F495323
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1684 | 564 | 3368 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300025932|Ga0207690_10430213|Ga0207690_104302131 |
| Length | 277 |
| Sequence | MRDPPAHLPPRRSIPLRAATIAGIATRSTSMRLSHKIAIVTGAAQGIGLATALKFAREGASVVVCDLHDVGTAVAAVSAVSVEGAACLGQVMDVTDRAQVDAMVAAVKDRFGRIDVLVNNAGITRDARLQKMTLEQFDAVIDVNLRGVFHCTQAVADAMVAQGSGSILNASSVVGIYGNFGQTNYAATKFGVIGFTKTWSRELGPKGVRVNAVAPGFVETPILATVPDKVLQHMREQVPLHRLGRPEEIANVYAFLASDEASYVNGAVIEVSGGMSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 130 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 131 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 132 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 150 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 172 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 173 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 281 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 285 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 286 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 287 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 288 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 289 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 291 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 292 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 293 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 294 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 295 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 296 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 297 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 298 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 299 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 300 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 301 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 302 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 303 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 304 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 305 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 306 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 307 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 308 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 309 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 310 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 311 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 312 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 313 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 314 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 315 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 316 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 317 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 318 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 320 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 321 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 322 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 323 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 324 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 325 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 326 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 327 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 328 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 329 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 330 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 331 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 332 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 333 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 334 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 335 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 336 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 337 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 338 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 339 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 340 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 341 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 342 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 343 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 344 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 345 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 346 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 347 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 348 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 349 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 350 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 351 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 352 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 353 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 354 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 355 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 356 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 357 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 358 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 359 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 360 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 361 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 429 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 430 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 431 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 432 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 433 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 434 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 437 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 438 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 439 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 440 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 441 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 442 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 443 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 444 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 445 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 446 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 449 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 450 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 451 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 452 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 453 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 481 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 482 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 483 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 484 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 485 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 496 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 499 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 501 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 502 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 503 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 505 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 506 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 508 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 509 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 510 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 512 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 528 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 529 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 530 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 531 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 532 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 533 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 534 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 535 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 536 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 537 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 538 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 539 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 540 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 541 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 542 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 543 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 544 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 545 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 546 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 547 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 548 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 549 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 550 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 551 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 552 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 553 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 554 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 555 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 556 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 557 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 558 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 559 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 560 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 561 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 562 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 563 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 564 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.67 |
| Metatranscriptomes | 1.13 |
| Isolates | 2.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.13 |
| Nodule | 0.59 |
| Rhizoplane | 3.86 |
| Rhizosphere | 83.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207690_10430213 | 3300025932 | Bacteria | 1057 |
| 2 | JGI24740J21852_10001143 | 3300001979 | Bacteria | 11990 |
| 3 | JGI24740J21852_10010597 | 3300001979 | Bacteria | 3541 |
| 4 | JGI24739J22299_10009570 | 3300001989 | Bacteria | 3607 |
| 5 | JGI24748J21848_1020814 | 3300002074 | Bacteria | 791 |
| 6 | JGI24738J21930_10000443 | 3300002075 | Bacteria | 11696 |
| 7 | JGI25155J39150_1000366 | 3300002704 | Bacteria | 13753 |
| 8 | JGI25156J39149_1000649 | 3300002705 | Bacteria | 19021 |
| 9 | JGI25156J39149_1000693 | 3300002705 | Bacteria | 18068 |
| 10 | JGI25156J39149_1001347 | 3300002705 | Bacteria | 10537 |
| 11 | JGI25156J39149_1007814 | 3300002705 | Bacteria | 2764 |
| 12 | JGI25154J39366_1000534 | 3300002738 | Bacteria | 19006 |
| 13 | JGI25154J39366_1001866 | 3300002738 | Bacteria | 6417 |
| 14 | JGI25157J39369_1000566 | 3300002741 | Bacteria | 22112 |
| 15 | JGI25157J39369_1000665 | 3300002741 | Bacteria | 19017 |
| 16 | JGI25164J39214_1006209 | 3300002772 | Bacteria | 1262 |
| 17 | JGI25150J39212_1007383 | 3300002774 | Bacteria | 2212 |
| 18 | JGI25159J45721_1000689 | 3300002987 | Bacteria | 14836 |
| 19 | JGI25159J45721_1016659 | 3300002987 | Bacteria | 1556 |
| 20 | JGI25151J46595_10001030 | 3300003187 | Bacteria | 20866 |
| 21 | JGI25151J46595_10014571 | 3300003187 | Bacteria | 3497 |
| 22 | rootH1_10010127 | 3300003316 | Bacteria | 3985 |
| 23 | rootL2_10062439 | 3300003322 | Bacteria | 2059 |
| 24 | rootL2_10086809 | 3300003322 | Bacteria | 2197 |
| 25 | rootH1_10005148 | 3300003323 | Bacteria | 3757 |
| 26 | JGI25160J50197_1000305 | 3300003354 | Bacteria | 34747 |
| 27 | JGI25161J50226_1000018 | 3300003374 | Bacteria | 172599 |
| 28 | Ga0055539_1001771 | 3300003752 | Bacteria | 3727 |
| 29 | Ga0055532_1000453 | 3300003758 | Bacteria | 19021 |
| 30 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 31 | Ga0055535_1008682 | 3300003761 | Bacteria | 1809 |
| 32 | Ga0055542_1001255 | 3300003762 | Bacteria | 13936 |
| 33 | Ga0055529_1000806 | 3300003763 | Bacteria | 19128 |
| 34 | Ga0055537_1000008 | 3300003773 | Bacteria | 142572 |
| 35 | Ga0055537_1016554 | 3300003773 | Bacteria | 1243 |
| 36 | Ga0055524_1000083 | 3300003775 | Bacteria | 119259 |
| 37 | Ga0055534_1001337 | 3300003784 | Bacteria | 9902 |
| 38 | Ga0055528_1000652 | 3300003790 | Bacteria | 25243 |
| 39 | Ga0055530_10000211 | 3300003791 | Bacteria | 52600 |
| 40 | Ga0055540_1000012 | 3300003792 | Bacteria | 262667 |
| 41 | Ga0055540_1014922 | 3300003792 | Bacteria | 2288 |
| 42 | Ga0055531_10000181 | 3300003794 | Bacteria | 71324 |
| 43 | Ga0055531_10004842 | 3300003794 | Bacteria | 8031 |
| 44 | Ga0055531_10013006 | 3300003794 | Bacteria | 3870 |
| 45 | Ga0055543_1000418 | 3300004625 | Bacteria | 26839 |
| 46 | Ga0065165_1002315 | 3300005262 | Bacteria | 16665 |
| 47 | Ga0065165_1004913 | 3300005262 | Bacteria | 7892 |
| 48 | Ga0065712_10020755 | 3300005290 | Bacteria | 1411 |
| 49 | Ga0065712_10133994 | 3300005290 | Bacteria | 1517 |
| 50 | Ga0065715_10136268 | 3300005293 | Bacteria | 1925 |
| 51 | Ga0065715_10159109 | 3300005293 | Bacteria | 1647 |
| 52 | Ga0065715_10161730 | 3300005293 | Bacteria | 1623 |
| 53 | Ga0065715_10173334 | 3300005293 | Bacteria | 1529 |
| 54 | Ga0065715_10236508 | 3300005293 | Bacteria | 1215 |
| 55 | Ga0065715_10282474 | 3300005293 | Bacteria | 1083 |
| 56 | Ga0065707_10207925 | 3300005295 | Bacteria | 1279 |
| 57 | Ga0065707_10324178 | 3300005295 | Bacteria | 961 |
| 58 | Ga0070658_10031442 | 3300005327 | Bacteria | 4262 |
| 59 | Ga0070658_10054387 | 3300005327 | Bacteria | 3250 |
| 60 | Ga0070658_10136621 | 3300005327 | Bacteria | 2046 |
| 61 | Ga0070658_10141460 | 3300005327 | Bacteria | 2010 |
| 62 | Ga0070658_10214779 | 3300005327 | Bacteria | 1625 |
| 63 | Ga0070676_10003185 | 3300005328 | Bacteria | 8505 |
| 64 | Ga0070676_10011669 | 3300005328 | Bacteria | 4781 |
| 65 | Ga0070676_10060407 | 3300005328 | Bacteria | 2251 |
| 66 | Ga0070676_10423806 | 3300005328 | Bacteria | 930 |
| 67 | Ga0070683_100015001 | 3300005329 | Bacteria | 6796 |
| 68 | Ga0070683_100024314 | 3300005329 | Bacteria | 5425 |
| 69 | Ga0070683_100061006 | 3300005329 | Bacteria | 3505 |
| 70 | Ga0070690_100000658 | 3300005330 | Bacteria | 17624 |
| 71 | Ga0070690_100001010 | 3300005330 | Bacteria | 14386 |
| 72 | Ga0070690_100199390 | 3300005330 | Bacteria | 1392 |
| 73 | Ga0070670_100002859 | 3300005331 | Bacteria | 14280 |
| 74 | Ga0070670_100011705 | 3300005331 | Bacteria | 7504 |
| 75 | Ga0070670_100012920 | 3300005331 | Bacteria | 7149 |
| 76 | Ga0070670_100025473 | 3300005331 | Bacteria | 5089 |
| 77 | Ga0070670_100048045 | 3300005331 | Bacteria | 3673 |
| 78 | Ga0070670_100061382 | 3300005331 | Bacteria | 3227 |
| 79 | Ga0070670_100111928 | 3300005331 | Bacteria | 2353 |
| 80 | Ga0070670_100158846 | 3300005331 | Bacteria | 1959 |
| 81 | Ga0070677_10000636 | 3300005333 | Bacteria | 11763 |
| 82 | Ga0070677_10060316 | 3300005333 | Bacteria | 1562 |
| 83 | Ga0068869_100000751 | 3300005334 | Bacteria | 18417 |
| 84 | Ga0068869_100004117 | 3300005334 | Bacteria | 9015 |
| 85 | Ga0068869_100037455 | 3300005334 | Bacteria | 3448 |
| 86 | Ga0068869_100091480 | 3300005334 | Bacteria | 2288 |
| 87 | Ga0070666_10001025 | 3300005335 | Bacteria | 17121 |
| 88 | Ga0070666_10001481 | 3300005335 | Bacteria | 14260 |
| 89 | Ga0070666_10017038 | 3300005335 | Bacteria | 4654 |
| 90 | Ga0070666_10095964 | 3300005335 | Bacteria | 2041 |
| 91 | Ga0070666_10271727 | 3300005335 | Bacteria | 1203 |
| 92 | Ga0070680_100076067 | 3300005336 | Bacteria | 2764 |
| 93 | Ga0070680_100085318 | 3300005336 | Bacteria | 2609 |
| 94 | Ga0070680_100189634 | 3300005336 | Bacteria | 1732 |
| 95 | Ga0070682_100151070 | 3300005337 | Bacteria | 1594 |
| 96 | Ga0068868_100007511 | 3300005338 | Bacteria | 7766 |
| 97 | Ga0068868_100008375 | 3300005338 | Bacteria | 7402 |
| 98 | Ga0068868_100062121 | 3300005338 | Bacteria | 2960 |
| 99 | Ga0068868_100108488 | 3300005338 | Bacteria | 2253 |
| 100 | Ga0068868_100176122 | 3300005338 | Bacteria | 1773 |
| 101 | Ga0068868_100239544 | 3300005338 | Bacteria | 1524 |
| 102 | Ga0070660_100028688 | 3300005339 | Bacteria | 4165 |
| 103 | Ga0070660_100039542 | 3300005339 | Bacteria | 3586 |
| 104 | Ga0070660_100051494 | 3300005339 | Bacteria | 3171 |
| 105 | Ga0070660_100243343 | 3300005339 | Bacteria | 1466 |
| 106 | Ga0070660_100321432 | 3300005339 | Bacteria | 1271 |
| 107 | Ga0070660_100703085 | 3300005339 | Bacteria | 847 |
| 108 | Ga0070689_100040979 | 3300005340 | Bacteria | 3553 |
| 109 | Ga0070689_100079947 | 3300005340 | Bacteria | 2565 |
| 110 | Ga0070689_100110933 | 3300005340 | Bacteria | 2181 |
| 111 | Ga0070689_100286962 | 3300005340 | Bacteria | 1367 |
| 112 | Ga0070687_100050151 | 3300005343 | Bacteria | 2154 |
| 113 | Ga0070687_100255918 | 3300005343 | Bacteria | 1090 |
| 114 | Ga0070661_100007597 | 3300005344 | Bacteria | 7477 |
| 115 | Ga0070661_100010061 | 3300005344 | Bacteria | 6566 |
| 116 | Ga0070661_100021144 | 3300005344 | Bacteria | 4645 |
| 117 | Ga0070661_100029562 | 3300005344 | Bacteria | 3956 |
| 118 | Ga0070661_100041032 | 3300005344 | Bacteria | 3377 |
| 119 | Ga0070661_100070345 | 3300005344 | Bacteria | 2573 |
| 120 | Ga0070661_100097608 | 3300005344 | Bacteria | 2182 |
| 121 | Ga0070661_100237008 | 3300005344 | Bacteria | 1404 |
| 122 | Ga0070661_100374968 | 3300005344 | Bacteria | 1121 |
| 123 | Ga0070692_10005718 | 3300005345 | Bacteria | 5339 |
| 124 | Ga0070692_10038658 | 3300005345 | Bacteria | 2433 |
| 125 | Ga0070668_100001025 | 3300005347 | Bacteria | 19580 |
| 126 | Ga0070668_100002685 | 3300005347 | Bacteria | 13082 |
| 127 | Ga0070668_100003032 | 3300005347 | Bacteria | 12427 |
| 128 | Ga0070668_100003427 | 3300005347 | Bacteria | 11711 |
| 129 | Ga0070668_100005260 | 3300005347 | Bacteria | 9601 |
| 130 | Ga0070668_100019396 | 3300005347 | Bacteria | 5119 |
| 131 | Ga0070668_100082717 | 3300005347 | Bacteria | 2518 |
| 132 | Ga0070668_100123554 | 3300005347 | Bacteria | 2072 |
| 133 | Ga0070668_100146879 | 3300005347 | Bacteria | 1904 |
| 134 | Ga0070668_100264040 | 3300005347 | Bacteria | 1433 |
| 135 | Ga0070668_100324228 | 3300005347 | Bacteria | 1297 |
| 136 | Ga0070669_100001889 | 3300005353 | Bacteria | 15109 |
| 137 | Ga0070669_100015790 | 3300005353 | Bacteria | 5385 |
| 138 | Ga0070669_100065004 | 3300005353 | Bacteria | 2687 |
| 139 | Ga0070669_100105418 | 3300005353 | Bacteria | 2132 |
| 140 | Ga0070675_100004878 | 3300005354 | Bacteria | 10238 |
| 141 | Ga0070675_100006068 | 3300005354 | Bacteria | 9256 |
| 142 | Ga0070675_100012545 | 3300005354 | Bacteria | 6644 |
| 143 | Ga0070675_100015597 | 3300005354 | Bacteria | 6011 |
| 144 | Ga0070675_100049855 | 3300005354 | Bacteria | 3437 |
| 145 | Ga0070675_100542111 | 3300005354 | Bacteria | 1051 |
| 146 | Ga0070671_100007740 | 3300005355 | Bacteria | 8583 |
| 147 | Ga0070671_100008568 | 3300005355 | Bacteria | 8198 |
| 148 | Ga0070671_100008695 | 3300005355 | Bacteria | 8147 |
| 149 | Ga0070671_100021169 | 3300005355 | Bacteria | 5310 |
| 150 | Ga0070671_100048504 | 3300005355 | Bacteria | 3531 |
| 151 | Ga0070671_100106418 | 3300005355 | Bacteria | 2355 |
| 152 | Ga0070671_100118613 | 3300005355 | Bacteria | 2226 |
| 153 | Ga0070671_100172511 | 3300005355 | Bacteria | 1829 |
| 154 | Ga0070674_100000692 | 3300005356 | Bacteria | 17091 |
| 155 | Ga0070674_100020957 | 3300005356 | Bacteria | 4188 |
| 156 | Ga0070674_100095654 | 3300005356 | Bacteria | 2153 |
| 157 | Ga0070674_100144238 | 3300005356 | Bacteria | 1791 |
| 158 | Ga0070674_100172176 | 3300005356 | Bacteria | 1652 |
| 159 | Ga0070674_100234743 | 3300005356 | Bacteria | 1433 |
| 160 | Ga0070674_100656702 | 3300005356 | Bacteria | 892 |
| 161 | Ga0070673_100000093 | 3300005364 | Bacteria | 39643 |
| 162 | Ga0070673_100006849 | 3300005364 | Bacteria | 7453 |
| 163 | Ga0070673_100035677 | 3300005364 | Bacteria | 3772 |
| 164 | Ga0070673_100037281 | 3300005364 | Bacteria | 3703 |
| 165 | Ga0070673_100104922 | 3300005364 | Bacteria | 2334 |
| 166 | Ga0070673_100117265 | 3300005364 | Bacteria | 2215 |
| 167 | Ga0070673_100385301 | 3300005364 | Bacteria | 1251 |
| 168 | Ga0070688_100000489 | 3300005365 | Bacteria | 20048 |
| 169 | Ga0070688_100015178 | 3300005365 | Bacteria | 4375 |
| 170 | Ga0070688_100048466 | 3300005365 | Bacteria | 2640 |
| 171 | Ga0070659_100025885 | 3300005366 | Bacteria | 4512 |
| 172 | Ga0070659_100045936 | 3300005366 | Bacteria | 3423 |
| 173 | Ga0070659_100097304 | 3300005366 | Bacteria | 2365 |
| 174 | Ga0070659_100097699 | 3300005366 | Bacteria | 2360 |
| 175 | Ga0070659_100107236 | 3300005366 | Bacteria | 2252 |
| 176 | Ga0070659_100227542 | 3300005366 | Bacteria | 1541 |
| 177 | Ga0070659_100243677 | 3300005366 | Bacteria | 1488 |
| 178 | Ga0070659_100246176 | 3300005366 | Bacteria | 1481 |
| 179 | Ga0070667_100025931 | 3300005367 | Bacteria | 4875 |
| 180 | Ga0070667_100038812 | 3300005367 | Bacteria | 3992 |
| 181 | Ga0070667_100042408 | 3300005367 | Bacteria | 3818 |
| 182 | Ga0070667_100107435 | 3300005367 | Bacteria | 2416 |
| 183 | Ga0070667_100113340 | 3300005367 | Bacteria | 2353 |
| 184 | Ga0070667_100128822 | 3300005367 | Bacteria | 2207 |
| 185 | Ga0070667_100243386 | 3300005367 | Bacteria | 1607 |
| 186 | Ga0070667_100354586 | 3300005367 | Bacteria | 1329 |
| 187 | Ga0070709_10001884 | 3300005434 | Bacteria | 11372 |
| 188 | Ga0070709_10430527 | 3300005434 | Bacteria | 990 |
| 189 | Ga0070709_10514817 | 3300005434 | Bacteria | 911 |
