F495323

General Info

Members Datasets Scaffolds Average Seq Length
1684 564 3368 246

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10430213|Ga0207690_104302131
Length 277
Sequence MRDPPAHLPPRRSIPLRAATIAGIATRSTSMRLSHKIAIVTGAAQGIGLATALKFAREGASVVVCDLHDVGTAVAAVSAVSVEGAACLGQVMDVTDRAQVDAMVAAVKDRFGRIDVLVNNAGITRDARLQKMTLEQFDAVIDVNLRGVFHCTQAVADAMVAQGSGSILNASSVVGIYGNFGQTNYAATKFGVIGFTKTWSRELGPKGVRVNAVAPGFVETPILATVPDKVLQHMREQVPLHRLGRPEEIANVYAFLASDEASYVNGAVIEVSGGMSV

Samples

Sample ID Description Type Environment
1 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
130 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
131 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
150 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
167 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
168 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
174 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
175 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
182 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
183 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
184 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
187 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
196 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
199 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
281 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
285 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
286 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
287 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
288 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
289 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
291 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
292 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
293 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
294 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
295 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
296 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
297 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
298 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
299 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
300 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
301 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
302 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
303 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
304 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
305 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
306 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
307 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
308 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
309 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
310 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
311 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
312 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
313 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
314 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
315 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
316 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
317 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
318 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
319 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
320 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
321 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
322 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
323 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
324 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
325 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
326 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
327 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
328 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
329 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
330 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
331 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
332 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
333 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
334 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
335 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
336 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
337 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
338 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
339 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
340 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
341 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
342 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
343 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
344 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
345 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
346 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
347 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
348 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
349 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
350 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
351 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
352 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
353 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
354 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
355 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
356 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
357 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
358 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
359 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
360 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
361 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
362 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
363 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
364 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
365 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
366 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
367 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
368 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
369 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
370 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
371 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
372 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
373 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
374 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
375 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
376 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
377 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
378 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
379 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
380 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
381 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
382 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
383 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
384 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
385 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
386 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
387 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
388 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
389 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
390 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
