051	Ga0075364_10027911	Ga0075364_100279114	341
1281	3300006178	Ga0075367_10164293	Ga0075367_101642932	341
1282	3300006186	Ga0075369_10003467	Ga0075369_100034674	341
1283	3300009093	Ga0105240_10077435	Ga0105240_100774352	341
1284	3300009093	Ga0105240_10160150	Ga0105240_101601503	341
1285	3300009174	Ga0105241_10023205	Ga0105241_100232054	341
1286	3300009177	Ga0105248_10000450	Ga0105248_100004504	341
1287	3300009545	Ga0105237_10042233	Ga0105237_100422334	341
1288	3300009551	Ga0105238_10011534	Ga0105238_100115345	341
1289	3300009551	Ga0105238_10056949	Ga0105238_100569492	341
1290	3300009553	Ga0105249_10132765	Ga0105249_101327653	341
1291	3300010375	Ga0105239_10019695	Ga0105239_100196955	341
1292	3300010375	Ga0105239_10037487	Ga0105239_100374874	341
1293	3300013104	Ga0157370_10016479	Ga0157370_100164795	341
1294	3300013105	Ga0157369_10264853	Ga0157369_102648532	341
1295	3300013307	Ga0157372_10004609	Ga0157372_100046094	341
1296	3300014326	Ga0157380_10266818	Ga0157380_102668182	341
1297	3300014326	Ga0157380_10339860	Ga0157380_103398602	341
1298	3300014968	Ga0157379_10000015	Ga0157379_1000001531	341
1299	3300025904	Ga0207647_10015326	Ga0207647_100153264	341
1300	3300025904	Ga0207647_10023664	Ga0207647_100236644	341
1301	3300025911	Ga0207654_10000383	Ga0207654_1000038312	341
1302	3300025913	Ga0207695_10008781	Ga0207695_1000878112	341
1303	3300025914	Ga0207671_10000702	Ga0207671_1000070213	341
1304	3300025919	Ga0207657_10034449	Ga0207657_100344494	341
1305	3300025924	Ga0207694_10000933	Ga0207694_1000093312	341
1306	3300025932	Ga0207690_10118527	Ga0207690_101185272	341
1307	3300025933	Ga0207706_10028246	Ga0207706_100282461	341
1308	3300025933	Ga0207706_10035172	Ga0207706_100351722	341
1309	3300025941	Ga0207711_10001827	Ga0207711_1000182717	341
1310	3300025945	Ga0207679_10288493	Ga0207679_102884932	341
1311	3300025949	Ga0207667_10007448	Ga0207667_100074484	341
1312	3300025981	Ga0207640_10007022	Ga0207640_100070224	341
1313	3300025981	Ga0207640_10373902	Ga0207640_103739021	341
1314	3300026035	Ga0207703_10000094	Ga0207703_1000009431	341
1315	3300026041	Ga0207639_10001071	Ga0207639_100010714	341
1316	3300026078	Ga0207702_10002429	Ga0207702_100024293	341
1317	3300026088	Ga0207641_10100637	Ga0207641_101006372	341
1318	3300026116	Ga0207674_10004606	Ga0207674_1000460614	341
1319	3300026142	Ga0207698_10003380	Ga0207698_100033805	341
1320	3300031911	Ga0307412_10232468	Ga0307412_102324682	341
1321	3300033180	Ga0307510_10003088	Ga0307510_1000308813	341
1322	3300037466	Ga0395898_0012071	Ga0395898_0012071_7171_8199	341
1323	3300037471	Ga0395905_0018917	Ga0395905_0018917_1801_2835	341
1324	3300037471	Ga0395905_0212001	Ga0395905_0212001_540_1574	341
1325	3300038443	Ga0395901_0030832	Ga0395901_0030832_2943_3971	341
1326	3300041496	Ga0451839_0426667	Ga0451839_0426667_35_1084	341
1327	3300044683	Ga0466965_0038068	Ga0466965_0038068_330_1358	341
1328	3300045976	Ga0466967_0022489	Ga0466967_0022489_3697_4725	341
1329	3300045976	Ga0466967_0378902	Ga0466967_0378902_236_1264	341
1330	3300046453	Ga0495627_001072	Ga0495627_001072_4960_5997	341
1331	3300046463	Ga0495653_0045911	Ga0495653_0045911_2060_3094	341
1332	3300046507	Ga0495606_0034505	Ga0495606_0034505_332_1360	341
1333	3300046531	Ga0495665_0002959	Ga0495665_0002959_3264_4292	341
1334	3300046674	Ga0495588_0023820	Ga0495588_0023820_126_1154	341
1335	3300046694	Ga0495649_0029073	Ga0495649_0029073_86_1111	341
1336	3300047315	Ga0495581_0016932	Ga0495581_0016932_1979_3007	341
1337	3300048916	Ga0496113_0019641	Ga0496113_0019641_3666_4694	341
1338	3300048921	Ga0496118_0029338	Ga0496118_0029338_1686_2714	341