| 190 | Ga0070709_10654168 | 3300005434 | Bacteria | 814 |
| 191 | Ga0070714_100054946 | 3300005435 | Bacteria | 3403 |
| 192 | Ga0070714_100208731 | 3300005435 | Bacteria | 1789 |
| 193 | Ga0070714_100223740 | 3300005435 | Bacteria | 1731 |
| 194 | Ga0070714_100574091 | 3300005435 | Bacteria | 1081 |
| 195 | Ga0070713_100000090 | 3300005436 | Bacteria | 57703 |
| 196 | Ga0070713_100000232 | 3300005436 | Bacteria | 36963 |
| 197 | Ga0070713_100074644 | 3300005436 | Bacteria | 2873 |
| 198 | Ga0070713_100135900 | 3300005436 | Bacteria | 2172 |
| 199 | Ga0070710_10006281 | 3300005437 | Bacteria | 5695 |
| 200 | Ga0070710_10008791 | 3300005437 | Bacteria | 4925 |
| 201 | Ga0070701_10006039 | 3300005438 | Bacteria | 5062 |
| 202 | Ga0070701_10361097 | 3300005438 | Bacteria | 910 |
| 203 | Ga0070711_100001221 | 3300005439 | Bacteria | 13864 |
| 204 | Ga0070711_100046861 | 3300005439 | Bacteria | 2948 |
| 205 | Ga0070711_100078585 | 3300005439 | Bacteria | 2345 |
| 206 | Ga0070711_100153118 | 3300005439 | Bacteria | 1741 |
| 207 | Ga0070705_100209676 | 3300005440 | Bacteria | 1342 |
| 208 | Ga0070700_100000303 | 3300005441 | Bacteria | 25814 |
| 209 | Ga0070700_100064955 | 3300005441 | Bacteria | 2312 |
| 210 | Ga0070694_100047176 | 3300005444 | Bacteria | 2894 |
| 211 | Ga0070694_100153287 | 3300005444 | Bacteria | 1685 |
| 212 | Ga0070708_100018603 | 3300005445 | Bacteria | 5816 |
| 213 | Ga0070708_100314955 | 3300005445 | Bacteria | 1474 |
| 214 | Ga0070663_100004067 | 3300005455 | Bacteria | 8541 |
| 215 | Ga0070663_100004262 | 3300005455 | Bacteria | 8372 |
| 216 | Ga0070663_100030299 | 3300005455 | Bacteria | 3706 |
| 217 | Ga0070663_100113582 | 3300005455 | Bacteria | 2038 |
| 218 | Ga0070663_100627904 | 3300005455 | Bacteria | 906 |
| 219 | Ga0070678_100000443 | 3300005456 | Bacteria | 19607 |
| 220 | Ga0070678_100020775 | 3300005456 | Bacteria | 4314 |
| 221 | Ga0070678_100037888 | 3300005456 | Bacteria | 3390 |
| 222 | Ga0070678_100040788 | 3300005456 | Bacteria | 3286 |
| 223 | Ga0070678_100144929 | 3300005456 | Bacteria | 1905 |
| 224 | Ga0070678_100296457 | 3300005456 | Bacteria | 1373 |
| 225 | Ga0070662_100001239 | 3300005457 | Bacteria | 15663 |
| 226 | Ga0070662_100320583 | 3300005457 | Bacteria | 1264 |
| 227 | Ga0070681_10018539 | 3300005458 | Bacteria | 6957 |
| 228 | Ga0070681_10020974 | 3300005458 | Bacteria | 6545 |
| 229 | Ga0070681_10068268 | 3300005458 | Bacteria | 3522 |
| 230 | Ga0070681_10121863 | 3300005458 | Bacteria | 2542 |
| 231 | Ga0070681_10179611 | 3300005458 | Bacteria | 2038 |
| 232 | Ga0070681_10318999 | 3300005458 | Bacteria | 1463 |
| 233 | Ga0070681_10472338 | 3300005458 | Bacteria | 1167 |
| 234 | Ga0068867_100003718 | 3300005459 | Bacteria | 10737 |
| 235 | Ga0068867_100012127 | 3300005459 | Bacteria | 6087 |
| 236 | Ga0068867_100063788 | 3300005459 | Bacteria | 2739 |
| 237 | Ga0068867_100081929 | 3300005459 | Bacteria | 2433 |
| 238 | Ga0068867_100088186 | 3300005459 | Bacteria | 2351 |
| 239 | Ga0068867_100104340 | 3300005459 | Bacteria | 2169 |
| 240 | Ga0068867_100311605 | 3300005459 | Bacteria | 1301 |
| 241 | Ga0068867_100692307 | 3300005459 | Bacteria | 899 |
| 242 | Ga0070685_10017407 | 3300005466 | Bacteria | 3846 |
| 243 | Ga0070685_10044934 | 3300005466 | Bacteria | 2531 |
| 244 | Ga0070707_100012578 | 3300005468 | Bacteria | 7905 |
| 245 | Ga0070707_100036043 | 3300005468 | Bacteria | 4719 |
| 246 | Ga0070698_100006372 | 3300005471 | Bacteria | 12812 |
| 247 | Ga0070699_100014042 | 3300005518 | Bacteria | 6890 |
| 248 | Ga0070699_100015841 | 3300005518 | Bacteria | 6472 |
| 249 | Ga0070699_100031664 | 3300005518 | Bacteria | 4566 |
| 250 | Ga0070679_100014667 | 3300005530 | Bacteria | 7531 |
| 251 | Ga0070679_100016933 | 3300005530 | Bacteria | 7046 |
| 252 | Ga0070679_100034615 | 3300005530 | Bacteria | 5006 |
| 253 | Ga0070679_100054314 | 3300005530 | Bacteria | 3987 |
| 254 | Ga0070679_100069820 | 3300005530 | Bacteria | 3505 |
| 255 | Ga0070679_100083680 | 3300005530 | Bacteria | 3179 |
| 256 | Ga0070679_100094597 | 3300005530 | Bacteria | 2975 |
| 257 | Ga0070679_100291703 | 3300005530 | Bacteria | 1583 |
| 258 | Ga0070684_100040489 | 3300005535 | Bacteria | 4013 |
| 259 | Ga0070684_100128155 | 3300005535 | Bacteria | 2288 |
| 260 | Ga0070684_100238681 | 3300005535 | Bacteria | 1660 |
| 261 | Ga0070684_100266198 | 3300005535 | Bacteria | 1568 |
| 262 | Ga0068853_100006808 | 3300005539 | Bacteria | 9113 |
| 263 | Ga0068853_100012679 | 3300005539 | Bacteria | 6862 |
| 264 | Ga0068853_100023777 | 3300005539 | Bacteria | 5133 |
| 265 | Ga0068853_100065974 | 3300005539 | Bacteria | 3142 |
| 266 | Ga0068853_100068629 | 3300005539 | Bacteria | 3082 |
| 267 | Ga0068853_100114281 | 3300005539 | Bacteria | 2401 |
| 268 | Ga0068853_100169928 | 3300005539 | Bacteria | 1972 |
| 269 | Ga0068853_100192279 | 3300005539 | Bacteria | 1854 |
| 270 | Ga0070672_100008459 | 3300005543 | Bacteria | 7040 |
| 271 | Ga0070672_100012894 | 3300005543 | Bacteria | 5889 |
| 272 | Ga0070672_100023150 | 3300005543 | Bacteria | 4574 |
| 273 | Ga0070672_100044451 | 3300005543 | Bacteria | 3431 |
| 274 | Ga0070672_100048369 | 3300005543 | Bacteria | 3305 |
| 275 | Ga0070672_100118482 | 3300005543 | Bacteria | 2165 |
| 276 | Ga0070672_100139581 | 3300005543 | Bacteria | 1998 |
| 277 | Ga0070672_100199153 | 3300005543 | Bacteria | 1674 |
| 278 | Ga0070672_100483261 | 3300005543 | Bacteria | 1070 |
| 279 | Ga0070672_100500838 | 3300005543 | Bacteria | 1051 |
| 280 | Ga0070686_100000467 | 3300005544 | Bacteria | 24436 |
| 281 | Ga0070686_100020587 | 3300005544 | Bacteria | 3905 |
| 282 | Ga0070686_100041405 | 3300005544 | Bacteria | 2879 |
| 283 | Ga0070695_100010817 | 3300005545 | Bacteria | 5452 |
| 284 | Ga0070695_100114746 | 3300005545 | Bacteria | 1834 |
| 285 | Ga0070695_100168682 | 3300005545 | Bacteria | 1543 |
| 286 | Ga0070696_100005244 | 3300005546 | Bacteria | 8660 |
| 287 | Ga0070696_100031225 | 3300005546 | Bacteria | 3650 |
| 288 | Ga0070696_100052416 | 3300005546 | Bacteria | 2838 |
| 289 | Ga0070696_100177991 | 3300005546 | Bacteria | 1576 |
| 290 | Ga0070693_100003921 | 3300005547 | Bacteria | 6978 |
| 291 | Ga0070693_100056503 | 3300005547 | Bacteria | 2265 |
| 292 | Ga0070693_100110896 | 3300005547 | Bacteria | 1687 |
| 293 | Ga0070693_100178663 | 3300005547 | Bacteria | 1365 |
| 294 | Ga0070693_100248092 | 3300005547 | Bacteria | 1179 |
| 295 | Ga0070665_100004030 | 3300005548 | Bacteria | 15466 |
| 296 | Ga0070665_100008150 | 3300005548 | Bacteria | 10607 |
| 297 | Ga0070665_100019341 | 3300005548 | Bacteria | 6834 |
| 298 | Ga0070665_100020459 | 3300005548 | Bacteria | 6646 |
| 299 | Ga0070665_100094903 | 3300005548 | Bacteria | 2987 |
| 300 | Ga0070665_100207987 | 3300005548 | Bacteria | 1957 |
| 301 | Ga0070665_100231823 | 3300005548 | Bacteria | 1846 |
| 302 | Ga0070704_100027154 | 3300005549 | Bacteria | 3793 |
| 303 | Ga0070704_100036676 | 3300005549 | Bacteria | 3343 |
| 304 | Ga0070704_100108747 | 3300005549 | Bacteria | 2105 |
| 305 | Ga0070704_100148002 | 3300005549 | Bacteria | 1842 |
| 306 | Ga0070704_100748199 | 3300005549 | Bacteria | 870 |
| 307 | Ga0068855_100002732 | 3300005563 | Bacteria | 21749 |
| 308 | Ga0068855_100006426 | 3300005563 | Bacteria | 14310 |
| 309 | Ga0068855_100011358 | 3300005563 | Bacteria | 10752 |
| 310 | Ga0068855_100037906 | 3300005563 | Bacteria | 5729 |
| 311 | Ga0068855_100041199 | 3300005563 | Bacteria | 5475 |
| 312 | Ga0068855_100073548 | 3300005563 | Bacteria | 3970 |
| 313 | Ga0068855_100110829 | 3300005563 | Bacteria | 3150 |
| 314 | Ga0068855_100225491 | 3300005563 | Bacteria | 2100 |
| 315 | Ga0068855_100258827 | 3300005563 | Bacteria | 1939 |
| 316 | Ga0068855_100386964 | 3300005563 | Bacteria | 1535 |
| 317 | Ga0068855_100488557 | 3300005563 | Bacteria | 1339 |
| 318 | Ga0068855_100642241 | 3300005563 | Bacteria | 1141 |
| 319 | Ga0070664_100000511 | 3300005564 | Bacteria | 29475 |
| 320 | Ga0070664_100004503 | 3300005564 | Bacteria | 11178 |
| 321 | Ga0070664_100005335 | 3300005564 | Bacteria | 10315 |
| 322 | Ga0070664_100060960 | 3300005564 | Bacteria | 3214 |
| 323 | Ga0070664_100246528 | 3300005564 | Bacteria | 1605 |
| 324 | Ga0070664_100448929 | 3300005564 | Bacteria | 1184 |
| 325 | Ga0068857_100034228 | 3300005577 | Bacteria | 4493 |
| 326 | Ga0068857_100087269 | 3300005577 | Bacteria | 2790 |
| 327 | Ga0068857_100096956 | 3300005577 | Bacteria | 2643 |
| 328 | Ga0068857_100112499 | 3300005577 | Bacteria | 2447 |
| 329 | Ga0068857_100134701 | 3300005577 | Bacteria | 2230 |
| 330 | Ga0068857_100287017 | 3300005577 | Bacteria | 1515 |
| 331 | Ga0068854_100017225 | 3300005578 | Bacteria | 4831 |
| 332 | Ga0068854_100141708 | 3300005578 | Bacteria | 1845 |
| 333 | Ga0068854_100250260 | 3300005578 | Bacteria | 1415 |
| 334 | Ga0068854_100416182 | 3300005578 | Bacteria | 1115 |
| 335 | Ga0068856_100007158 | 3300005614 | Bacteria | 10878 |
| 336 | Ga0068856_100011352 | 3300005614 | Bacteria | 8641 |
| 337 | Ga0068856_100017996 | 3300005614 | Bacteria | 6851 |
| 338 | Ga0068856_100026025 | 3300005614 | Bacteria | 5706 |
| 339 | Ga0068856_100059727 | 3300005614 | Bacteria | 3766 |
| 340 | Ga0068856_100065608 | 3300005614 | Bacteria | 3588 |
| 341 | Ga0068856_100129068 | 3300005614 | Bacteria | 2532 |
| 342 | Ga0068856_100151921 | 3300005614 | Bacteria | 2325 |
| 343 | Ga0070702_100003215 | 3300005615 | Bacteria | 7263 |
| 344 | Ga0070702_100039684 | 3300005615 | Bacteria | 2628 |
| 345 | Ga0070702_100511699 | 3300005615 | Bacteria | 884 |
| 346 | Ga0068852_100006625 | 3300005616 | Bacteria | 8392 |
| 347 | Ga0068852_100010689 | 3300005616 | Bacteria | 6872 |
| 348 | Ga0068852_100043293 | 3300005616 | Bacteria | 3818 |
| 349 | Ga0068852_100281497 | 3300005616 | Bacteria | 1603 |
| 350 | Ga0068852_100294195 | 3300005616 | Bacteria | 1570 |
| 351 | Ga0068852_100359607 | 3300005616 | Bacteria | 1424 |
| 352 | Ga0068852_100371297 | 3300005616 | Bacteria | 1401 |
| 353 | Ga0068852_100372797 | 3300005616 | Bacteria | 1399 |
| 354 | Ga0068852_100639553 | 3300005616 | Bacteria | 1070 |
| 355 | Ga0068859_100006866 | 3300005617 | Bacteria | 11558 |
| 356 | Ga0068859_100007090 | 3300005617 | Bacteria | 11377 |
| 357 | Ga0068859_100020538 | 3300005617 | Bacteria | 6628 |
| 358 | Ga0068859_100022814 | 3300005617 | Bacteria | 6275 |
| 359 | Ga0068859_100108822 | 3300005617 | Bacteria | 2833 |
| 360 | Ga0068859_100143840 | 3300005617 | Bacteria | 2459 |
| 361 | Ga0068859_100151458 | 3300005617 | Bacteria | 2395 |
| 362 | Ga0068859_100168489 | 3300005617 | Bacteria | 2271 |
| 363 | Ga0068859_100296861 | 3300005617 | Bacteria | 1709 |
| 364 | Ga0068859_100777206 | 3300005617 | Bacteria | 1046 |
| 365 | Ga0068864_100001045 | 3300005618 | Bacteria | 23232 |
| 366 | Ga0068864_100003588 | 3300005618 | Bacteria | 12833 |
| 367 | Ga0068864_100006726 | 3300005618 | Bacteria | 9419 |
| 368 | Ga0068864_100010086 | 3300005618 | Bacteria | 7801 |
| 369 | Ga0068864_100043765 | 3300005618 | Bacteria | 3835 |
| 370 | Ga0068864_100507111 | 3300005618 | Bacteria | 1161 |
| 371 | Ga0068864_100562841 | 3300005618 | Bacteria | 1103 |
| 372 | Ga0068864_100668327 | 3300005618 | Bacteria | 1013 |
| 373 | Ga0068866_10000316 | 3300005718 | Bacteria | 23003 |
| 374 | Ga0068866_10006289 | 3300005718 | Bacteria | 4943 |
| 375 | Ga0068866_10026634 | 3300005718 | Bacteria | 2733 |
| 376 | Ga0068866_10075337 | 3300005718 | Bacteria | 1796 |
| 377 | Ga0068866_10168736 | 3300005718 | Bacteria | 1283 |
| 378 | Ga0068861_100000641 | 3300005719 | Bacteria | 20777 |
| 379 | Ga0068861_100009372 | 3300005719 | Bacteria | 6758 |
| 380 | Ga0068861_100020224 | 3300005719 | Bacteria | 4763 |
| 381 | Ga0068861_100100178 | 3300005719 | Bacteria | 2302 |
| 382 | Ga0068861_100276739 | 3300005719 | Bacteria | 1444 |
| 383 | Ga0068851_10001933 | 3300005834 | Bacteria | 9104 |
| 384 | Ga0068851_10002235 | 3300005834 | Bacteria | 8516 |
| 385 | Ga0068851_10003453 | 3300005834 | Bacteria | 7032 |
| 386 | Ga0068851_10009319 | 3300005834 | Bacteria | 4559 |
| 387 | Ga0068851_10037904 | 3300005834 | Bacteria | 2418 |
| 388 | Ga0068870_10000992 | 3300005840 | Bacteria | 11202 |
| 389 | Ga0068870_10008695 | 3300005840 | Bacteria | 4578 |
| 390 | Ga0068870_10009180 | 3300005840 | Bacteria | 4483 |
| 391 | Ga0068870_10064048 | 3300005840 | Bacteria | 1984 |
| 392 | Ga0068870_10116494 | 3300005840 | Bacteria | 1533 |
| 393 | Ga0068863_100001612 | 3300005841 | Bacteria | 22307 |
| 394 | Ga0068863_100008594 | 3300005841 | Bacteria | 9982 |
| 395 | Ga0068863_100009929 | 3300005841 | Bacteria | 9268 |
| 396 | Ga0068863_100011872 | 3300005841 | Bacteria | 8419 |
| 397 | Ga0068863_100020431 | 3300005841 | Bacteria | 6328 |
| 398 | Ga0068863_100048728 | 3300005841 | Bacteria | 4017 |
| 399 | Ga0068863_100152542 | 3300005841 | Bacteria | 2211 |
| 400 | Ga0068863_100541631 | 3300005841 | Bacteria | 1149 |
| 401 | Ga0068863_100712763 | 3300005841 | Bacteria | 998 |
| 402 | Ga0068858_100001394 | 3300005842 | Bacteria | 24881 |
| 403 | Ga0068858_100003984 | 3300005842 | Bacteria | 14574 |
| 404 | Ga0068858_100012410 | 3300005842 | Bacteria | 8033 |
| 405 | Ga0068858_100027086 | 3300005842 | Bacteria | 5324 |
| 406 | Ga0068858_100071779 | 3300005842 | Bacteria | 3211 |
| 407 | Ga0068858_100095063 | 3300005842 | Bacteria | 2776 |
| 408 | Ga0068858_100513268 | 3300005842 | Bacteria | 1159 |
| 409 | Ga0068860_100007907 | 3300005843 | Bacteria | 10616 |
| 410 | Ga0068860_100026090 | 3300005843 | Bacteria | 5636 |
| 411 | Ga0068860_100173252 | 3300005843 | Bacteria | 2085 |
| 412 | Ga0068860_100221184 | 3300005843 | Bacteria | 1839 |
| 413 | Ga0068860_100444357 | 3300005843 | Bacteria | 1289 |
| 414 | Ga0068860_100656937 | 3300005843 | Bacteria | 1056 |
| 415 | Ga0068860_100970631 | 3300005843 | Bacteria | 867 |
| 416 | Ga0068862_100012477 | 3300005844 | Bacteria | 7033 |
| 417 | Ga0068862_100037785 | 3300005844 | Bacteria | 4093 |
| 418 | Ga0068862_100054258 | 3300005844 | Bacteria | 3431 |
| 419 | Ga0068862_100068067 | 3300005844 | Bacteria | 3071 |
| 420 | Ga0068862_100132704 | 3300005844 | Bacteria | 2204 |
| 421 | Ga0068862_100402356 | 3300005844 | Bacteria | 1281 |
| 422 | Ga0068862_100451163 | 3300005844 | Bacteria | 1212 |
| 423 | Ga0068862_100539113 | 3300005844 | Bacteria | 1113 |
| 424 | Ga0081539_10014013 | 3300005985 | Bacteria | 5973 |
| 425 | Ga0081539_10075730 | 3300005985 | Bacteria | 1786 |
| 426 | Ga0075365_10014803 | 3300006038 | Bacteria | 4701 |
| 427 | Ga0075364_10033552 | 3300006051 | Bacteria | 3306 |
| 428 | Ga0075364_10082235 | 3300006051 | Bacteria | 2131 |
| 429 | Ga0070715_10019852 | 3300006163 | Bacteria | 2583 |
| 430 | Ga0070716_100009938 | 3300006173 | Bacteria | 4758 |
| 431 | Ga0070712_100014827 | 3300006175 | Bacteria | 5008 |
| 432 | Ga0070712_100217889 | 3300006175 | Bacteria | 1509 |
| 433 | Ga0075362_10005914 | 3300006177 | Bacteria | 4520 |
| 434 | Ga0075367_10015782 | 3300006178 | Bacteria | 4114 |
| 435 | Ga0075366_10058047 | 3300006195 | Bacteria | 2299 |
| 436 | Ga0075366_10070800 | 3300006195 | Bacteria | 2077 |
| 437 | Ga0075366_10083060 | 3300006195 | Bacteria | 1914 |
| 438 | Ga0075366_10098296 | 3300006195 | Bacteria | 1756 |
| 439 | Ga0097621_100000222 | 3300006237 | Bacteria | 37946 |
| 440 | Ga0097621_100070761 | 3300006237 | Bacteria | 2881 |
| 441 | Ga0097621_100087886 | 3300006237 | Bacteria | 2596 |
| 442 | Ga0097621_100104130 | 3300006237 | Bacteria | 2391 |
| 443 | Ga0097621_100161963 | 3300006237 | Bacteria | 1923 |
| 444 | Ga0097621_100166019 | 3300006237 | Bacteria | 1901 |
| 445 | Ga0097621_100316941 | 3300006237 | Bacteria | 1380 |
| 446 | Ga0097621_100516248 | 3300006237 | Bacteria | 1084 |
| 447 | Ga0097621_100589834 | 3300006237 | Bacteria | 1015 |
| 448 | Ga0075370_10072397 | 3300006353 | Bacteria | 1973 |
| 449 | Ga0075370_10079849 | 3300006353 | Bacteria | 1879 |
| 450 | Ga0068871_100001148 | 3300006358 | Bacteria | 17759 |
| 451 | Ga0068871_100001249 | 3300006358 | Bacteria | 16987 |
| 452 | Ga0068871_100026132 | 3300006358 | Bacteria | 4552 |
| 453 | Ga0068871_100039054 | 3300006358 | Bacteria | 3796 |
| 454 | Ga0068871_100040602 | 3300006358 | Bacteria | 3727 |
| 455 | Ga0068871_100055400 | 3300006358 | Bacteria | 3219 |
| 456 | Ga0068871_100092820 | 3300006358 | Bacteria | 2518 |
| 457 | Ga0068871_100199020 | 3300006358 | Bacteria | 1729 |
| 458 | Ga0068871_100210433 | 3300006358 | Bacteria | 1682 |
| 459 | Ga0068871_100251524 | 3300006358 | Bacteria | 1539 |
| 460 | Ga0068871_100256318 | 3300006358 | Bacteria | 1525 |
| 461 | Ga0068871_100271002 | 3300006358 | Bacteria | 1483 |
| 462 | Ga0075428_100015381 | 3300006844 | Bacteria | 8485 |
| 463 | Ga0075428_100155710 | 3300006844 | Bacteria | 2483 |
| 464 | Ga0075428_100205522 | 3300006844 | Bacteria | 2128 |
| 465 | Ga0075428_100784239 | 3300006844 | Bacteria | 1013 |
| 466 | Ga0075430_100161418 | 3300006846 | Bacteria | 1865 |
| 467 | Ga0075430_100240986 | 3300006846 | Bacteria | 1498 |
| 468 | Ga0075431_100001453 | 3300006847 | Bacteria | 21848 |
| 469 | Ga0075433_10003142 | 3300006852 | Bacteria | 12717 |
| 470 | Ga0075434_100017017 | 3300006871 | Bacteria | 6997 |
| 471 | Ga0075434_100109799 | 3300006871 | Bacteria | 2769 |
| 472 | Ga0075434_100244584 | 3300006871 | Bacteria | 1814 |
| 473 | Ga0075434_100441960 | 3300006871 | Bacteria | 1322 |
| 474 | Ga0075429_100010169 | 3300006880 | Bacteria | 8145 |
| 475 | Ga0075429_100064786 | 3300006880 | Bacteria | 3182 |
| 476 | Ga0075429_100258042 | 3300006880 | Bacteria | 1526 |
| 477 | Ga0068865_100003115 | 3300006881 | Bacteria | 9921 |
| 478 | Ga0068865_100007315 | 3300006881 | Bacteria | 6784 |
| 479 | Ga0068865_100164022 | 3300006881 | Bacteria | 1697 |
| 480 | Ga0068865_100180113 | 3300006881 | Bacteria | 1627 |
| 481 | Ga0075436_100017723 | 3300006914 | Bacteria | 4874 |
| 482 | Ga0097620_100006866 | 3300006931 | Bacteria | 11558 |
| 483 | Ga0097620_100007090 | 3300006931 | Bacteria | 11377 |
| 484 | Ga0097620_100020536 | 3300006931 | Bacteria | 6628 |
| 485 | Ga0097620_100022816 | 3300006931 | Bacteria | 6275 |
| 486 | Ga0097620_100108827 | 3300006931 | Bacteria | 2833 |
| 487 | Ga0097620_100143836 | 3300006931 | Bacteria | 2459 |
| 488 | Ga0097620_100151465 | 3300006931 | Bacteria | 2395 |
| 489 | Ga0097620_100168485 | 3300006931 | Bacteria | 2271 |
| 490 | Ga0097620_100296871 | 3300006931 | Bacteria | 1709 |
| 491 | Ga0097620_100777229 | 3300006931 | Bacteria | 1046 |
| 492 | Ga0079104_1011832 | 3300006946 | Bacteria | 2780 |
| 493 | Ga0075435_100098787 | 3300007076 | Bacteria | 2417 |
| 494 | Ga0075435_100432494 | 3300007076 | Bacteria | 1134 |
| 495 | Ga0099794_10029281 | 3300007265 | Bacteria | 2565 |
| 496 | Ga0105251_10002743 | 3300009011 | Bacteria | 13485 |
| 497 | Ga0105251_10052734 | 3300009011 | Bacteria | 1935 |
| 498 | Ga0105244_10037827 | 3300009036 | Bacteria | 2520 |
| 499 | Ga0105250_10041045 | 3300009092 | Bacteria | 1855 |
| 500 | Ga0105240_10005332 | 3300009093 | Bacteria | 19184 |
| 501 | Ga0105240_10007963 | 3300009093 | Bacteria | 15281 |
| 502 | Ga0105240_10010948 | 3300009093 | Bacteria | 12707 |
| 503 | Ga0105240_10051986 | 3300009093 | Bacteria | 5152 |
| 504 | Ga0105240_10052944 | 3300009093 | Bacteria | 5099 |
| 505 | Ga0105240_10055478 | 3300009093 | Bacteria | 4961 |
| 506 | Ga0105240_10087772 | 3300009093 | Bacteria | 3808 |
| 507 | Ga0105240_10103262 | 3300009093 | Bacteria | 3464 |
| 508 | Ga0105240_10153782 | 3300009093 | Bacteria | 2738 |
| 509 | Ga0111539_10035571 | 3300009094 | Bacteria | 6029 |
| 510 | Ga0111539_10109472 | 3300009094 | Bacteria | 3242 |
| 511 | Ga0111539_10149924 | 3300009094 | Bacteria | 2730 |
| 512 | Ga0105245_10007734 | 3300009098 | Bacteria | 9411 |
| 513 | Ga0105245_10018004 | 3300009098 | Bacteria | 6170 |
| 514 | Ga0105245_10108032 | 3300009098 | Bacteria | 2584 |
| 515 | Ga0105245_10311179 | 3300009098 | Bacteria | 1549 |
| 516 | Ga0105245_10539931 | 3300009098 | Bacteria | 1187 |
| 517 | Ga0105245_10849444 | 3300009098 | Bacteria | 953 |
| 518 | Ga0105247_10054934 | 3300009101 | Bacteria | 2457 |
| 519 | Ga0105247_10094990 | 3300009101 | Bacteria | 1898 |
| 520 | Ga0114129_10063609 | 3300009147 | Bacteria | 5151 |
| 521 | Ga0114129_10179602 | 3300009147 | Bacteria | 2881 |
| 522 | Ga0114129_10535004 | 3300009147 | Bacteria | 1526 |
| 523 | Ga0105243_10001049 | 3300009148 | Bacteria | 25308 |
| 524 | Ga0105243_10113509 | 3300009148 | Bacteria | 2272 |
| 525 | Ga0105243_10117717 | 3300009148 | Bacteria | 2234 |
| 526 | Ga0105243_10194756 | 3300009148 | Bacteria | 1773 |
| 527 | Ga0105243_10444280 | 3300009148 | Bacteria | 1215 |
| 528 | Ga0105241_10004999 | 3300009174 | Bacteria | 9786 |
| 529 | Ga0105241_10011388 | 3300009174 | Bacteria | 6520 |
| 530 | Ga0105241_10133171 | 3300009174 | Bacteria | 2015 |
| 531 | Ga0105241_10169090 | 3300009174 | Bacteria | 1804 |
| 532 | Ga0105241_10191296 | 3300009174 | Bacteria | 1704 |
| 533 | Ga0105241_10211915 | 3300009174 | Bacteria | 1624 |
| 534 | Ga0105242_10008617 | 3300009176 | Bacteria | 7832 |
| 535 | Ga0105242_10033636 | 3300009176 | Bacteria | 4107 |
| 536 | Ga0105242_10049504 | 3300009176 | Bacteria | 3420 |
| 537 | Ga0105242_10068530 | 3300009176 | Bacteria | 2936 |
| 538 | Ga0105242_10135717 | 3300009176 | Bacteria | 2129 |
| 539 | Ga0105248_10001582 | 3300009177 | Bacteria | 25337 |