391 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
392 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
393 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
394 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
395 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
396 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
397 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
398 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
399 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
400 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
401 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
402 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
403 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
404 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
405 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
406 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
407 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
408 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
409 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
410 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
411 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
412 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
413 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
414 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
415 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
416 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
417 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
418 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
419 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
420 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
421 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
422 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
423 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
424 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
425 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
431 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
432 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
433 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
434 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
435 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
436 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
437 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
438 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
439 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
440 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
441 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
444 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
454 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
468 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
469 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
470 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
471 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
472 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
473 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
474 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
475 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
476 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
477 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
478 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
480 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
481 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
482 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
483 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
484 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
485 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
486 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
487 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
488 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
489 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
490 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
491 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
492 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
493 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
494 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
495 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
496 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
497 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
498 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
499 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
500 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
501 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
502 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
503 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
504 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
505 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
506 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
507 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
508 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
509 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
510 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
511 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
512 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
528 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
529 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
530 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
531 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
532 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
533 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
534 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
535 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
536 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
537 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
538 2738541337 Pelomonas sp. BT06 Isolate Unclassified
539 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
540 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
541 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
542 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
543 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
544 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
545 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
546 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
547 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
548 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
549 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
550 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
551 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
552 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
553 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
554 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
555 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
556 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
557 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
558 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
559 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
560 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
561 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
562 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
563 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