1339	3300048926	Ga0496123_0126229	Ga0496123_0126229_368_1396	341
1340	3300048929	Ga0496126_0006618	Ga0496126_0006618_7411_8439	341
1341	3300048929	Ga0496126_0186830	Ga0496126_0186830_603_1631	341
1342	3300049573	Ga0501037_0010386	Ga0501037_0010386_5543_6574	341
1343	3300049581	Ga0501047_0000036	Ga0501047_0000036_13670_14701	341
1344	3300049675	Ga0501243_001464	Ga0501243_001464_73_1131	341
1345	3300049822	Ga0501035_0373541	Ga0501035_0373541_42_1073	341
1346	3300049823	Ga0501044_0093884	Ga0501044_0093884_1836_2867	341
1347	3300050491	nmdc:mga00v17_2323_c1	nmdc:mga00v17_2323_c1_7117_8145	341
1348	3300053087	Ga0500643_000288	Ga0500643_000288_27013_28038	341
1349	iso_pu_bacteria	2643221578	2643900950	341
1350	iso_pu_bacteria	2643221673	2644407096	341
1351	iso_pu_bacteria	2784746763	2785338952	341
1352	iso_pu_bacteria	2811994879	2812358301	341
1353	iso_pu_bacteria	2946072368	2946073377	341
1354	iso_pu_bacteria	8048356638	8048364369	341
1355	iso_pu_bacteria	8048379754	8048380633	341
1356	3300001979	JGI24740J21852_10000711	JGI24740J21852_100007118	342
1357	3300003578	Ga0006562J51391_1047977	Ga0006562J51391_10479774	342
1358	3300003578	Ga0006562J51391_1047978	Ga0006562J51391_10479782	342
1359	3300005548	Ga0070665_100005167	Ga0070665_1000051676	342
1360	3300005937	Ga0081455_10000072	Ga0081455_1000007293	342
1361	3300009093	Ga0105240_10144154	Ga0105240_101441542	342
1362	3300009148	Ga0105243_10003676	Ga0105243_100036769	342
1363	3300013104	Ga0157370_10017127	Ga0157370_100171272	342
1364	3300020081	Ga0206354_11589331	Ga0206354_115893312	342
1365	3300025913	Ga0207695_10255339	Ga0207695_102553392	342
1366	3300025935	Ga0207709_10009590	Ga0207709_100095904	342
1367	3300026041	Ga0207639_10003561	Ga0207639_100035615	342
1368	3300028379	Ga0268266_10020341	Ga0268266_100203412	342
1369	3300028794	Ga0307515_10003461	Ga0307515_1000346127	342
1370	3300031507	Ga0307509_10001929	Ga0307509_1000192910	342
1371	3300031616	Ga0307508_10002660	Ga0307508_100026607	342
1372	3300031711	Ga0265314_10037140	Ga0265314_100371403	342
1373	3300031995	Ga0307409_100359717	Ga0307409_1003597171	342
1374	3300032002	Ga0307416_100544319	Ga0307416_1005443191	342
1375	3300037312	Ga0395899_0026758	Ga0395899_0026758_1596_2642	342
1376	3300037418	Ga0395900_0004209	Ga0395900_0004209_12762_13808	342
1377	3300037418	Ga0395900_0153446	Ga0395900_0153446_858_1937	342
1378	3300037466	Ga0395898_0035174	Ga0395898_0035174_1467_2513	342
1379	3300037466	Ga0395898_0445558	Ga0395898_0445558_16_1095	342
1380	3300037471	Ga0395905_0005858	Ga0395905_0005858_11288_12346	342
1381	3300037471	Ga0395905_0050569	Ga0395905_0050569_2661_3719	342
1382	3300037471	Ga0395905_0062684	Ga0395905_0062684_84_1130	342
1383	3300037471	Ga0395905_0066056	Ga0395905_0066056_1056_2135	342
1384	3300038443	Ga0395901_0026128	Ga0395901_0026128_2597_3643	342
1385	3300042876	Ga0451577_0089587	Ga0451577_0089587_1203_2273	342
1386	3300044656	Ga0466969_0009500	Ga0466969_0009500_836_1876	342
1387	3300044658	Ga0466972_0000462	Ga0466972_0000462_12347_13387	342
1388	3300044684	Ga0466966_0000927	Ga0466966_0000927_16135_17166	342
1389	3300044684	Ga0466966_0001664	Ga0466966_0001664_7797_8837	342
1390	3300044693	Ga0466961_0005318	Ga0466961_0005318_3089_4129	342
1391	3300044693	Ga0466961_0012135	Ga0466961_0012135_1196_2227	342
1392	3300044693	Ga0466961_0034753	Ga0466961_0034753_1100_2140	342
1393	3300044712	Ga0453684_0297449	Ga0453684_0297449_669_1739	342
1394	3300044719	Ga0466971_0098252	Ga0466971_0098252_51_1091	342
1395	3300044735	Ga0466968_0013336	Ga0466968_0013336_1510_2541	342
1396	3300044765	Ga0466970_0004934	Ga0466970_0004934_3330_4361	342