| 540 | Ga0105248_10017598 | 3300009177 | Bacteria | 7882 |
| 541 | Ga0105248_10051646 | 3300009177 | Bacteria | 4613 |
| 542 | Ga0105248_10092385 | 3300009177 | Bacteria | 3408 |
| 543 | Ga0105248_10206169 | 3300009177 | Bacteria | 2215 |
| 544 | Ga0105248_10210479 | 3300009177 | Bacteria | 2191 |
| 545 | Ga0105248_10407780 | 3300009177 | Bacteria | 1530 |
| 546 | Ga0105248_10411363 | 3300009177 | Bacteria | 1523 |
| 547 | Ga0105248_10656181 | 3300009177 | Bacteria | 1184 |
| 548 | Ga0105237_10251541 | 3300009545 | Bacteria | 1769 |
| 549 | Ga0105237_10296207 | 3300009545 | Bacteria | 1621 |
| 550 | Ga0105237_10754237 | 3300009545 | Bacteria | 980 |
| 551 | Ga0105237_10901748 | 3300009545 | Bacteria | 891 |
| 552 | Ga0105238_10018816 | 3300009551 | Bacteria | 7030 |
| 553 | Ga0105238_10020373 | 3300009551 | Bacteria | 6751 |
| 554 | Ga0105238_10022414 | 3300009551 | Bacteria | 6437 |
| 555 | Ga0105238_10024425 | 3300009551 | Bacteria | 6161 |
| 556 | Ga0105238_10188701 | 3300009551 | Bacteria | 2038 |
| 557 | Ga0105238_10275015 | 3300009551 | Bacteria | 1665 |
| 558 | Ga0105238_10294372 | 3300009551 | Bacteria | 1606 |
| 559 | Ga0105238_10592306 | 3300009551 | Bacteria | 1116 |
| 560 | Ga0105249_10032924 | 3300009553 | Bacteria | 4691 |
| 561 | Ga0105249_10044049 | 3300009553 | Bacteria | 4059 |
| 562 | Ga0105249_10152779 | 3300009553 | Bacteria | 2224 |
| 563 | Ga0105249_10487632 | 3300009553 | Bacteria | 1276 |
| 564 | Ga0105249_10807548 | 3300009553 | Bacteria | 1002 |
| 565 | Ga0105249_11066178 | 3300009553 | Bacteria | 878 |
| 566 | Ga0105239_10062662 | 3300010375 | Bacteria | 4081 |
| 567 | Ga0105239_10071336 | 3300010375 | Bacteria | 3816 |
| 568 | Ga0105239_10226037 | 3300010375 | Bacteria | 2100 |
| 569 | Ga0105239_10229772 | 3300010375 | Bacteria | 2081 |
| 570 | Ga0105239_10295711 | 3300010375 | Bacteria | 1823 |
| 571 | Ga0105239_10381096 | 3300010375 | Bacteria | 1594 |
| 572 | Ga0105239_10385023 | 3300010375 | Bacteria | 1586 |
| 573 | Ga0105239_10741509 | 3300010375 | Bacteria | 1124 |
| 574 | Ga0105246_10170701 | 3300011119 | Bacteria | 1666 |
| 575 | Ga0105246_10184760 | 3300011119 | Bacteria | 1608 |
| 576 | Ga0157315_1004490 | 3300012508 | Bacteria | 1000 |
| 577 | Ga0157327_1001229 | 3300012512 | Bacteria | 1565 |
| 578 | Ga0157373_10002207 | 3300013100 | Bacteria | 14740 |
| 579 | Ga0157373_10003362 | 3300013100 | Bacteria | 12094 |
| 580 | Ga0157373_10078122 | 3300013100 | Bacteria | 2334 |
| 581 | Ga0157371_10006571 | 3300013102 | Bacteria | 9558 |
| 582 | Ga0157371_10072528 | 3300013102 | Bacteria | 2438 |
| 583 | Ga0157371_10080385 | 3300013102 | Bacteria | 2308 |
| 584 | Ga0157370_10006295 | 3300013104 | Bacteria | 13127 |
| 585 | Ga0157370_10021285 | 3300013104 | Bacteria | 6464 |
| 586 | Ga0157370_10055287 | 3300013104 | Bacteria | 3782 |
| 587 | Ga0157370_10069027 | 3300013104 | Bacteria | 3339 |
| 588 | Ga0157370_10092677 | 3300013104 | Bacteria | 2835 |
| 589 | Ga0157370_10136259 | 3300013104 | Bacteria | 2288 |
| 590 | Ga0157370_10324205 | 3300013104 | Bacteria | 1420 |
| 591 | Ga0157370_10352702 | 3300013104 | Bacteria | 1356 |
| 592 | Ga0157369_10024453 | 3300013105 | Bacteria | 6719 |
| 593 | Ga0157369_10082302 | 3300013105 | Bacteria | 3444 |
| 594 | Ga0157369_10082556 | 3300013105 | Bacteria | 3438 |
| 595 | Ga0157369_10085636 | 3300013105 | Bacteria | 3367 |
| 596 | Ga0157369_10108729 | 3300013105 | Bacteria | 2949 |
| 597 | Ga0157369_10447990 | 3300013105 | Bacteria | 1337 |
| 598 | Ga0157369_10478192 | 3300013105 | Bacteria | 1289 |
| 599 | Ga0157369_10565825 | 3300013105 | Bacteria | 1174 |
| 600 | Ga0157374_10000101 | 3300013296 | Bacteria | 79331 |
| 601 | Ga0157374_10002126 | 3300013296 | Bacteria | 16676 |
| 602 | Ga0157374_10043144 | 3300013296 | Bacteria | 4164 |
| 603 | Ga0157374_10055941 | 3300013296 | Bacteria | 3683 |
| 604 | Ga0157374_10131964 | 3300013296 | Bacteria | 2418 |
| 605 | Ga0157374_10248666 | 3300013296 | Bacteria | 1749 |
| 606 | Ga0157374_10383346 | 3300013296 | Bacteria | 1400 |
| 607 | Ga0157374_10549002 | 3300013296 | Bacteria | 1163 |
| 608 | Ga0157378_10007717 | 3300013297 | Bacteria | 9388 |
| 609 | Ga0157378_10024000 | 3300013297 | Bacteria | 5365 |
| 610 | Ga0157378_10028450 | 3300013297 | Bacteria | 4932 |
| 611 | Ga0157378_10049210 | 3300013297 | Bacteria | 3750 |
| 612 | Ga0157378_10085967 | 3300013297 | Bacteria | 2850 |
| 613 | Ga0157378_10241503 | 3300013297 | Bacteria | 1725 |
| 614 | Ga0157378_10548527 | 3300013297 | Bacteria | 1161 |
| 615 | Ga0157378_10737532 | 3300013297 | Bacteria | 1007 |
| 616 | Ga0163162_10003900 | 3300013306 | Bacteria | 14320 |
| 617 | Ga0163162_10006452 | 3300013306 | Bacteria | 11363 |
| 618 | Ga0163162_10018193 | 3300013306 | Bacteria | 6882 |
| 619 | Ga0163162_10044644 | 3300013306 | Bacteria | 4439 |
| 620 | Ga0163162_10065842 | 3300013306 | Bacteria | 3672 |
| 621 | Ga0163162_10080823 | 3300013306 | Bacteria | 3319 |
| 622 | Ga0163162_10201339 | 3300013306 | Bacteria | 2120 |
| 623 | Ga0163162_10255263 | 3300013306 | Bacteria | 1885 |
| 624 | Ga0163162_10446604 | 3300013306 | Bacteria | 1425 |
| 625 | Ga0163162_10456554 | 3300013306 | Bacteria | 1409 |
| 626 | Ga0163162_10558562 | 3300013306 | Bacteria | 1272 |
| 627 | Ga0157372_10002893 | 3300013307 | Bacteria | 18564 |
| 628 | Ga0157372_10045423 | 3300013307 | Bacteria | 4873 |
| 629 | Ga0157372_10145144 | 3300013307 | Bacteria | 2737 |
| 630 | Ga0157372_10179119 | 3300013307 | Bacteria | 2453 |
| 631 | Ga0157372_10181975 | 3300013307 | Bacteria | 2433 |
| 632 | Ga0157372_10194953 | 3300013307 | Bacteria | 2347 |
| 633 | Ga0157372_10359702 | 3300013307 | Bacteria | 1696 |
| 634 | Ga0157372_10367836 | 3300013307 | Bacteria | 1675 |
| 635 | Ga0157372_10554664 | 3300013307 | Bacteria | 1339 |
| 636 | Ga0157375_10007225 | 3300013308 | Bacteria | 9713 |
| 637 | Ga0157375_10018533 | 3300013308 | Bacteria | 6315 |
| 638 | Ga0157375_10060413 | 3300013308 | Bacteria | 3759 |
| 639 | Ga0157375_10098277 | 3300013308 | Bacteria | 3004 |
| 640 | Ga0157375_10117652 | 3300013308 | Bacteria | 2763 |
| 641 | Ga0157375_10132095 | 3300013308 | Bacteria | 2617 |
| 642 | Ga0157375_10185804 | 3300013308 | Bacteria | 2232 |
| 643 | Ga0157375_10270160 | 3300013308 | Bacteria | 1862 |
| 644 | Ga0157375_10521293 | 3300013308 | Bacteria | 1352 |
| 645 | Ga0157375_10638439 | 3300013308 | Bacteria | 1222 |
| 646 | Ga0157375_10713847 | 3300013308 | Bacteria | 1156 |
| 647 | Ga0157375_10749460 | 3300013308 | Bacteria | 1128 |
| 648 | Ga0163163_10006567 | 3300014325 | Bacteria | 10189 |
| 649 | Ga0163163_10037640 | 3300014325 | Bacteria | 4708 |
| 650 | Ga0163163_10057777 | 3300014325 | Bacteria | 3837 |
| 651 | Ga0163163_10108091 | 3300014325 | Bacteria | 2808 |
| 652 | Ga0163163_10330598 | 3300014325 | Bacteria | 1578 |
| 653 | Ga0163163_10541784 | 3300014325 | Bacteria | 1226 |
| 654 | Ga0163163_10838443 | 3300014325 | Bacteria | 983 |
| 655 | Ga0157380_10000735 | 3300014326 | Bacteria | 20434 |
| 656 | Ga0157380_10240499 | 3300014326 | Bacteria | 1632 |
| 657 | Ga0157380_10833778 | 3300014326 | Bacteria | 942 |
| 658 | Ga0182008_10023345 | 3300014497 | Bacteria | 3160 |
| 659 | Ga0157377_10007059 | 3300014745 | Bacteria | 5396 |
| 660 | Ga0157377_10328090 | 3300014745 | Bacteria | 1019 |
| 661 | Ga0157379_10000336 | 3300014968 | Bacteria | 37683 |
| 662 | Ga0157379_10003104 | 3300014968 | Bacteria | 14052 |
| 663 | Ga0157379_10045727 | 3300014968 | Bacteria | 3907 |
| 664 | Ga0157379_10287156 | 3300014968 | Bacteria | 1498 |
| 665 | Ga0157376_10001583 | 3300014969 | Bacteria | 15040 |
| 666 | Ga0157376_10003640 | 3300014969 | Bacteria | 10638 |
| 667 | Ga0157376_10010988 | 3300014969 | Bacteria | 6652 |
| 668 | Ga0157376_10072403 | 3300014969 | Bacteria | 2932 |
| 669 | Ga0157376_10076850 | 3300014969 | Bacteria | 2854 |
| 670 | Ga0182006_1024307 | 3300015261 | Bacteria | 2500 |
| 671 | Ga0182007_10030018 | 3300015262 | Bacteria | 1859 |
| 672 | Ga0183361_10004 | 3300016635 | Bacteria | 484183 |
| 673 | Ga0163161_10025976 | 3300017792 | Bacteria | 4148 |
| 674 | Ga0163161_10044095 | 3300017792 | Bacteria | 3212 |
| 675 | Ga0163161_10222345 | 3300017792 | Bacteria | 1463 |
| 676 | Ga0163161_10250839 | 3300017792 | Bacteria | 1379 |
| 677 | Ga0163161_10634731 | 3300017792 | Bacteria | 884 |
| 678 | Ga0206353_10397806 | 3300020082 | Bacteria | 1176 |
| 679 | Ga0213872_10000081 | 3300021361 | Bacteria | 88397 |
| 680 | Ga0213872_10000104 | 3300021361 | Bacteria | 78306 |
| 681 | Ga0213872_10000132 | 3300021361 | Bacteria | 67609 |
| 682 | Ga0213872_10011708 | 3300021361 | Bacteria | 4147 |
| 683 | Ga0213872_10020413 | 3300021361 | Bacteria | 3054 |
| 684 | Ga0213872_10158401 | 3300021361 | Bacteria | 986 |
| 685 | Ga0213876_10013450 | 3300021384 | Bacteria | 4346 |
| 686 | Ga0209435_100080 | 3300025206 | Bacteria | 49104 |
| 687 | Ga0209436_117651 | 3300025208 | Bacteria | 1037 |
| 688 | Ga0209672_102997 | 3300025228 | Bacteria | 3707 |
| 689 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 690 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 691 | Ga0207427_100271 | 3300025231 | Bacteria | 39130 |
| 692 | Ga0209437_100117 | 3300025233 | Bacteria | 209271 |
| 693 | Ga0209258_100759 | 3300025242 | Bacteria | 20248 |
| 694 | Ga0209258_100788 | 3300025242 | Bacteria | 19070 |
| 695 | Ga0209258_103781 | 3300025242 | Bacteria | 3113 |
| 696 | Ga0207425_1004618 | 3300025245 | Bacteria | 4081 |
| 697 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 698 | Ga0209646_1000481 | 3300025246 | Bacteria | 19783 |
| 699 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 700 | Ga0209026_1000729 | 3300025250 | Bacteria | 19150 |
| 701 | Ga0209677_100823 | 3300025253 | Bacteria | 15482 |
| 702 | Ga0209677_108638 | 3300025253 | Bacteria | 1942 |
| 703 | Ga0209148_1000037 | 3300025254 | Bacteria | 494767 |
| 704 | Ga0209148_1016699 | 3300025254 | Bacteria | 1259 |
| 705 | Ga0209759_1000033 | 3300025256 | Bacteria | 276117 |
| 706 | Ga0209759_1000272 | 3300025256 | Bacteria | 73495 |
| 707 | Ga0209759_1000440 | 3300025256 | Bacteria | 48778 |
| 708 | Ga0209759_1000815 | 3300025256 | Bacteria | 24792 |
| 709 | Ga0209759_1004244 | 3300025256 | Bacteria | 5411 |
| 710 | Ga0209759_1007678 | 3300025256 | Bacteria | 3439 |
| 711 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 712 | Ga0209565_1000418 | 3300025263 | Bacteria | 34964 |
| 713 | Ga0209455_1000458 | 3300025272 | Bacteria | 30970 |
| 714 | Ga0209455_1000622 | 3300025272 | Bacteria | 22117 |
| 715 | Ga0209673_1000074 | 3300025273 | Bacteria | 233552 |
| 716 | Ga0209130_1000050 | 3300025284 | Bacteria | 222092 |
| 717 | Ga0209130_1000584 | 3300025284 | Bacteria | 35499 |
| 718 | Ga0209675_1000044 | 3300025291 | Bacteria | 230392 |
| 719 | Ga0209675_1002560 | 3300025291 | Bacteria | 9230 |
| 720 | Ga0209675_1011851 | 3300025291 | Bacteria | 2859 |
| 721 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 722 | Ga0209025_1000342 | 3300025294 | Bacteria | 102758 |
| 723 | Ga0209025_1001851 | 3300025294 | Bacteria | 24838 |
| 724 | Ga0209025_1004094 | 3300025294 | Bacteria | 13003 |
| 725 | Ga0209025_1004428 | 3300025294 | Bacteria | 12210 |
| 726 | Ga0209025_1006692 | 3300025294 | Bacteria | 8847 |
| 727 | Ga0209025_1006807 | 3300025294 | Bacteria | 8742 |
| 728 | Ga0209564_1000470 | 3300025295 | Bacteria | 67507 |
| 729 | Ga0209564_1003476 | 3300025295 | Bacteria | 10740 |
| 730 | Ga0209564_1003544 | 3300025295 | Bacteria | 10502 |
| 731 | Ga0209758_1009604 | 3300025297 | Bacteria | 5973 |
| 732 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 733 | Ga0209050_1002573 | 3300025298 | Bacteria | 15095 |
| 734 | Ga0209050_1002886 | 3300025298 | Bacteria | 13572 |
| 735 | Ga0209050_1008201 | 3300025298 | Bacteria | 5641 |
| 736 | Ga0209050_1038283 | 3300025298 | Bacteria | 1369 |
| 737 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 738 | Ga0209256_1000544 | 3300025299 | Bacteria | 54207 |
| 739 | Ga0207426_1000071 | 3300025302 | Bacteria | 329539 |
| 740 | Ga0207426_1001953 | 3300025302 | Bacteria | 14709 |
| 741 | Ga0207426_1003763 | 3300025302 | Bacteria | 7907 |
| 742 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 743 | Ga0209051_1003446 | 3300025303 | Bacteria | 10364 |
| 744 | Ga0209051_1009661 | 3300025303 | Bacteria | 4949 |
| 745 | Ga0209051_1019129 | 3300025303 | Bacteria | 3001 |
| 746 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 747 | Ga0209257_1000053 | 3300025304 | Bacteria | 425160 |
| 748 | Ga0209257_1000631 | 3300025304 | Bacteria | 56521 |
| 749 | Ga0207697_10003163 | 3300025315 | Bacteria | 8202 |
| 750 | Ga0207697_10061877 | 3300025315 | Bacteria | 1558 |
| 751 | Ga0207697_10099563 | 3300025315 | Bacteria | 1238 |
| 752 | Ga0207656_10015731 | 3300025321 | Bacteria | 2933 |
| 753 | Ga0207656_10021969 | 3300025321 | Bacteria | 2555 |
| 754 | Ga0207656_10050527 | 3300025321 | Bacteria | 1795 |
| 755 | Ga0207713_1004266 | 3300025735 | Bacteria | 9329 |
| 756 | Ga0207682_10000082 | 3300025893 | Bacteria | 42307 |
| 757 | Ga0207682_10006577 | 3300025893 | Bacteria | 4677 |
| 758 | Ga0207682_10041075 | 3300025893 | Bacteria | 1887 |
| 759 | Ga0207692_10008129 | 3300025898 | Bacteria | 4331 |
| 760 | Ga0207692_10024545 | 3300025898 | Bacteria | 2804 |
| 761 | Ga0207692_10026320 | 3300025898 | Bacteria | 2728 |
| 762 | Ga0207642_10000717 | 3300025899 | Bacteria | 10263 |
| 763 | Ga0207642_10008923 | 3300025899 | Bacteria | 3466 |
| 764 | Ga0207642_10056540 | 3300025899 | Bacteria | 1800 |
| 765 | Ga0207642_10110619 | 3300025899 | Bacteria | 1398 |
| 766 | Ga0207688_10042752 | 3300025901 | Bacteria | 2523 |
| 767 | Ga0207680_10009521 | 3300025903 | Bacteria | 4821 |
| 768 | Ga0207680_10028537 | 3300025903 | Bacteria | 3123 |
| 769 | Ga0207680_10148196 | 3300025903 | Bacteria | 1562 |
| 770 | Ga0207680_10358753 | 3300025903 | Bacteria | 1025 |
| 771 | Ga0207680_10362137 | 3300025903 | Bacteria | 1020 |
| 772 | Ga0207647_10039064 | 3300025904 | Bacteria | 2997 |
| 773 | Ga0207647_10085536 | 3300025904 | Bacteria | 1886 |
| 774 | Ga0207647_10187394 | 3300025904 | Bacteria | 1200 |
| 775 | Ga0207685_10001009 | 3300025905 | Bacteria | 5464 |
| 776 | Ga0207699_10172160 | 3300025906 | Bacteria | 1449 |
| 777 | Ga0207645_10002355 | 3300025907 | Bacteria | 14906 |
| 778 | Ga0207645_10004888 | 3300025907 | Bacteria | 9825 |
| 779 | Ga0207645_10010285 | 3300025907 | Bacteria | 6427 |
| 780 | Ga0207645_10130449 | 3300025907 | Bacteria | 1636 |
| 781 | Ga0207645_10139442 | 3300025907 | Bacteria | 1580 |
| 782 | Ga0207643_10001052 | 3300025908 | Bacteria | 16349 |
| 783 | Ga0207643_10002227 | 3300025908 | Bacteria | 10572 |
| 784 | Ga0207643_10011695 | 3300025908 | Bacteria | 4741 |
| 785 | Ga0207643_10046825 | 3300025908 | Bacteria | 2445 |
| 786 | Ga0207643_10053897 | 3300025908 | Bacteria | 2285 |
| 787 | Ga0207705_10065907 | 3300025909 | Bacteria | 2619 |
| 788 | Ga0207705_10108271 | 3300025909 | Bacteria | 2051 |
| 789 | Ga0207705_10440134 | 3300025909 | Bacteria | 1010 |
| 790 | Ga0207654_10008575 | 3300025911 | Bacteria | 5175 |
| 791 | Ga0207654_10058591 | 3300025911 | Bacteria | 2243 |
| 792 | Ga0207707_10028631 | 3300025912 | Bacteria | 4869 |
| 793 | Ga0207707_10061747 | 3300025912 | Bacteria | 3261 |
| 794 | Ga0207707_10081154 | 3300025912 | Bacteria | 2831 |
| 795 | Ga0207707_10343921 | 3300025912 | Bacteria | 1286 |
| 796 | Ga0207707_10560417 | 3300025912 | Bacteria | 970 |
| 797 | Ga0207707_10635345 | 3300025912 | Bacteria | 901 |
| 798 | Ga0207707_10728006 | 3300025912 | Bacteria | 831 |
| 799 | Ga0207695_10004475 | 3300025913 | Bacteria | 19039 |
| 800 | Ga0207695_10025394 | 3300025913 | Bacteria | 6633 |
| 801 | Ga0207695_10057658 | 3300025913 | Bacteria | 4034 |
| 802 | Ga0207695_10104980 | 3300025913 | Bacteria | 2813 |
| 803 | Ga0207695_10371774 | 3300025913 | Bacteria | 1316 |
| 804 | Ga0207671_10032166 | 3300025914 | Bacteria | 3905 |
| 805 | Ga0207671_10052856 | 3300025914 | Bacteria | 3011 |
| 806 | Ga0207671_10144116 | 3300025914 | Bacteria | 1837 |
| 807 | Ga0207671_10321588 | 3300025914 | Bacteria | 1224 |
| 808 | Ga0207693_10000069 | 3300025915 | Bacteria | 90103 |
| 809 | Ga0207693_10017171 | 3300025915 | Bacteria | 5771 |
| 810 | Ga0207693_10080225 | 3300025915 | Bacteria | 2555 |
| 811 | Ga0207663_10036233 | 3300025916 | Bacteria | 2967 |
| 812 | Ga0207663_10053178 | 3300025916 | Bacteria | 2529 |
| 813 | Ga0207663_10059764 | 3300025916 | Bacteria | 2413 |
| 814 | Ga0207660_10041498 | 3300025917 | Bacteria | 3224 |
| 815 | Ga0207660_10080430 | 3300025917 | Bacteria | 2393 |
| 816 | Ga0207660_10098692 | 3300025917 | Bacteria | 2179 |
| 817 | Ga0207660_10168581 | 3300025917 | Bacteria | 1694 |
| 818 | Ga0207660_10196280 | 3300025917 | Bacteria | 1574 |
| 819 | Ga0207662_10010039 | 3300025918 | Bacteria | 5222 |
| 820 | Ga0207662_10018980 | 3300025918 | Bacteria | 3907 |
| 821 | Ga0207662_10054338 | 3300025918 | Bacteria | 2388 |
| 822 | Ga0207662_10300986 | 3300025918 | Bacteria | 1066 |
| 823 | Ga0207657_10000151 | 3300025919 | Bacteria | 70697 |
| 824 | Ga0207657_10012062 | 3300025919 | Bacteria | 8547 |
| 825 | Ga0207657_10039663 | 3300025919 | Bacteria | 4183 |
| 826 | Ga0207657_10077361 | 3300025919 | Bacteria | 2804 |
| 827 | Ga0207657_10155946 | 3300025919 | Bacteria | 1857 |
| 828 | Ga0207657_10208633 | 3300025919 | Bacteria | 1569 |
| 829 | Ga0207657_10292766 | 3300025919 | Bacteria | 1291 |
| 830 | Ga0207649_10005808 | 3300025920 | Bacteria | 6683 |
| 831 | Ga0207649_10013767 | 3300025920 | Bacteria | 4522 |
| 832 | Ga0207649_10041017 | 3300025920 | Bacteria | 2816 |
| 833 | Ga0207649_10056859 | 3300025920 | Bacteria | 2444 |
| 834 | Ga0207649_10239042 | 3300025920 | Bacteria | 1303 |
| 835 | Ga0207649_10598454 | 3300025920 | Bacteria | 848 |
| 836 | Ga0207652_10013663 | 3300025921 | Bacteria | 6565 |
| 837 | Ga0207652_10047545 | 3300025921 | Bacteria | 3665 |
| 838 | Ga0207652_10052888 | 3300025921 | Bacteria | 3488 |
| 839 | Ga0207652_10066044 | 3300025921 | Bacteria | 3134 |
| 840 | Ga0207652_10079488 | 3300025921 | Bacteria | 2865 |
| 841 | Ga0207652_10187611 | 3300025921 | Bacteria | 1859 |
| 842 | Ga0207652_10342584 | 3300025921 | Bacteria | 1349 |
| 843 | Ga0207646_10009271 | 3300025922 | Bacteria | 9740 |
| 844 | Ga0207646_10524256 | 3300025922 | Bacteria | 1066 |
| 845 | Ga0207681_10011576 | 3300025923 | Bacteria | 5419 |
| 846 | Ga0207681_10034634 | 3300025923 | Bacteria | 3321 |
| 847 | Ga0207681_10137865 | 3300025923 | Bacteria | 1813 |
| 848 | Ga0207681_10171093 | 3300025923 | Bacteria | 1646 |
| 849 | Ga0207681_10190689 | 3300025923 | Bacteria | 1568 |
| 850 | Ga0207681_10206539 | 3300025923 | Bacteria | 1511 |
| 851 | Ga0207681_10235430 | 3300025923 | Bacteria | 1423 |
| 852 | Ga0207681_10472107 | 3300025923 | Bacteria | 1023 |
| 853 | Ga0207694_10020992 | 3300025924 | Bacteria | 4944 |
| 854 | Ga0207694_10027012 | 3300025924 | Bacteria | 4370 |
| 855 | Ga0207694_10047563 | 3300025924 | Bacteria | 3318 |
| 856 | Ga0207694_10062916 | 3300025924 | Bacteria | 2890 |
| 857 | Ga0207694_10167502 | 3300025924 | Bacteria | 1777 |
| 858 | Ga0207694_10184149 | 3300025924 | Bacteria | 1694 |
| 859 | Ga0207694_10219451 | 3300025924 | Bacteria | 1550 |
| 860 | Ga0207694_10247277 | 3300025924 | Bacteria | 1459 |
| 861 | Ga0207650_10004791 | 3300025925 | Bacteria | 9247 |
| 862 | Ga0207650_10011760 | 3300025925 | Bacteria | 6034 |
| 863 | Ga0207650_10034508 | 3300025925 | Bacteria | 3669 |
| 864 | Ga0207650_10042217 | 3300025925 | Bacteria | 3345 |
| 865 | Ga0207650_10074583 | 3300025925 | Bacteria | 2558 |
| 866 | Ga0207650_10079443 | 3300025925 | Bacteria | 2484 |
| 867 | Ga0207650_10080023 | 3300025925 | Bacteria | 2476 |
| 868 | Ga0207650_10085248 | 3300025925 | Bacteria | 2403 |
| 869 | Ga0207650_10094146 | 3300025925 | Bacteria | 2294 |
| 870 | Ga0207650_10134148 | 3300025925 | Bacteria | 1940 |
| 871 | Ga0207650_10178986 | 3300025925 | Bacteria | 1689 |
| 872 | Ga0207650_10404321 | 3300025925 | Bacteria | 1131 |
| 873 | Ga0207659_10007542 | 3300025926 | Bacteria | 6700 |
| 874 | Ga0207659_10008038 | 3300025926 | Bacteria | 6530 |
| 875 | Ga0207659_10028928 | 3300025926 | Bacteria | 3770 |
| 876 | Ga0207659_10032593 | 3300025926 | Bacteria | 3578 |
| 877 | Ga0207659_10068289 | 3300025926 | Bacteria | 2585 |
| 878 | Ga0207659_10103945 | 3300025926 | Bacteria | 2147 |
| 879 | Ga0207659_10414818 | 3300025926 | Bacteria | 1128 |
| 880 | Ga0207659_10701947 | 3300025926 | Bacteria | 866 |
| 881 | Ga0207659_10720696 | 3300025926 | Bacteria | 855 |
| 882 | Ga0207659_10796364 | 3300025926 | Bacteria | 812 |
| 883 | Ga0207687_10001955 | 3300025927 | Bacteria | 14185 |
| 884 | Ga0207687_10003815 | 3300025927 | Bacteria | 10129 |
| 885 | Ga0207687_10177980 | 3300025927 | Bacteria | 1645 |
| 886 | Ga0207700_10000065 | 3300025928 | Bacteria | 65305 |
| 887 | Ga0207700_10007518 | 3300025928 | Bacteria | 6664 |
| 888 | Ga0207700_10297979 | 3300025928 | Bacteria | 1391 |
| 889 | Ga0207664_10081146 | 3300025929 | Bacteria | 2638 |
| 890 | Ga0207664_10113619 | 3300025929 | Bacteria | 2255 |
| 891 | Ga0207664_10311233 | 3300025929 | Bacteria | 1387 |
| 892 | Ga0207664_10415902 | 3300025929 | Bacteria | 1197 |
| 893 | Ga0207664_10623080 | 3300025929 | Bacteria | 969 |
| 894 | Ga0207644_10013680 | 3300025931 | Bacteria | 5416 |