564 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 1.13
Isolates 2.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.13
Nodule 0.59
Rhizoplane 3.86
Rhizosphere 83.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207690_10430213 3300025932 Bacteria 1057
2 JGI24740J21852_10001143 3300001979 Bacteria 11990
3 JGI24740J21852_10010597 3300001979 Bacteria 3541
4 JGI24739J22299_10009570 3300001989 Bacteria 3607
5 JGI24748J21848_1020814 3300002074 Bacteria 791
6 JGI24738J21930_10000443 3300002075 Bacteria 11696
7 JGI25155J39150_1000366 3300002704 Bacteria 13753
8 JGI25156J39149_1000649 3300002705 Bacteria 19021
9 JGI25156J39149_1000693 3300002705 Bacteria 18068
10 JGI25156J39149_1001347 3300002705 Bacteria 10537
11 JGI25156J39149_1007814 3300002705 Bacteria 2764
12 JGI25154J39366_1000534 3300002738 Bacteria 19006
13 JGI25154J39366_1001866 3300002738 Bacteria 6417
14 JGI25157J39369_1000566 3300002741 Bacteria 22112
15 JGI25157J39369_1000665 3300002741 Bacteria 19017
16 JGI25164J39214_1006209 3300002772 Bacteria 1262
17 JGI25150J39212_1007383 3300002774 Bacteria 2212
18 JGI25159J45721_1000689 3300002987 Bacteria 14836
19 JGI25159J45721_1016659 3300002987 Bacteria 1556
20 JGI25151J46595_10001030 3300003187 Bacteria 20866
21 JGI25151J46595_10014571 3300003187 Bacteria 3497
22 rootH1_10010127 3300003316 Bacteria 3985
23 rootL2_10062439 3300003322 Bacteria 2059
24 rootL2_10086809 3300003322 Bacteria 2197
25 rootH1_10005148 3300003323 Bacteria 3757
26 JGI25160J50197_1000305 3300003354 Bacteria 34747
27 JGI25161J50226_1000018 3300003374 Bacteria 172599
28 Ga0055539_1001771 3300003752 Bacteria 3727
29 Ga0055532_1000453 3300003758 Bacteria 19021
30 Ga0055525_1000004 3300003759 Bacteria 888039
31 Ga0055535_1008682 3300003761 Bacteria 1809
32 Ga0055542_1001255 3300003762 Bacteria 13936
33 Ga0055529_1000806 3300003763 Bacteria 19128
34 Ga0055537_1000008 3300003773 Bacteria 142572
35 Ga0055537_1016554 3300003773 Bacteria 1243
36 Ga0055524_1000083 3300003775 Bacteria 119259
37 Ga0055534_1001337 3300003784 Bacteria 9902
38 Ga0055528_1000652 3300003790 Bacteria 25243
39 Ga0055530_10000211 3300003791 Bacteria 52600
40 Ga0055540_1000012 3300003792 Bacteria 262667
41 Ga0055540_1014922 3300003792 Bacteria 2288
42 Ga0055531_10000181 3300003794 Bacteria 71324
43 Ga0055531_10004842 3300003794 Bacteria 8031
44 Ga0055531_10013006 3300003794 Bacteria 3870
45 Ga0055543_1000418 3300004625 Bacteria 26839
46 Ga0065165_1002315 3300005262 Bacteria 16665
47 Ga0065165_1004913 3300005262 Bacteria 7892
48 Ga0065712_10020755 3300005290 Bacteria 1411
49 Ga0065712_10133994 3300005290 Bacteria 1517
50 Ga0065715_10136268 3300005293 Bacteria 1925
51 Ga0065715_10159109 3300005293 Bacteria 1647
52 Ga0065715_10161730 3300005293 Bacteria 1623
53 Ga0065715_10173334 3300005293 Bacteria 1529
54 Ga0065715_10236508 3300005293 Bacteria 1215
55 Ga0065715_10282474 3300005293 Bacteria 1083
56 Ga0065707_10207925 3300005295 Bacteria 1279
57 Ga0065707_10324178 3300005295 Bacteria 961
58 Ga0070658_10031442 3300005327 Bacteria 4262
59 Ga0070658_10054387 3300005327 Bacteria 3250
60 Ga0070658_10136621 3300005327 Bacteria 2046
61 Ga0070658_10141460 3300005327 Bacteria 2010
62 Ga0070658_10214779 3300005327 Bacteria 1625
63 Ga0070676_10003185 3300005328 Bacteria 8505
64 Ga0070676_10011669 3300005328 Bacteria 4781
65 Ga0070676_10060407 3300005328 Bacteria 2251
66 Ga0070676_10423806 3300005328 Bacteria 930
67 Ga0070683_100015001 3300005329 Bacteria 6796
68 Ga0070683_100024314 3300005329 Bacteria 5425
69 Ga0070683_100061006 3300005329 Bacteria 3505
70 Ga0070690_100000658 3300005330 Bacteria 17624
71 Ga0070690_100001010 3300005330 Bacteria 14386
72 Ga0070690_100199390 3300005330 Bacteria 1392
73 Ga0070670_100002859 3300005331 Bacteria 14280
74 Ga0070670_100011705 3300005331 Bacteria 7504
75 Ga0070670_100012920 3300005331 Bacteria 7149
76 Ga0070670_100025473 3300005331 Bacteria 5089
77 Ga0070670_100048045 3300005331 Bacteria 3673
78 Ga0070670_100061382 3300005331 Bacteria 3227
79 Ga0070670_100111928 3300005331 Bacteria 2353
80 Ga0070670_100158846 3300005331 Bacteria 1959
81 Ga0070677_10000636 3300005333 Bacteria 11763
82 Ga0070677_10060316 3300005333 Bacteria 1562
83 Ga0068869_100000751 3300005334 Bacteria 18417
84 Ga0068869_100004117 3300005334 Bacteria 9015
85 Ga0068869_100037455 3300005334 Bacteria 3448
86 Ga0068869_100091480 3300005334 Bacteria 2288
87 Ga0070666_10001025 3300005335 Bacteria 17121
88 Ga0070666_10001481 3300005335 Bacteria 14260
89 Ga0070666_10017038 3300005335 Bacteria 4654
90 Ga0070666_10095964 3300005335 Bacteria 2041
91 Ga0070666_10271727 3300005335 Bacteria 1203
92 Ga0070680_100076067 3300005336 Bacteria 2764
93 Ga0070680_100085318 3300005336 Bacteria 2609
94 Ga0070680_100189634 3300005336 Bacteria 1732
95 Ga0070682_100151070 3300005337 Bacteria 1594
96 Ga0068868_100007511 3300005338 Bacteria 7766
97 Ga0068868_100008375 3300005338 Bacteria 7402
98 Ga0068868_100062121 3300005338 Bacteria 2960
99 Ga0068868_100108488 3300005338 Bacteria 2253
100 Ga0068868_100176122 3300005338 Bacteria 1773
101 Ga0068868_100239544 3300005338 Bacteria 1524
102 Ga0070660_100028688 3300005339 Bacteria 4165
103 Ga0070660_100039542 3300005339 Bacteria 3586
104 Ga0070660_100051494 3300005339 Bacteria 3171
105 Ga0070660_100243343 3300005339 Bacteria 1466
106 Ga0070660_100321432 3300005339 Bacteria 1271
107 Ga0070660_100703085 3300005339 Bacteria 847
108 Ga0070689_100040979 3300005340 Bacteria 3553
109 Ga0070689_100079947 3300005340 Bacteria 2565
110 Ga0070689_100110933 3300005340 Bacteria 2181
111 Ga0070689_100286962 3300005340 Bacteria 1367
112 Ga0070687_100050151 3300005343 Bacteria 2154
113 Ga0070687_100255918 3300005343 Bacteria 1090
114 Ga0070661_100007597 3300005344 Bacteria 7477
115 Ga0070661_100010061 3300005344 Bacteria 6566
116 Ga0070661_100021144 3300005344 Bacteria 4645
117 Ga0070661_100029562 3300005344 Bacteria 3956
118 Ga0070661_100041032 3300005344 Bacteria 3377
119 Ga0070661_100070345 3300005344 Bacteria 2573
120 Ga0070661_100097608 3300005344 Bacteria 2182
121 Ga0070661_100237008 3300005344 Bacteria 1404
122 Ga0070661_100374968 3300005344 Bacteria 1121
123 Ga0070692_10005718 3300005345 Bacteria 5339
124 Ga0070692_10038658 3300005345 Bacteria 2433
125 Ga0070668_100001025 3300005347 Bacteria 19580
126 Ga0070668_100002685 3300005347 Bacteria 13082
127 Ga0070668_100003032 3300005347 Bacteria 12427
128 Ga0070668_100003427 3300005347 Bacteria 11711
129 Ga0070668_100005260 3300005347 Bacteria 9601
130 Ga0070668_100019396 3300005347 Bacteria 5119
131 Ga0070668_100082717 3300005347 Bacteria 2518
132 Ga0070668_100123554 3300005347 Bacteria 2072
133 Ga0070668_100146879 3300005347 Bacteria 1904
134 Ga0070668_100264040 3300005347 Bacteria 1433
135 Ga0070668_100324228 3300005347 Bacteria 1297
136 Ga0070669_100001889 3300005353 Bacteria 15109
137 Ga0070669_100015790 3300005353 Bacteria 5385
138 Ga0070669_100065004 3300005353 Bacteria 2687
139 Ga0070669_100105418 3300005353 Bacteria 2132
140 Ga0070675_100004878 3300005354 Bacteria 10238
141 Ga0070675_100006068 3300005354 Bacteria 9256
142 Ga0070675_100012545 3300005354 Bacteria 6644
143 Ga0070675_100015597 3300005354 Bacteria 6011
144 Ga0070675_100049855 3300005354 Bacteria 3437
145 Ga0070675_100542111 3300005354 Bacteria 1051
146 Ga0070671_100007740 3300005355 Bacteria 8583
147 Ga0070671_100008568 3300005355 Bacteria 8198
148 Ga0070671_100008695 3300005355 Bacteria 8147
149 Ga0070671_100021169 3300005355 Bacteria 5310