1397	3300044842	Ga0466957_0123522	Ga0466957_0123522_359_1390	342
1398	3300045049	Ga0466959_0019614	Ga0466959_0019614_3273_4304	342
1399	3300045049	Ga0466959_0077580	Ga0466959_0077580_690_1730	342
1400	3300045051	Ga0451576_0008986	Ga0451576_0008986_3011_4081	342
1401	3300045836	Ga0466958_0020230	Ga0466958_0020230_1538_2569	342
1402	3300048905	Ga0496102_0001362	Ga0496102_0001362_10747_11784	342
1403	3300048906	Ga0496103_0004050	Ga0496103_0004050_7747_8784	342
1404	3300048921	Ga0496118_0008803	Ga0496118_0008803_7397_8464	342
1405	3300048927	Ga0496124_0006777	Ga0496124_0006777_9847_10914	342
1406	3300048928	Ga0496125_0029798	Ga0496125_0029798_2852_3919	342
1407	3300049571	Ga0501034_0000106	Ga0501034_0000106_104644_105693	342
1408	3300061719	Ga0466962_0065263	Ga0466962_0065263_75_1115	342
1409	3300061719	Ga0466962_0103894	Ga0466962_0103894_163_1203	342
1410	iso_pu_bacteria	2684623035	2686538252	342
1411	iso_pu_bacteria	2915358134	2915358969	342
1412	iso_pu_bacteria	2945909444	2945914585	342
1413	iso_pu_bacteria	2945984333	2945990014	342
1414	iso_pu_bacteria	8048369669	8048371700	342
1415	3300003791	Ga0055530_10006899	Ga0055530_100068993	343
1416	3300003792	Ga0055540_1000374	Ga0055540_100037428	343
1417	3300003794	Ga0055531_10000475	Ga0055531_1000047517	343
1418	3300003794	Ga0055531_10000798	Ga0055531_1000079827	343
1419	3300005288	Ga0065714_10072687	Ga0065714_100726873	343
1420	3300005338	Ga0068868_100096800	Ga0068868_1000968001	343
1421	3300005455	Ga0070663_100171543	Ga0070663_1001715431	343
1422	3300005457	Ga0070662_100002546	Ga0070662_1000025463	343
1423	3300005457	Ga0070662_100127245	Ga0070662_1001272452	343
1424	3300005539	Ga0068853_100496487	Ga0068853_1004964871	343
1425	3300005548	Ga0070665_100405076	Ga0070665_1004050762	343
1426	3300005563	Ga0068855_100639185	Ga0068855_1006391851	343
1427	3300005617	Ga0068859_100410724	Ga0068859_1004107242	343
1428	3300005842	Ga0068858_100194908	Ga0068858_1001949082	343
1429	3300006931	Ga0097620_100410757	Ga0097620_1004107571	343
1430	3300006946	Ga0079104_1023539	Ga0079104_10235392	343
1431	3300006948	Ga0099826_10011905	Ga0099826_100119055	343
1432	3300009148	Ga0105243_10013641	Ga0105243_100136413	343
1433	3300013306	Ga0163162_10319926	Ga0163162_103199262	343
1434	3300013308	Ga0157375_10145300	Ga0157375_101453002	343
1435	3300014497	Ga0182008_10000353	Ga0182008_1000035328	343
1436	3300017792	Ga0163161_10000201	Ga0163161_1000020116	343
1437	3300025292	Ga0209676_1000779	Ga0209676_100077917	343
1438	3300025298	Ga0209050_1000412	Ga0209050_100041271	343
1439	3300025303	Ga0209051_1000150	Ga0209051_100015072	343
1440	3300025304	Ga0209257_1000275	Ga0209257_100027590	343
1441	3300025728	Ga0207655_1022408	Ga0207655_10224082	343
1442	3300025899	Ga0207642_10038024	Ga0207642_100380241	343
1443	3300025901	Ga0207688_10015128	Ga0207688_100151284	343
1444	3300025933	Ga0207706_10005299	Ga0207706_100052999	343
1445	3300025933	Ga0207706_10059270	Ga0207706_100592703	343
1446	3300025935	Ga0207709_10003334	Ga0207709_100033349	343
1447	3300026041	Ga0207639_10046183	Ga0207639_100461833	343
1448	3300026067	Ga0207678_10180867	Ga0207678_101808672	343
1449	3300026116	Ga0207674_10151585	Ga0207674_101515851	343
1450	3300026118	Ga0207675_100018468	Ga0207675_1000184684	343
1451	3300026121	Ga0207683_10100938	Ga0207683_101009381	343
1452	3300028379	Ga0268266_10331744	Ga0268266_103317442	343
1453	3300031456	Ga0307513_10000219	Ga0307513_1000021963	343
1454	3300031548	Ga0307408_100012250	Ga0307408_1000122505	343
1455	3300031911	Ga0307412_10226929	Ga0307412_102269292	343
1456	3300032004	Ga0307414_10002087	Ga0307414_100020877	343
1457	3300045051	Ga0451576_0027926	Ga0451576_0027926_2664_3698	343