| 895 | Ga0207644_10027774 | 3300025931 | Bacteria | 3912 |
| 896 | Ga0207644_10104092 | 3300025931 | Bacteria | 2136 |
| 897 | Ga0207644_10115397 | 3300025931 | Bacteria | 2036 |
| 898 | Ga0207644_10171596 | 3300025931 | Bacteria | 1693 |
| 899 | Ga0207644_10477413 | 3300025931 | Bacteria | 1026 |
| 900 | Ga0207690_10002121 | 3300025932 | Bacteria | 12149 |
| 901 | Ga0207690_10164032 | 3300025932 | Bacteria | 1659 |
| 902 | Ga0207690_10171859 | 3300025932 | Bacteria | 1624 |
| 903 | Ga0207690_10184497 | 3300025932 | Bacteria | 1573 |
| 904 | Ga0207690_10201593 | 3300025932 | Bacteria | 1512 |
| 905 | Ga0207690_10357628 | 3300025932 | Bacteria | 1156 |
| 906 | Ga0207706_10000045 | 3300025933 | Bacteria | 120758 |
| 907 | Ga0207706_10019809 | 3300025933 | Bacteria | 6049 |
| 908 | Ga0207706_10046407 | 3300025933 | Bacteria | 3846 |
| 909 | Ga0207706_10149404 | 3300025933 | Bacteria | 2055 |
| 910 | Ga0207706_10191005 | 3300025933 | Bacteria | 1798 |
| 911 | Ga0207686_10000845 | 3300025934 | Bacteria | 18612 |
| 912 | Ga0207686_10014544 | 3300025934 | Bacteria | 4384 |
| 913 | Ga0207686_10035797 | 3300025934 | Bacteria | 2983 |
| 914 | Ga0207686_10037045 | 3300025934 | Bacteria | 2941 |
| 915 | Ga0207686_10045954 | 3300025934 | Bacteria | 2690 |
| 916 | Ga0207686_10095494 | 3300025934 | Bacteria | 1973 |
| 917 | Ga0207709_10014580 | 3300025935 | Bacteria | 4343 |
| 918 | Ga0207709_10027760 | 3300025935 | Bacteria | 3265 |
| 919 | Ga0207709_10159096 | 3300025935 | Bacteria | 1573 |
| 920 | Ga0207709_10262608 | 3300025935 | Bacteria | 1267 |
| 921 | Ga0207670_10015418 | 3300025936 | Bacteria | 4566 |
| 922 | Ga0207670_10050297 | 3300025936 | Bacteria | 2792 |
| 923 | Ga0207669_10061366 | 3300025937 | Bacteria | 2310 |
| 924 | Ga0207669_10154658 | 3300025937 | Bacteria | 1611 |
| 925 | Ga0207669_10175810 | 3300025937 | Bacteria | 1529 |
| 926 | Ga0207669_10241525 | 3300025937 | Bacteria | 1339 |
| 927 | Ga0207669_10243469 | 3300025937 | Bacteria | 1334 |
| 928 | Ga0207669_10246999 | 3300025937 | Bacteria | 1326 |
| 929 | Ga0207704_10005678 | 3300025938 | Bacteria | 5767 |
| 930 | Ga0207704_10006884 | 3300025938 | Bacteria | 5335 |
| 931 | Ga0207704_10012648 | 3300025938 | Bacteria | 4193 |
| 932 | Ga0207704_10460681 | 3300025938 | Bacteria | 1017 |
| 933 | Ga0207665_10033149 | 3300025939 | Bacteria | 3422 |
| 934 | Ga0207665_10140526 | 3300025939 | Bacteria | 1721 |
| 935 | Ga0207691_10000316 | 3300025940 | Bacteria | 48235 |
| 936 | Ga0207691_10000338 | 3300025940 | Bacteria | 47065 |
| 937 | Ga0207691_10001034 | 3300025940 | Bacteria | 27579 |
| 938 | Ga0207691_10021310 | 3300025940 | Bacteria | 6120 |
| 939 | Ga0207691_10022502 | 3300025940 | Bacteria | 5944 |
| 940 | Ga0207691_10029470 | 3300025940 | Bacteria | 5135 |
| 941 | Ga0207691_10030708 | 3300025940 | Bacteria | 5019 |
| 942 | Ga0207691_10042058 | 3300025940 | Bacteria | 4214 |
| 943 | Ga0207691_10109538 | 3300025940 | Bacteria | 2457 |
| 944 | Ga0207691_10192109 | 3300025940 | Bacteria | 1780 |
| 945 | Ga0207691_10352878 | 3300025940 | Bacteria | 1258 |
| 946 | Ga0207711_10000164 | 3300025941 | Bacteria | 71542 |
| 947 | Ga0207711_10002873 | 3300025941 | Bacteria | 15098 |
| 948 | Ga0207711_10048728 | 3300025941 | Bacteria | 3625 |
| 949 | Ga0207711_10366130 | 3300025941 | Bacteria | 1336 |
| 950 | Ga0207711_10482233 | 3300025941 | Bacteria | 1155 |
| 951 | Ga0207711_10590307 | 3300025941 | Bacteria | 1036 |
| 952 | Ga0207711_10680992 | 3300025941 | Bacteria | 959 |
| 953 | Ga0207689_10000136 | 3300025942 | Bacteria | 62820 |
| 954 | Ga0207689_10000889 | 3300025942 | Bacteria | 28731 |
| 955 | Ga0207689_10006468 | 3300025942 | Bacteria | 10353 |
| 956 | Ga0207689_10008327 | 3300025942 | Bacteria | 9033 |
| 957 | Ga0207689_10035481 | 3300025942 | Bacteria | 4143 |
| 958 | Ga0207689_10107284 | 3300025942 | Bacteria | 2295 |
| 959 | Ga0207689_10186836 | 3300025942 | Bacteria | 1709 |
| 960 | Ga0207661_10013035 | 3300025944 | Bacteria | 6066 |
| 961 | Ga0207661_10030076 | 3300025944 | Bacteria | 4179 |
| 962 | Ga0207661_10050108 | 3300025944 | Bacteria | 3325 |
| 963 | Ga0207661_10055964 | 3300025944 | Bacteria | 3165 |
| 964 | Ga0207679_10003393 | 3300025945 | Bacteria | 9826 |
| 965 | Ga0207679_10003765 | 3300025945 | Bacteria | 9398 |
| 966 | Ga0207679_10021822 | 3300025945 | Bacteria | 4349 |
| 967 | Ga0207679_10023459 | 3300025945 | Bacteria | 4220 |
| 968 | Ga0207679_10048055 | 3300025945 | Bacteria | 3104 |
| 969 | Ga0207679_10223762 | 3300025945 | Bacteria | 1584 |
| 970 | Ga0207679_10250192 | 3300025945 | Bacteria | 1506 |
| 971 | Ga0207679_10676334 | 3300025945 | Bacteria | 935 |
| 972 | Ga0207667_10004085 | 3300025949 | Bacteria | 17932 |
| 973 | Ga0207667_10004150 | 3300025949 | Bacteria | 17803 |
| 974 | Ga0207667_10005013 | 3300025949 | Bacteria | 16183 |
| 975 | Ga0207667_10027186 | 3300025949 | Bacteria | 6234 |
| 976 | Ga0207667_10039264 | 3300025949 | Bacteria | 5046 |
| 977 | Ga0207667_10046288 | 3300025949 | Bacteria | 4606 |
| 978 | Ga0207667_10056153 | 3300025949 | Bacteria | 4137 |
| 979 | Ga0207667_10060441 | 3300025949 | Bacteria | 3966 |
| 980 | Ga0207667_10141143 | 3300025949 | Bacteria | 2480 |
| 981 | Ga0207667_10177224 | 3300025949 | Bacteria | 2190 |
| 982 | Ga0207667_10241642 | 3300025949 | Bacteria | 1848 |
| 983 | Ga0207667_10442418 | 3300025949 | Bacteria | 1321 |
| 984 | Ga0207667_10669534 | 3300025949 | Bacteria | 1042 |
| 985 | Ga0207651_10007222 | 3300025960 | Bacteria | 5906 |
| 986 | Ga0207651_10017942 | 3300025960 | Bacteria | 4196 |
| 987 | Ga0207651_10023887 | 3300025960 | Bacteria | 3770 |
| 988 | Ga0207651_10049282 | 3300025960 | Bacteria | 2852 |
| 989 | Ga0207651_10053465 | 3300025960 | Bacteria | 2761 |
| 990 | Ga0207651_10097968 | 3300025960 | Bacteria | 2167 |
| 991 | Ga0207712_10012054 | 3300025961 | Bacteria | 5520 |
| 992 | Ga0207712_10174793 | 3300025961 | Bacteria | 1682 |
| 993 | Ga0207712_10301262 | 3300025961 | Bacteria | 1315 |
| 994 | Ga0207668_10006032 | 3300025972 | Bacteria | 7145 |
| 995 | Ga0207668_10007633 | 3300025972 | Bacteria | 6438 |
| 996 | Ga0207668_10014248 | 3300025972 | Bacteria | 4918 |
| 997 | Ga0207668_10022713 | 3300025972 | Bacteria | 4021 |
| 998 | Ga0207668_10025826 | 3300025972 | Bacteria | 3806 |
| 999 | Ga0207668_10044136 | 3300025972 | Bacteria | 3030 |
| 1000 | Ga0207668_10271061 | 3300025972 | Bacteria | 1387 |
| 1001 | Ga0207668_10607131 | 3300025972 | Bacteria | 953 |
| 1002 | Ga0207668_10694170 | 3300025972 | Bacteria | 894 |
| 1003 | Ga0207640_10032658 | 3300025981 | Bacteria | 3229 |
| 1004 | Ga0207640_10093425 | 3300025981 | Bacteria | 2090 |
| 1005 | Ga0207640_10154240 | 3300025981 | Bacteria | 1691 |
| 1006 | Ga0207640_10167128 | 3300025981 | Bacteria | 1635 |
| 1007 | Ga0207640_10227438 | 3300025981 | Bacteria | 1432 |
| 1008 | Ga0207640_10333230 | 3300025981 | Bacteria | 1213 |
| 1009 | Ga0207658_10002886 | 3300025986 | Bacteria | 12320 |
| 1010 | Ga0207658_10010048 | 3300025986 | Bacteria | 6429 |
| 1011 | Ga0207658_10011457 | 3300025986 | Bacteria | 6034 |
| 1012 | Ga0207658_10056071 | 3300025986 | Bacteria | 2922 |
| 1013 | Ga0207658_10180650 | 3300025986 | Bacteria | 1746 |
| 1014 | Ga0207658_10208881 | 3300025986 | Bacteria | 1635 |
| 1015 | Ga0207658_10324036 | 3300025986 | Bacteria | 1334 |
| 1016 | Ga0207677_10000092 | 3300026023 | Bacteria | 73792 |
| 1017 | Ga0207677_10035476 | 3300026023 | Bacteria | 3240 |
| 1018 | Ga0207677_10059609 | 3300026023 | Bacteria | 2633 |
| 1019 | Ga0207677_10169237 | 3300026023 | Bacteria | 1707 |
| 1020 | Ga0207677_10545677 | 3300026023 | Bacteria | 1009 |
| 1021 | Ga0207703_10000506 | 3300026035 | Bacteria | 40394 |
| 1022 | Ga0207703_10004214 | 3300026035 | Bacteria | 11854 |
| 1023 | Ga0207703_10014986 | 3300026035 | Bacteria | 6050 |
| 1024 | Ga0207703_10081584 | 3300026035 | Bacteria | 2696 |
| 1025 | Ga0207639_10132173 | 3300026041 | Bacteria | 2068 |
| 1026 | Ga0207639_10157971 | 3300026041 | Bacteria | 1907 |
| 1027 | Ga0207639_10237960 | 3300026041 | Bacteria | 1581 |
| 1028 | Ga0207639_10276334 | 3300026041 | Bacteria | 1475 |
| 1029 | Ga0207639_10351962 | 3300026041 | Bacteria | 1316 |
| 1030 | Ga0207639_10357246 | 3300026041 | Bacteria | 1306 |
| 1031 | Ga0207678_10002764 | 3300026067 | Bacteria | 15882 |
| 1032 | Ga0207678_10005468 | 3300026067 | Bacteria | 11361 |
| 1033 | Ga0207678_10007894 | 3300026067 | Bacteria | 9388 |
| 1034 | Ga0207678_10014773 | 3300026067 | Bacteria | 6871 |
| 1035 | Ga0207678_10133036 | 3300026067 | Bacteria | 2122 |
| 1036 | Ga0207678_10150853 | 3300026067 | Bacteria | 1984 |
| 1037 | Ga0207678_10441811 | 3300026067 | Bacteria | 1130 |
| 1038 | Ga0207678_10477706 | 3300026067 | Bacteria | 1085 |
| 1039 | Ga0207678_10484983 | 3300026067 | Bacteria | 1077 |
| 1040 | Ga0207708_10000464 | 3300026075 | Bacteria | 31415 |
| 1041 | Ga0207708_10022897 | 3300026075 | Bacteria | 4719 |
| 1042 | Ga0207708_10041861 | 3300026075 | Bacteria | 3492 |
| 1043 | Ga0207708_10496569 | 3300026075 | Bacteria | 1022 |
| 1044 | Ga0207702_10002581 | 3300026078 | Bacteria | 17033 |
| 1045 | Ga0207702_10010013 | 3300026078 | Bacteria | 7949 |
| 1046 | Ga0207702_10011289 | 3300026078 | Bacteria | 7446 |
| 1047 | Ga0207702_10013322 | 3300026078 | Bacteria | 6838 |
| 1048 | Ga0207702_10067235 | 3300026078 | Bacteria | 3075 |
| 1049 | Ga0207702_10109585 | 3300026078 | Bacteria | 2452 |
| 1050 | Ga0207641_10003632 | 3300026088 | Bacteria | 13601 |
| 1051 | Ga0207641_10005922 | 3300026088 | Bacteria | 10367 |
| 1052 | Ga0207641_10008864 | 3300026088 | Bacteria | 8307 |
| 1053 | Ga0207641_10011137 | 3300026088 | Bacteria | 7378 |
| 1054 | Ga0207641_10044889 | 3300026088 | Bacteria | 3718 |
| 1055 | Ga0207641_10046818 | 3300026088 | Bacteria | 3646 |
| 1056 | Ga0207641_10127513 | 3300026088 | Bacteria | 2280 |
| 1057 | Ga0207641_10156765 | 3300026088 | Bacteria | 2066 |
| 1058 | Ga0207641_10247563 | 3300026088 | Bacteria | 1663 |
| 1059 | Ga0207648_10000684 | 3300026089 | Bacteria | 37958 |
| 1060 | Ga0207648_10001366 | 3300026089 | Bacteria | 26971 |
| 1061 | Ga0207648_10004085 | 3300026089 | Bacteria | 15124 |
| 1062 | Ga0207648_10008908 | 3300026089 | Bacteria | 9659 |
| 1063 | Ga0207648_10050071 | 3300026089 | Bacteria | 3653 |
| 1064 | Ga0207648_10063075 | 3300026089 | Bacteria | 3231 |
| 1065 | Ga0207648_10232541 | 3300026089 | Bacteria | 1640 |
| 1066 | Ga0207648_10256233 | 3300026089 | Bacteria | 1560 |
| 1067 | Ga0207648_10338045 | 3300026089 | Bacteria | 1355 |
| 1068 | Ga0207648_10459022 | 3300026089 | Bacteria | 1161 |
| 1069 | Ga0207676_10000121 | 3300026095 | Bacteria | 68688 |
| 1070 | Ga0207676_10004876 | 3300026095 | Bacteria | 9496 |
| 1071 | Ga0207676_10010720 | 3300026095 | Bacteria | 6534 |
| 1072 | Ga0207676_10021343 | 3300026095 | Bacteria | 4750 |
| 1073 | Ga0207676_10029406 | 3300026095 | Bacteria | 4114 |
| 1074 | Ga0207676_10031843 | 3300026095 | Bacteria | 3968 |
| 1075 | Ga0207676_10044175 | 3300026095 | Bacteria | 3436 |
| 1076 | Ga0207676_10090343 | 3300026095 | Bacteria | 2513 |
| 1077 | Ga0207676_10232789 | 3300026095 | Bacteria | 1648 |
| 1078 | Ga0207676_10344716 | 3300026095 | Bacteria | 1376 |
| 1079 | Ga0207674_10000225 | 3300026116 | Bacteria | 70648 |
| 1080 | Ga0207674_10001745 | 3300026116 | Bacteria | 27816 |
| 1081 | Ga0207674_10003791 | 3300026116 | Bacteria | 18445 |
| 1082 | Ga0207674_10005488 | 3300026116 | Bacteria | 15061 |
| 1083 | Ga0207674_10006478 | 3300026116 | Bacteria | 13764 |
| 1084 | Ga0207674_10047615 | 3300026116 | Bacteria | 4393 |
| 1085 | Ga0207674_10130296 | 3300026116 | Bacteria | 2479 |
| 1086 | Ga0207674_10155859 | 3300026116 | Bacteria | 2239 |
| 1087 | Ga0207674_10476873 | 3300026116 | Bacteria | 1206 |
| 1088 | Ga0207675_100000213 | 3300026118 | Bacteria | 54289 |
| 1089 | Ga0207675_100000855 | 3300026118 | Bacteria | 30355 |
| 1090 | Ga0207675_100037223 | 3300026118 | Bacteria | 4539 |
| 1091 | Ga0207675_100057980 | 3300026118 | Bacteria | 3614 |
| 1092 | Ga0207675_100159518 | 3300026118 | Bacteria | 2151 |
| 1093 | Ga0207675_100159573 | 3300026118 | Bacteria | 2150 |
| 1094 | Ga0207675_100180708 | 3300026118 | Bacteria | 2020 |
| 1095 | Ga0207675_100434927 | 3300026118 | Bacteria | 1298 |
| 1096 | Ga0207675_100473994 | 3300026118 | Bacteria | 1243 |
| 1097 | Ga0207683_10000121 | 3300026121 | Bacteria | 64376 |
| 1098 | Ga0207683_10000281 | 3300026121 | Bacteria | 45555 |
| 1099 | Ga0207683_10003368 | 3300026121 | Bacteria | 13933 |
| 1100 | Ga0207683_10006240 | 3300026121 | Bacteria | 10220 |
| 1101 | Ga0207683_10008506 | 3300026121 | Bacteria | 8784 |
| 1102 | Ga0207683_10010771 | 3300026121 | Bacteria | 7797 |
| 1103 | Ga0207683_10071847 | 3300026121 | Bacteria | 3060 |
| 1104 | Ga0207683_10310082 | 3300026121 | Bacteria | 1444 |
| 1105 | Ga0207683_10545596 | 3300026121 | Bacteria | 1072 |
| 1106 | Ga0207698_10003670 | 3300026142 | Bacteria | 9273 |
| 1107 | Ga0207698_10010928 | 3300026142 | Bacteria | 5863 |
| 1108 | Ga0207698_10032050 | 3300026142 | Bacteria | 3803 |
| 1109 | Ga0207698_10205246 | 3300026142 | Bacteria | 1768 |
| 1110 | Ga0207698_10281897 | 3300026142 | Bacteria | 1537 |
| 1111 | Ga0207698_10314649 | 3300026142 | Bacteria | 1463 |
| 1112 | Ga0207698_10505070 | 3300026142 | Bacteria | 1177 |
| 1113 | Ga0209371_1010418 | 3300027312 | Bacteria | 2860 |
| 1114 | Ga0209969_1012955 | 3300027360 | Bacteria | 1205 |
| 1115 | Ga0209981_1005979 | 3300027378 | Bacteria | 1624 |
| 1116 | Ga0209996_1001078 | 3300027395 | Bacteria | 3252 |
| 1117 | Ga0209996_1009978 | 3300027395 | Bacteria | 1255 |
| 1118 | Ga0210000_1018837 | 3300027462 | Bacteria | 1049 |
| 1119 | Ga0209995_1005683 | 3300027471 | Bacteria | 2004 |
| 1120 | Ga0209968_1000987 | 3300027526 | Bacteria | 4373 |
| 1121 | Ga0209999_1006228 | 3300027543 | Bacteria | 2142 |
| 1122 | Ga0209982_1013388 | 3300027552 | Bacteria | 1235 |
| 1123 | Ga0209970_1000504 | 3300027614 | Bacteria | 6703 |
| 1124 | Ga0209983_1008586 | 3300027665 | Bacteria | 2089 |
| 1125 | Ga0209971_1009975 | 3300027682 | Bacteria | 2246 |
| 1126 | Ga0209971_1022202 | 3300027682 | Bacteria | 1511 |
| 1127 | Ga0209966_1000138 | 3300027695 | Bacteria | 30805 |
| 1128 | Ga0209974_10002121 | 3300027876 | Bacteria | 7260 |
| 1129 | Ga0209974_10024770 | 3300027876 | Bacteria | 1985 |
| 1130 | Ga0209974_10027418 | 3300027876 | Bacteria | 1885 |
| 1131 | Ga0209974_10062921 | 3300027876 | Bacteria | 1258 |
| 1132 | Ga0207428_10013439 | 3300027907 | Bacteria | 7151 |
| 1133 | Ga0207428_10177058 | 3300027907 | Bacteria | 1613 |
| 1134 | Ga0268266_10014216 | 3300028379 | Bacteria | 6847 |
| 1135 | Ga0268266_10022829 | 3300028379 | Bacteria | 5326 |
| 1136 | Ga0268266_10048019 | 3300028379 | Bacteria | 3658 |
| 1137 | Ga0268266_10299933 | 3300028379 | Bacteria | 1499 |
| 1138 | Ga0268266_10498499 | 3300028379 | Bacteria | 1162 |
| 1139 | Ga0268266_10510854 | 3300028379 | Bacteria | 1148 |
| 1140 | Ga0268265_10050352 | 3300028380 | Bacteria | 3138 |
| 1141 | Ga0268265_10053828 | 3300028380 | Bacteria | 3050 |
| 1142 | Ga0268265_10073856 | 3300028380 | Bacteria | 2665 |
| 1143 | Ga0268265_10290441 | 3300028380 | Bacteria | 1467 |
| 1144 | Ga0268265_10700427 | 3300028380 | Bacteria | 978 |
| 1145 | Ga0268264_10007565 | 3300028381 | Bacteria | 9061 |
| 1146 | Ga0268264_10014520 | 3300028381 | Bacteria | 6472 |
| 1147 | Ga0268264_10016351 | 3300028381 | Bacteria | 6075 |
| 1148 | Ga0268264_10028647 | 3300028381 | Bacteria | 4558 |
| 1149 | Ga0268264_10144510 | 3300028381 | Bacteria | 2125 |
| 1150 | Ga0268264_10185110 | 3300028381 | Bacteria | 1894 |
| 1151 | Ga0268264_10364201 | 3300028381 | Bacteria | 1380 |
| 1152 | Ga0268264_10441999 | 3300028381 | Bacteria | 1258 |
| 1153 | Ga0265336_10000040 | 3300028666 | Bacteria | 138266 |
| 1154 | Ga0307515_10022881 | 3300028794 | Bacteria | 10992 |
| 1155 | Ga0265324_10001969 | 3300029957 | Bacteria | 11010 |
| 1156 | Ga0268256_1011174 | 3300030500 | Bacteria | 2860 |
| 1157 | Ga0307511_10004027 | 3300030521 | Bacteria | 15028 |
| 1158 | Ga0265760_10075064 | 3300031090 | Bacteria | 1041 |
| 1159 | Ga0265320_10011984 | 3300031240 | Bacteria | 5074 |
| 1160 | Ga0265339_10003247 | 3300031249 | Bacteria | 11394 |
| 1161 | Ga0265331_10056087 | 3300031250 | Bacteria | 1872 |
| 1162 | Ga0265316_10056387 | 3300031344 | Bacteria | 3069 |
| 1163 | Ga0307513_10000014 | 3300031456 | Bacteria | 303157 |
| 1164 | Ga0307509_10108266 | 3300031507 | Bacteria | 2793 |
| 1165 | Ga0307408_100016188 | 3300031548 | Bacteria | 4972 |
| 1166 | Ga0307408_100115037 | 3300031548 | Bacteria | 2074 |
| 1167 | Ga0265313_10018912 | 3300031595 | Bacteria | 3853 |
| 1168 | Ga0265313_10045468 | 3300031595 | Bacteria | 2138 |
| 1169 | Ga0307508_10319699 | 3300031616 | Bacteria | 1144 |
| 1170 | Ga0265314_10008372 | 3300031711 | Bacteria | 8863 |
| 1171 | Ga0265342_10004326 | 3300031712 | Bacteria | 11240 |
| 1172 | Ga0265342_10014320 | 3300031712 | Bacteria | 5269 |
| 1173 | Ga0307516_10144330 | 3300031730 | Bacteria | 2147 |
| 1174 | Ga0307413_10081564 | 3300031824 | Bacteria | 2074 |
| 1175 | Ga0307413_10188359 | 3300031824 | Bacteria | 1479 |
| 1176 | Ga0307410_10169969 | 3300031852 | Bacteria | 1642 |
| 1177 | Ga0307410_10184959 | 3300031852 | Bacteria | 1580 |
| 1178 | Ga0307406_10009098 | 3300031901 | Bacteria | 5558 |
| 1179 | Ga0307406_10256170 | 3300031901 | Bacteria | 1321 |
| 1180 | Ga0307407_10006322 | 3300031903 | Bacteria | 5246 |
| 1181 | Ga0307407_10227006 | 3300031903 | Bacteria | 1266 |
| 1182 | Ga0307412_10000059 | 3300031911 | Bacteria | 138772 |
| 1183 | Ga0307412_10061948 | 3300031911 | Bacteria | 2517 |
| 1184 | Ga0307412_10205611 | 3300031911 | Bacteria | 1498 |
| 1185 | Ga0307409_100038309 | 3300031995 | Bacteria | 3544 |
| 1186 | Ga0307416_100049321 | 3300032002 | Bacteria | 3347 |
| 1187 | Ga0307416_100055199 | 3300032002 | Bacteria | 3198 |
| 1188 | Ga0307416_100276979 | 3300032002 | Bacteria | 1651 |
| 1189 | Ga0307416_100325020 | 3300032002 | Bacteria | 1543 |
| 1190 | Ga0307416_100434728 | 3300032002 | Bacteria | 1361 |
| 1191 | Ga0307416_101034194 | 3300032002 | Bacteria | 925 |
| 1192 | Ga0307414_10072710 | 3300032004 | Bacteria | 2485 |
| 1193 | Ga0307411_10006981 | 3300032005 | Bacteria | 5703 |
| 1194 | Ga0307507_10069599 | 3300033179 | Bacteria | 3200 |
| 1195 | Ga0373959_0009971 | 3300034820 | Bacteria | 1651 |
| 1196 | Ga0373934_0010219 | 3300035086 | Bacteria | 3523 |
| 1197 | Ga0373934_0144853 | 3300035086 | Bacteria | 972 |
| 1198 | Ga0373923_0046028 | 3300035111 | Bacteria | 1813 |
| 1199 | Ga0373923_0226649 | 3300035111 | Bacteria | 870 |
| 1200 | Ga0373945_0015509 | 3300035116 | Bacteria | 2564 |
| 1201 | Ga0373945_0026059 | 3300035116 | Bacteria | 2035 |
| 1202 | Ga0373953_0009840 | 3300035117 | Bacteria | 3308 |
| 1203 | Ga0373953_0067837 | 3300035117 | Bacteria | 1468 |
| 1204 | Ga0373954_0010596 | 3300035118 | Bacteria | 4070 |
| 1205 | Ga0373954_0025613 | 3300035118 | Bacteria | 2698 |
| 1206 | Ga0373956_0004626 | 3300035119 | Bacteria | 5499 |
| 1207 | Ga0373957_0024247 | 3300035120 | Bacteria | 2177 |
| 1208 | Ga0373943_0008558 | 3300035170 | Bacteria | 4587 |
| 1209 | Ga0373943_0034893 | 3300035170 | Bacteria | 2401 |
| 1210 | Ga0373943_0038302 | 3300035170 | Bacteria | 2304 |
| 1211 | Ga0373946_0011410 | 3300035171 | Bacteria | 3315 |
| 1212 | Ga0373946_0032950 | 3300035171 | Bacteria | 2083 |
| 1213 | Ga0373946_0135530 | 3300035171 | Bacteria | 1137 |
| 1214 | Ga0373955_0111495 | 3300035172 | Bacteria | 1582 |
| 1215 | Ga0373924_0042033 | 3300035410 | Bacteria | 1874 |
| 1216 | Ga0373931_0004585 | 3300035691 | Bacteria | 6324 |
| 1217 | Ga0373931_0008340 | 3300035691 | Bacteria | 4908 |
| 1218 | Ga0373935_0069216 | 3300035692 | Bacteria | 2272 |
| 1219 | Ga0373935_0205764 | 3300035692 | Bacteria | 1362 |
| 1220 | Ga0373935_0363139 | 3300035692 | Bacteria | 1034 |
| 1221 | Ga0373927_0019638 | 3300035695 | Bacteria | 4430 |
| 1222 | Ga0373927_0057677 | 3300035695 | Bacteria | 2511 |
| 1223 | Ga0373927_0105906 | 3300035695 | Bacteria | 1831 |
| 1224 | Ga0373933_0022808 | 3300035724 | Bacteria | 3569 |
| 1225 | Ga0373933_0293637 | 3300035724 | Bacteria | 1051 |
| 1226 | Ga0373947_0010110 | 3300035725 | Bacteria | 5417 |
| 1227 | Ga0373947_0024048 | 3300035725 | Bacteria | 3547 |
| 1228 | Ga0373947_0549328 | 3300035725 | Bacteria | 786 |
| 1229 | Ga0373937_0001683 | 3300036401 | Bacteria | 18592 |
| 1230 | Ga0373937_0039849 | 3300036401 | Bacteria | 4281 |
| 1231 | Ga0373937_0242898 | 3300036401 | Bacteria | 1697 |
| 1232 | Ga0373937_0436245 | 3300036401 | Bacteria | 1243 |
| 1233 | Ga0373925_0124205 | 3300037068 | Bacteria | 2006 |
| 1234 | Ga0373925_0382290 | 3300037068 | Bacteria | 1146 |
| 1235 | Ga0395899_0009973 | 3300037312 | Bacteria | 7285 |
| 1236 | Ga0395899_0034497 | 3300037312 | Bacteria | 3800 |
| 1237 | Ga0395899_0288594 | 3300037312 | Bacteria | 1114 |
| 1238 | Ga0395900_0001667 | 3300037418 | Bacteria | 25970 |
| 1239 | Ga0395900_0048750 | 3300037418 | Bacteria | 4363 |
| 1240 | Ga0395900_0088562 | 3300037418 | Bacteria | 3182 |
| 1241 | Ga0395900_0097779 | 3300037418 | Bacteria | 3016 |
| 1242 | Ga0395900_0309033 | 3300037418 | Bacteria | 1564 |
| 1243 | Ga0395900_0411504 | 3300037418 | Bacteria | 1314 |
| 1244 | Ga0395898_0004523 | 3300037466 | Bacteria | 15190 |