150 Ga0070671_100048504 3300005355 Bacteria 3531
151 Ga0070671_100106418 3300005355 Bacteria 2355
152 Ga0070671_100118613 3300005355 Bacteria 2226
153 Ga0070671_100172511 3300005355 Bacteria 1829
154 Ga0070674_100000692 3300005356 Bacteria 17091
155 Ga0070674_100020957 3300005356 Bacteria 4188
156 Ga0070674_100095654 3300005356 Bacteria 2153
157 Ga0070674_100144238 3300005356 Bacteria 1791
158 Ga0070674_100172176 3300005356 Bacteria 1652
159 Ga0070674_100234743 3300005356 Bacteria 1433
160 Ga0070674_100656702 3300005356 Bacteria 892
161 Ga0070673_100000093 3300005364 Bacteria 39643
162 Ga0070673_100006849 3300005364 Bacteria 7453
163 Ga0070673_100035677 3300005364 Bacteria 3772
164 Ga0070673_100037281 3300005364 Bacteria 3703
165 Ga0070673_100104922 3300005364 Bacteria 2334
166 Ga0070673_100117265 3300005364 Bacteria 2215
167 Ga0070673_100385301 3300005364 Bacteria 1251
168 Ga0070688_100000489 3300005365 Bacteria 20048
169 Ga0070688_100015178 3300005365 Bacteria 4375
170 Ga0070688_100048466 3300005365 Bacteria 2640
171 Ga0070659_100025885 3300005366 Bacteria 4512
172 Ga0070659_100045936 3300005366 Bacteria 3423
173 Ga0070659_100097304 3300005366 Bacteria 2365
174 Ga0070659_100097699 3300005366 Bacteria 2360
175 Ga0070659_100107236 3300005366 Bacteria 2252
176 Ga0070659_100227542 3300005366 Bacteria 1541
177 Ga0070659_100243677 3300005366 Bacteria 1488
178 Ga0070659_100246176 3300005366 Bacteria 1481
179 Ga0070667_100025931 3300005367 Bacteria 4875
180 Ga0070667_100038812 3300005367 Bacteria 3992
181 Ga0070667_100042408 3300005367 Bacteria 3818
182 Ga0070667_100107435 3300005367 Bacteria 2416
183 Ga0070667_100113340 3300005367 Bacteria 2353
184 Ga0070667_100128822 3300005367 Bacteria 2207
185 Ga0070667_100243386 3300005367 Bacteria 1607
186 Ga0070667_100354586 3300005367 Bacteria 1329
187 Ga0070709_10001884 3300005434 Bacteria 11372
188 Ga0070709_10430527 3300005434 Bacteria 990
189 Ga0070709_10514817 3300005434 Bacteria 911
190 Ga0070709_10654168 3300005434 Bacteria 814
191 Ga0070714_100054946 3300005435 Bacteria 3403
192 Ga0070714_100208731 3300005435 Bacteria 1789
193 Ga0070714_100223740 3300005435 Bacteria 1731
194 Ga0070714_100574091 3300005435 Bacteria 1081
195 Ga0070713_100000090 3300005436 Bacteria 57703
196 Ga0070713_100000232 3300005436 Bacteria 36963
197 Ga0070713_100074644 3300005436 Bacteria 2873
198 Ga0070713_100135900 3300005436 Bacteria 2172
199 Ga0070710_10006281 3300005437 Bacteria 5695
200 Ga0070710_10008791 3300005437 Bacteria 4925
201 Ga0070701_10006039 3300005438 Bacteria 5062
202 Ga0070701_10361097 3300005438 Bacteria 910
203 Ga0070711_100001221 3300005439 Bacteria 13864
204 Ga0070711_100046861 3300005439 Bacteria 2948
205 Ga0070711_100078585 3300005439 Bacteria 2345
206 Ga0070711_100153118 3300005439 Bacteria 1741
207 Ga0070705_100209676 3300005440 Bacteria 1342
208 Ga0070700_100000303 3300005441 Bacteria 25814
209 Ga0070700_100064955 3300005441 Bacteria 2312
210 Ga0070694_100047176 3300005444 Bacteria 2894
211 Ga0070694_100153287 3300005444 Bacteria 1685
212 Ga0070708_100018603 3300005445 Bacteria 5816
213 Ga0070708_100314955 3300005445 Bacteria 1474
214 Ga0070663_100004067 3300005455 Bacteria 8541
215 Ga0070663_100004262 3300005455 Bacteria 8372
216 Ga0070663_100030299 3300005455 Bacteria 3706
217 Ga0070663_100113582 3300005455 Bacteria 2038
218 Ga0070663_100627904 3300005455 Bacteria 906
219 Ga0070678_100000443 3300005456 Bacteria 19607
220 Ga0070678_100020775 3300005456 Bacteria 4314
221 Ga0070678_100037888 3300005456 Bacteria 3390
222 Ga0070678_100040788 3300005456 Bacteria 3286
223 Ga0070678_100144929 3300005456 Bacteria 1905
224 Ga0070678_100296457 3300005456 Bacteria 1373
225 Ga0070662_100001239 3300005457 Bacteria 15663
226 Ga0070662_100320583 3300005457 Bacteria 1264
227 Ga0070681_10018539 3300005458 Bacteria 6957
228 Ga0070681_10020974 3300005458 Bacteria 6545
229 Ga0070681_10068268 3300005458 Bacteria 3522
230 Ga0070681_10121863 3300005458 Bacteria 2542
231 Ga0070681_10179611 3300005458 Bacteria 2038
232 Ga0070681_10318999 3300005458 Bacteria 1463
233 Ga0070681_10472338 3300005458 Bacteria 1167
234 Ga0068867_100003718 3300005459 Bacteria 10737
235 Ga0068867_100012127 3300005459 Bacteria 6087
236 Ga0068867_100063788 3300005459 Bacteria 2739
237 Ga0068867_100081929 3300005459 Bacteria 2433
238 Ga0068867_100088186 3300005459 Bacteria 2351
239 Ga0068867_100104340 3300005459 Bacteria 2169
240 Ga0068867_100311605 3300005459 Bacteria 1301
241 Ga0068867_100692307 3300005459 Bacteria 899
242 Ga0070685_10017407 3300005466 Bacteria 3846
243 Ga0070685_10044934 3300005466 Bacteria 2531
244 Ga0070707_100012578 3300005468 Bacteria 7905
245 Ga0070707_100036043 3300005468 Bacteria 4719
246 Ga0070698_100006372 3300005471 Bacteria 12812
247 Ga0070699_100014042 3300005518 Bacteria 6890
248 Ga0070699_100015841 3300005518 Bacteria 6472
249 Ga0070699_100031664 3300005518 Bacteria 4566
250 Ga0070679_100014667 3300005530 Bacteria 7531
251 Ga0070679_100016933 3300005530 Bacteria 7046
252 Ga0070679_100034615 3300005530 Bacteria 5006
253 Ga0070679_100054314 3300005530 Bacteria 3987
254 Ga0070679_100069820 3300005530 Bacteria 3505
255 Ga0070679_100083680 3300005530 Bacteria 3179
256 Ga0070679_100094597 3300005530 Bacteria 2975
257 Ga0070679_100291703 3300005530 Bacteria 1583
258 Ga0070684_100040489 3300005535 Bacteria 4013
259 Ga0070684_100128155 3300005535 Bacteria 2288
260 Ga0070684_100238681 3300005535 Bacteria 1660
261 Ga0070684_100266198 3300005535 Bacteria 1568
262 Ga0068853_100006808 3300005539 Bacteria 9113
263 Ga0068853_100012679 3300005539 Bacteria 6862
264 Ga0068853_100023777 3300005539 Bacteria 5133
265 Ga0068853_100065974 3300005539 Bacteria 3142
266 Ga0068853_100068629 3300005539 Bacteria 3082
267 Ga0068853_100114281 3300005539 Bacteria 2401
268 Ga0068853_100169928 3300005539 Bacteria 1972
269 Ga0068853_100192279 3300005539 Bacteria 1854
270 Ga0070672_100008459 3300005543 Bacteria 7040
271 Ga0070672_100012894 3300005543 Bacteria 5889
272 Ga0070672_100023150 3300005543 Bacteria 4574
273 Ga0070672_100044451 3300005543 Bacteria 3431
274 Ga0070672_100048369 3300005543 Bacteria 3305
275 Ga0070672_100118482 3300005543 Bacteria 2165
276 Ga0070672_100139581 3300005543 Bacteria 1998
277 Ga0070672_100199153 3300005543 Bacteria 1674
278 Ga0070672_100483261 3300005543 Bacteria 1070
279 Ga0070672_100500838 3300005543 Bacteria 1051
280 Ga0070686_100000467 3300005544 Bacteria 24436
281 Ga0070686_100020587 3300005544 Bacteria 3905
282 Ga0070686_100041405 3300005544 Bacteria 2879
283 Ga0070695_100010817 3300005545 Bacteria 5452
284 Ga0070695_100114746 3300005545 Bacteria 1834
285 Ga0070695_100168682 3300005545 Bacteria 1543
286 Ga0070696_100005244 3300005546 Bacteria 8660
287 Ga0070696_100031225 3300005546 Bacteria 3650
288 Ga0070696_100052416 3300005546 Bacteria 2838
289 Ga0070696_100177991 3300005546 Bacteria 1576
290 Ga0070693_100003921 3300005547 Bacteria 6978
291 Ga0070693_100056503 3300005547 Bacteria 2265
292 Ga0070693_100110896 3300005547 Bacteria 1687
293 Ga0070693_100178663 3300005547 Bacteria 1365
294 Ga0070693_100248092 3300005547 Bacteria 1179
295 Ga0070665_100004030 3300005548 Bacteria 15466
296 Ga0070665_100008150 3300005548 Bacteria 10607
297 Ga0070665_100019341 3300005548 Bacteria 6834
298 Ga0070665_100020459 3300005548 Bacteria 6646
299 Ga0070665_100094903 3300005548 Bacteria 2987
300 Ga0070665_100207987 3300005548 Bacteria 1957
301 Ga0070665_100231823 3300005548 Bacteria 1846
302 Ga0070704_100027154 3300005549 Bacteria 3793