1458	3300046455	Ga0495603_0007336	Ga0495603_0007336_2749_3783	343
1459	3300046472	Ga0495580_0015860	Ga0495580_0015860_2709_3743	343
1460	3300046491	Ga0495584_0118609	Ga0495584_0118609_227_1261	343
1461	3300046513	Ga0495616_0037408	Ga0495616_0037408_723_1757	343
1462	3300046528	Ga0495642_0090933	Ga0495642_0090933_140_1186	343
1463	3300046557	Ga0495622_0011238	Ga0495622_0011238_1687_2733	343
1464	3300046679	Ga0495623_0202603	Ga0495623_0202603_32_1087	343
1465	3300047319	Ga0495674_0006435	Ga0495674_0006435_6187_7221	343
1466	3300047319	Ga0495674_0007194	Ga0495674_0007194_2905_3960	343
1467	3300047320	Ga0495672_0007520	Ga0495672_0007520_4037_5071	343
1468	3300047321	Ga0495676_0067182	Ga0495676_0067182_925_1968	343
1469	3300047323	Ga0495683_0014751	Ga0495683_0014751_2256_3290	343
1470	3300047443	Ga0495687_036601	Ga0495687_036601_58_1092	343
1471	3300047469	Ga0495673_0008706	Ga0495673_0008706_1424_2458	343
1472	3300048903	Ga0496100_0008351	Ga0496100_0008351_81_1115	343
1473	3300048903	Ga0496100_0154789	Ga0496100_0154789_183_1229	343
1474	3300048904	Ga0496101_0052905	Ga0496101_0052905_935_1981	343
1475	3300048905	Ga0496102_0046800	Ga0496102_0046800_2517_3569	343
1476	3300048907	Ga0496104_0020106	Ga0496104_0020106_1434_2468	343
1477	3300048907	Ga0496104_0034365	Ga0496104_0034365_2730_3776	343
1478	3300048908	Ga0496105_0005813	Ga0496105_0005813_2513_3559	343
1479	3300048908	Ga0496105_0063948	Ga0496105_0063948_863_1897	343
1480	3300048909	Ga0496106_0100261	Ga0496106_0100261_1182_2216	343
1481	3300048909	Ga0496106_0142053	Ga0496106_0142053_502_1536	343
1482	3300048913	Ga0496110_0291118	Ga0496110_0291118_283_1335	343
1483	3300048915	Ga0496112_0019536	Ga0496112_0019536_2399_3433	343
1484	3300048916	Ga0496113_0006120	Ga0496113_0006120_6534_7568	343
1485	3300048920	Ga0496117_0008128	Ga0496117_0008128_6794_7927	343
1486	3300048921	Ga0496118_0003112	Ga0496118_0003112_1408_2541	343
1487	3300048921	Ga0496118_0109992	Ga0496118_0109992_411_1442	343
1488	3300048922	Ga0496119_0000119	Ga0496119_0000119_83038_84069	343
1489	3300048923	Ga0496120_0031371	Ga0496120_0031371_834_1865	343
1490	3300048924	Ga0496121_0000382	Ga0496121_0000382_22825_23868	343
1491	3300048924	Ga0496121_0002155	Ga0496121_0002155_14097_15143	343
1492	3300048924	Ga0496121_0009162	Ga0496121_0009162_10010_11044	343
1493	3300049459	Ga0495678_036129	Ga0495678_036129_670_1704	343
1494	3300053079	Ga0500610_0000020	Ga0500610_0000020_25433_26503	343
1495	iso_pu_bacteria	2643221549	2643766676	343
1496	iso_pu_bacteria	2643221649	2644278126	343
1497	iso_pu_bacteria	2721755702	2723640571	343
1498	iso_pu_bacteria	2808606372	2808899371	343
1499	iso_pu_bacteria	2929212328	2929217851	343
1500	3300002070	JGI24750J21931_1002100	JGI24750J21931_10021001	344
1501	3300002073	JGI24745J21846_1001283	JGI24745J21846_10012832	344
1502	3300002076	JGI24749J21850_1004251	JGI24749J21850_10042512	344
1503	3300002077	JGI24744J21845_10000214	JGI24744J21845_100002147	344
1504	3300002244	JGI24742J22300_10000517	JGI24742J22300_100005172	344
1505	3300002459	JGI24751J29686_10017101	JGI24751J29686_100171012	344
1506	3300005331	Ga0070670_100035314	Ga0070670_1000353144	344
1507	3300005336	Ga0070680_100089435	Ga0070680_1000894352	344
1508	3300005343	Ga0070687_100036621	Ga0070687_1000366212	344
1509	3300005345	Ga0070692_10040316	Ga0070692_100403162	344
1510	3300005347	Ga0070668_100298556	Ga0070668_1002985561	344
1511	3300005353	Ga0070669_100153879	Ga0070669_1001538792	344
1512	3300005364	Ga0070673_100066340	Ga0070673_1000663402	344
1513	3300005434	Ga0070709_10013047	Ga0070709_100130474	344
1514	3300005441	Ga0070700_100233018	Ga0070700_1002330182	344