| 1245 | Ga0395898_0116565 | 3300037466 | Bacteria | 2559 |
| 1246 | Ga0395898_0137478 | 3300037466 | Bacteria | 2339 |
| 1247 | Ga0395905_0000071 | 3300037471 | Bacteria | 174580 |
| 1248 | Ga0395905_0029519 | 3300037471 | Bacteria | 5166 |
| 1249 | Ga0395905_0033370 | 3300037471 | Bacteria | 4835 |
| 1250 | Ga0395905_0092936 | 3300037471 | Bacteria | 2829 |
| 1251 | Ga0436364_1275388 | 3300037853 | Bacteria | 2804 |
| 1252 | Ga0395901_0000095 | 3300038443 | Bacteria | 119290 |
| 1253 | Ga0395901_0036040 | 3300038443 | Bacteria | 5112 |
| 1254 | Ga0395901_0056760 | 3300038443 | Bacteria | 4073 |
| 1255 | Ga0395901_0060912 | 3300038443 | Bacteria | 3928 |
| 1256 | Ga0395901_0105442 | 3300038443 | Bacteria | 2958 |
| 1257 | Ga0395901_0179409 | 3300038443 | Bacteria | 2221 |
| 1258 | Ga0436365_0796717 | 3300039437 | Bacteria | 4335 |
| 1259 | Ga0436361_0107660 | 3300039447 | Bacteria | 63286 |
| 1260 | Ga0436361_0453531 | 3300039447 | Bacteria | 1496 |
| 1261 | Ga0436361_0487098 | 3300039447 | Bacteria | 4252 |
| 1262 | Ga0436361_0745691 | 3300039447 | Bacteria | 89622 |
| 1263 | Ga0436361_0805654 | 3300039447 | Bacteria | 2054 |
| 1264 | Ga0436361_1206467 | 3300039447 | Bacteria | 80244 |
| 1265 | Ga0439465_0019172 | 3300041413 | Bacteria | 2139 |
| 1266 | Ga0451798_0358443 | 3300041458 | Bacteria | 919 |
| 1267 | Ga0451807_1547476 | 3300041486 | Bacteria | 930 |
| 1268 | Ga0451853_2590518 | 3300041512 | Bacteria | 1538 |
| 1269 | Ga0439435_0066000 | 3300042436 | Bacteria | 1063 |
| 1270 | Ga0450893_0020799 | 3300042532 | Bacteria | 1130 |
| 1271 | Ga0451577_0005590 | 3300042876 | Bacteria | 12795 |
| 1272 | Ga0451577_0007354 | 3300042876 | Bacteria | 10826 |
| 1273 | Ga0451577_0008741 | 3300042876 | Bacteria | 9820 |
| 1274 | Ga0451577_0076280 | 3300042876 | Bacteria | 2989 |
| 1275 | Ga0451577_0140387 | 3300042876 | Bacteria | 2171 |
| 1276 | Ga0451577_0154158 | 3300042876 | Bacteria | 2067 |
| 1277 | Ga0466969_0001965 | 3300044656 | Bacteria | 10990 |
| 1278 | Ga0466972_0000084 | 3300044658 | Bacteria | 86336 |
| 1279 | Ga0466972_0005185 | 3300044658 | Bacteria | 6524 |
| 1280 | Ga0466982_0008424 | 3300044672 | Bacteria | 5185 |
| 1281 | Ga0466965_0004304 | 3300044683 | Bacteria | 6325 |
| 1282 | Ga0466965_0009948 | 3300044683 | Bacteria | 4425 |
| 1283 | Ga0466966_0000586 | 3300044684 | Bacteria | 23168 |
| 1284 | Ga0466966_0015399 | 3300044684 | Bacteria | 5056 |
| 1285 | Ga0466961_0001415 | 3300044693 | Bacteria | 14877 |
| 1286 | Ga0466961_0006560 | 3300044693 | Bacteria | 7395 |
| 1287 | Ga0466961_0123640 | 3300044693 | Bacteria | 1624 |
| 1288 | Ga0466963_0053293 | 3300044694 | Bacteria | 2686 |
| 1289 | Ga0466964_0012708 | 3300044706 | Bacteria | 3187 |
| 1290 | Ga0466964_0048842 | 3300044706 | Bacteria | 1731 |
| 1291 | Ga0466964_0072036 | 3300044706 | Bacteria | 1463 |
| 1292 | Ga0466964_0097806 | 3300044706 | Bacteria | 1288 |
| 1293 | Ga0453684_0038361 | 3300044712 | Bacteria | 6552 |
| 1294 | Ga0453684_0252699 | 3300044712 | Bacteria | 2024 |
| 1295 | Ga0453684_0324555 | 3300044712 | Bacteria | 1742 |
| 1296 | Ga0453684_0373913 | 3300044712 | Bacteria | 1601 |
| 1297 | Ga0453684_0552277 | 3300044712 | Bacteria | 1268 |
| 1298 | Ga0466971_0009896 | 3300044719 | Bacteria | 4164 |
| 1299 | Ga0466960_0118273 | 3300044901 | Bacteria | 1385 |
| 1300 | Ga0466960_0140072 | 3300044901 | Bacteria | 1284 |
| 1301 | Ga0466960_0237523 | 3300044901 | Bacteria | 1008 |
| 1302 | Ga0466959_0010505 | 3300045049 | Bacteria | 6621 |
| 1303 | Ga0466959_0033595 | 3300045049 | Bacteria | 3794 |
| 1304 | Ga0451576_0003357 | 3300045051 | Bacteria | 22176 |
| 1305 | Ga0451576_0015971 | 3300045051 | Bacteria | 8299 |
| 1306 | Ga0451576_0048382 | 3300045051 | Bacteria | 4467 |
| 1307 | Ga0466958_0143803 | 3300045836 | Bacteria | 1502 |
| 1308 | Ga0466958_0226025 | 3300045836 | Bacteria | 1195 |
| 1309 | Ga0466967_0010897 | 3300045976 | Bacteria | 6850 |
| 1310 | Ga0466967_0235320 | 3300045976 | Bacteria | 1745 |
| 1311 | Ga0466967_0464283 | 3300045976 | Bacteria | 1239 |
| 1312 | Ga0495592_0093928 | 3300046454 | Bacteria | 2147 |
| 1313 | Ga0495603_0011710 | 3300046455 | Bacteria | 5308 |
| 1314 | Ga0495590_0015933 | 3300046457 | Bacteria | 2718 |
| 1315 | Ga0495591_001235 | 3300046458 | Bacteria | 16515 |
| 1316 | Ga0495629_0011435 | 3300046459 | Bacteria | 6447 |
| 1317 | Ga0495629_0013424 | 3300046459 | Bacteria | 5909 |
| 1318 | Ga0495629_0025910 | 3300046459 | Bacteria | 4166 |
| 1319 | Ga0495651_0031194 | 3300046462 | Bacteria | 4157 |
| 1320 | Ga0495651_0077070 | 3300046462 | Bacteria | 2524 |
| 1321 | Ga0495651_0199113 | 3300046462 | Bacteria | 1403 |
| 1322 | Ga0495653_0035337 | 3300046463 | Bacteria | 3945 |
| 1323 | Ga0495653_0101167 | 3300046463 | Bacteria | 2088 |
| 1324 | Ga0495650_0003970 | 3300046471 | Bacteria | 10396 |
| 1325 | Ga0495650_0009757 | 3300046471 | Bacteria | 5433 |
| 1326 | Ga0495650_0104765 | 3300046471 | Bacteria | 1058 |
| 1327 | Ga0495580_0098520 | 3300046472 | Bacteria | 2033 |
| 1328 | Ga0495580_0128610 | 3300046472 | Bacteria | 1757 |
| 1329 | Ga0495580_0296523 | 3300046472 | Bacteria | 1101 |
| 1330 | Ga0495582_0009817 | 3300046473 | Bacteria | 5272 |
| 1331 | Ga0495639_0067302 | 3300046475 | Bacteria | 1649 |
| 1332 | Ga0495662_0036255 | 3300046476 | Bacteria | 2380 |
| 1333 | Ga0495662_0084613 | 3300046476 | Bacteria | 1544 |
| 1334 | Ga0495664_0037859 | 3300046477 | Bacteria | 2847 |
| 1335 | Ga0495664_0045779 | 3300046477 | Bacteria | 2595 |
| 1336 | Ga0495664_0059767 | 3300046477 | Bacteria | 2269 |
| 1337 | Ga0495585_0015782 | 3300046492 | Bacteria | 4386 |
| 1338 | Ga0495596_0010328 | 3300046500 | Bacteria | 4068 |
| 1339 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 1340 | Ga0495583_0003496 | 3300046506 | Bacteria | 11897 |
| 1341 | Ga0495606_0008997 | 3300046507 | Bacteria | 8542 |
| 1342 | Ga0495606_0009638 | 3300046507 | Bacteria | 8135 |
| 1343 | Ga0495606_0200061 | 3300046507 | Bacteria | 1139 |
| 1344 | Ga0495608_0020916 | 3300046511 | Bacteria | 4494 |
| 1345 | Ga0495610_0000624 | 3300046512 | Bacteria | 35024 |
| 1346 | Ga0495618_0005918 | 3300046514 | Bacteria | 7430 |
| 1347 | Ga0495618_0192781 | 3300046514 | Bacteria | 1292 |
| 1348 | Ga0495620_0002905 | 3300046515 | Bacteria | 9845 |
| 1349 | Ga0495628_0005536 | 3300046516 | Bacteria | 11055 |
| 1350 | Ga0495630_0024678 | 3300046517 | Bacteria | 4443 |
| 1351 | Ga0495630_0159312 | 3300046517 | Bacteria | 1718 |
| 1352 | Ga0495666_0004392 | 3300046526 | Bacteria | 7126 |
| 1353 | Ga0495642_0016251 | 3300046528 | Bacteria | 2899 |
| 1354 | Ga0495642_0025549 | 3300046528 | Bacteria | 2341 |
| 1355 | Ga0495652_0002282 | 3300046529 | Bacteria | 20011 |
| 1356 | Ga0495665_0018812 | 3300046531 | Bacteria | 3711 |
| 1357 | Ga0495665_0022165 | 3300046531 | Bacteria | 3415 |
| 1358 | Ga0495665_0115993 | 3300046531 | Bacteria | 1403 |
| 1359 | Ga0495640_0003666 | 3300046533 | Bacteria | 12347 |
| 1360 | Ga0495640_0036801 | 3300046533 | Bacteria | 3456 |
| 1361 | Ga0495586_0087879 | 3300046535 | Bacteria | 1714 |
| 1362 | Ga0495587_0079172 | 3300046536 | Bacteria | 1906 |
| 1363 | Ga0495587_0092093 | 3300046536 | Bacteria | 1750 |
| 1364 | Ga0495598_0092816 | 3300046537 | Bacteria | 987 |
| 1365 | Ga0495597_0001164 | 3300046542 | Bacteria | 19754 |
| 1366 | Ga0495645_0040975 | 3300046543 | Bacteria | 3377 |
| 1367 | Ga0495622_0000017 | 3300046557 | Bacteria | 176313 |
| 1368 | Ga0495622_0075510 | 3300046557 | Bacteria | 1553 |
| 1369 | Ga0495667_0080883 | 3300046559 | Bacteria | 2112 |
| 1370 | Ga0495668_0177672 | 3300046616 | Bacteria | 1166 |
| 1371 | Ga0495634_0070757 | 3300046642 | Bacteria | 2299 |
| 1372 | Ga0495625_0000720 | 3300046660 | Bacteria | 46548 |
| 1373 | Ga0495625_0002351 | 3300046660 | Bacteria | 20624 |
| 1374 | Ga0495625_0108423 | 3300046660 | Bacteria | 1900 |
| 1375 | Ga0495635_0020342 | 3300046663 | Bacteria | 4623 |
| 1376 | Ga0495635_0087455 | 3300046663 | Bacteria | 2132 |
| 1377 | Ga0495635_0405936 | 3300046663 | Bacteria | 904 |
| 1378 | Ga0495599_0118722 | 3300046678 | Bacteria | 1644 |
| 1379 | Ga0495599_0219791 | 3300046678 | Bacteria | 1163 |
| 1380 | Ga0495623_0001196 | 3300046679 | Bacteria | 17603 |
| 1381 | Ga0495623_0003843 | 3300046679 | Bacteria | 9901 |
| 1382 | Ga0495623_0016582 | 3300046679 | Bacteria | 4758 |
| 1383 | Ga0495646_0032940 | 3300046680 | Bacteria | 3222 |
| 1384 | Ga0495647_0010822 | 3300046681 | Bacteria | 3115 |
| 1385 | Ga0495658_0011509 | 3300046683 | Bacteria | 4452 |
| 1386 | Ga0495669_0006842 | 3300046684 | Bacteria | 4772 |
| 1387 | Ga0495669_0155922 | 3300046684 | Bacteria | 1082 |
| 1388 | Ga0495613_0061262 | 3300046689 | Bacteria | 2755 |
| 1389 | Ga0495613_0132585 | 3300046689 | Bacteria | 1783 |
| 1390 | Ga0495671_0028235 | 3300046692 | Bacteria | 2893 |
| 1391 | Ga0495671_0137725 | 3300046692 | Bacteria | 1190 |
| 1392 | Ga0495649_0001661 | 3300046694 | Bacteria | 16548 |
| 1393 | Ga0495649_0012734 | 3300046694 | Bacteria | 4880 |
| 1394 | Ga0495589_0024749 | 3300046794 | Bacteria | 3050 |
| 1395 | Ga0495600_0022736 | 3300046809 | Bacteria | 4029 |
| 1396 | Ga0495600_0028081 | 3300046809 | Bacteria | 3639 |
| 1397 | Ga0495600_0225339 | 3300046809 | Bacteria | 1198 |
| 1398 | Ga0495660_0079063 | 3300046810 | Bacteria | 1728 |
| 1399 | Ga0495581_0069288 | 3300047315 | Bacteria | 2039 |
| 1400 | Ga0495604_0029323 | 3300047317 | Bacteria | 4377 |
| 1401 | Ga0495604_0038276 | 3300047317 | Bacteria | 3773 |
| 1402 | Ga0495674_0004590 | 3300047319 | Bacteria | 13282 |
| 1403 | Ga0495674_0028010 | 3300047319 | Bacteria | 5143 |
| 1404 | Ga0495674_0121639 | 3300047319 | Bacteria | 2204 |
| 1405 | Ga0495672_0065420 | 3300047320 | Bacteria | 2078 |
| 1406 | Ga0495672_0215345 | 3300047320 | Bacteria | 951 |
| 1407 | Ga0495676_0008883 | 3300047321 | Bacteria | 9179 |
| 1408 | Ga0495680_0002429 | 3300047322 | Bacteria | 19072 |
| 1409 | Ga0495680_0108235 | 3300047322 | Bacteria | 2063 |
| 1410 | Ga0495680_0233566 | 3300047322 | Bacteria | 1308 |
| 1411 | Ga0495683_0010627 | 3300047323 | Bacteria | 4857 |
| 1412 | Ga0495683_0014936 | 3300047323 | Bacteria | 4044 |
| 1413 | Ga0495683_0050651 | 3300047323 | Bacteria | 2077 |
| 1414 | Ga0495683_0198432 | 3300047323 | Bacteria | 906 |
| 1415 | Ga0495687_000018 | 3300047443 | Bacteria | 342973 |
| 1416 | Ga0495687_016907 | 3300047443 | Bacteria | 3656 |
| 1417 | Ga0495687_017543 | 3300047443 | Bacteria | 3566 |
| 1418 | Ga0495675_0011625 | 3300047444 | Bacteria | 5527 |
| 1419 | Ga0495675_0022924 | 3300047444 | Bacteria | 3979 |
| 1420 | Ga0495675_0084521 | 3300047444 | Bacteria | 1996 |
| 1421 | Ga0495675_0149768 | 3300047444 | Bacteria | 1442 |
| 1422 | Ga0495679_001857 | 3300047446 | Bacteria | 11385 |
| 1423 | Ga0495673_0003863 | 3300047469 | Bacteria | 9660 |
| 1424 | Ga0495593_0031662 | 3300047673 | Bacteria | 2887 |
| 1425 | Ga0495593_0034509 | 3300047673 | Bacteria | 2751 |
| 1426 | Ga0495602_0004432 | 3300048088 | Bacteria | 14658 |
| 1427 | Ga0495602_0049627 | 3300048088 | Bacteria | 3756 |
| 1428 | Ga0495602_0475822 | 3300048088 | Bacteria | 877 |
| 1429 | Ga0495614_0003119 | 3300048089 | Bacteria | 7386 |
| 1430 | Ga0496100_0000932 | 3300048903 | Bacteria | 13978 |
| 1431 | Ga0496101_0035342 | 3300048904 | Bacteria | 3534 |
| 1432 | Ga0496101_0048175 | 3300048904 | Bacteria | 3062 |
| 1433 | Ga0496101_0076536 | 3300048904 | Bacteria | 2465 |
| 1434 | Ga0496101_0128333 | 3300048904 | Bacteria | 1923 |
| 1435 | Ga0496102_0005827 | 3300048905 | Bacteria | 10481 |
| 1436 | Ga0496102_0013163 | 3300048905 | Bacteria | 7157 |
| 1437 | Ga0496102_0029208 | 3300048905 | Bacteria | 4932 |
| 1438 | Ga0496102_0101051 | 3300048905 | Bacteria | 2679 |
| 1439 | Ga0496102_0128891 | 3300048905 | Bacteria | 2366 |
| 1440 | Ga0496102_0684922 | 3300048905 | Bacteria | 948 |
| 1441 | Ga0496103_0000360 | 3300048906 | Bacteria | 41308 |
| 1442 | Ga0496103_0017085 | 3300048906 | Bacteria | 4338 |
| 1443 | Ga0496103_0157698 | 3300048906 | Bacteria | 1455 |
| 1444 | Ga0496104_0008205 | 3300048907 | Bacteria | 9271 |
| 1445 | Ga0496104_0055939 | 3300048907 | Bacteria | 3730 |
| 1446 | Ga0496104_0107203 | 3300048907 | Bacteria | 2677 |
| 1447 | Ga0496104_0187626 | 3300048907 | Bacteria | 1978 |
| 1448 | Ga0496104_0295484 | 3300048907 | Bacteria | 1532 |
| 1449 | Ga0496105_0225702 | 3300048908 | Bacteria | 1523 |
| 1450 | Ga0496105_0236571 | 3300048908 | Bacteria | 1483 |
| 1451 | Ga0496105_0269350 | 3300048908 | Bacteria | 1376 |
| 1452 | Ga0496105_0522566 | 3300048908 | Bacteria | 929 |
| 1453 | Ga0496106_0002881 | 3300048909 | Bacteria | 12786 |
| 1454 | Ga0496106_0005706 | 3300048909 | Bacteria | 9208 |
| 1455 | Ga0496106_0037670 | 3300048909 | Bacteria | 3618 |
| 1456 | Ga0496106_0075317 | 3300048909 | Bacteria | 2585 |
| 1457 | Ga0496107_0021554 | 3300048910 | Bacteria | 4554 |
| 1458 | Ga0496107_0263252 | 3300048910 | Bacteria | 1283 |
| 1459 | Ga0496107_0626397 | 3300048910 | Bacteria | 794 |
| 1460 | Ga0496108_0002202 | 3300048911 | Bacteria | 15604 |
| 1461 | Ga0496108_0152356 | 3300048911 | Bacteria | 1995 |
| 1462 | Ga0496108_0202704 | 3300048911 | Bacteria | 1722 |
| 1463 | Ga0496109_0017843 | 3300048912 | Bacteria | 6226 |
| 1464 | Ga0496109_0042598 | 3300048912 | Bacteria | 4113 |
| 1465 | Ga0496109_0232224 | 3300048912 | Bacteria | 1736 |
| 1466 | Ga0496109_0334805 | 3300048912 | Bacteria | 1429 |
| 1467 | Ga0496109_0423774 | 3300048912 | Bacteria | 1257 |
| 1468 | Ga0496110_0026929 | 3300048913 | Bacteria | 4924 |
| 1469 | Ga0496110_0060777 | 3300048913 | Bacteria | 3333 |
| 1470 | Ga0496110_0237863 | 3300048913 | Bacteria | 1657 |
| 1471 | Ga0496110_0756156 | 3300048913 | Bacteria | 875 |
| 1472 | Ga0496111_0018131 | 3300048914 | Bacteria | 4873 |
| 1473 | Ga0496111_0179064 | 3300048914 | Bacteria | 1576 |
| 1474 | Ga0496111_0272509 | 3300048914 | Bacteria | 1255 |
| 1475 | Ga0496111_0312054 | 3300048914 | Bacteria | 1165 |
| 1476 | Ga0496111_0431633 | 3300048914 | Bacteria | 973 |
| 1477 | Ga0496112_0002417 | 3300048915 | Bacteria | 15038 |
| 1478 | Ga0496112_0007505 | 3300048915 | Bacteria | 9682 |
| 1479 | Ga0496112_0011630 | 3300048915 | Bacteria | 8049 |
| 1480 | Ga0496112_0021278 | 3300048915 | Bacteria | 6166 |
| 1481 | Ga0496112_0024005 | 3300048915 | Bacteria | 5834 |
| 1482 | Ga0496112_0807209 | 3300048915 | Bacteria | 863 |
| 1483 | Ga0496113_0003212 | 3300048916 | Bacteria | 9742 |
| 1484 | Ga0496113_0080747 | 3300048916 | Bacteria | 2491 |
| 1485 | Ga0496113_0635835 | 3300048916 | Bacteria | 854 |
| 1486 | Ga0496114_0032563 | 3300048917 | Bacteria | 4292 |
| 1487 | Ga0496114_0045449 | 3300048917 | Bacteria | 3648 |
| 1488 | Ga0496114_0159642 | 3300048917 | Bacteria | 1960 |
| 1489 | Ga0496114_0462092 | 3300048917 | Bacteria | 1124 |
| 1490 | Ga0496115_0267060 | 3300048918 | Bacteria | 1406 |
| 1491 | Ga0496115_0422515 | 3300048918 | Bacteria | 1080 |
| 1492 | Ga0496116_0001434 | 3300048919 | Bacteria | 26780 |
| 1493 | Ga0496116_0003129 | 3300048919 | Bacteria | 16611 |
| 1494 | Ga0496117_0002321 | 3300048920 | Bacteria | 24382 |
| 1495 | Ga0496117_0003647 | 3300048920 | Bacteria | 17731 |
| 1496 | Ga0496117_0015333 | 3300048920 | Bacteria | 6540 |
| 1497 | Ga0496117_0090755 | 3300048920 | Bacteria | 1967 |
| 1498 | Ga0496118_0000167 | 3300048921 | Bacteria | 119146 |
| 1499 | Ga0496118_0026815 | 3300048921 | Bacteria | 4896 |
| 1500 | Ga0496119_0067523 | 3300048922 | Bacteria | 2109 |
| 1501 | Ga0496120_0066373 | 3300048923 | Bacteria | 1996 |
| 1502 | Ga0496121_0002717 | 3300048924 | Bacteria | 26409 |
| 1503 | Ga0496121_0008605 | 3300048924 | Bacteria | 11948 |
| 1504 | Ga0496121_0035577 | 3300048924 | Bacteria | 4460 |
| 1505 | Ga0496121_0187320 | 3300048924 | Bacteria | 1487 |
| 1506 | Ga0496122_0001194 | 3300048925 | Bacteria | 44317 |
| 1507 | Ga0496122_0006237 | 3300048925 | Bacteria | 13796 |
| 1508 | Ga0496122_0209967 | 3300048925 | Bacteria | 1129 |
| 1509 | Ga0496123_0000532 | 3300048926 | Bacteria | 65557 |
| 1510 | Ga0496123_0006105 | 3300048926 | Bacteria | 11810 |
| 1511 | Ga0496123_0178168 | 3300048926 | Bacteria | 1113 |
| 1512 | Ga0496124_0010208 | 3300048927 | Bacteria | 9542 |
| 1513 | Ga0496124_0263491 | 3300048927 | Bacteria | 1267 |
| 1514 | Ga0496125_0002955 | 3300048928 | Bacteria | 21369 |
| 1515 | Ga0496125_0007063 | 3300048928 | Bacteria | 11996 |
| 1516 | Ga0496125_0069394 | 3300048928 | Bacteria | 2766 |
| 1517 | Ga0496126_0000031 | 3300048929 | Bacteria | 373371 |
| 1518 | Ga0496126_0223632 | 3300048929 | Bacteria | 1580 |
| 1519 | Ga0496126_0238121 | 3300048929 | Bacteria | 1522 |
| 1520 | Ga0495682_0048755 | 3300049460 | Bacteria | 1543 |
| 1521 | Ga0501032_0006231 | 3300049569 | Bacteria | 8778 |
| 1522 | Ga0501033_0003584 | 3300049570 | Bacteria | 12688 |
| 1523 | Ga0501033_0028951 | 3300049570 | Bacteria | 4162 |
| 1524 | Ga0501034_0001085 | 3300049571 | Bacteria | 38426 |
| 1525 | Ga0501034_0006814 | 3300049571 | Bacteria | 12219 |
| 1526 | Ga0501034_0023666 | 3300049571 | Bacteria | 6256 |
| 1527 | Ga0501034_0031655 | 3300049571 | Bacteria | 5373 |
| 1528 | Ga0501034_0141472 | 3300049571 | Bacteria | 2385 |
| 1529 | Ga0501036_0001771 | 3300049572 | Bacteria | 16761 |
| 1530 | Ga0501037_0004252 | 3300049573 | Bacteria | 10376 |
| 1531 | Ga0501037_0089918 | 3300049573 | Bacteria | 2221 |
| 1532 | Ga0501037_0246304 | 3300049573 | Bacteria | 1252 |
| 1533 | Ga0501038_0000494 | 3300049574 | Bacteria | 34711 |
| 1534 | Ga0501038_0509482 | 3300049574 | Bacteria | 919 |
| 1535 | Ga0501039_0392240 | 3300049575 | Bacteria | 1090 |
| 1536 | Ga0501040_0191592 | 3300049576 | Bacteria | 1451 |
| 1537 | Ga0501042_0095808 | 3300049578 | Bacteria | 2132 |
| 1538 | Ga0501042_0120643 | 3300049578 | Bacteria | 1888 |
| 1539 | Ga0501042_0230434 | 3300049578 | Bacteria | 1336 |
| 1540 | Ga0501043_0001194 | 3300049579 | Bacteria | 22852 |
| 1541 | Ga0501043_0100387 | 3300049579 | Bacteria | 2275 |
| 1542 | Ga0501046_0002440 | 3300049580 | Bacteria | 17427 |
| 1543 | Ga0501047_0004711 | 3300049581 | Bacteria | 12827 |
| 1544 | Ga0501047_0020936 | 3300049581 | Bacteria | 6282 |
| 1545 | Ga0501048_0088518 | 3300049582 | Bacteria | 2184 |
| 1546 | Ga0501048_0307881 | 3300049582 | Bacteria | 1127 |
| 1547 | Ga0501067_0015301 | 3300049583 | Bacteria | 4245 |
| 1548 | Ga0501067_0178771 | 3300049583 | Bacteria | 1182 |
| 1549 | Ga0501068_0000813 | 3300049584 | Bacteria | 16219 |
| 1550 | Ga0501068_0370192 | 3300049584 | Bacteria | 922 |
| 1551 | Ga0501071_0151491 | 3300049587 | Bacteria | 1730 |
| 1552 | Ga0501072_0031458 | 3300049588 | Bacteria | 4154 |
| 1553 | Ga0501072_0190902 | 3300049588 | Bacteria | 1634 |
| 1554 | Ga0501073_0001692 | 3300049589 | Bacteria | 16336 |
| 1555 | Ga0501073_0007913 | 3300049589 | Bacteria | 7886 |
| 1556 | Ga0501074_0070330 | 3300049590 | Bacteria | 2516 |
| 1557 | Ga0501074_0114150 | 3300049590 | Bacteria | 1932 |
| 1558 | Ga0501074_0235881 | 3300049590 | Bacteria | 1302 |
| 1559 | Ga0501076_0013746 | 3300049592 | Bacteria | 6074 |
| 1560 | Ga0501076_0363433 | 3300049592 | Bacteria | 1189 |
| 1561 | Ga0501079_0054792 | 3300049741 | Bacteria | 3076 |
| 1562 | Ga0501080_0000614 | 3300049742 | Bacteria | 28250 |
| 1563 | Ga0501080_0001764 | 3300049742 | Bacteria | 18566 |
| 1564 | Ga0501080_0026131 | 3300049742 | Bacteria | 5424 |
| 1565 | Ga0501080_0093075 | 3300049742 | Bacteria | 2799 |
| 1566 | Ga0501081_0002070 | 3300049743 | Bacteria | 12509 |
| 1567 | Ga0501083_0016784 | 3300049744 | Bacteria | 5114 |
| 1568 | Ga0501083_0026400 | 3300049744 | Bacteria | 4014 |
| 1569 | Ga0501083_0044081 | 3300049744 | Bacteria | 3020 |
| 1570 | Ga0501035_0034907 | 3300049822 | Bacteria | 4568 |
| 1571 | Ga0501035_0082472 | 3300049822 | Bacteria | 2837 |
| 1572 | Ga0501035_0137165 | 3300049822 | Bacteria | 2129 |
| 1573 | Ga0501035_0294525 | 3300049822 | Bacteria | 1369 |
| 1574 | Ga0501044_0000236 | 3300049823 | Bacteria | 69634 |
| 1575 | Ga0501044_0012609 | 3300049823 | Bacteria | 9154 |
| 1576 | nmdc:mga03683_22708_c1 | 3300050489 | Bacteria | 2434 |
| 1577 | nmdc:mga03683_245360_c1 | 3300050489 | Bacteria | 831 |
| 1578 | nmdc:mga00v17_14882_c1 | 3300050491 | Bacteria | 4352 |
| 1579 | nmdc:mga00v17_46477_c1 | 3300050491 | Bacteria | 2626 |
| 1580 | nmdc:mga0yw44_26020_c1 | 3300050492 | Bacteria | 3337 |
| 1581 | nmdc:mga0yw44_80260_c1 | 3300050492 | Bacteria | 2043 |
| 1582 | nmdc:mga0k408_16840_c1 | 3300050493 | Bacteria | 4063 |
| 1583 | nmdc:mga0k408_21004_c2 | 3300050493 | Bacteria | 2525 |
| 1584 | nmdc:mga0k408_96283_c1 | 3300050493 | Bacteria | 1742 |
| 1585 | nmdc:mga07m45_19107_c2 | 3300050496 | Bacteria | 2846 |
| 1586 | nmdc:mga07m45_51636_c1 | 3300050496 | Bacteria | 2319 |
| 1587 | nmdc:mga05p37_42889_c1 | 3300050507 | Bacteria | 5561 |
| 1588 | nmdc:mga05p37_807231_c1 | 3300050507 | Bacteria | 1025 |
| 1589 | nmdc:mga09592_16785_c1 | 3300050508 | Bacteria | 5993 |
| 1590 | nmdc:mga09592_254596_c1 | 3300050508 | Bacteria | 1522 |
| 1591 | nmdc:mga09592_59925_c1 | 3300050508 | Bacteria | 3218 |
| 1592 | nmdc:mga0qj67_23454_c1 | 3300050509 | Bacteria | 4748 |
| 1593 | nmdc:mga0qj67_381204_c1 | 3300050509 | Bacteria | 1139 |
| 1594 | nmdc:mga06r32_60240_c1 | 3300050510 | Bacteria | 3653 |
| 1595 | nmdc:mga08y16_140934_c1 | 3300050511 | Bacteria | 2507 |
| 1596 | nmdc:mga08y16_189783_c1 | 3300050511 | Bacteria | 2132 |