303 Ga0070704_100036676 3300005549 Bacteria 3343
304 Ga0070704_100108747 3300005549 Bacteria 2105
305 Ga0070704_100148002 3300005549 Bacteria 1842
306 Ga0070704_100748199 3300005549 Bacteria 870
307 Ga0068855_100002732 3300005563 Bacteria 21749
308 Ga0068855_100006426 3300005563 Bacteria 14310
309 Ga0068855_100011358 3300005563 Bacteria 10752
310 Ga0068855_100037906 3300005563 Bacteria 5729
311 Ga0068855_100041199 3300005563 Bacteria 5475
312 Ga0068855_100073548 3300005563 Bacteria 3970
313 Ga0068855_100110829 3300005563 Bacteria 3150
314 Ga0068855_100225491 3300005563 Bacteria 2100
315 Ga0068855_100258827 3300005563 Bacteria 1939
316 Ga0068855_100386964 3300005563 Bacteria 1535
317 Ga0068855_100488557 3300005563 Bacteria 1339
318 Ga0068855_100642241 3300005563 Bacteria 1141
319 Ga0070664_100000511 3300005564 Bacteria 29475
320 Ga0070664_100004503 3300005564 Bacteria 11178
321 Ga0070664_100005335 3300005564 Bacteria 10315
322 Ga0070664_100060960 3300005564 Bacteria 3214
323 Ga0070664_100246528 3300005564 Bacteria 1605
324 Ga0070664_100448929 3300005564 Bacteria 1184
325 Ga0068857_100034228 3300005577 Bacteria 4493
326 Ga0068857_100087269 3300005577 Bacteria 2790
327 Ga0068857_100096956 3300005577 Bacteria 2643
328 Ga0068857_100112499 3300005577 Bacteria 2447
329 Ga0068857_100134701 3300005577 Bacteria 2230
330 Ga0068857_100287017 3300005577 Bacteria 1515
331 Ga0068854_100017225 3300005578 Bacteria 4831
332 Ga0068854_100141708 3300005578 Bacteria 1845
333 Ga0068854_100250260 3300005578 Bacteria 1415
334 Ga0068854_100416182 3300005578 Bacteria 1115
335 Ga0068856_100007158 3300005614 Bacteria 10878
336 Ga0068856_100011352 3300005614 Bacteria 8641
337 Ga0068856_100017996 3300005614 Bacteria 6851
338 Ga0068856_100026025 3300005614 Bacteria 5706
339 Ga0068856_100059727 3300005614 Bacteria 3766
340 Ga0068856_100065608 3300005614 Bacteria 3588
341 Ga0068856_100129068 3300005614 Bacteria 2532
342 Ga0068856_100151921 3300005614 Bacteria 2325
343 Ga0070702_100003215 3300005615 Bacteria 7263
344 Ga0070702_100039684 3300005615 Bacteria 2628
345 Ga0070702_100511699 3300005615 Bacteria 884
346 Ga0068852_100006625 3300005616 Bacteria 8392
347 Ga0068852_100010689 3300005616 Bacteria 6872
348 Ga0068852_100043293 3300005616 Bacteria 3818
349 Ga0068852_100281497 3300005616 Bacteria 1603
350 Ga0068852_100294195 3300005616 Bacteria 1570
351 Ga0068852_100359607 3300005616 Bacteria 1424
352 Ga0068852_100371297 3300005616 Bacteria 1401
353 Ga0068852_100372797 3300005616 Bacteria 1399
354 Ga0068852_100639553 3300005616 Bacteria 1070
355 Ga0068859_100006866 3300005617 Bacteria 11558
356 Ga0068859_100007090 3300005617 Bacteria 11377
357 Ga0068859_100020538 3300005617 Bacteria 6628
358 Ga0068859_100022814 3300005617 Bacteria 6275
359 Ga0068859_100108822 3300005617 Bacteria 2833
360 Ga0068859_100143840 3300005617 Bacteria 2459
361 Ga0068859_100151458 3300005617 Bacteria 2395
362 Ga0068859_100168489 3300005617 Bacteria 2271
363 Ga0068859_100296861 3300005617 Bacteria 1709
364 Ga0068859_100777206 3300005617 Bacteria 1046
365 Ga0068864_100001045 3300005618 Bacteria 23232
366 Ga0068864_100003588 3300005618 Bacteria 12833
367 Ga0068864_100006726 3300005618 Bacteria 9419
368 Ga0068864_100010086 3300005618 Bacteria 7801
369 Ga0068864_100043765 3300005618 Bacteria 3835
370 Ga0068864_100507111 3300005618 Bacteria 1161
371 Ga0068864_100562841 3300005618 Bacteria 1103
372 Ga0068864_100668327 3300005618 Bacteria 1013
373 Ga0068866_10000316 3300005718 Bacteria 23003
374 Ga0068866_10006289 3300005718 Bacteria 4943
375 Ga0068866_10026634 3300005718 Bacteria 2733
376 Ga0068866_10075337 3300005718 Bacteria 1796
377 Ga0068866_10168736 3300005718 Bacteria 1283
378 Ga0068861_100000641 3300005719 Bacteria 20777
379 Ga0068861_100009372 3300005719 Bacteria 6758
380 Ga0068861_100020224 3300005719 Bacteria 4763
381 Ga0068861_100100178 3300005719 Bacteria 2302
382 Ga0068861_100276739 3300005719 Bacteria 1444
383 Ga0068851_10001933 3300005834 Bacteria 9104
384 Ga0068851_10002235 3300005834 Bacteria 8516
385 Ga0068851_10003453 3300005834 Bacteria 7032
386 Ga0068851_10009319 3300005834 Bacteria 4559
387 Ga0068851_10037904 3300005834 Bacteria 2418
388 Ga0068870_10000992 3300005840 Bacteria 11202
389 Ga0068870_10008695 3300005840 Bacteria 4578
390 Ga0068870_10009180 3300005840 Bacteria 4483
391 Ga0068870_10064048 3300005840 Bacteria 1984
392 Ga0068870_10116494 3300005840 Bacteria 1533
393 Ga0068863_100001612 3300005841 Bacteria 22307
394 Ga0068863_100008594 3300005841 Bacteria 9982
395 Ga0068863_100009929 3300005841 Bacteria 9268
396 Ga0068863_100011872 3300005841 Bacteria 8419
397 Ga0068863_100020431 3300005841 Bacteria 6328
398 Ga0068863_100048728 3300005841 Bacteria 4017
399 Ga0068863_100152542 3300005841 Bacteria 2211
400 Ga0068863_100541631 3300005841 Bacteria 1149
401 Ga0068863_100712763 3300005841 Bacteria 998
402 Ga0068858_100001394 3300005842 Bacteria 24881
403 Ga0068858_100003984 3300005842 Bacteria 14574
404 Ga0068858_100012410 3300005842 Bacteria 8033
405 Ga0068858_100027086 3300005842 Bacteria 5324
406 Ga0068858_100071779 3300005842 Bacteria 3211
407 Ga0068858_100095063 3300005842 Bacteria 2776
408 Ga0068858_100513268 3300005842 Bacteria 1159
409 Ga0068860_100007907 3300005843 Bacteria 10616
410 Ga0068860_100026090 3300005843 Bacteria 5636
411 Ga0068860_100173252 3300005843 Bacteria 2085
412 Ga0068860_100221184 3300005843 Bacteria 1839
413 Ga0068860_100444357 3300005843 Bacteria 1289
414 Ga0068860_100656937 3300005843 Bacteria 1056
415 Ga0068860_100970631 3300005843 Bacteria 867
416 Ga0068862_100012477 3300005844 Bacteria 7033
417 Ga0068862_100037785 3300005844 Bacteria 4093
418 Ga0068862_100054258 3300005844 Bacteria 3431
419 Ga0068862_100068067 3300005844 Bacteria 3071
420 Ga0068862_100132704 3300005844 Bacteria 2204
421 Ga0068862_100402356 3300005844 Bacteria 1281
422 Ga0068862_100451163 3300005844 Bacteria 1212
423 Ga0068862_100539113 3300005844 Bacteria 1113
424 Ga0081539_10014013 3300005985 Bacteria 5973
425 Ga0081539_10075730 3300005985 Bacteria 1786
426 Ga0075365_10014803 3300006038 Bacteria 4701
427 Ga0075364_10033552 3300006051 Bacteria 3306
428 Ga0075364_10082235 3300006051 Bacteria 2131
429 Ga0070715_10019852 3300006163 Bacteria 2583
430 Ga0070716_100009938 3300006173 Bacteria 4758
431 Ga0070712_100014827 3300006175 Bacteria 5008
432 Ga0070712_100217889 3300006175 Bacteria 1509
433 Ga0075362_10005914 3300006177 Bacteria 4520
434 Ga0075367_10015782 3300006178 Bacteria 4114
435 Ga0075366_10058047 3300006195 Bacteria 2299
436 Ga0075366_10070800 3300006195 Bacteria 2077
437 Ga0075366_10083060 3300006195 Bacteria 1914
438 Ga0075366_10098296 3300006195 Bacteria 1756
439 Ga0097621_100000222 3300006237 Bacteria 37946
440 Ga0097621_100070761 3300006237 Bacteria 2881
441 Ga0097621_100087886 3300006237 Bacteria 2596
442 Ga0097621_100104130 3300006237 Bacteria 2391
443 Ga0097621_100161963 3300006237 Bacteria 1923
444 Ga0097621_100166019 3300006237 Bacteria 1901
445 Ga0097621_100316941 3300006237 Bacteria 1380
446 Ga0097621_100516248 3300006237 Bacteria 1084
447 Ga0097621_100589834 3300006237 Bacteria 1015
448 Ga0075370_10072397 3300006353 Bacteria 1973
449 Ga0075370_10079849 3300006353 Bacteria 1879
450 Ga0068871_100001148 3300006358 Bacteria 17759
451 Ga0068871_100001249 3300006358 Bacteria 16987
452 Ga0068871_100026132 3300006358 Bacteria 4552
453 Ga0068871_100039054 3300006358 Bacteria 3796
454 Ga0068871_100040602 3300006358 Bacteria 3727