1515	3300005445	Ga0070708_100109310	Ga0070708_1001093102	344
1516	3300005458	Ga0070681_10023386	Ga0070681_100233863	344
1517	3300005467	Ga0070706_100017747	Ga0070706_1000177473	344
1518	3300005471	Ga0070698_100024948	Ga0070698_1000249483	344
1519	3300005530	Ga0070679_100389841	Ga0070679_1003898411	344
1520	3300005530	Ga0070679_100441610	Ga0070679_1004416102	344
1521	3300005539	Ga0068853_100094831	Ga0068853_1000948312	344
1522	3300005545	Ga0070695_100022082	Ga0070695_1000220823	344
1523	3300005548	Ga0070665_100096194	Ga0070665_1000961943	344
1524	3300005616	Ga0068852_100010518	Ga0068852_1000105183	344
1525	3300005834	Ga0068851_10046099	Ga0068851_100460992	344
1526	3300006048	Ga0075363_100019796	Ga0075363_1000197962	344
1527	3300006177	Ga0075362_10037781	Ga0075362_100377812	344
1528	3300006186	Ga0075369_10027436	Ga0075369_100274362	344
1529	3300006186	Ga0075369_10079529	Ga0075369_100795292	344
1530	3300006195	Ga0075366_10000691	Ga0075366_1000069115	344
1531	3300006353	Ga0075370_10000589	Ga0075370_100005894	344
1532	3300006871	Ga0075434_100220638	Ga0075434_1002206382	344
1533	3300009092	Ga0105250_10030697	Ga0105250_100306973	344
1534	3300009093	Ga0105240_10076538	Ga0105240_100765383	344
1535	3300009093	Ga0105240_10100206	Ga0105240_101002063	344
1536	3300009094	Ga0111539_10275603	Ga0111539_102756032	344
1537	3300009098	Ga0105245_10603499	Ga0105245_106034991	344
1538	3300011119	Ga0105246_10062811	Ga0105246_100628112	344
1539	3300013296	Ga0157374_10142773	Ga0157374_101427732	344
1540	3300014969	Ga0157376_10044652	Ga0157376_100446524	344
1541	3300025901	Ga0207688_10016838	Ga0207688_100168383	344
1542	3300025904	Ga0207647_10003420	Ga0207647_100034203	344
1543	3300025905	Ga0207685_10014285	Ga0207685_100142852	344
1544	3300025907	Ga0207645_10006008	Ga0207645_100060082	344
1545	3300025910	Ga0207684_10055485	Ga0207684_100554852	344
1546	3300025912	Ga0207707_10077753	Ga0207707_100777532	344
1547	3300025913	Ga0207695_10055228	Ga0207695_100552282	344
1548	3300025915	Ga0207693_10005274	Ga0207693_100052748	344
1549	3300025918	Ga0207662_10000254	Ga0207662_100002545	344
1550	3300025919	Ga0207657_10036394	Ga0207657_100363942	344
1551	3300025933	Ga0207706_10065155	Ga0207706_100651553	344
1552	3300025934	Ga0207686_10003225	Ga0207686_100032258	344
1553	3300025935	Ga0207709_10055055	Ga0207709_100550552	344
1554	3300025939	Ga0207665_10055951	Ga0207665_100559512	344
1555	3300025940	Ga0207691_10013126	Ga0207691_100131264	344
1556	3300025942	Ga0207689_10022570	Ga0207689_100225705	344
1557	3300026067	Ga0207678_10012246	Ga0207678_100122466	344
1558	3300026075	Ga0207708_10011471	Ga0207708_100114715	344
1559	3300026078	Ga0207702_10173590	Ga0207702_101735902	344
1560	3300026089	Ga0207648_10015533	Ga0207648_100155332	344
1561	3300026118	Ga0207675_100062339	Ga0207675_1000623392	344
1562	3300026121	Ga0207683_10013203	Ga0207683_100132036	344
1563	3300026121	Ga0207683_10199936	Ga0207683_101999362	344
1564	3300028381	Ga0268264_10001384	Ga0268264_100013842	344
1565	3300028794	Ga0307515_10100958	Ga0307515_101009583	344
1566	3300035092	Ga0373952_0017907	Ga0373952_0017907_380_1417	344
1567	3300035691	Ga0373931_0003665	Ga0373931_0003665_1385_2422	344
1568	3300037466	Ga0395898_0164832	Ga0395898_0164832_701_1738	344
1569	3300042005	Ga0439448_0019533	Ga0439448_0019533_599_1636	344
1570	3300044901	Ga0466960_0024039	Ga0466960_0024039_834_1877	344
1571	3300045836	Ga0466958_0004427	Ga0466958_0004427_5299_6351	344
1572	3300046453	Ga0495627_026424	Ga0495627_026424_699_1739	344
1573	3300046475	Ga0495639_0003285	Ga0495639_0003285_3056_4093	344