| 1597 | nmdc:mga08y16_26937_c1 | 3300050511 | Bacteria | 6058 |
| 1598 | nmdc:mga08y16_456734_c1 | 3300050511 | Bacteria | 1302 |
| 1599 | nmdc:mga08y16_965338_c1 | 3300050511 | Bacteria | 834 |
| 1600 | nmdc:mga0n895_401234_c1 | 3300050512 | Bacteria | 1387 |
| 1601 | nmdc:mga0n895_4460_c1 | 3300050512 | Bacteria | 11501 |
| 1602 | nmdc:mga0n895_45248_c1 | 3300050512 | Bacteria | 4294 |
| 1603 | nmdc:mga0rr50_16136_c1 | 3300050513 | Bacteria | 4950 |
| 1604 | nmdc:mga0rr50_304249_c1 | 3300050513 | Bacteria | 1334 |
| 1605 | nmdc:mga0rr50_398644_c1 | 3300050513 | Bacteria | 1162 |
| 1606 | nmdc:mga08x19_46547_c1 | 3300050514 | Bacteria | 2774 |
| 1607 | nmdc:mga0a205_8120_c1 | 3300050515 | Bacteria | 9537 |
| 1608 | Ga0495612_0080658 | 3300053078 | Bacteria | 1367 |
| 1609 | Ga0500635_0000440 | 3300053080 | Bacteria | 12001 |
| 1610 | Ga0495595_0091601 | 3300053084 | Bacteria | 1459 |
| 1611 | Ga0495619_0026499 | 3300053085 | Bacteria | 3729 |
| 1612 | Ga0500644_0011531 | 3300053088 | Bacteria | 2417 |
| 1613 | Ga0500566_0149636 | 3300053094 | Bacteria | 1229 |
| 1614 | Ga0500566_0183242 | 3300053094 | Bacteria | 1072 |
| 1615 | Ga0500593_000087 | 3300053117 | Bacteria | 33673 |
| 1616 | Ga0500595_014220 | 3300053119 | Bacteria | 3025 |
| 1617 | Ga0500655_035102 | 3300053133 | Bacteria | 974 |
| 1618 | Ga0500658_0049219 | 3300053134 | Bacteria | 1717 |
| 1619 | Ga0500604_0000278 | 3300053151 | Bacteria | 14267 |
| 1620 | Ga0500616_0000520 | 3300053153 | Bacteria | 48822 |
| 1621 | Ga0500616_0007851 | 3300053153 | Bacteria | 6715 |
| 1622 | Ga0500627_0009870 | 3300053158 | Bacteria | 3458 |
| 1623 | Ga0500627_0192198 | 3300053158 | Bacteria | 916 |
| 1624 | Ga0500638_138050 | 3300053162 | Bacteria | 1098 |
| 1625 | Ga0500645_000100 | 3300053730 | Bacteria | 68299 |
| 1626 | Ga0500645_002016 | 3300053730 | Bacteria | 9498 |
| 1627 | Ga0500609_002189 | 3300053731 | Bacteria | 2791 |
| 1628 | Ga0501084_0385692 | 3300054114 | Bacteria | 1184 |
| 1629 | Ga0500661_001464 | 3300055283 | Bacteria | 4430 |
| 1630 | Ga0587077_008909 | 3300059493 | Bacteria | 1508 |
| 1631 | Ga0587086_005942 | 3300059507 | Bacteria | 1342 |
| 1632 | Ga0587088_006045 | 3300059508 | Bacteria | 1616 |
| 1633 | Ga0587092_036494 | 3300059512 | Bacteria | 837 |
| 1634 | Ga0587094_016727 | 3300059513 | Bacteria | 1025 |
| 1635 | Ga0587117_016677 | 3300059627 | Bacteria | 980 |
| 1636 | Ga0587068_003730 | 3300059641 | Bacteria | 1971 |
| 1637 | Ga0587072_016692 | 3300059643 | Bacteria | 1259 |
| 1638 | Ga0587075_021123 | 3300059644 | Bacteria | 968 |
| 1639 | Ga0587076_000599 | 3300059645 | Bacteria | 3090 |
| 1640 | Ga0587078_000752 | 3300059646 | Bacteria | 2625 |
| 1641 | Ga0587078_016808 | 3300059646 | Bacteria | 894 |
| 1642 | Ga0587100_001375 | 3300059648 | Bacteria | 1412 |
| 1643 | Ga0587102_000802 | 3300059649 | Bacteria | 1969 |
| 1644 | Ga0587071_008180 | 3300060344 | Bacteria | 1689 |
| 1645 | Ga0587111_0000638 | 3300060346 | Bacteria | 3564 |
| 1646 | Ga0587111_0001949 | 3300060346 | Bacteria | 2638 |
| 1647 | Ga0530510_0126595 | 3300061734 | Bacteria | 1878 |
| 1648 | 2509126550 | 2508501125 | Bacteria | 7208311 |
| 1649 | 2511245773 | 2511231002 | Bacteria | 5042903 |
| 1650 | 2512929184 | 2512875016 | Bacteria | 6529530 |
| 1651 | 2563065098 | 2562617112 | Bacteria | 10918404 |
| 1652 | 2588514463 | 2588253730 | Bacteria | 6881675 |
| 1653 | 2644028937 | 2643221603 | Bacteria | 6147767 |
| 1654 | 2713481915 | 2711768613 | Bacteria | 11048459 |
| 1655 | 2738821071 | 2738541296 | Bacteria | 7285013 |
| 1656 | 2738833553 | 2738541298 | Bacteria | 7286732 |
| 1657 | 2738876960 | 2738541306 | Bacteria | 7284992 |
| 1658 | 2739055841 | 2738541337 | Bacteria | 6183410 |
| 1659 | 2739186709 | 2738543002 | Bacteria | 7284546 |
| 1660 | 2739223553 | 2738543008 | Bacteria | 7282815 |
| 1661 | 2819595283 | 2818991445 | Bacteria | 4955017 |
| 1662 | 2857366159 | 2857357740 | Bacteria | 9937880 |
| 1663 | 2876367258 | 2876363079 | Bacteria | 6544991 |
| 1664 | 2884812645 | 2884811622 | Bacteria | 5552861 |
| 1665 | 2884841125 | 2884836552 | Bacteria | 5219991 |
| 1666 | 2884856000 | 2884852848 | Bacteria | 5221161 |
| 1667 | 2896157075 | 2896154374 | Bacteria | 5221518 |
| 1668 | 2903453272 | 2903448605 | Bacteria | 7357801 |
| 1669 | 2903526749 | 2903521522 | Bacteria | 6525694 |
| 1670 | 2903530632 | 2903528002 | Bacteria | 6586099 |
| 1671 | 2919704873 | 2919704043 | Bacteria | 5560311 |
| 1672 | 2921655269 | 2921643360 | Bacteria | 11448031 |
| 1673 | 2937850916 | 2937848649 | Bacteria | 6983481 |
| 1674 | 2945939366 | 2945934425 | Bacteria | 7444609 |
| 1675 | 2963650051 | 2963644680 | Bacteria | 6530403 |
| 1676 | 2968086638 | 2968083720 | Bacteria | 7351627 |
| 1677 | 2977923891 | 2977922695 | Bacteria | 6956781 |
| 1678 | 2990706709 | 2990703756 | Bacteria | 7715990 |
| 1679 | 3004213329 | 3004211236 | Bacteria | 7417683 |
| 1680 | 3004221402 | 3004218560 | Bacteria | 7421728 |
| 1681 | 3004334607 | 3004334049 | Bacteria | 8449246 |
| 1682 | 637078942 | 637000159 | Bacteria | 7596297 |
| 1683 | 642424633 | 641736151 | Bacteria | 7477263 |
| 1684 | 642620539 | 642555113 | Bacteria | 8214658 |
| 1685 | Ga0207690_10430213 | |||
| 1686 | JGI24740J21852_10001143 | |||
| 1687 | JGI24740J21852_10010597 | |||
| 1688 | JGI24739J22299_10009570 | |||
| 1689 | JGI24748J21848_1020814 | |||
| 1690 | JGI24738J21930_10000443 | |||
| 1691 | JGI25155J39150_1000366 | |||
| 1692 | JGI25156J39149_1000649 | |||
| 1693 | JGI25156J39149_1000693 | |||
| 1694 | JGI25156J39149_1001347 | |||
| 1695 | JGI25156J39149_1007814 | |||
| 1696 | JGI25154J39366_1000534 | |||
| 1697 | JGI25154J39366_1001866 | |||
| 1698 | JGI25157J39369_1000566 | |||
| 1699 | JGI25157J39369_1000665 | |||
| 1700 | JGI25164J39214_1006209 | |||
| 1701 | JGI25150J39212_1007383 | |||
| 1702 | JGI25159J45721_1000689 | |||
| 1703 | JGI25159J45721_1016659 | |||
| 1704 | JGI25151J46595_10001030 | |||
| 1705 | JGI25151J46595_10014571 | |||
| 1706 | rootH1_10010127 | |||
| 1707 | rootL2_10062439 | |||
| 1708 | rootL2_10086809 | |||
| 1709 | rootH1_10005148 | |||
| 1710 | JGI25160J50197_1000305 | |||
| 1711 | JGI25161J50226_1000018 | |||
| 1712 | Ga0055539_1001771 | |||
| 1713 | Ga0055532_1000453 | |||
| 1714 | Ga0055525_1000004 | |||
| 1715 | Ga0055535_1008682 | |||
| 1716 | Ga0055542_1001255 | |||
| 1717 | Ga0055529_1000806 | |||
| 1718 | Ga0055537_1000008 | |||
| 1719 | Ga0055537_1016554 | |||
| 1720 | Ga0055524_1000083 | |||
| 1721 | Ga0055534_1001337 | |||
| 1722 | Ga0055528_1000652 | |||
| 1723 | Ga0055530_10000211 | |||
| 1724 | Ga0055540_1000012 | |||
| 1725 | Ga0055540_1014922 | |||
| 1726 | Ga0055531_10000181 | |||
| 1727 | Ga0055531_10004842 | |||
| 1728 | Ga0055531_10013006 | |||
| 1729 | Ga0055543_1000418 | |||
| 1730 | Ga0065165_1002315 | |||
| 1731 | Ga0065165_1004913 | |||
| 1732 | Ga0065712_10020755 | |||
| 1733 | Ga0065712_10133994 | |||
| 1734 | Ga0065715_10136268 | |||
| 1735 | Ga0065715_10159109 | |||
| 1736 | Ga0065715_10161730 | |||
| 1737 | Ga0065715_10173334 | |||
| 1738 | Ga0065715_10236508 | |||
| 1739 | Ga0065715_10282474 | |||
| 1740 | Ga0065707_10207925 | |||
| 1741 | Ga0065707_10324178 | |||
| 1742 | Ga0070658_10031442 | |||
| 1743 | Ga0070658_10054387 | |||
| 1744 | Ga0070658_10136621 | |||
| 1745 | Ga0070658_10141460 | |||
| 1746 | Ga0070658_10214779 | |||
| 1747 | Ga0070676_10003185 | |||
| 1748 | Ga0070676_10011669 | |||
| 1749 | Ga0070676_10060407 | |||
| 1750 | Ga0070676_10423806 | |||
| 1751 | Ga0070683_100015001 | |||
| 1752 | Ga0070683_100024314 | |||
| 1753 | Ga0070683_100061006 | |||
| 1754 | Ga0070690_100000658 | |||
| 1755 | Ga0070690_100001010 | |||
| 1756 | Ga0070690_100199390 | |||
| 1757 | Ga0070670_100002859 | |||
| 1758 | Ga0070670_100011705 | |||
| 1759 | Ga0070670_100012920 | |||
| 1760 | Ga0070670_100025473 | |||
| 1761 | Ga0070670_100048045 | |||
| 1762 | Ga0070670_100061382 | |||
| 1763 | Ga0070670_100111928 | |||
| 1764 | Ga0070670_100158846 | |||
| 1765 | Ga0070677_10000636 | |||
| 1766 | Ga0070677_10060316 | |||
| 1767 | Ga0068869_100000751 | |||
| 1768 | Ga0068869_100004117 | |||
| 1769 | Ga0068869_100037455 | |||
| 1770 | Ga0068869_100091480 | |||
| 1771 | Ga0070666_10001025 | |||
| 1772 | Ga0070666_10001481 | |||
| 1773 | Ga0070666_10017038 | |||
| 1774 | Ga0070666_10095964 | |||
| 1775 | Ga0070666_10271727 | |||
| 1776 | Ga0070680_100076067 | |||
| 1777 | Ga0070680_100085318 | |||
| 1778 | Ga0070680_100189634 | |||
| 1779 | Ga0070682_100151070 | |||
| 1780 | Ga0068868_100007511 | |||
| 1781 | Ga0068868_100008375 | |||
| 1782 | Ga0068868_100062121 | |||
| 1783 | Ga0068868_100108488 | |||
| 1784 | Ga0068868_100176122 | |||
| 1785 | Ga0068868_100239544 | |||
| 1786 | Ga0070660_100028688 | |||
| 1787 | Ga0070660_100039542 | |||
| 1788 | Ga0070660_100051494 | |||
| 1789 | Ga0070660_100243343 | |||
| 1790 | Ga0070660_100321432 | |||
| 1791 | Ga0070660_100703085 | |||
| 1792 | Ga0070689_100040979 | |||
| 1793 | Ga0070689_100079947 | |||
| 1794 | Ga0070689_100110933 | |||
| 1795 | Ga0070689_100286962 | |||
| 1796 | Ga0070687_100050151 | |||
| 1797 | Ga0070687_100255918 | |||
| 1798 | Ga0070661_100007597 | |||
| 1799 | Ga0070661_100010061 | |||
| 1800 | Ga0070661_100021144 | |||
| 1801 | Ga0070661_100029562 | |||
| 1802 | Ga0070661_100041032 | |||
| 1803 | Ga0070661_100070345 | |||
| 1804 | Ga0070661_100097608 | |||
| 1805 | Ga0070661_100237008 | |||
| 1806 | Ga0070661_100374968 | |||
| 1807 | Ga0070692_10005718 | |||
| 1808 | Ga0070692_10038658 | |||
| 1809 | Ga0070668_100001025 | |||
| 1810 | Ga0070668_100002685 | |||
| 1811 | Ga0070668_100003032 | |||
| 1812 | Ga0070668_100003427 | |||
| 1813 | Ga0070668_100005260 | |||
| 1814 | Ga0070668_100019396 | |||
| 1815 | Ga0070668_100082717 | |||
| 1816 | Ga0070668_100123554 | |||
| 1817 | Ga0070668_100146879 | |||
| 1818 | Ga0070668_100264040 | |||
| 1819 | Ga0070668_100324228 | |||
| 1820 | Ga0070669_100001889 | |||
| 1821 | Ga0070669_100015790 | |||
| 1822 | Ga0070669_100065004 | |||
| 1823 | Ga0070669_100105418 | |||
| 1824 | Ga0070675_100004878 | |||
| 1825 | Ga0070675_100006068 | |||
| 1826 | Ga0070675_100012545 | |||
| 1827 | Ga0070675_100015597 | |||
| 1828 | Ga0070675_100049855 | |||
| 1829 | Ga0070675_100542111 | |||
| 1830 | Ga0070671_100007740 | |||
| 1831 | Ga0070671_100008568 | |||
| 1832 | Ga0070671_100008695 | |||
| 1833 | Ga0070671_100021169 | |||
| 1834 | Ga0070671_100048504 | |||
| 1835 | Ga0070671_100106418 | |||
| 1836 | Ga0070671_100118613 | |||
| 1837 | Ga0070671_100172511 | |||
| 1838 | Ga0070674_100000692 | |||
| 1839 | Ga0070674_100020957 | |||
| 1840 | Ga0070674_100095654 | |||
| 1841 | Ga0070674_100144238 | |||
| 1842 | Ga0070674_100172176 | |||
| 1843 | Ga0070674_100234743 | |||
| 1844 | Ga0070674_100656702 | |||
| 1845 | Ga0070673_100000093 | |||
| 1846 | Ga0070673_100006849 | |||
| 1847 | Ga0070673_100035677 | |||
| 1848 | Ga0070673_100037281 | |||
| 1849 | Ga0070673_100104922 | |||
| 1850 | Ga0070673_100117265 | |||
| 1851 | Ga0070673_100385301 | |||
| 1852 | Ga0070688_100000489 | |||
| 1853 | Ga0070688_100015178 | |||
| 1854 | Ga0070688_100048466 | |||
| 1855 | Ga0070659_100025885 | |||
| 1856 | Ga0070659_100045936 | |||
| 1857 | Ga0070659_100097304 | |||
| 1858 | Ga0070659_100097699 | |||
| 1859 | Ga0070659_100107236 | |||
| 1860 | Ga0070659_100227542 | |||
| 1861 | Ga0070659_100243677 | |||
| 1862 | Ga0070659_100246176 | |||
| 1863 | Ga0070667_100025931 | |||
| 1864 | Ga0070667_100038812 | |||
| 1865 | Ga0070667_100042408 | |||
| 1866 | Ga0070667_100107435 | |||
| 1867 | Ga0070667_100113340 | |||
| 1868 | Ga0070667_100128822 | |||
| 1869 | Ga0070667_100243386 | |||
| 1870 | Ga0070667_100354586 | |||
| 1871 | Ga0070709_10001884 | |||
| 1872 | Ga0070709_10430527 | |||
| 1873 | Ga0070709_10514817 | |||
| 1874 | Ga0070709_10654168 | |||
| 1875 | Ga0070714_100054946 | |||
| 1876 | Ga0070714_100208731 | |||
| 1877 | Ga0070714_100223740 | |||
| 1878 | Ga0070714_100574091 | |||
| 1879 | Ga0070713_100000090 | |||
| 1880 | Ga0070713_100000232 | |||
| 1881 | Ga0070713_100074644 | |||
| 1882 | Ga0070713_100135900 | |||
| 1883 | Ga0070710_10006281 | |||
| 1884 | Ga0070710_10008791 | |||
| 1885 | Ga0070701_10006039 | |||
| 1886 | Ga0070701_10361097 | |||
| 1887 | Ga0070711_100001221 | |||
| 1888 | Ga0070711_100046861 | |||
| 1889 | Ga0070711_100078585 | |||
| 1890 | Ga0070711_100153118 | |||
| 1891 | Ga0070705_100209676 | |||
| 1892 | Ga0070700_100000303 | |||
| 1893 | Ga0070700_100064955 | |||
| 1894 | Ga0070694_100047176 | |||
| 1895 | Ga0070694_100153287 | |||
| 1896 | Ga0070708_100018603 | |||
| 1897 | Ga0070708_100314955 | |||
| 1898 | Ga0070663_100004067 | |||
| 1899 | Ga0070663_100004262 | |||
| 1900 | Ga0070663_100030299 | |||
| 1901 | Ga0070663_100113582 | |||
| 1902 | Ga0070663_100627904 | |||
| 1903 | Ga0070678_100000443 | |||
| 1904 | Ga0070678_100020775 | |||
| 1905 | Ga0070678_100037888 | |||
| 1906 | Ga0070678_100040788 | |||
| 1907 | Ga0070678_100144929 | |||
| 1908 | Ga0070678_100296457 | |||
| 1909 | Ga0070662_100001239 | |||
| 1910 | Ga0070662_100320583 | |||
| 1911 | Ga0070681_10018539 | |||
| 1912 | Ga0070681_10020974 | |||
| 1913 | Ga0070681_10068268 | |||
| 1914 | Ga0070681_10121863 | |||
| 1915 | Ga0070681_10179611 | |||
| 1916 | Ga0070681_10318999 | |||
| 1917 | Ga0070681_10472338 | |||
| 1918 | Ga0068867_100003718 | |||
| 1919 | Ga0068867_100012127 | |||
| 1920 | Ga0068867_100063788 | |||
| 1921 | Ga0068867_100081929 | |||
| 1922 | Ga0068867_100088186 | |||
| 1923 | Ga0068867_100104340 | |||
| 1924 | Ga0068867_100311605 | |||
| 1925 | Ga0068867_100692307 | |||
| 1926 | Ga0070685_10017407 | |||
| 1927 | Ga0070685_10044934 | |||
| 1928 | Ga0070707_100012578 | |||
| 1929 | Ga0070707_100036043 | |||
| 1930 | Ga0070698_100006372 | |||
| 1931 | Ga0070699_100014042 | |||
| 1932 | Ga0070699_100015841 | |||
| 1933 | Ga0070699_100031664 | |||
| 1934 | Ga0070679_100014667 | |||
| 1935 | Ga0070679_100016933 | |||
| 1936 | Ga0070679_100034615 | |||
| 1937 | Ga0070679_100054314 | |||
| 1938 | Ga0070679_100069820 | |||
| 1939 | Ga0070679_100083680 | |||
| 1940 | Ga0070679_100094597 | |||
| 1941 | Ga0070679_100291703 | |||
| 1942 | Ga0070684_100040489 | |||
| 1943 | Ga0070684_100128155 | |||
| 1944 | Ga0070684_100238681 | |||
| 1945 | Ga0070684_100266198 | |||
| 1946 | Ga0068853_100006808 | |||
| 1947 | Ga0068853_100012679 | |||
| 1948 | Ga0068853_100023777 | |||
| 1949 | Ga0068853_100065974 | |||
| 1950 | Ga0068853_100068629 | |||
| 1951 | Ga0068853_100114281 | |||
| 1952 | Ga0068853_100169928 | |||
| 1953 | Ga0068853_100192279 | |||
| 1954 | Ga0070672_100008459 | |||
| 1955 | Ga0070672_100012894 | |||
| 1956 | Ga0070672_100023150 | |||
| 1957 | Ga0070672_100044451 | |||
| 1958 | Ga0070672_100048369 | |||
| 1959 | Ga0070672_100118482 | |||
| 1960 | Ga0070672_100139581 | |||
| 1961 | Ga0070672_100199153 | |||
| 1962 | Ga0070672_100483261 | |||
| 1963 | Ga0070672_100500838 | |||
| 1964 | Ga0070686_100000467 | |||
| 1965 | Ga0070686_100020587 | |||
| 1966 | Ga0070686_100041405 | |||
| 1967 | Ga0070695_100010817 | |||
| 1968 | Ga0070695_100114746 | |||
| 1969 | Ga0070695_100168682 | |||
| 1970 | Ga0070696_100005244 | |||
| 1971 | Ga0070696_100031225 | |||
| 1972 | Ga0070696_100052416 | |||
| 1973 | Ga0070696_100177991 | |||
| 1974 | Ga0070693_100003921 | |||
| 1975 | Ga0070693_100056503 | |||
| 1976 | Ga0070693_100110896 | |||
| 1977 | Ga0070693_100178663 | |||
| 1978 | Ga0070693_100248092 | |||
| 1979 | Ga0070665_100004030 | |||
| 1980 | Ga0070665_100008150 | |||
| 1981 | Ga0070665_100019341 | |||
| 1982 | Ga0070665_100020459 | |||
| 1983 | Ga0070665_100094903 | |||
| 1984 | Ga0070665_100207987 | |||
| 1985 | Ga0070665_100231823 | |||
| 1986 | Ga0070704_100027154 | |||
| 1987 | Ga0070704_100036676 | |||
| 1988 | Ga0070704_100108747 | |||
| 1989 | Ga0070704_100148002 | |||
| 1990 | Ga0070704_100748199 | |||
| 1991 | Ga0068855_100002732 | |||
| 1992 | Ga0068855_100006426 | |||
| 1993 | Ga0068855_100011358 | |||
| 1994 | Ga0068855_100037906 | |||
| 1995 | Ga0068855_100041199 | |||
| 1996 | Ga0068855_100073548 | |||
| 1997 | Ga0068855_100110829 | |||
| 1998 | Ga0068855_100225491 | |||
| 1999 | Ga0068855_100258827 | |||
| 2000 | Ga0068855_100386964 | |||
| 2001 | Ga0068855_100488557 | |||
| 2002 | Ga0068855_100642241 | |||
| 2003 | Ga0070664_100000511 | |||
| 2004 | Ga0070664_100004503 | |||
| 2005 | Ga0070664_100005335 | |||
| 2006 | Ga0070664_100060960 | |||
| 2007 | Ga0070664_100246528 | |||
| 2008 | Ga0070664_100448929 | |||
| 2009 | Ga0068857_100034228 | |||
| 2010 | Ga0068857_100087269 | |||
| 2011 | Ga0068857_100096956 | |||
| 2012 | Ga0068857_100112499 | |||
| 2013 | Ga0068857_100134701 | |||
| 2014 | Ga0068857_100287017 | |||
| 2015 | Ga0068854_100017225 | |||
| 2016 | Ga0068854_100141708 | |||
| 2017 | Ga0068854_100250260 | |||
| 2018 | Ga0068854_100416182 | |||
| 2019 | Ga0068856_100007158 | |||
| 2020 | Ga0068856_100011352 | |||
| 2021 | Ga0068856_100017996 | |||
| 2022 | Ga0068856_100026025 | |||
| 2023 | Ga0068856_100059727 | |||
| 2024 | Ga0068856_100065608 | |||
| 2025 | Ga0068856_100129068 | |||
| 2026 | Ga0068856_100151921 | |||
| 2027 | Ga0070702_100003215 | |||
| 2028 | Ga0070702_100039684 | |||
| 2029 | Ga0070702_100511699 | |||
| 2030 | Ga0068852_100006625 | |||
| 2031 | Ga0068852_100010689 | |||
| 2032 | Ga0068852_100043293 | |||
| 2033 | Ga0068852_100281497 | |||
| 2034 | Ga0068852_100294195 | |||
| 2035 | Ga0068852_100359607 | |||
| 2036 | Ga0068852_100371297 | |||
| 2037 | Ga0068852_100372797 | |||
| 2038 | Ga0068852_100639553 | |||
| 2039 | Ga0068859_100006866 | |||
| 2040 | Ga0068859_100007090 | |||
| 2041 | Ga0068859_100020538 | |||
| 2042 | Ga0068859_100022814 | |||
| 2043 | Ga0068859_100108822 | |||
| 2044 | Ga0068859_100143840 | |||
| 2045 | Ga0068859_100151458 | |||
| 2046 | Ga0068859_100168489 | |||
| 2047 | Ga0068859_100296861 | |||
| 2048 | Ga0068859_100777206 | |||
| 2049 | Ga0068864_100001045 | |||
| 2050 | Ga0068864_100003588 | |||
| 2051 | Ga0068864_100006726 | |||
| 2052 | Ga0068864_100010086 | |||
| 2053 | Ga0068864_100043765 | |||
| 2054 | Ga0068864_100507111 | |||
| 2055 | Ga0068864_100562841 | |||
| 2056 | Ga0068864_100668327 | |||
| 2057 | Ga0068866_10000316 | |||
| 2058 | Ga0068866_10006289 | |||
| 2059 | Ga0068866_10026634 | |||
| 2060 | Ga0068866_10075337 | |||
| 2061 | Ga0068866_10168736 | |||
| 2062 | Ga0068861_100000641 | |||
| 2063 | Ga0068861_100009372 | |||
| 2064 | Ga0068861_100020224 | |||
| 2065 | Ga0068861_100100178 | |||
| 2066 | Ga0068861_100276739 | |||
| 2067 | Ga0068851_10001933 | |||
| 2068 | Ga0068851_10002235 | |||
| 2069 | Ga0068851_10003453 | |||
| 2070 | Ga0068851_10009319 | |||
| 2071 | Ga0068851_10037904 | |||
| 2072 | Ga0068870_10000992 | |||
| 2073 | Ga0068870_10008695 | |||
| 2074 | Ga0068870_10009180 | |||
| 2075 | Ga0068870_10064048 | |||
| 2076 | Ga0068870_10116494 | |||
| 2077 | Ga0068863_100001612 | |||
| 2078 | Ga0068863_100008594 | |||
| 2079 | Ga0068863_100009929 | |||
| 2080 | Ga0068863_100011872 | |||
| 2081 | Ga0068863_100020431 | |||
| 2082 | Ga0068863_100048728 | |||
| 2083 | Ga0068863_100152542 | |||
| 2084 | Ga0068863_100541631 | |||
| 2085 | Ga0068863_100712763 | |||
| 2086 | Ga0068858_100001394 | |||
| 2087 | Ga0068858_100003984 | |||
| 2088 | Ga0068858_100012410 | |||
| 2089 | Ga0068858_100027086 | |||
| 2090 | Ga0068858_100071779 | |||
| 2091 | Ga0068858_100095063 | |||
| 2092 | Ga0068858_100513268 | |||
| 2093 | Ga0068860_100007907 | |||
| 2094 | Ga0068860_100026090 | |||
| 2095 | Ga0068860_100173252 | |||
| 2096 | Ga0068860_100221184 | |||
| 2097 | Ga0068860_100444357 | |||
| 2098 | Ga0068860_100656937 | |||
| 2099 | Ga0068860_100970631 | |||
| 2100 | Ga0068862_100012477 | |||
| 2101 | Ga0068862_100037785 | |||
| 2102 | Ga0068862_100054258 | |||
| 2103 | Ga0068862_100068067 | |||
| 2104 | Ga0068862_100132704 | |||
| 2105 | Ga0068862_100402356 | |||
| 2106 | Ga0068862_100451163 | |||
| 2107 | Ga0068862_100539113 | |||
| 2108 | Ga0081539_10014013 | |||
| 2109 | Ga0081539_10075730 | |||
| 2110 | Ga0075365_10014803 | |||
| 2111 | Ga0075364_10033552 | |||
| 2112 | Ga0075364_10082235 | |||
| 2113 | Ga0070715_10019852 | |||
| 2114 | Ga0070716_100009938 | |||
| 2115 | Ga0070712_100014827 | |||
| 2116 | Ga0070712_100217889 | |||
| 2117 | Ga0075362_10005914 | |||
| 2118 | Ga0075367_10015782 | |||
| 2119 | Ga0075366_10058047 | |||
| 2120 | Ga0075366_10070800 | |||
| 2121 | Ga0075366_10083060 | |||
| 2122 | Ga0075366_10098296 | |||
| 2123 | Ga0097621_100000222 | |||
| 2124 | Ga0097621_100070761 | |||
| 2125 | Ga0097621_100087886 | |||
| 2126 | Ga0097621_100104130 | |||
| 2127 | Ga0097621_100161963 | |||
| 2128 | Ga0097621_100166019 | |||
| 2129 | Ga0097621_100316941 | |||
| 2130 | Ga0097621_100516248 | |||
| 2131 | Ga0097621_100589834 | |||
| 2132 | Ga0075370_10072397 | |||
| 2133 | Ga0075370_10079849 | |||
| 2134 | Ga0068871_100001148 | |||
| 2135 | Ga0068871_100001249 | |||
| 2136 | Ga0068871_100026132 | |||
| 2137 | Ga0068871_100039054 | |||
| 2138 | Ga0068871_100040602 | |||
| 2139 | Ga0068871_100055400 | |||
| 2140 | Ga0068871_100092820 | |||
| 2141 | Ga0068871_100199020 | |||
| 2142 | Ga0068871_100210433 | |||
| 2143 | Ga0068871_100251524 | |||
| 2144 | Ga0068871_100256318 | |||
| 2145 | Ga0068871_100271002 | |||