455 Ga0068871_100055400 3300006358 Bacteria 3219
456 Ga0068871_100092820 3300006358 Bacteria 2518
457 Ga0068871_100199020 3300006358 Bacteria 1729
458 Ga0068871_100210433 3300006358 Bacteria 1682
459 Ga0068871_100251524 3300006358 Bacteria 1539
460 Ga0068871_100256318 3300006358 Bacteria 1525
461 Ga0068871_100271002 3300006358 Bacteria 1483
462 Ga0075428_100015381 3300006844 Bacteria 8485
463 Ga0075428_100155710 3300006844 Bacteria 2483
464 Ga0075428_100205522 3300006844 Bacteria 2128
465 Ga0075428_100784239 3300006844 Bacteria 1013
466 Ga0075430_100161418 3300006846 Bacteria 1865
467 Ga0075430_100240986 3300006846 Bacteria 1498
468 Ga0075431_100001453 3300006847 Bacteria 21848
469 Ga0075433_10003142 3300006852 Bacteria 12717
470 Ga0075434_100017017 3300006871 Bacteria 6997
471 Ga0075434_100109799 3300006871 Bacteria 2769
472 Ga0075434_100244584 3300006871 Bacteria 1814
473 Ga0075434_100441960 3300006871 Bacteria 1322
474 Ga0075429_100010169 3300006880 Bacteria 8145
475 Ga0075429_100064786 3300006880 Bacteria 3182
476 Ga0075429_100258042 3300006880 Bacteria 1526
477 Ga0068865_100003115 3300006881 Bacteria 9921
478 Ga0068865_100007315 3300006881 Bacteria 6784
479 Ga0068865_100164022 3300006881 Bacteria 1697
480 Ga0068865_100180113 3300006881 Bacteria 1627
481 Ga0075436_100017723 3300006914 Bacteria 4874
482 Ga0097620_100006866 3300006931 Bacteria 11558
483 Ga0097620_100007090 3300006931 Bacteria 11377
484 Ga0097620_100020536 3300006931 Bacteria 6628
485 Ga0097620_100022816 3300006931 Bacteria 6275
486 Ga0097620_100108827 3300006931 Bacteria 2833
487 Ga0097620_100143836 3300006931 Bacteria 2459
488 Ga0097620_100151465 3300006931 Bacteria 2395
489 Ga0097620_100168485 3300006931 Bacteria 2271
490 Ga0097620_100296871 3300006931 Bacteria 1709
491 Ga0097620_100777229 3300006931 Bacteria 1046
492 Ga0079104_1011832 3300006946 Bacteria 2780
493 Ga0075435_100098787 3300007076 Bacteria 2417
494 Ga0075435_100432494 3300007076 Bacteria 1134
495 Ga0099794_10029281 3300007265 Bacteria 2565
496 Ga0105251_10002743 3300009011 Bacteria 13485
497 Ga0105251_10052734 3300009011 Bacteria 1935
498 Ga0105244_10037827 3300009036 Bacteria 2520
499 Ga0105250_10041045 3300009092 Bacteria 1855
500 Ga0105240_10005332 3300009093 Bacteria 19184
501 Ga0105240_10007963 3300009093 Bacteria 15281
502 Ga0105240_10010948 3300009093 Bacteria 12707
503 Ga0105240_10051986 3300009093 Bacteria 5152
504 Ga0105240_10052944 3300009093 Bacteria 5099
505 Ga0105240_10055478 3300009093 Bacteria 4961
506 Ga0105240_10087772 3300009093 Bacteria 3808
507 Ga0105240_10103262 3300009093 Bacteria 3464
508 Ga0105240_10153782 3300009093 Bacteria 2738
509 Ga0111539_10035571 3300009094 Bacteria 6029
510 Ga0111539_10109472 3300009094 Bacteria 3242
511 Ga0111539_10149924 3300009094 Bacteria 2730
512 Ga0105245_10007734 3300009098 Bacteria 9411
513 Ga0105245_10018004 3300009098 Bacteria 6170
514 Ga0105245_10108032 3300009098 Bacteria 2584
515 Ga0105245_10311179 3300009098 Bacteria 1549
516 Ga0105245_10539931 3300009098 Bacteria 1187
517 Ga0105245_10849444 3300009098 Bacteria 953
518 Ga0105247_10054934 3300009101 Bacteria 2457
519 Ga0105247_10094990 3300009101 Bacteria 1898
520 Ga0114129_10063609 3300009147 Bacteria 5151
521 Ga0114129_10179602 3300009147 Bacteria 2881
522 Ga0114129_10535004 3300009147 Bacteria 1526
523 Ga0105243_10001049 3300009148 Bacteria 25308
524 Ga0105243_10113509 3300009148 Bacteria 2272
525 Ga0105243_10117717 3300009148 Bacteria 2234
526 Ga0105243_10194756 3300009148 Bacteria 1773
527 Ga0105243_10444280 3300009148 Bacteria 1215
528 Ga0105241_10004999 3300009174 Bacteria 9786
529 Ga0105241_10011388 3300009174 Bacteria 6520
530 Ga0105241_10133171 3300009174 Bacteria 2015
531 Ga0105241_10169090 3300009174 Bacteria 1804
532 Ga0105241_10191296 3300009174 Bacteria 1704
533 Ga0105241_10211915 3300009174 Bacteria 1624
534 Ga0105242_10008617 3300009176 Bacteria 7832
535 Ga0105242_10033636 3300009176 Bacteria 4107
536 Ga0105242_10049504 3300009176 Bacteria 3420
537 Ga0105242_10068530 3300009176 Bacteria 2936
538 Ga0105242_10135717 3300009176 Bacteria 2129
539 Ga0105248_10001582 3300009177 Bacteria 25337
540 Ga0105248_10017598 3300009177 Bacteria 7882
541 Ga0105248_10051646 3300009177 Bacteria 4613
542 Ga0105248_10092385 3300009177 Bacteria 3408
543 Ga0105248_10206169 3300009177 Bacteria 2215
544 Ga0105248_10210479 3300009177 Bacteria 2191
545 Ga0105248_10407780 3300009177 Bacteria 1530
546 Ga0105248_10411363 3300009177 Bacteria 1523
547 Ga0105248_10656181 3300009177 Bacteria 1184
548 Ga0105237_10251541 3300009545 Bacteria 1769
549 Ga0105237_10296207 3300009545 Bacteria 1621
550 Ga0105237_10754237 3300009545 Bacteria 980
551 Ga0105237_10901748 3300009545 Bacteria 891
552 Ga0105238_10018816 3300009551 Bacteria 7030
553 Ga0105238_10020373 3300009551 Bacteria 6751
554 Ga0105238_10022414 3300009551 Bacteria 6437
555 Ga0105238_10024425 3300009551 Bacteria 6161
556 Ga0105238_10188701 3300009551 Bacteria 2038
557 Ga0105238_10275015 3300009551 Bacteria 1665
558 Ga0105238_10294372 3300009551 Bacteria 1606
559 Ga0105238_10592306 3300009551 Bacteria 1116
560 Ga0105249_10032924 3300009553 Bacteria 4691
561 Ga0105249_10044049 3300009553 Bacteria 4059
562 Ga0105249_10152779 3300009553 Bacteria 2224
563 Ga0105249_10487632 3300009553 Bacteria 1276
564 Ga0105249_10807548 3300009553 Bacteria 1002
565 Ga0105249_11066178 3300009553 Bacteria 878
566 Ga0105239_10062662 3300010375 Bacteria 4081
567 Ga0105239_10071336 3300010375 Bacteria 3816
568 Ga0105239_10226037 3300010375 Bacteria 2100
569 Ga0105239_10229772 3300010375 Bacteria 2081
570 Ga0105239_10295711 3300010375 Bacteria 1823
571 Ga0105239_10381096 3300010375 Bacteria 1594
572 Ga0105239_10385023 3300010375 Bacteria 1586
573 Ga0105239_10741509 3300010375 Bacteria 1124
574 Ga0105246_10170701 3300011119 Bacteria 1666
575 Ga0105246_10184760 3300011119 Bacteria 1608
576 Ga0157315_1004490 3300012508 Bacteria 1000
577 Ga0157327_1001229 3300012512 Bacteria 1565
578 Ga0157373_10002207 3300013100 Bacteria 14740
579 Ga0157373_10003362 3300013100 Bacteria 12094
580 Ga0157373_10078122 3300013100 Bacteria 2334
581 Ga0157371_10006571 3300013102 Bacteria 9558
582 Ga0157371_10072528 3300013102 Bacteria 2438
583 Ga0157371_10080385 3300013102 Bacteria 2308
584 Ga0157370_10006295 3300013104 Bacteria 13127
585 Ga0157370_10021285 3300013104 Bacteria 6464
586 Ga0157370_10055287 3300013104 Bacteria 3782
587 Ga0157370_10069027 3300013104 Bacteria 3339
588 Ga0157370_10092677 3300013104 Bacteria 2835
589 Ga0157370_10136259 3300013104 Bacteria 2288
590 Ga0157370_10324205 3300013104 Bacteria 1420
591 Ga0157370_10352702 3300013104 Bacteria 1356
592 Ga0157369_10024453 3300013105 Bacteria 6719
593 Ga0157369_10082302 3300013105 Bacteria 3444
594 Ga0157369_10082556 3300013105 Bacteria 3438
595 Ga0157369_10085636 3300013105 Bacteria 3367
596 Ga0157369_10108729 3300013105 Bacteria 2949
597 Ga0157369_10447990 3300013105 Bacteria 1337
598 Ga0157369_10478192 3300013105 Bacteria 1289
599 Ga0157369_10565825 3300013105 Bacteria 1174
600 Ga0157374_10000101 3300013296 Bacteria 79331
601 Ga0157374_10002126 3300013296 Bacteria 16676
602 Ga0157374_10043144 3300013296 Bacteria 4164
603 Ga0157374_10055941 3300013296 Bacteria 3683
604 Ga0157374_10131964 3300013296 Bacteria 2418
605 Ga0157374_10248666 3300013296 Bacteria 1749
606 Ga0157374_10383346 3300013296 Bacteria 1400
607 Ga0157374_10549002 3300013296 Bacteria 1163
608 Ga0157378_10007717 3300013297 Bacteria 9388