1574	3300046512	Ga0495610_0000198	Ga0495610_0000198_52666_53706	344
1575	3300046518	Ga0495631_0000063	Ga0495631_0000063_12859_13899	344
1576	3300046525	Ga0495663_0000394	Ga0495663_0000394_9160_10200	344
1577	3300046528	Ga0495642_0076951	Ga0495642_0076951_187_1224	344
1578	3300046558	Ga0495633_0006427	Ga0495633_0006427_5412_6452	344
1579	3300046660	Ga0495625_0059375	Ga0495625_0059375_939_1982	344
1580	3300047320	Ga0495672_0000006	Ga0495672_0000006_481020_482060	344
1581	3300048903	Ga0496100_0009196	Ga0496100_0009196_4400_5437	344
1582	3300048904	Ga0496101_0006713	Ga0496101_0006713_900_1937	344
1583	3300048905	Ga0496102_0017432	Ga0496102_0017432_1481_2518	344
1584	3300048906	Ga0496103_0008193	Ga0496103_0008193_23_1060	344
1585	3300048907	Ga0496104_0016732	Ga0496104_0016732_2084_3121	344
1586	3300048907	Ga0496104_0276725	Ga0496104_0276725_165_1202	344
1587	3300048908	Ga0496105_0043486	Ga0496105_0043486_2170_3207	344
1588	3300048909	Ga0496106_0048984	Ga0496106_0048984_116_1153	344
1589	3300048911	Ga0496108_0147251	Ga0496108_0147251_901_1938	344
1590	3300048912	Ga0496109_0128879	Ga0496109_0128879_69_1106	344
1591	3300048912	Ga0496109_0207237	Ga0496109_0207237_404_1441	344
1592	3300048913	Ga0496110_0019584	Ga0496110_0019584_3215_4252	344
1593	3300048914	Ga0496111_0049764	Ga0496111_0049764_733_1770	344
1594	3300048916	Ga0496113_0072833	Ga0496113_0072833_1146_2183	344
1595	3300048925	Ga0496122_0000662	Ga0496122_0000662_50290_51330	344
1596	3300048926	Ga0496123_0000478	Ga0496123_0000478_50289_51329	344
1597	3300048927	Ga0496124_0000569	Ga0496124_0000569_9215_10255	344
1598	3300048928	Ga0496125_0000395	Ga0496125_0000395_32445_33485	344
1599	3300048928	Ga0496125_0005275	Ga0496125_0005275_5122_6162	344
1600	3300049581	Ga0501047_0295781	Ga0501047_0295781_290_1339	344
1601	3300049686	Ga0501257_001732	Ga0501257_001732_2666_3724	344
1602	3300050493	nmdc:mga0k408_29312_c1	nmdc:mga0k408_29312_c1_1514_2551	344
1603	3300050496	nmdc:mga07m45_28397_c1	nmdc:mga07m45_28397_c1_1092_2129	344
1604	3300053734	Ga0500565_000835	Ga0500565_000835_293_1333	344
1605	iso_pu_bacteria	2870628048	2870628179	344
1606	iso_pu_bacteria	2904541872	2904545693	344
1607	iso_pu_bacteria	2929160207	2929168348	344
1608	iso_pu_bacteria	2935390628	2935393775	344
1609	iso_pu_bacteria	2939674588	2939674789	344
1610	3300010375	Ga0105239_10000626	Ga0105239_1000062620	345
1611	3300028794	Ga0307515_10264390	Ga0307515_102643901	345
1612	3300031456	Ga0307513_10126960	Ga0307513_101269602	345
1613	3300031649	Ga0307514_10043511	Ga0307514_100435112	345
1614	3300046558	Ga0495633_0067193	Ga0495633_0067193_251_1291	345
1615	3300048917	Ga0496114_0051083	Ga0496114_0051083_1761_2831	345
1616	3300049776	Ga0501280_001356	Ga0501280_001356_1375_2436	345
1617	iso_pu_bacteria	2935409751	2935410066	345
1618	3300003187	JGI25151J46595_10006212	JGI25151J46595_100062126	346
1619	3300005347	Ga0070668_100012270	Ga0070668_1000122702	346
1620	3300005434	Ga0070709_10074903	Ga0070709_100749031	346
1621	3300005439	Ga0070711_100017440	Ga0070711_1000174405	346
1622	3300005543	Ga0070672_100240562	Ga0070672_1002405622	346
1623	3300006173	Ga0070716_100002397	Ga0070716_1000023973	346
1624	3300006175	Ga0070712_100005544	Ga0070712_10000554410	346
1625	3300014325	Ga0163163_10000004	Ga0163163_10000004350	346
1626	3300014968	Ga0157379_10000284	Ga0157379_100002847	346
1627	3300025294	Ga0209025_1000029	Ga0209025_100002914	346
1628	3300025898	Ga0207692_10023138	Ga0207692_100231383	346
1629	3300025906	Ga0207699_10023992	Ga0207699_100239924	346
1630	3300025915	Ga0207693_10004892	Ga0207693_100048923	346
1631	3300025916	Ga0207663_10081169	Ga0207663_100811692	346