| 2146 | Ga0075428_100015381 | |||
| 2147 | Ga0075428_100155710 | |||
| 2148 | Ga0075428_100205522 | |||
| 2149 | Ga0075428_100784239 | |||
| 2150 | Ga0075430_100161418 | |||
| 2151 | Ga0075430_100240986 | |||
| 2152 | Ga0075431_100001453 | |||
| 2153 | Ga0075433_10003142 | |||
| 2154 | Ga0075434_100017017 | |||
| 2155 | Ga0075434_100109799 | |||
| 2156 | Ga0075434_100244584 | |||
| 2157 | Ga0075434_100441960 | |||
| 2158 | Ga0075429_100010169 | |||
| 2159 | Ga0075429_100064786 | |||
| 2160 | Ga0075429_100258042 | |||
| 2161 | Ga0068865_100003115 | |||
| 2162 | Ga0068865_100007315 | |||
| 2163 | Ga0068865_100164022 | |||
| 2164 | Ga0068865_100180113 | |||
| 2165 | Ga0075436_100017723 | |||
| 2166 | Ga0097620_100006866 | |||
| 2167 | Ga0097620_100007090 | |||
| 2168 | Ga0097620_100020536 | |||
| 2169 | Ga0097620_100022816 | |||
| 2170 | Ga0097620_100108827 | |||
| 2171 | Ga0097620_100143836 | |||
| 2172 | Ga0097620_100151465 | |||
| 2173 | Ga0097620_100168485 | |||
| 2174 | Ga0097620_100296871 | |||
| 2175 | Ga0097620_100777229 | |||
| 2176 | Ga0079104_1011832 | |||
| 2177 | Ga0075435_100098787 | |||
| 2178 | Ga0075435_100432494 | |||
| 2179 | Ga0099794_10029281 | |||
| 2180 | Ga0105251_10002743 | |||
| 2181 | Ga0105251_10052734 | |||
| 2182 | Ga0105244_10037827 | |||
| 2183 | Ga0105250_10041045 | |||
| 2184 | Ga0105240_10005332 | |||
| 2185 | Ga0105240_10007963 | |||
| 2186 | Ga0105240_10010948 | |||
| 2187 | Ga0105240_10051986 | |||
| 2188 | Ga0105240_10052944 | |||
| 2189 | Ga0105240_10055478 | |||
| 2190 | Ga0105240_10087772 | |||
| 2191 | Ga0105240_10103262 | |||
| 2192 | Ga0105240_10153782 | |||
| 2193 | Ga0111539_10035571 | |||
| 2194 | Ga0111539_10109472 | |||
| 2195 | Ga0111539_10149924 | |||
| 2196 | Ga0105245_10007734 | |||
| 2197 | Ga0105245_10018004 | |||
| 2198 | Ga0105245_10108032 | |||
| 2199 | Ga0105245_10311179 | |||
| 2200 | Ga0105245_10539931 | |||
| 2201 | Ga0105245_10849444 | |||
| 2202 | Ga0105247_10054934 | |||
| 2203 | Ga0105247_10094990 | |||
| 2204 | Ga0114129_10063609 | |||
| 2205 | Ga0114129_10179602 | |||
| 2206 | Ga0114129_10535004 | |||
| 2207 | Ga0105243_10001049 | |||
| 2208 | Ga0105243_10113509 | |||
| 2209 | Ga0105243_10117717 | |||
| 2210 | Ga0105243_10194756 | |||
| 2211 | Ga0105243_10444280 | |||
| 2212 | Ga0105241_10004999 | |||
| 2213 | Ga0105241_10011388 | |||
| 2214 | Ga0105241_10133171 | |||
| 2215 | Ga0105241_10169090 | |||
| 2216 | Ga0105241_10191296 | |||
| 2217 | Ga0105241_10211915 | |||
| 2218 | Ga0105242_10008617 | |||
| 2219 | Ga0105242_10033636 | |||
| 2220 | Ga0105242_10049504 | |||
| 2221 | Ga0105242_10068530 | |||
| 2222 | Ga0105242_10135717 | |||
| 2223 | Ga0105248_10001582 | |||
| 2224 | Ga0105248_10017598 | |||
| 2225 | Ga0105248_10051646 | |||
| 2226 | Ga0105248_10092385 | |||
| 2227 | Ga0105248_10206169 | |||
| 2228 | Ga0105248_10210479 | |||
| 2229 | Ga0105248_10407780 | |||
| 2230 | Ga0105248_10411363 | |||
| 2231 | Ga0105248_10656181 | |||
| 2232 | Ga0105237_10251541 | |||
| 2233 | Ga0105237_10296207 | |||
| 2234 | Ga0105237_10754237 | |||
| 2235 | Ga0105237_10901748 | |||
| 2236 | Ga0105238_10018816 | |||
| 2237 | Ga0105238_10020373 | |||
| 2238 | Ga0105238_10022414 | |||
| 2239 | Ga0105238_10024425 | |||
| 2240 | Ga0105238_10188701 | |||
| 2241 | Ga0105238_10275015 | |||
| 2242 | Ga0105238_10294372 | |||
| 2243 | Ga0105238_10592306 | |||
| 2244 | Ga0105249_10032924 | |||
| 2245 | Ga0105249_10044049 | |||
| 2246 | Ga0105249_10152779 | |||
| 2247 | Ga0105249_10487632 | |||
| 2248 | Ga0105249_10807548 | |||
| 2249 | Ga0105249_11066178 | |||
| 2250 | Ga0105239_10062662 | |||
| 2251 | Ga0105239_10071336 | |||
| 2252 | Ga0105239_10226037 | |||
| 2253 | Ga0105239_10229772 | |||
| 2254 | Ga0105239_10295711 | |||
| 2255 | Ga0105239_10381096 | |||
| 2256 | Ga0105239_10385023 | |||
| 2257 | Ga0105239_10741509 | |||
| 2258 | Ga0105246_10170701 | |||
| 2259 | Ga0105246_10184760 | |||
| 2260 | Ga0157315_1004490 | |||
| 2261 | Ga0157327_1001229 | |||
| 2262 | Ga0157373_10002207 | |||
| 2263 | Ga0157373_10003362 | |||
| 2264 | Ga0157373_10078122 | |||
| 2265 | Ga0157371_10006571 | |||
| 2266 | Ga0157371_10072528 | |||
| 2267 | Ga0157371_10080385 | |||
| 2268 | Ga0157370_10006295 | |||
| 2269 | Ga0157370_10021285 | |||
| 2270 | Ga0157370_10055287 | |||
| 2271 | Ga0157370_10069027 | |||
| 2272 | Ga0157370_10092677 | |||
| 2273 | Ga0157370_10136259 | |||
| 2274 | Ga0157370_10324205 | |||
| 2275 | Ga0157370_10352702 | |||
| 2276 | Ga0157369_10024453 | |||
| 2277 | Ga0157369_10082302 | |||
| 2278 | Ga0157369_10082556 | |||
| 2279 | Ga0157369_10085636 | |||
| 2280 | Ga0157369_10108729 | |||
| 2281 | Ga0157369_10447990 | |||
| 2282 | Ga0157369_10478192 | |||
| 2283 | Ga0157369_10565825 | |||
| 2284 | Ga0157374_10000101 | |||
| 2285 | Ga0157374_10002126 | |||
| 2286 | Ga0157374_10043144 | |||
| 2287 | Ga0157374_10055941 | |||
| 2288 | Ga0157374_10131964 | |||
| 2289 | Ga0157374_10248666 | |||
| 2290 | Ga0157374_10383346 | |||
| 2291 | Ga0157374_10549002 | |||
| 2292 | Ga0157378_10007717 | |||
| 2293 | Ga0157378_10024000 | |||
| 2294 | Ga0157378_10028450 | |||
| 2295 | Ga0157378_10049210 | |||
| 2296 | Ga0157378_10085967 | |||
| 2297 | Ga0157378_10241503 | |||
| 2298 | Ga0157378_10548527 | |||
| 2299 | Ga0157378_10737532 | |||
| 2300 | Ga0163162_10003900 | |||
| 2301 | Ga0163162_10006452 | |||
| 2302 | Ga0163162_10018193 | |||
| 2303 | Ga0163162_10044644 | |||
| 2304 | Ga0163162_10065842 | |||
| 2305 | Ga0163162_10080823 | |||
| 2306 | Ga0163162_10201339 | |||
| 2307 | Ga0163162_10255263 | |||
| 2308 | Ga0163162_10446604 | |||
| 2309 | Ga0163162_10456554 | |||
| 2310 | Ga0163162_10558562 | |||
| 2311 | Ga0157372_10002893 | |||
| 2312 | Ga0157372_10045423 | |||
| 2313 | Ga0157372_10145144 | |||
| 2314 | Ga0157372_10179119 | |||
| 2315 | Ga0157372_10181975 | |||
| 2316 | Ga0157372_10194953 | |||
| 2317 | Ga0157372_10359702 | |||
| 2318 | Ga0157372_10367836 | |||
| 2319 | Ga0157372_10554664 | |||
| 2320 | Ga0157375_10007225 | |||
| 2321 | Ga0157375_10018533 | |||
| 2322 | Ga0157375_10060413 | |||
| 2323 | Ga0157375_10098277 | |||
| 2324 | Ga0157375_10117652 | |||
| 2325 | Ga0157375_10132095 | |||
| 2326 | Ga0157375_10185804 | |||
| 2327 | Ga0157375_10270160 | |||
| 2328 | Ga0157375_10521293 | |||
| 2329 | Ga0157375_10638439 | |||
| 2330 | Ga0157375_10713847 | |||
| 2331 | Ga0157375_10749460 | |||
| 2332 | Ga0163163_10006567 | |||
| 2333 | Ga0163163_10037640 | |||
| 2334 | Ga0163163_10057777 | |||
| 2335 | Ga0163163_10108091 | |||
| 2336 | Ga0163163_10330598 | |||
| 2337 | Ga0163163_10541784 | |||
| 2338 | Ga0163163_10838443 | |||
| 2339 | Ga0157380_10000735 | |||
| 2340 | Ga0157380_10240499 | |||
| 2341 | Ga0157380_10833778 | |||
| 2342 | Ga0182008_10023345 | |||
| 2343 | Ga0157377_10007059 | |||
| 2344 | Ga0157377_10328090 | |||
| 2345 | Ga0157379_10000336 | |||
| 2346 | Ga0157379_10003104 | |||
| 2347 | Ga0157379_10045727 | |||
| 2348 | Ga0157379_10287156 | |||
| 2349 | Ga0157376_10001583 | |||
| 2350 | Ga0157376_10003640 | |||
| 2351 | Ga0157376_10010988 | |||
| 2352 | Ga0157376_10072403 | |||
| 2353 | Ga0157376_10076850 | |||
| 2354 | Ga0182006_1024307 | |||
| 2355 | Ga0182007_10030018 | |||
| 2356 | Ga0183361_10004 | |||
| 2357 | Ga0163161_10025976 | |||
| 2358 | Ga0163161_10044095 | |||
| 2359 | Ga0163161_10222345 | |||
| 2360 | Ga0163161_10250839 | |||
| 2361 | Ga0163161_10634731 | |||
| 2362 | Ga0206353_10397806 | |||
| 2363 | Ga0213872_10000081 | |||
| 2364 | Ga0213872_10000104 | |||
| 2365 | Ga0213872_10000132 | |||
| 2366 | Ga0213872_10011708 | |||
| 2367 | Ga0213872_10020413 | |||
| 2368 | Ga0213872_10158401 | |||
| 2369 | Ga0213876_10013450 | |||
| 2370 | Ga0209435_100080 | |||
| 2371 | Ga0209436_117651 | |||
| 2372 | Ga0209672_102997 | |||
| 2373 | Ga0209147_100004 | |||
| 2374 | Ga0209563_100013 | |||
| 2375 | Ga0207427_100271 | |||
| 2376 | Ga0209437_100117 | |||
| 2377 | Ga0209258_100759 | |||
| 2378 | Ga0209258_100788 | |||
| 2379 | Ga0209258_103781 | |||
| 2380 | Ga0207425_1004618 | |||
| 2381 | Ga0209646_1000060 | |||
| 2382 | Ga0209646_1000481 | |||
| 2383 | Ga0209026_1000049 | |||
| 2384 | Ga0209026_1000729 | |||
| 2385 | Ga0209677_100823 | |||
| 2386 | Ga0209677_108638 | |||
| 2387 | Ga0209148_1000037 | |||
| 2388 | Ga0209148_1016699 | |||
| 2389 | Ga0209759_1000033 | |||
| 2390 | Ga0209759_1000272 | |||
| 2391 | Ga0209759_1000440 | |||
| 2392 | Ga0209759_1000815 | |||
| 2393 | Ga0209759_1004244 | |||
| 2394 | Ga0209759_1007678 | |||
| 2395 | Ga0209565_1000004 | |||
| 2396 | Ga0209565_1000418 | |||
| 2397 | Ga0209455_1000458 | |||
| 2398 | Ga0209455_1000622 | |||
| 2399 | Ga0209673_1000074 | |||
| 2400 | Ga0209130_1000050 | |||
| 2401 | Ga0209130_1000584 | |||
| 2402 | Ga0209675_1000044 | |||
| 2403 | Ga0209675_1002560 | |||
| 2404 | Ga0209675_1011851 | |||
| 2405 | Ga0209676_1000029 | |||
| 2406 | Ga0209025_1000342 | |||
| 2407 | Ga0209025_1001851 | |||
| 2408 | Ga0209025_1004094 | |||
| 2409 | Ga0209025_1004428 | |||
| 2410 | Ga0209025_1006692 | |||
| 2411 | Ga0209025_1006807 | |||
| 2412 | Ga0209564_1000470 | |||
| 2413 | Ga0209564_1003476 | |||
| 2414 | Ga0209564_1003544 | |||
| 2415 | Ga0209758_1009604 | |||
| 2416 | Ga0209050_1000003 | |||
| 2417 | Ga0209050_1002573 | |||
| 2418 | Ga0209050_1002886 | |||
| 2419 | Ga0209050_1008201 | |||
| 2420 | Ga0209050_1038283 | |||
| 2421 | Ga0209256_1000001 | |||
| 2422 | Ga0209256_1000544 | |||
| 2423 | Ga0207426_1000071 | |||
| 2424 | Ga0207426_1001953 | |||
| 2425 | Ga0207426_1003763 | |||
| 2426 | Ga0209051_1000003 | |||
| 2427 | Ga0209051_1003446 | |||
| 2428 | Ga0209051_1009661 | |||
| 2429 | Ga0209051_1019129 | |||
| 2430 | Ga0209257_1000018 | |||
| 2431 | Ga0209257_1000053 | |||
| 2432 | Ga0209257_1000631 | |||
| 2433 | Ga0207697_10003163 | |||
| 2434 | Ga0207697_10061877 | |||
| 2435 | Ga0207697_10099563 | |||
| 2436 | Ga0207656_10015731 | |||
| 2437 | Ga0207656_10021969 | |||
| 2438 | Ga0207656_10050527 | |||
| 2439 | Ga0207713_1004266 | |||
| 2440 | Ga0207682_10000082 | |||
| 2441 | Ga0207682_10006577 | |||
| 2442 | Ga0207682_10041075 | |||
| 2443 | Ga0207692_10008129 | |||
| 2444 | Ga0207692_10024545 | |||
| 2445 | Ga0207692_10026320 | |||
| 2446 | Ga0207642_10000717 | |||
| 2447 | Ga0207642_10008923 | |||
| 2448 | Ga0207642_10056540 | |||
| 2449 | Ga0207642_10110619 | |||
| 2450 | Ga0207688_10042752 | |||
| 2451 | Ga0207680_10009521 | |||
| 2452 | Ga0207680_10028537 | |||
| 2453 | Ga0207680_10148196 | |||
| 2454 | Ga0207680_10358753 | |||
| 2455 | Ga0207680_10362137 | |||
| 2456 | Ga0207647_10039064 | |||
| 2457 | Ga0207647_10085536 | |||
| 2458 | Ga0207647_10187394 | |||
| 2459 | Ga0207685_10001009 | |||
| 2460 | Ga0207699_10172160 | |||
| 2461 | Ga0207645_10002355 | |||
| 2462 | Ga0207645_10004888 | |||
| 2463 | Ga0207645_10010285 | |||
| 2464 | Ga0207645_10130449 | |||
| 2465 | Ga0207645_10139442 | |||
| 2466 | Ga0207643_10001052 | |||
| 2467 | Ga0207643_10002227 | |||
| 2468 | Ga0207643_10011695 | |||
| 2469 | Ga0207643_10046825 | |||
| 2470 | Ga0207643_10053897 | |||
| 2471 | Ga0207705_10065907 | |||
| 2472 | Ga0207705_10108271 | |||
| 2473 | Ga0207705_10440134 | |||
| 2474 | Ga0207654_10008575 | |||
| 2475 | Ga0207654_10058591 | |||
| 2476 | Ga0207707_10028631 | |||
| 2477 | Ga0207707_10061747 | |||
| 2478 | Ga0207707_10081154 | |||
| 2479 | Ga0207707_10343921 | |||
| 2480 | Ga0207707_10560417 | |||
| 2481 | Ga0207707_10635345 | |||
| 2482 | Ga0207707_10728006 | |||
| 2483 | Ga0207695_10004475 | |||
| 2484 | Ga0207695_10025394 | |||
| 2485 | Ga0207695_10057658 | |||
| 2486 | Ga0207695_10104980 | |||
| 2487 | Ga0207695_10371774 | |||
| 2488 | Ga0207671_10032166 | |||
| 2489 | Ga0207671_10052856 | |||
| 2490 | Ga0207671_10144116 | |||
| 2491 | Ga0207671_10321588 | |||
| 2492 | Ga0207693_10000069 | |||
| 2493 | Ga0207693_10017171 | |||
| 2494 | Ga0207693_10080225 | |||
| 2495 | Ga0207663_10036233 | |||
| 2496 | Ga0207663_10053178 | |||
| 2497 | Ga0207663_10059764 | |||
| 2498 | Ga0207660_10041498 | |||
| 2499 | Ga0207660_10080430 | |||
| 2500 | Ga0207660_10098692 | |||
| 2501 | Ga0207660_10168581 | |||
| 2502 | Ga0207660_10196280 | |||
| 2503 | Ga0207662_10010039 | |||
| 2504 | Ga0207662_10018980 | |||
| 2505 | Ga0207662_10054338 | |||
| 2506 | Ga0207662_10300986 | |||
| 2507 | Ga0207657_10000151 | |||
| 2508 | Ga0207657_10012062 | |||
| 2509 | Ga0207657_10039663 | |||
| 2510 | Ga0207657_10077361 | |||
| 2511 | Ga0207657_10155946 | |||
| 2512 | Ga0207657_10208633 | |||
| 2513 | Ga0207657_10292766 | |||
| 2514 | Ga0207649_10005808 | |||
| 2515 | Ga0207649_10013767 | |||
| 2516 | Ga0207649_10041017 | |||
| 2517 | Ga0207649_10056859 | |||
| 2518 | Ga0207649_10239042 | |||
| 2519 | Ga0207649_10598454 | |||
| 2520 | Ga0207652_10013663 | |||
| 2521 | Ga0207652_10047545 | |||
| 2522 | Ga0207652_10052888 | |||
| 2523 | Ga0207652_10066044 | |||
| 2524 | Ga0207652_10079488 | |||
| 2525 | Ga0207652_10187611 | |||
| 2526 | Ga0207652_10342584 | |||
| 2527 | Ga0207646_10009271 | |||
| 2528 | Ga0207646_10524256 | |||
| 2529 | Ga0207681_10011576 | |||
| 2530 | Ga0207681_10034634 | |||
| 2531 | Ga0207681_10137865 | |||
| 2532 | Ga0207681_10171093 | |||
| 2533 | Ga0207681_10190689 | |||
| 2534 | Ga0207681_10206539 | |||
| 2535 | Ga0207681_10235430 | |||
| 2536 | Ga0207681_10472107 | |||
| 2537 | Ga0207694_10020992 | |||
| 2538 | Ga0207694_10027012 | |||
| 2539 | Ga0207694_10047563 | |||
| 2540 | Ga0207694_10062916 | |||
| 2541 | Ga0207694_10167502 | |||
| 2542 | Ga0207694_10184149 | |||
| 2543 | Ga0207694_10219451 | |||
| 2544 | Ga0207694_10247277 | |||
| 2545 | Ga0207650_10004791 | |||
| 2546 | Ga0207650_10011760 | |||
| 2547 | Ga0207650_10034508 | |||
| 2548 | Ga0207650_10042217 | |||
| 2549 | Ga0207650_10074583 | |||
| 2550 | Ga0207650_10079443 | |||
| 2551 | Ga0207650_10080023 | |||
| 2552 | Ga0207650_10085248 | |||
| 2553 | Ga0207650_10094146 | |||
| 2554 | Ga0207650_10134148 | |||
| 2555 | Ga0207650_10178986 | |||
| 2556 | Ga0207650_10404321 | |||
| 2557 | Ga0207659_10007542 | |||
| 2558 | Ga0207659_10008038 | |||
| 2559 | Ga0207659_10028928 | |||
| 2560 | Ga0207659_10032593 | |||
| 2561 | Ga0207659_10068289 | |||
| 2562 | Ga0207659_10103945 | |||
| 2563 | Ga0207659_10414818 | |||
| 2564 | Ga0207659_10701947 | |||
| 2565 | Ga0207659_10720696 | |||
| 2566 | Ga0207659_10796364 | |||
| 2567 | Ga0207687_10001955 | |||
| 2568 | Ga0207687_10003815 | |||
| 2569 | Ga0207687_10177980 | |||
| 2570 | Ga0207700_10000065 | |||
| 2571 | Ga0207700_10007518 | |||
| 2572 | Ga0207700_10297979 | |||
| 2573 | Ga0207664_10081146 | |||
| 2574 | Ga0207664_10113619 | |||
| 2575 | Ga0207664_10311233 | |||
| 2576 | Ga0207664_10415902 | |||
| 2577 | Ga0207664_10623080 | |||
| 2578 | Ga0207644_10013680 | |||
| 2579 | Ga0207644_10027774 | |||
| 2580 | Ga0207644_10104092 | |||
| 2581 | Ga0207644_10115397 | |||
| 2582 | Ga0207644_10171596 | |||
| 2583 | Ga0207644_10477413 | |||
| 2584 | Ga0207690_10002121 | |||
| 2585 | Ga0207690_10164032 | |||
| 2586 | Ga0207690_10171859 | |||
| 2587 | Ga0207690_10184497 | |||
| 2588 | Ga0207690_10201593 | |||
| 2589 | Ga0207690_10357628 | |||
| 2590 | Ga0207706_10000045 | |||
| 2591 | Ga0207706_10019809 | |||
| 2592 | Ga0207706_10046407 | |||
| 2593 | Ga0207706_10149404 | |||
| 2594 | Ga0207706_10191005 | |||
| 2595 | Ga0207686_10000845 | |||
| 2596 | Ga0207686_10014544 | |||
| 2597 | Ga0207686_10035797 | |||
| 2598 | Ga0207686_10037045 | |||
| 2599 | Ga0207686_10045954 | |||
| 2600 | Ga0207686_10095494 | |||
| 2601 | Ga0207709_10014580 | |||
| 2602 | Ga0207709_10027760 | |||
| 2603 | Ga0207709_10159096 | |||
| 2604 | Ga0207709_10262608 | |||
| 2605 | Ga0207670_10015418 | |||
| 2606 | Ga0207670_10050297 | |||
| 2607 | Ga0207669_10061366 | |||
| 2608 | Ga0207669_10154658 | |||
| 2609 | Ga0207669_10175810 | |||
| 2610 | Ga0207669_10241525 | |||
| 2611 | Ga0207669_10243469 | |||
| 2612 | Ga0207669_10246999 | |||
| 2613 | Ga0207704_10005678 | |||
| 2614 | Ga0207704_10006884 | |||
| 2615 | Ga0207704_10012648 | |||
| 2616 | Ga0207704_10460681 | |||
| 2617 | Ga0207665_10033149 | |||
| 2618 | Ga0207665_10140526 | |||
| 2619 | Ga0207691_10000316 | |||
| 2620 | Ga0207691_10000338 | |||
| 2621 | Ga0207691_10001034 | |||
| 2622 | Ga0207691_10021310 | |||
| 2623 | Ga0207691_10022502 | |||
| 2624 | Ga0207691_10029470 | |||
| 2625 | Ga0207691_10030708 | |||
| 2626 | Ga0207691_10042058 | |||
| 2627 | Ga0207691_10109538 | |||
| 2628 | Ga0207691_10192109 | |||
| 2629 | Ga0207691_10352878 | |||
| 2630 | Ga0207711_10000164 | |||
| 2631 | Ga0207711_10002873 | |||
| 2632 | Ga0207711_10048728 | |||
| 2633 | Ga0207711_10366130 | |||
| 2634 | Ga0207711_10482233 | |||
| 2635 | Ga0207711_10590307 | |||
| 2636 | Ga0207711_10680992 | |||
| 2637 | Ga0207689_10000136 | |||
| 2638 | Ga0207689_10000889 | |||
| 2639 | Ga0207689_10006468 | |||
| 2640 | Ga0207689_10008327 | |||
| 2641 | Ga0207689_10035481 | |||
| 2642 | Ga0207689_10107284 | |||
| 2643 | Ga0207689_10186836 | |||
| 2644 | Ga0207661_10013035 | |||
| 2645 | Ga0207661_10030076 | |||
| 2646 | Ga0207661_10050108 | |||
| 2647 | Ga0207661_10055964 | |||
| 2648 | Ga0207679_10003393 | |||
| 2649 | Ga0207679_10003765 | |||
| 2650 | Ga0207679_10021822 | |||
| 2651 | Ga0207679_10023459 | |||
| 2652 | Ga0207679_10048055 | |||
| 2653 | Ga0207679_10223762 | |||
| 2654 | Ga0207679_10250192 | |||
| 2655 | Ga0207679_10676334 | |||
| 2656 | Ga0207667_10004085 | |||
| 2657 | Ga0207667_10004150 | |||
| 2658 | Ga0207667_10005013 | |||
| 2659 | Ga0207667_10027186 | |||
| 2660 | Ga0207667_10039264 | |||
| 2661 | Ga0207667_10046288 | |||
| 2662 | Ga0207667_10056153 | |||
| 2663 | Ga0207667_10060441 | |||
| 2664 | Ga0207667_10141143 | |||
| 2665 | Ga0207667_10177224 | |||
| 2666 | Ga0207667_10241642 | |||
| 2667 | Ga0207667_10442418 | |||
| 2668 | Ga0207667_10669534 | |||
| 2669 | Ga0207651_10007222 | |||
| 2670 | Ga0207651_10017942 | |||
| 2671 | Ga0207651_10023887 | |||
| 2672 | Ga0207651_10049282 | |||
| 2673 | Ga0207651_10053465 | |||
| 2674 | Ga0207651_10097968 | |||
| 2675 | Ga0207712_10012054 | |||
| 2676 | Ga0207712_10174793 | |||
| 2677 | Ga0207712_10301262 | |||
| 2678 | Ga0207668_10006032 | |||
| 2679 | Ga0207668_10007633 | |||
| 2680 | Ga0207668_10014248 | |||
| 2681 | Ga0207668_10022713 | |||
| 2682 | Ga0207668_10025826 | |||
| 2683 | Ga0207668_10044136 | |||
| 2684 | Ga0207668_10271061 | |||
| 2685 | Ga0207668_10607131 | |||
| 2686 | Ga0207668_10694170 | |||
| 2687 | Ga0207640_10032658 | |||
| 2688 | Ga0207640_10093425 | |||
| 2689 | Ga0207640_10154240 | |||
| 2690 | Ga0207640_10167128 | |||
| 2691 | Ga0207640_10227438 | |||
| 2692 | Ga0207640_10333230 | |||
| 2693 | Ga0207658_10002886 | |||
| 2694 | Ga0207658_10010048 | |||
| 2695 | Ga0207658_10011457 | |||
| 2696 | Ga0207658_10056071 | |||
| 2697 | Ga0207658_10180650 | |||
| 2698 | Ga0207658_10208881 | |||
| 2699 | Ga0207658_10324036 | |||
| 2700 | Ga0207677_10000092 | |||
| 2701 | Ga0207677_10035476 | |||
| 2702 | Ga0207677_10059609 | |||
| 2703 | Ga0207677_10169237 | |||
| 2704 | Ga0207677_10545677 | |||
| 2705 | Ga0207703_10000506 | |||
| 2706 | Ga0207703_10004214 | |||
| 2707 | Ga0207703_10014986 | |||
| 2708 | Ga0207703_10081584 | |||
| 2709 | Ga0207639_10132173 | |||
| 2710 | Ga0207639_10157971 | |||
| 2711 | Ga0207639_10237960 | |||
| 2712 | Ga0207639_10276334 | |||
| 2713 | Ga0207639_10351962 | |||
| 2714 | Ga0207639_10357246 | |||
| 2715 | Ga0207678_10002764 | |||
| 2716 | Ga0207678_10005468 | |||
| 2717 | Ga0207678_10007894 | |||
| 2718 | Ga0207678_10014773 | |||
| 2719 | Ga0207678_10133036 | |||
| 2720 | Ga0207678_10150853 | |||
| 2721 | Ga0207678_10441811 | |||
| 2722 | Ga0207678_10477706 | |||
| 2723 | Ga0207678_10484983 | |||
| 2724 | Ga0207708_10000464 | |||
| 2725 | Ga0207708_10022897 | |||
| 2726 | Ga0207708_10041861 | |||
| 2727 | Ga0207708_10496569 | |||
| 2728 | Ga0207702_10002581 | |||
| 2729 | Ga0207702_10010013 | |||
| 2730 | Ga0207702_10011289 | |||
| 2731 | Ga0207702_10013322 | |||
| 2732 | Ga0207702_10067235 | |||
| 2733 | Ga0207702_10109585 | |||
| 2734 | Ga0207641_10003632 | |||
| 2735 | Ga0207641_10005922 | |||
| 2736 | Ga0207641_10008864 | |||
| 2737 | Ga0207641_10011137 | |||
| 2738 | Ga0207641_10044889 | |||
| 2739 | Ga0207641_10046818 | |||
| 2740 | Ga0207641_10127513 | |||
| 2741 | Ga0207641_10156765 | |||
| 2742 | Ga0207641_10247563 | |||
| 2743 | Ga0207648_10000684 | |||
| 2744 | Ga0207648_10001366 | |||
| 2745 | Ga0207648_10004085 | |||
| 2746 | Ga0207648_10008908 | |||
| 2747 | Ga0207648_10050071 | |||
| 2748 | Ga0207648_10063075 | |||
| 2749 | Ga0207648_10232541 | |||
| 2750 | Ga0207648_10256233 | |||
| 2751 | Ga0207648_10338045 | |||
| 2752 | Ga0207648_10459022 | |||
| 2753 | Ga0207676_10000121 | |||
| 2754 | Ga0207676_10004876 | |||
| 2755 | Ga0207676_10010720 | |||
| 2756 | Ga0207676_10021343 | |||
| 2757 | Ga0207676_10029406 | |||
| 2758 | Ga0207676_10031843 | |||
| 2759 | Ga0207676_10044175 | |||
| 2760 | Ga0207676_10090343 | |||
| 2761 | Ga0207676_10232789 | |||
| 2762 | Ga0207676_10344716 | |||
| 2763 | Ga0207674_10000225 | |||
| 2764 | Ga0207674_10001745 | |||
| 2765 | Ga0207674_10003791 | |||
| 2766 | Ga0207674_10005488 | |||
| 2767 | Ga0207674_10006478 | |||
| 2768 | Ga0207674_10047615 | |||
| 2769 | Ga0207674_10130296 | |||
| 2770 | Ga0207674_10155859 | |||
| 2771 | Ga0207674_10476873 | |||
| 2772 | Ga0207675_100000213 | |||