609 Ga0157378_10024000 3300013297 Bacteria 5365
610 Ga0157378_10028450 3300013297 Bacteria 4932
611 Ga0157378_10049210 3300013297 Bacteria 3750
612 Ga0157378_10085967 3300013297 Bacteria 2850
613 Ga0157378_10241503 3300013297 Bacteria 1725
614 Ga0157378_10548527 3300013297 Bacteria 1161
615 Ga0157378_10737532 3300013297 Bacteria 1007
616 Ga0163162_10003900 3300013306 Bacteria 14320
617 Ga0163162_10006452 3300013306 Bacteria 11363
618 Ga0163162_10018193 3300013306 Bacteria 6882
619 Ga0163162_10044644 3300013306 Bacteria 4439
620 Ga0163162_10065842 3300013306 Bacteria 3672
621 Ga0163162_10080823 3300013306 Bacteria 3319
622 Ga0163162_10201339 3300013306 Bacteria 2120
623 Ga0163162_10255263 3300013306 Bacteria 1885
624 Ga0163162_10446604 3300013306 Bacteria 1425
625 Ga0163162_10456554 3300013306 Bacteria 1409
626 Ga0163162_10558562 3300013306 Bacteria 1272
627 Ga0157372_10002893 3300013307 Bacteria 18564
628 Ga0157372_10045423 3300013307 Bacteria 4873
629 Ga0157372_10145144 3300013307 Bacteria 2737
630 Ga0157372_10179119 3300013307 Bacteria 2453
631 Ga0157372_10181975 3300013307 Bacteria 2433
632 Ga0157372_10194953 3300013307 Bacteria 2347
633 Ga0157372_10359702 3300013307 Bacteria 1696
634 Ga0157372_10367836 3300013307 Bacteria 1675
635 Ga0157372_10554664 3300013307 Bacteria 1339
636 Ga0157375_10007225 3300013308 Bacteria 9713
637 Ga0157375_10018533 3300013308 Bacteria 6315
638 Ga0157375_10060413 3300013308 Bacteria 3759
639 Ga0157375_10098277 3300013308 Bacteria 3004
640 Ga0157375_10117652 3300013308 Bacteria 2763
641 Ga0157375_10132095 3300013308 Bacteria 2617
642 Ga0157375_10185804 3300013308 Bacteria 2232
643 Ga0157375_10270160 3300013308 Bacteria 1862
644 Ga0157375_10521293 3300013308 Bacteria 1352
645 Ga0157375_10638439 3300013308 Bacteria 1222
646 Ga0157375_10713847 3300013308 Bacteria 1156
647 Ga0157375_10749460 3300013308 Bacteria 1128
648 Ga0163163_10006567 3300014325 Bacteria 10189
649 Ga0163163_10037640 3300014325 Bacteria 4708
650 Ga0163163_10057777 3300014325 Bacteria 3837
651 Ga0163163_10108091 3300014325 Bacteria 2808
652 Ga0163163_10330598 3300014325 Bacteria 1578
653 Ga0163163_10541784 3300014325 Bacteria 1226
654 Ga0163163_10838443 3300014325 Bacteria 983
655 Ga0157380_10000735 3300014326 Bacteria 20434
656 Ga0157380_10240499 3300014326 Bacteria 1632
657 Ga0157380_10833778 3300014326 Bacteria 942
658 Ga0182008_10023345 3300014497 Bacteria 3160
659 Ga0157377_10007059 3300014745 Bacteria 5396
660 Ga0157377_10328090 3300014745 Bacteria 1019
661 Ga0157379_10000336 3300014968 Bacteria 37683
662 Ga0157379_10003104 3300014968 Bacteria 14052
663 Ga0157379_10045727 3300014968 Bacteria 3907
664 Ga0157379_10287156 3300014968 Bacteria 1498
665 Ga0157376_10001583 3300014969 Bacteria 15040
666 Ga0157376_10003640 3300014969 Bacteria 10638
667 Ga0157376_10010988 3300014969 Bacteria 6652
668 Ga0157376_10072403 3300014969 Bacteria 2932
669 Ga0157376_10076850 3300014969 Bacteria 2854
670 Ga0182006_1024307 3300015261 Bacteria 2500
671 Ga0182007_10030018 3300015262 Bacteria 1859
672 Ga0183361_10004 3300016635 Bacteria 484183
673 Ga0163161_10025976 3300017792 Bacteria 4148
674 Ga0163161_10044095 3300017792 Bacteria 3212
675 Ga0163161_10222345 3300017792 Bacteria 1463
676 Ga0163161_10250839 3300017792 Bacteria 1379
677 Ga0163161_10634731 3300017792 Bacteria 884
678 Ga0206353_10397806 3300020082 Bacteria 1176
679 Ga0213872_10000081 3300021361 Bacteria 88397
680 Ga0213872_10000104 3300021361 Bacteria 78306
681 Ga0213872_10000132 3300021361 Bacteria 67609
682 Ga0213872_10011708 3300021361 Bacteria 4147
683 Ga0213872_10020413 3300021361 Bacteria 3054
684 Ga0213872_10158401 3300021361 Bacteria 986
685 Ga0213876_10013450 3300021384 Bacteria 4346
686 Ga0209435_100080 3300025206 Bacteria 49104
687 Ga0209436_117651 3300025208 Bacteria 1037
688 Ga0209672_102997 3300025228 Bacteria 3707
689 Ga0209147_100004 3300025229 Bacteria 1371850
690 Ga0209563_100013 3300025230 Bacteria 941463
691 Ga0207427_100271 3300025231 Bacteria 39130
692 Ga0209437_100117 3300025233 Bacteria 209271
693 Ga0209258_100759 3300025242 Bacteria 20248
694 Ga0209258_100788 3300025242 Bacteria 19070
695 Ga0209258_103781 3300025242 Bacteria 3113
696 Ga0207425_1004618 3300025245 Bacteria 4081
697 Ga0209646_1000060 3300025246 Bacteria 256386
698 Ga0209646_1000481 3300025246 Bacteria 19783
699 Ga0209026_1000049 3300025250 Bacteria 255273
700 Ga0209026_1000729 3300025250 Bacteria 19150
701 Ga0209677_100823 3300025253 Bacteria 15482
702 Ga0209677_108638 3300025253 Bacteria 1942
703 Ga0209148_1000037 3300025254 Bacteria 494767
704 Ga0209148_1016699 3300025254 Bacteria 1259
705 Ga0209759_1000033 3300025256 Bacteria 276117
706 Ga0209759_1000272 3300025256 Bacteria 73495
707 Ga0209759_1000440 3300025256 Bacteria 48778
708 Ga0209759_1000815 3300025256 Bacteria 24792
709 Ga0209759_1004244 3300025256 Bacteria 5411
710 Ga0209759_1007678 3300025256 Bacteria 3439
711 Ga0209565_1000004 3300025263 Bacteria 983150
712 Ga0209565_1000418 3300025263 Bacteria 34964
713 Ga0209455_1000458 3300025272 Bacteria 30970
714 Ga0209455_1000622 3300025272 Bacteria 22117
715 Ga0209673_1000074 3300025273 Bacteria 233552
716 Ga0209130_1000050 3300025284 Bacteria 222092
717 Ga0209130_1000584 3300025284 Bacteria 35499
718 Ga0209675_1000044 3300025291 Bacteria 230392
719 Ga0209675_1002560 3300025291 Bacteria 9230
720 Ga0209675_1011851 3300025291 Bacteria 2859
721 Ga0209676_1000029 3300025292 Bacteria 520536
722 Ga0209025_1000342 3300025294 Bacteria 102758
723 Ga0209025_1001851 3300025294 Bacteria 24838
724 Ga0209025_1004094 3300025294 Bacteria 13003
725 Ga0209025_1004428 3300025294 Bacteria 12210
726 Ga0209025_1006692 3300025294 Bacteria 8847
727 Ga0209025_1006807 3300025294 Bacteria 8742
728 Ga0209564_1000470 3300025295 Bacteria 67507
729 Ga0209564_1003476 3300025295 Bacteria 10740
730 Ga0209564_1003544 3300025295 Bacteria 10502
731 Ga0209758_1009604 3300025297 Bacteria 5973
732 Ga0209050_1000003 3300025298 Bacteria 1609245
733 Ga0209050_1002573 3300025298 Bacteria 15095
734 Ga0209050_1002886 3300025298 Bacteria 13572
735 Ga0209050_1008201 3300025298 Bacteria 5641
736 Ga0209050_1038283 3300025298 Bacteria 1369
737 Ga0209256_1000001 3300025299 Bacteria 2166974
738 Ga0209256_1000544 3300025299 Bacteria 54207
739 Ga0207426_1000071 3300025302 Bacteria 329539
740 Ga0207426_1001953 3300025302 Bacteria 14709
741 Ga0207426_1003763 3300025302 Bacteria 7907
742 Ga0209051_1000003 3300025303 Bacteria 1609245
743 Ga0209051_1003446 3300025303 Bacteria 10364
744 Ga0209051_1009661 3300025303 Bacteria 4949
745 Ga0209051_1019129 3300025303 Bacteria 3001
746 Ga0209257_1000018 3300025304 Bacteria 836016
747 Ga0209257_1000053 3300025304 Bacteria 425160
748 Ga0209257_1000631 3300025304 Bacteria 56521
749 Ga0207697_10003163 3300025315 Bacteria 8202
750 Ga0207697_10061877 3300025315 Bacteria 1558
751 Ga0207697_10099563 3300025315 Bacteria 1238
752 Ga0207656_10015731 3300025321 Bacteria 2933
753 Ga0207656_10021969 3300025321 Bacteria 2555
754 Ga0207656_10050527 3300025321 Bacteria 1795
755 Ga0207713_1004266 3300025735 Bacteria 9329
756 Ga0207682_10000082 3300025893 Bacteria 42307
757 Ga0207682_10006577 3300025893 Bacteria 4677
758 Ga0207682_10041075 3300025893 Bacteria 1887
759 Ga0207692_10008129 3300025898 Bacteria 4331
760 Ga0207692_10024545 3300025898 Bacteria 2804
761 Ga0207692_10026320 3300025898 Bacteria 2728
762 Ga0207642_10000717 3300025899 Bacteria 10263
763 Ga0207642_10008923 3300025899 Bacteria 3466
764 Ga0207642_10056540 3300025899 Bacteria 1800