1632	3300025928	Ga0207700_10004057	Ga0207700_1000405710	346
1633	3300025939	Ga0207665_10003419	Ga0207665_100034196	346
1634	3300025972	Ga0207668_10035999	Ga0207668_100359993	346
1635	3300028800	Ga0265338_10139736	Ga0265338_101397362	346
1636	iso_pu_bacteria	2622736605	2623500936	346
1637	iso_pu_bacteria	2867346516	2867347023	346
1638	iso_pu_bacteria	8047710418	8047712035	346
1639	3300046454	Ga0495592_0012672	Ga0495592_0012672_2974_4020	347
1640	3300046463	Ga0495653_0036548	Ga0495653_0036548_559_1605	347
1641	3300046476	Ga0495662_0008243	Ga0495662_0008243_1636_2682	347
1642	3300046477	Ga0495664_0003557	Ga0495664_0003557_6491_7537	347
1643	3300046511	Ga0495608_0073290	Ga0495608_0073290_666_1712	347
1644	3300046516	Ga0495628_0046359	Ga0495628_0046359_402_1448	347
1645	3300046517	Ga0495630_0006537	Ga0495630_0006537_5497_6543	347
1646	3300046526	Ga0495666_0005780	Ga0495666_0005780_1687_2733	347
1647	3300046529	Ga0495652_0034602	Ga0495652_0034602_1760_2806	347
1648	3300046533	Ga0495640_0016046	Ga0495640_0016046_3924_4970	347
1649	3300046535	Ga0495586_0014575	Ga0495586_0014575_1376_2422	347
1650	3300046536	Ga0495587_0001318	Ga0495587_0001318_13676_14722	347
1651	3300046559	Ga0495667_0059961	Ga0495667_0059961_445_1491	347
1652	3300046675	Ga0495657_0059057	Ga0495657_0059057_918_1964	347
1653	3300046679	Ga0495623_0001804	Ga0495623_0001804_11585_12631	347
1654	3300046680	Ga0495646_0000390	Ga0495646_0000390_21282_22328	347
1655	3300046689	Ga0495613_0109142	Ga0495613_0109142_641_1687	347
1656	3300046809	Ga0495600_0001254	Ga0495600_0001254_11585_12631	347
1657	3300047315	Ga0495581_0103882	Ga0495581_0103882_380_1426	347
1658	3300047317	Ga0495604_0001552	Ga0495604_0001552_6299_7345	347
1659	3300047319	Ga0495674_0023541	Ga0495674_0023541_4227_5273	347
1660	3300047444	Ga0495675_0001577	Ga0495675_0001577_1115_2161	347
1661	3300047471	Ga0495684_0002582	Ga0495684_0002582_11585_12631	347
1662	3300048088	Ga0495602_0005230	Ga0495602_0005230_11585_12631	347
1663	3300053077	Ga0495601_0107814	Ga0495601_0107814_331_1377	347
1664	3300005614	Ga0068856_100031379	Ga0068856_1000313792	348
1665	3300006195	Ga0075366_10002546	Ga0075366_100025463	348
1666	3300006353	Ga0075370_10001354	Ga0075370_100013545	348
1667	3300009093	Ga0105240_10103573	Ga0105240_101035732	348
1668	3300009545	Ga0105237_10019441	Ga0105237_100194412	348
1669	3300010375	Ga0105239_10021350	Ga0105239_100213502	348
1670	3300026078	Ga0207702_10012384	Ga0207702_100123844	348
1671	3300031616	Ga0307508_10001653	Ga0307508_1000165313	348
1672	3300050493	nmdc:mga0k408_3752_c1	nmdc:mga0k408_3752_c1_1283_2383	348
1673	3300050496	nmdc:mga07m45_1348_c1	nmdc:mga07m45_1348_c1_3267_4367	348
1674	3300009545	Ga0105237_10001013	Ga0105237_1000101311	349
1675	3300010375	Ga0105239_10001157	Ga0105239_1000115711	349
1676	3300025914	Ga0207671_10010953	Ga0207671_100109531	349
1677	3300025949	Ga0207667_10169458	Ga0207667_101694582	349
1678	iso_pu_bacteria	2506783011	2506866591	349
1679	iso_pu_bacteria	2773857933	2774903118	349
1680	3300025229	Ga0209147_100156	Ga0209147_10015612	350
1681	3300053087	Ga0500643_000806	Ga0500643_000806_11905_12963	350
1682	3300000549	LJQas_1006075	LJQas_10060752	351
1683	3300046454	Ga0495592_0015756	Ga0495592_0015756_4133_5200	351
1684	3300046529	Ga0495652_0000784	Ga0495652_0000784_25994_27061	351
1685	3300046543	Ga0495645_0017315	Ga0495645_0017315_2188_3255	351
1686	3300046679	Ga0495623_0030607	Ga0495623_0030607_2239_3306	351
1687	3300046689	Ga0495613_0128580	Ga0495613_0128580_289_1383	351
1688	3300053077	Ga0495601_0039665	Ga0495601_0039665_447_1514	351
1689	3300053101	Ga0500553_077520	Ga0500553_077520_186_1280	351