| 2773 | Ga0207675_100000855 | |||
| 2774 | Ga0207675_100037223 | |||
| 2775 | Ga0207675_100057980 | |||
| 2776 | Ga0207675_100159518 | |||
| 2777 | Ga0207675_100159573 | |||
| 2778 | Ga0207675_100180708 | |||
| 2779 | Ga0207675_100434927 | |||
| 2780 | Ga0207675_100473994 | |||
| 2781 | Ga0207683_10000121 | |||
| 2782 | Ga0207683_10000281 | |||
| 2783 | Ga0207683_10003368 | |||
| 2784 | Ga0207683_10006240 | |||
| 2785 | Ga0207683_10008506 | |||
| 2786 | Ga0207683_10010771 | |||
| 2787 | Ga0207683_10071847 | |||
| 2788 | Ga0207683_10310082 | |||
| 2789 | Ga0207683_10545596 | |||
| 2790 | Ga0207698_10003670 | |||
| 2791 | Ga0207698_10010928 | |||
| 2792 | Ga0207698_10032050 | |||
| 2793 | Ga0207698_10205246 | |||
| 2794 | Ga0207698_10281897 | |||
| 2795 | Ga0207698_10314649 | |||
| 2796 | Ga0207698_10505070 | |||
| 2797 | Ga0209371_1010418 | |||
| 2798 | Ga0209969_1012955 | |||
| 2799 | Ga0209981_1005979 | |||
| 2800 | Ga0209996_1001078 | |||
| 2801 | Ga0209996_1009978 | |||
| 2802 | Ga0210000_1018837 | |||
| 2803 | Ga0209995_1005683 | |||
| 2804 | Ga0209968_1000987 | |||
| 2805 | Ga0209999_1006228 | |||
| 2806 | Ga0209982_1013388 | |||
| 2807 | Ga0209970_1000504 | |||
| 2808 | Ga0209983_1008586 | |||
| 2809 | Ga0209971_1009975 | |||
| 2810 | Ga0209971_1022202 | |||
| 2811 | Ga0209966_1000138 | |||
| 2812 | Ga0209974_10002121 | |||
| 2813 | Ga0209974_10024770 | |||
| 2814 | Ga0209974_10027418 | |||
| 2815 | Ga0209974_10062921 | |||
| 2816 | Ga0207428_10013439 | |||
| 2817 | Ga0207428_10177058 | |||
| 2818 | Ga0268266_10014216 | |||
| 2819 | Ga0268266_10022829 | |||
| 2820 | Ga0268266_10048019 | |||
| 2821 | Ga0268266_10299933 | |||
| 2822 | Ga0268266_10498499 | |||
| 2823 | Ga0268266_10510854 | |||
| 2824 | Ga0268265_10050352 | |||
| 2825 | Ga0268265_10053828 | |||
| 2826 | Ga0268265_10073856 | |||
| 2827 | Ga0268265_10290441 | |||
| 2828 | Ga0268265_10700427 | |||
| 2829 | Ga0268264_10007565 | |||
| 2830 | Ga0268264_10014520 | |||
| 2831 | Ga0268264_10016351 | |||
| 2832 | Ga0268264_10028647 | |||
| 2833 | Ga0268264_10144510 | |||
| 2834 | Ga0268264_10185110 | |||
| 2835 | Ga0268264_10364201 | |||
| 2836 | Ga0268264_10441999 | |||
| 2837 | Ga0265336_10000040 | |||
| 2838 | Ga0307515_10022881 | |||
| 2839 | Ga0265324_10001969 | |||
| 2840 | Ga0268256_1011174 | |||
| 2841 | Ga0307511_10004027 | |||
| 2842 | Ga0265760_10075064 | |||
| 2843 | Ga0265320_10011984 | |||
| 2844 | Ga0265339_10003247 | |||
| 2845 | Ga0265331_10056087 | |||
| 2846 | Ga0265316_10056387 | |||
| 2847 | Ga0307513_10000014 | |||
| 2848 | Ga0307509_10108266 | |||
| 2849 | Ga0307408_100016188 | |||
| 2850 | Ga0307408_100115037 | |||
| 2851 | Ga0265313_10018912 | |||
| 2852 | Ga0265313_10045468 | |||
| 2853 | Ga0307508_10319699 | |||
| 2854 | Ga0265314_10008372 | |||
| 2855 | Ga0265342_10004326 | |||
| 2856 | Ga0265342_10014320 | |||
| 2857 | Ga0307516_10144330 | |||
| 2858 | Ga0307413_10081564 | |||
| 2859 | Ga0307413_10188359 | |||
| 2860 | Ga0307410_10169969 | |||
| 2861 | Ga0307410_10184959 | |||
| 2862 | Ga0307406_10009098 | |||
| 2863 | Ga0307406_10256170 | |||
| 2864 | Ga0307407_10006322 | |||
| 2865 | Ga0307407_10227006 | |||
| 2866 | Ga0307412_10000059 | |||
| 2867 | Ga0307412_10061948 | |||
| 2868 | Ga0307412_10205611 | |||
| 2869 | Ga0307409_100038309 | |||
| 2870 | Ga0307416_100049321 | |||
| 2871 | Ga0307416_100055199 | |||
| 2872 | Ga0307416_100276979 | |||
| 2873 | Ga0307416_100325020 | |||
| 2874 | Ga0307416_100434728 | |||
| 2875 | Ga0307416_101034194 | |||
| 2876 | Ga0307414_10072710 | |||
| 2877 | Ga0307411_10006981 | |||
| 2878 | Ga0307507_10069599 | |||
| 2879 | Ga0373959_0009971 | |||
| 2880 | Ga0373934_0010219 | |||
| 2881 | Ga0373934_0144853 | |||
| 2882 | Ga0373923_0046028 | |||
| 2883 | Ga0373923_0226649 | |||
| 2884 | Ga0373945_0015509 | |||
| 2885 | Ga0373945_0026059 | |||
| 2886 | Ga0373953_0009840 | |||
| 2887 | Ga0373953_0067837 | |||
| 2888 | Ga0373954_0010596 | |||
| 2889 | Ga0373954_0025613 | |||
| 2890 | Ga0373956_0004626 | |||
| 2891 | Ga0373957_0024247 | |||
| 2892 | Ga0373943_0008558 | |||
| 2893 | Ga0373943_0034893 | |||
| 2894 | Ga0373943_0038302 | |||
| 2895 | Ga0373946_0011410 | |||
| 2896 | Ga0373946_0032950 | |||
| 2897 | Ga0373946_0135530 | |||
| 2898 | Ga0373955_0111495 | |||
| 2899 | Ga0373924_0042033 | |||
| 2900 | Ga0373931_0004585 | |||
| 2901 | Ga0373931_0008340 | |||
| 2902 | Ga0373935_0069216 | |||
| 2903 | Ga0373935_0205764 | |||
| 2904 | Ga0373935_0363139 | |||
| 2905 | Ga0373927_0019638 | |||
| 2906 | Ga0373927_0057677 | |||
| 2907 | Ga0373927_0105906 | |||
| 2908 | Ga0373933_0022808 | |||
| 2909 | Ga0373933_0293637 | |||
| 2910 | Ga0373947_0010110 | |||
| 2911 | Ga0373947_0024048 | |||
| 2912 | Ga0373947_0549328 | |||
| 2913 | Ga0373937_0001683 | |||
| 2914 | Ga0373937_0039849 | |||
| 2915 | Ga0373937_0242898 | |||
| 2916 | Ga0373937_0436245 | |||
| 2917 | Ga0373925_0124205 | |||
| 2918 | Ga0373925_0382290 | |||
| 2919 | Ga0395899_0009973 | |||
| 2920 | Ga0395899_0034497 | |||
| 2921 | Ga0395899_0288594 | |||
| 2922 | Ga0395900_0001667 | |||
| 2923 | Ga0395900_0048750 | |||
| 2924 | Ga0395900_0088562 | |||
| 2925 | Ga0395900_0097779 | |||
| 2926 | Ga0395900_0309033 | |||
| 2927 | Ga0395900_0411504 | |||
| 2928 | Ga0395898_0004523 | |||
| 2929 | Ga0395898_0116565 | |||
| 2930 | Ga0395898_0137478 | |||
| 2931 | Ga0395905_0000071 | |||
| 2932 | Ga0395905_0029519 | |||
| 2933 | Ga0395905_0033370 | |||
| 2934 | Ga0395905_0092936 | |||
| 2935 | Ga0436364_1275388 | |||
| 2936 | Ga0395901_0000095 | |||
| 2937 | Ga0395901_0036040 | |||
| 2938 | Ga0395901_0056760 | |||
| 2939 | Ga0395901_0060912 | |||
| 2940 | Ga0395901_0105442 | |||
| 2941 | Ga0395901_0179409 | |||
| 2942 | Ga0436365_0796717 | |||
| 2943 | Ga0436361_0107660 | |||
| 2944 | Ga0436361_0453531 | |||
| 2945 | Ga0436361_0487098 | |||
| 2946 | Ga0436361_0745691 | |||
| 2947 | Ga0436361_0805654 | |||
| 2948 | Ga0436361_1206467 | |||
| 2949 | Ga0439465_0019172 | |||
| 2950 | Ga0451798_0358443 | |||
| 2951 | Ga0451807_1547476 | |||
| 2952 | Ga0451853_2590518 | |||
| 2953 | Ga0439435_0066000 | |||
| 2954 | Ga0450893_0020799 | |||
| 2955 | Ga0451577_0005590 | |||
| 2956 | Ga0451577_0007354 | |||
| 2957 | Ga0451577_0008741 | |||
| 2958 | Ga0451577_0076280 | |||
| 2959 | Ga0451577_0140387 | |||
| 2960 | Ga0451577_0154158 | |||
| 2961 | Ga0466969_0001965 | |||
| 2962 | Ga0466972_0000084 | |||
| 2963 | Ga0466972_0005185 | |||
| 2964 | Ga0466982_0008424 | |||
| 2965 | Ga0466965_0004304 | |||
| 2966 | Ga0466965_0009948 | |||
| 2967 | Ga0466966_0000586 | |||
| 2968 | Ga0466966_0015399 | |||
| 2969 | Ga0466961_0001415 | |||
| 2970 | Ga0466961_0006560 | |||
| 2971 | Ga0466961_0123640 | |||
| 2972 | Ga0466963_0053293 | |||
| 2973 | Ga0466964_0012708 | |||
| 2974 | Ga0466964_0048842 | |||
| 2975 | Ga0466964_0072036 | |||
| 2976 | Ga0466964_0097806 | |||
| 2977 | Ga0453684_0038361 | |||
| 2978 | Ga0453684_0252699 | |||
| 2979 | Ga0453684_0324555 | |||
| 2980 | Ga0453684_0373913 | |||
| 2981 | Ga0453684_0552277 | |||
| 2982 | Ga0466971_0009896 | |||
| 2983 | Ga0466960_0118273 | |||
| 2984 | Ga0466960_0140072 | |||
| 2985 | Ga0466960_0237523 | |||
| 2986 | Ga0466959_0010505 | |||
| 2987 | Ga0466959_0033595 | |||
| 2988 | Ga0451576_0003357 | |||
| 2989 | Ga0451576_0015971 | |||
| 2990 | Ga0451576_0048382 | |||
| 2991 | Ga0466958_0143803 | |||
| 2992 | Ga0466958_0226025 | |||
| 2993 | Ga0466967_0010897 | |||
| 2994 | Ga0466967_0235320 | |||
| 2995 | Ga0466967_0464283 | |||
| 2996 | Ga0495592_0093928 | |||
| 2997 | Ga0495603_0011710 | |||
| 2998 | Ga0495590_0015933 | |||
| 2999 | Ga0495591_001235 | |||
| 3000 | Ga0495629_0011435 | |||
| 3001 | Ga0495629_0013424 | |||
| 3002 | Ga0495629_0025910 | |||
| 3003 | Ga0495651_0031194 | |||
| 3004 | Ga0495651_0077070 | |||
| 3005 | Ga0495651_0199113 | |||
| 3006 | Ga0495653_0035337 | |||
| 3007 | Ga0495653_0101167 | |||
| 3008 | Ga0495650_0003970 | |||
| 3009 | Ga0495650_0009757 | |||
| 3010 | Ga0495650_0104765 | |||
| 3011 | Ga0495580_0098520 | |||
| 3012 | Ga0495580_0128610 | |||
| 3013 | Ga0495580_0296523 | |||
| 3014 | Ga0495582_0009817 | |||
| 3015 | Ga0495639_0067302 | |||
| 3016 | Ga0495662_0036255 | |||
| 3017 | Ga0495662_0084613 | |||
| 3018 | Ga0495664_0037859 | |||
| 3019 | Ga0495664_0045779 | |||
| 3020 | Ga0495664_0059767 | |||
| 3021 | Ga0495585_0015782 | |||
| 3022 | Ga0495596_0010328 | |||
| 3023 | Ga0495583_0000046 | |||
| 3024 | Ga0495583_0003496 | |||
| 3025 | Ga0495606_0008997 | |||
| 3026 | Ga0495606_0009638 | |||
| 3027 | Ga0495606_0200061 | |||
| 3028 | Ga0495608_0020916 | |||
| 3029 | Ga0495610_0000624 | |||
| 3030 | Ga0495618_0005918 | |||
| 3031 | Ga0495618_0192781 | |||
| 3032 | Ga0495620_0002905 | |||
| 3033 | Ga0495628_0005536 | |||
| 3034 | Ga0495630_0024678 | |||
| 3035 | Ga0495630_0159312 | |||
| 3036 | Ga0495666_0004392 | |||
| 3037 | Ga0495642_0016251 | |||
| 3038 | Ga0495642_0025549 | |||
| 3039 | Ga0495652_0002282 | |||
| 3040 | Ga0495665_0018812 | |||
| 3041 | Ga0495665_0022165 | |||
| 3042 | Ga0495665_0115993 | |||
| 3043 | Ga0495640_0003666 | |||
| 3044 | Ga0495640_0036801 | |||
| 3045 | Ga0495586_0087879 | |||
| 3046 | Ga0495587_0079172 | |||
| 3047 | Ga0495587_0092093 | |||
| 3048 | Ga0495598_0092816 | |||
| 3049 | Ga0495597_0001164 | |||
| 3050 | Ga0495645_0040975 | |||
| 3051 | Ga0495622_0000017 | |||
| 3052 | Ga0495622_0075510 | |||
| 3053 | Ga0495667_0080883 | |||
| 3054 | Ga0495668_0177672 | |||
| 3055 | Ga0495634_0070757 | |||
| 3056 | Ga0495625_0000720 | |||
| 3057 | Ga0495625_0002351 | |||
| 3058 | Ga0495625_0108423 | |||
| 3059 | Ga0495635_0020342 | |||
| 3060 | Ga0495635_0087455 | |||
| 3061 | Ga0495635_0405936 | |||
| 3062 | Ga0495599_0118722 | |||
| 3063 | Ga0495599_0219791 | |||
| 3064 | Ga0495623_0001196 | |||
| 3065 | Ga0495623_0003843 | |||
| 3066 | Ga0495623_0016582 | |||
| 3067 | Ga0495646_0032940 | |||
| 3068 | Ga0495647_0010822 | |||
| 3069 | Ga0495658_0011509 | |||
| 3070 | Ga0495669_0006842 | |||
| 3071 | Ga0495669_0155922 | |||
| 3072 | Ga0495613_0061262 | |||
| 3073 | Ga0495613_0132585 | |||
| 3074 | Ga0495671_0028235 | |||
| 3075 | Ga0495671_0137725 | |||
| 3076 | Ga0495649_0001661 | |||
| 3077 | Ga0495649_0012734 | |||
| 3078 | Ga0495589_0024749 | |||
| 3079 | Ga0495600_0022736 | |||
| 3080 | Ga0495600_0028081 | |||
| 3081 | Ga0495600_0225339 | |||
| 3082 | Ga0495660_0079063 | |||
| 3083 | Ga0495581_0069288 | |||
| 3084 | Ga0495604_0029323 | |||
| 3085 | Ga0495604_0038276 | |||
| 3086 | Ga0495674_0004590 | |||
| 3087 | Ga0495674_0028010 | |||
| 3088 | Ga0495674_0121639 | |||
| 3089 | Ga0495672_0065420 | |||
| 3090 | Ga0495672_0215345 | |||
| 3091 | Ga0495676_0008883 | |||
| 3092 | Ga0495680_0002429 | |||
| 3093 | Ga0495680_0108235 | |||
| 3094 | Ga0495680_0233566 | |||
| 3095 | Ga0495683_0010627 | |||
| 3096 | Ga0495683_0014936 | |||
| 3097 | Ga0495683_0050651 | |||
| 3098 | Ga0495683_0198432 | |||
| 3099 | Ga0495687_000018 | |||
| 3100 | Ga0495687_016907 | |||
| 3101 | Ga0495687_017543 | |||
| 3102 | Ga0495675_0011625 | |||
| 3103 | Ga0495675_0022924 | |||
| 3104 | Ga0495675_0084521 | |||
| 3105 | Ga0495675_0149768 | |||
| 3106 | Ga0495679_001857 | |||
| 3107 | Ga0495673_0003863 | |||
| 3108 | Ga0495593_0031662 | |||
| 3109 | Ga0495593_0034509 | |||
| 3110 | Ga0495602_0004432 | |||
| 3111 | Ga0495602_0049627 | |||
| 3112 | Ga0495602_0475822 | |||
| 3113 | Ga0495614_0003119 | |||
| 3114 | Ga0496100_0000932 | |||
| 3115 | Ga0496101_0035342 | |||
| 3116 | Ga0496101_0048175 | |||
| 3117 | Ga0496101_0076536 | |||
| 3118 | Ga0496101_0128333 | |||
| 3119 | Ga0496102_0005827 | |||
| 3120 | Ga0496102_0013163 | |||
| 3121 | Ga0496102_0029208 | |||
| 3122 | Ga0496102_0101051 | |||
| 3123 | Ga0496102_0128891 | |||
| 3124 | Ga0496102_0684922 | |||
| 3125 | Ga0496103_0000360 | |||
| 3126 | Ga0496103_0017085 | |||
| 3127 | Ga0496103_0157698 | |||
| 3128 | Ga0496104_0008205 | |||
| 3129 | Ga0496104_0055939 | |||
| 3130 | Ga0496104_0107203 | |||
| 3131 | Ga0496104_0187626 | |||
| 3132 | Ga0496104_0295484 | |||
| 3133 | Ga0496105_0225702 | |||
| 3134 | Ga0496105_0236571 | |||
| 3135 | Ga0496105_0269350 | |||
| 3136 | Ga0496105_0522566 | |||
| 3137 | Ga0496106_0002881 | |||
| 3138 | Ga0496106_0005706 | |||
| 3139 | Ga0496106_0037670 | |||
| 3140 | Ga0496106_0075317 | |||
| 3141 | Ga0496107_0021554 | |||
| 3142 | Ga0496107_0263252 | |||
| 3143 | Ga0496107_0626397 | |||
| 3144 | Ga0496108_0002202 | |||
| 3145 | Ga0496108_0152356 | |||
| 3146 | Ga0496108_0202704 | |||
| 3147 | Ga0496109_0017843 | |||
| 3148 | Ga0496109_0042598 | |||
| 3149 | Ga0496109_0232224 | |||
| 3150 | Ga0496109_0334805 | |||
| 3151 | Ga0496109_0423774 | |||
| 3152 | Ga0496110_0026929 | |||
| 3153 | Ga0496110_0060777 | |||
| 3154 | Ga0496110_0237863 | |||
| 3155 | Ga0496110_0756156 | |||
| 3156 | Ga0496111_0018131 | |||
| 3157 | Ga0496111_0179064 | |||
| 3158 | Ga0496111_0272509 | |||
| 3159 | Ga0496111_0312054 | |||
| 3160 | Ga0496111_0431633 | |||
| 3161 | Ga0496112_0002417 | |||
| 3162 | Ga0496112_0007505 | |||
| 3163 | Ga0496112_0011630 | |||
| 3164 | Ga0496112_0021278 | |||
| 3165 | Ga0496112_0024005 | |||
| 3166 | Ga0496112_0807209 | |||
| 3167 | Ga0496113_0003212 | |||
| 3168 | Ga0496113_0080747 | |||
| 3169 | Ga0496113_0635835 | |||
| 3170 | Ga0496114_0032563 | |||
| 3171 | Ga0496114_0045449 | |||
| 3172 | Ga0496114_0159642 | |||
| 3173 | Ga0496114_0462092 | |||
| 3174 | Ga0496115_0267060 | |||
| 3175 | Ga0496115_0422515 | |||
| 3176 | Ga0496116_0001434 | |||
| 3177 | Ga0496116_0003129 | |||
| 3178 | Ga0496117_0002321 | |||
| 3179 | Ga0496117_0003647 | |||
| 3180 | Ga0496117_0015333 | |||
| 3181 | Ga0496117_0090755 | |||
| 3182 | Ga0496118_0000167 | |||
| 3183 | Ga0496118_0026815 | |||
| 3184 | Ga0496119_0067523 | |||
| 3185 | Ga0496120_0066373 | |||
| 3186 | Ga0496121_0002717 | |||
| 3187 | Ga0496121_0008605 | |||
| 3188 | Ga0496121_0035577 | |||
| 3189 | Ga0496121_0187320 | |||
| 3190 | Ga0496122_0001194 | |||
| 3191 | Ga0496122_0006237 | |||
| 3192 | Ga0496122_0209967 | |||
| 3193 | Ga0496123_0000532 | |||
| 3194 | Ga0496123_0006105 | |||
| 3195 | Ga0496123_0178168 | |||
| 3196 | Ga0496124_0010208 | |||
| 3197 | Ga0496124_0263491 | |||
| 3198 | Ga0496125_0002955 | |||
| 3199 | Ga0496125_0007063 | |||
| 3200 | Ga0496125_0069394 | |||
| 3201 | Ga0496126_0000031 | |||
| 3202 | Ga0496126_0223632 | |||
| 3203 | Ga0496126_0238121 | |||
| 3204 | Ga0495682_0048755 | |||
| 3205 | Ga0501032_0006231 | |||
| 3206 | Ga0501033_0003584 | |||
| 3207 | Ga0501033_0028951 | |||
| 3208 | Ga0501034_0001085 | |||
| 3209 | Ga0501034_0006814 | |||
| 3210 | Ga0501034_0023666 | |||
| 3211 | Ga0501034_0031655 | |||
| 3212 | Ga0501034_0141472 | |||
| 3213 | Ga0501036_0001771 | |||
| 3214 | Ga0501037_0004252 | |||
| 3215 | Ga0501037_0089918 | |||
| 3216 | Ga0501037_0246304 | |||
| 3217 | Ga0501038_0000494 | |||
| 3218 | Ga0501038_0509482 | |||
| 3219 | Ga0501039_0392240 | |||
| 3220 | Ga0501040_0191592 | |||
| 3221 | Ga0501042_0095808 | |||
| 3222 | Ga0501042_0120643 | |||
| 3223 | Ga0501042_0230434 | |||
| 3224 | Ga0501043_0001194 | |||
| 3225 | Ga0501043_0100387 | |||
| 3226 | Ga0501046_0002440 | |||
| 3227 | Ga0501047_0004711 | |||
| 3228 | Ga0501047_0020936 | |||
| 3229 | Ga0501048_0088518 | |||
| 3230 | Ga0501048_0307881 | |||
| 3231 | Ga0501067_0015301 | |||
| 3232 | Ga0501067_0178771 | |||
| 3233 | Ga0501068_0000813 | |||
| 3234 | Ga0501068_0370192 | |||
| 3235 | Ga0501071_0151491 | |||
| 3236 | Ga0501072_0031458 | |||
| 3237 | Ga0501072_0190902 | |||
| 3238 | Ga0501073_0001692 | |||
| 3239 | Ga0501073_0007913 | |||
| 3240 | Ga0501074_0070330 | |||
| 3241 | Ga0501074_0114150 | |||
| 3242 | Ga0501074_0235881 | |||
| 3243 | Ga0501076_0013746 | |||
| 3244 | Ga0501076_0363433 | |||
| 3245 | Ga0501079_0054792 | |||
| 3246 | Ga0501080_0000614 | |||
| 3247 | Ga0501080_0001764 | |||
| 3248 | Ga0501080_0026131 | |||
| 3249 | Ga0501080_0093075 | |||
| 3250 | Ga0501081_0002070 | |||
| 3251 | Ga0501083_0016784 | |||
| 3252 | Ga0501083_0026400 | |||
| 3253 | Ga0501083_0044081 | |||
| 3254 | Ga0501035_0034907 | |||
| 3255 | Ga0501035_0082472 | |||
| 3256 | Ga0501035_0137165 | |||
| 3257 | Ga0501035_0294525 | |||
| 3258 | Ga0501044_0000236 | |||
| 3259 | Ga0501044_0012609 | |||
| 3260 | nmdc:mga03683_22708_c1 | |||
| 3261 | nmdc:mga03683_245360_c1 | |||
| 3262 | nmdc:mga00v17_14882_c1 | |||
| 3263 | nmdc:mga00v17_46477_c1 | |||
| 3264 | nmdc:mga0yw44_26020_c1 | |||
| 3265 | nmdc:mga0yw44_80260_c1 | |||
| 3266 | nmdc:mga0k408_16840_c1 | |||
| 3267 | nmdc:mga0k408_21004_c2 | |||
| 3268 | nmdc:mga0k408_96283_c1 | |||
| 3269 | nmdc:mga07m45_19107_c2 | |||
| 3270 | nmdc:mga07m45_51636_c1 | |||
| 3271 | nmdc:mga05p37_42889_c1 | |||
| 3272 | nmdc:mga05p37_807231_c1 | |||
| 3273 | nmdc:mga09592_16785_c1 | |||
| 3274 | nmdc:mga09592_254596_c1 | |||
| 3275 | nmdc:mga09592_59925_c1 | |||
| 3276 | nmdc:mga0qj67_23454_c1 | |||
| 3277 | nmdc:mga0qj67_381204_c1 | |||
| 3278 | nmdc:mga06r32_60240_c1 | |||
| 3279 | nmdc:mga08y16_140934_c1 | |||
| 3280 | nmdc:mga08y16_189783_c1 | |||
| 3281 | nmdc:mga08y16_26937_c1 | |||
| 3282 | nmdc:mga08y16_456734_c1 | |||
| 3283 | nmdc:mga08y16_965338_c1 | |||
| 3284 | nmdc:mga0n895_401234_c1 | |||
| 3285 | nmdc:mga0n895_4460_c1 | |||
| 3286 | nmdc:mga0n895_45248_c1 | |||
| 3287 | nmdc:mga0rr50_16136_c1 | |||
| 3288 | nmdc:mga0rr50_304249_c1 | |||
| 3289 | nmdc:mga0rr50_398644_c1 | |||
| 3290 | nmdc:mga08x19_46547_c1 | |||
| 3291 | nmdc:mga0a205_8120_c1 | |||
| 3292 | Ga0495612_0080658 | |||
| 3293 | Ga0500635_0000440 | |||
| 3294 | Ga0495595_0091601 | |||
| 3295 | Ga0495619_0026499 | |||
| 3296 | Ga0500644_0011531 | |||
| 3297 | Ga0500566_0149636 | |||
| 3298 | Ga0500566_0183242 | |||
| 3299 | Ga0500593_000087 | |||
| 3300 | Ga0500595_014220 | |||
| 3301 | Ga0500655_035102 | |||
| 3302 | Ga0500658_0049219 | |||
| 3303 | Ga0500604_0000278 | |||
| 3304 | Ga0500616_0000520 | |||
| 3305 | Ga0500616_0007851 | |||
| 3306 | Ga0500627_0009870 | |||
| 3307 | Ga0500627_0192198 | |||
| 3308 | Ga0500638_138050 | |||
| 3309 | Ga0500645_000100 | |||
| 3310 | Ga0500645_002016 | |||
| 3311 | Ga0500609_002189 | |||
| 3312 | Ga0501084_0385692 | |||
| 3313 | Ga0500661_001464 | |||
| 3314 | Ga0587077_008909 | |||
| 3315 | Ga0587086_005942 | |||
| 3316 | Ga0587088_006045 | |||
| 3317 | Ga0587092_036494 | |||
| 3318 | Ga0587094_016727 | |||
| 3319 | Ga0587117_016677 | |||
| 3320 | Ga0587068_003730 | |||
| 3321 | Ga0587072_016692 | |||
| 3322 | Ga0587075_021123 | |||
| 3323 | Ga0587076_000599 | |||
| 3324 | Ga0587078_000752 | |||
| 3325 | Ga0587078_016808 | |||
| 3326 | Ga0587100_001375 | |||
| 3327 | Ga0587102_000802 | |||
| 3328 | Ga0587071_008180 | |||
| 3329 | Ga0587111_0000638 | |||
| 3330 | Ga0587111_0001949 | |||
| 3331 | Ga0530510_0126595 | |||
| 3332 | 2509126550 | |||
| 3333 | 2511245773 | |||
| 3334 | 2512929184 | |||
| 3335 | 2563065098 | |||
| 3336 | 2588514463 | |||
| 3337 | 2644028937 | |||
| 3338 | 2713481915 | |||
| 3339 | 2738821071 | |||
| 3340 | 2738833553 | |||
| 3341 | 2738876960 | |||
| 3342 | 2739055841 | |||
| 3343 | 2739186709 | |||
| 3344 | 2739223553 | |||
| 3345 | 2819595283 | |||
| 3346 | 2857366159 | |||
| 3347 | 2876367258 | |||
| 3348 | 2884812645 | |||
| 3349 | 2884841125 | |||
| 3350 | 2884856000 | |||
| 3351 | 2896157075 | |||
| 3352 | 2903453272 | |||
| 3353 | 2903526749 | |||
| 3354 | 2903530632 | |||
| 3355 | 2919704873 | |||
| 3356 | 2921655269 | |||
| 3357 | 2937850916 | |||
| 3358 | 2945939366 | |||
| 3359 | 2963650051 | |||
| 3360 | 2968086638 | |||
| 3361 | 2977923891 | |||
| 3362 | 2990706709 | |||
| 3363 | 3004213329 | |||
| 3364 | 3004221402 | |||
| 3365 | 3004334607 | |||
| 3366 | 637078942 | |||
| 3367 | 642424633 | |||
| 3368 | 642620539 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nbv-assembly1.cif.gz_A | crystal structure of fabg from cupriavidus taiwanensis | 0.9851 | 1 | 246 |
| 7tzp-assembly3.cif.gz_G | crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh | 0.981 | 1 | 246 |
| 4nbw-assembly1.cif.gz_D | crystal structure of fabg from plesiocystis pacifica | 0.9807 | 6 | 246 |
| 4nbu-assembly1.cif.gz_D | crystal structure of fabg from bacillus sp | 0.9799 | 1 | 246 |
| 7djs-assembly1.cif.gz_C | crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad | 0.9795 | 3 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4nbwD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9807 | 6 | 246 | 3.40.50.720 |
| af_B7FAC8_69_312_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.98 | 6 | 246 | 3.40.50.720 |
| 4urfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9778 | 1 | 243 | 3.40.50.720 |
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9755 | 1 | 245 | 3.40.50.720 |
| 2rhcB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9755 | 6 | 245 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R1UFC0-F1-model_v4 | deleted | 0.999 | 1 | 246 |
|
| AF-A0A522V0P9-F1-model_v4 | 3-oxoacyl-ACP reductase FabG (EC 1.1.1.100) | 0.9933 | 1 | 246 |
GO:0004316
GO:0006633 GO:0048038 |
| AF-A0A5E4K4M7-F1-model_v4 | L-rhamnose 1-dehydrogenase (NADP(+)) (EC 1.1.1.377) | 0.993 | 1 | 246 |
GO:0004316
GO:0006633 GO:0051287 |
| AF-A0A6G0ZWC7-F1-model_v4 | deleted | 0.9927 | 2 | 246 |
|
| AF-A0A2N2E2P3-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9922 | 1 | 246 |
GO:0004316
GO:0006633 GO:0051287 |