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00682

HMGL-like

6

263

0.97 PF07836

DmpG_comm

DmpG-like communication domain

272

334

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1nvm-assembly1.cif.gz_A	crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate	0.9925	3	335
4lrs-assembly1.cif.gz_A	crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during nad+ and coa accommodation whithin the shared cofactor-binding site	0.9845	3	337
4jn6-assembly1.cif.gz_A	crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37	0.9794	1	338
4jn6-assembly1.cif.gz_A	crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37	0.9766	1	338
4lrs-assembly1.cif.gz_A	crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during nad+ and coa accommodation whithin the shared cofactor-binding site	0.9759	3	337

ID	Description	Score	Start	End	Superfamily
1nvmE01	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9965	3	265	3.20.20.70
1nvmG02	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.9916	273	335	1.10.8.60
af_P51020_275_337_1.10.8.60	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.9909	273	334	1.10.8.60
1nvmE02	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.9903	273	333	1.10.8.60
af_O06334_8_264_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9769	3	260	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A6P1I588-F1-model_v4	4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)	1.003	84	233	GO:0003852 GO:0008701 GO:0009098
AF-A0A4Q2QN03-F1-model_v4	4-hydroxy-2-oxovalerate aldolase	1.003	82	209	GO:0003852 GO:0009098
AF-A0A6B3D2C3-F1-model_v4	4-hydroxy-2-oxovalerate aldolase	1.003	62	163	GO:0003824
AF-A0A3D9TR18-F1-model_v4	deleted	1.002	136	275
AF-A0A6M1I1J8-F1-model_v4	deleted	1.002	99	228

Feature Viewer

pLDDT	pTM	Quality
94.93	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495346

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00682

HMGL-like

HMGL-like

6

263

0.97

PF07836

DmpG_comm

DmpG-like communication domain

272

334

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map