765 Ga0207642_10110619 3300025899 Bacteria 1398
766 Ga0207688_10042752 3300025901 Bacteria 2523
767 Ga0207680_10009521 3300025903 Bacteria 4821
768 Ga0207680_10028537 3300025903 Bacteria 3123
769 Ga0207680_10148196 3300025903 Bacteria 1562
770 Ga0207680_10358753 3300025903 Bacteria 1025
771 Ga0207680_10362137 3300025903 Bacteria 1020
772 Ga0207647_10039064 3300025904 Bacteria 2997
773 Ga0207647_10085536 3300025904 Bacteria 1886
774 Ga0207647_10187394 3300025904 Bacteria 1200
775 Ga0207685_10001009 3300025905 Bacteria 5464
776 Ga0207699_10172160 3300025906 Bacteria 1449
777 Ga0207645_10002355 3300025907 Bacteria 14906
778 Ga0207645_10004888 3300025907 Bacteria 9825
779 Ga0207645_10010285 3300025907 Bacteria 6427
780 Ga0207645_10130449 3300025907 Bacteria 1636
781 Ga0207645_10139442 3300025907 Bacteria 1580
782 Ga0207643_10001052 3300025908 Bacteria 16349
783 Ga0207643_10002227 3300025908 Bacteria 10572
784 Ga0207643_10011695 3300025908 Bacteria 4741
785 Ga0207643_10046825 3300025908 Bacteria 2445
786 Ga0207643_10053897 3300025908 Bacteria 2285
787 Ga0207705_10065907 3300025909 Bacteria 2619
788 Ga0207705_10108271 3300025909 Bacteria 2051
789 Ga0207705_10440134 3300025909 Bacteria 1010
790 Ga0207654_10008575 3300025911 Bacteria 5175
791 Ga0207654_10058591 3300025911 Bacteria 2243
792 Ga0207707_10028631 3300025912 Bacteria 4869
793 Ga0207707_10061747 3300025912 Bacteria 3261
794 Ga0207707_10081154 3300025912 Bacteria 2831
795 Ga0207707_10343921 3300025912 Bacteria 1286
796 Ga0207707_10560417 3300025912 Bacteria 970
797 Ga0207707_10635345 3300025912 Bacteria 901
798 Ga0207707_10728006 3300025912 Bacteria 831
799 Ga0207695_10004475 3300025913 Bacteria 19039
800 Ga0207695_10025394 3300025913 Bacteria 6633
801 Ga0207695_10057658 3300025913 Bacteria 4034
802 Ga0207695_10104980 3300025913 Bacteria 2813
803 Ga0207695_10371774 3300025913 Bacteria 1316
804 Ga0207671_10032166 3300025914 Bacteria 3905
805 Ga0207671_10052856 3300025914 Bacteria 3011
806 Ga0207671_10144116 3300025914 Bacteria 1837
807 Ga0207671_10321588 3300025914 Bacteria 1224
808 Ga0207693_10000069 3300025915 Bacteria 90103
809 Ga0207693_10017171 3300025915 Bacteria 5771
810 Ga0207693_10080225 3300025915 Bacteria 2555
811 Ga0207663_10036233 3300025916 Bacteria 2967
812 Ga0207663_10053178 3300025916 Bacteria 2529
813 Ga0207663_10059764 3300025916 Bacteria 2413
814 Ga0207660_10041498 3300025917 Bacteria 3224
815 Ga0207660_10080430 3300025917 Bacteria 2393
816 Ga0207660_10098692 3300025917 Bacteria 2179
817 Ga0207660_10168581 3300025917 Bacteria 1694
818 Ga0207660_10196280 3300025917 Bacteria 1574
819 Ga0207662_10010039 3300025918 Bacteria 5222
820 Ga0207662_10018980 3300025918 Bacteria 3907
821 Ga0207662_10054338 3300025918 Bacteria 2388
822 Ga0207662_10300986 3300025918 Bacteria 1066
823 Ga0207657_10000151 3300025919 Bacteria 70697
824 Ga0207657_10012062 3300025919 Bacteria 8547
825 Ga0207657_10039663 3300025919 Bacteria 4183
826 Ga0207657_10077361 3300025919 Bacteria 2804
827 Ga0207657_10155946 3300025919 Bacteria 1857
828 Ga0207657_10208633 3300025919 Bacteria 1569
829 Ga0207657_10292766 3300025919 Bacteria 1291
830 Ga0207649_10005808 3300025920 Bacteria 6683
831 Ga0207649_10013767 3300025920 Bacteria 4522
832 Ga0207649_10041017 3300025920 Bacteria 2816
833 Ga0207649_10056859 3300025920 Bacteria 2444
834 Ga0207649_10239042 3300025920 Bacteria 1303
835 Ga0207649_10598454 3300025920 Bacteria 848
836 Ga0207652_10013663 3300025921 Bacteria 6565
837 Ga0207652_10047545 3300025921 Bacteria 3665
838 Ga0207652_10052888 3300025921 Bacteria 3488
839 Ga0207652_10066044 3300025921 Bacteria 3134
840 Ga0207652_10079488 3300025921 Bacteria 2865
841 Ga0207652_10187611 3300025921 Bacteria 1859
842 Ga0207652_10342584 3300025921 Bacteria 1349
843 Ga0207646_10009271 3300025922 Bacteria 9740
844 Ga0207646_10524256 3300025922 Bacteria 1066
845 Ga0207681_10011576 3300025923 Bacteria 5419
846 Ga0207681_10034634 3300025923 Bacteria 3321
847 Ga0207681_10137865 3300025923 Bacteria 1813
848 Ga0207681_10171093 3300025923 Bacteria 1646
849 Ga0207681_10190689 3300025923 Bacteria 1568
850 Ga0207681_10206539 3300025923 Bacteria 1511
851 Ga0207681_10235430 3300025923 Bacteria 1423
852 Ga0207681_10472107 3300025923 Bacteria 1023
853 Ga0207694_10020992 3300025924 Bacteria 4944
854 Ga0207694_10027012 3300025924 Bacteria 4370
855 Ga0207694_10047563 3300025924 Bacteria 3318
856 Ga0207694_10062916 3300025924 Bacteria 2890
857 Ga0207694_10167502 3300025924 Bacteria 1777
858 Ga0207694_10184149 3300025924 Bacteria 1694
859 Ga0207694_10219451 3300025924 Bacteria 1550
860 Ga0207694_10247277 3300025924 Bacteria 1459
861 Ga0207650_10004791 3300025925 Bacteria 9247
862 Ga0207650_10011760 3300025925 Bacteria 6034
863 Ga0207650_10034508 3300025925 Bacteria 3669
864 Ga0207650_10042217 3300025925 Bacteria 3345
865 Ga0207650_10074583 3300025925 Bacteria 2558
866 Ga0207650_10079443 3300025925 Bacteria 2484
867 Ga0207650_10080023 3300025925 Bacteria 2476
868 Ga0207650_10085248 3300025925 Bacteria 2403
869 Ga0207650_10094146 3300025925 Bacteria 2294
870 Ga0207650_10134148 3300025925 Bacteria 1940
871 Ga0207650_10178986 3300025925 Bacteria 1689
872 Ga0207650_10404321 3300025925 Bacteria 1131
873 Ga0207659_10007542 3300025926 Bacteria 6700
874 Ga0207659_10008038 3300025926 Bacteria 6530
875 Ga0207659_10028928 3300025926 Bacteria 3770
876 Ga0207659_10032593 3300025926 Bacteria 3578
877 Ga0207659_10068289 3300025926 Bacteria 2585
878 Ga0207659_10103945 3300025926 Bacteria 2147
879 Ga0207659_10414818 3300025926 Bacteria 1128
880 Ga0207659_10701947 3300025926 Bacteria 866
881 Ga0207659_10720696 3300025926 Bacteria 855
882 Ga0207659_10796364 3300025926 Bacteria 812
883 Ga0207687_10001955 3300025927 Bacteria 14185
884 Ga0207687_10003815 3300025927 Bacteria 10129
885 Ga0207687_10177980 3300025927 Bacteria 1645
886 Ga0207700_10000065 3300025928 Bacteria 65305
887 Ga0207700_10007518 3300025928 Bacteria 6664
888 Ga0207700_10297979 3300025928 Bacteria 1391
889 Ga0207664_10081146 3300025929 Bacteria 2638
890 Ga0207664_10113619 3300025929 Bacteria 2255
891 Ga0207664_10311233 3300025929 Bacteria 1387
892 Ga0207664_10415902 3300025929 Bacteria 1197
893 Ga0207664_10623080 3300025929 Bacteria 969
894 Ga0207644_10013680 3300025931 Bacteria 5416
895 Ga0207644_10027774 3300025931 Bacteria 3912
896 Ga0207644_10104092 3300025931 Bacteria 2136
897 Ga0207644_10115397 3300025931 Bacteria 2036
898 Ga0207644_10171596 3300025931 Bacteria 1693
899 Ga0207644_10477413 3300025931 Bacteria 1026
900 Ga0207690_10002121 3300025932 Bacteria 12149
901 Ga0207690_10164032 3300025932 Bacteria 1659
902 Ga0207690_10171859 3300025932 Bacteria 1624
903 Ga0207690_10184497 3300025932 Bacteria 1573
904 Ga0207690_10201593 3300025932 Bacteria 1512
905 Ga0207690_10357628 3300025932 Bacteria 1156
906 Ga0207706_10000045 3300025933 Bacteria 120758
907 Ga0207706_10019809 3300025933 Bacteria 6049
908 Ga0207706_10046407 3300025933 Bacteria 3846
909 Ga0207706_10149404 3300025933 Bacteria 2055
910 Ga0207706_10191005 3300025933 Bacteria 1798
911 Ga0207686_10000845 3300025934 Bacteria 18612
912 Ga0207686_10014544 3300025934 Bacteria 4384
913 Ga0207686_10035797 3300025934 Bacteria 2983
914 Ga0207686_10037045 3300025934 Bacteria 2941
915 Ga0207686_10045954 3300025934 Bacteria 2690
916 Ga0207686_10095494 3300025934 Bacteria 1973
917 Ga0207709_10014580 3300025935 Bacteria 4343
918 Ga0207709_10027760 3300025935 Bacteria 3265
919 Ga0207709_10159096 3300025935 Bacteria 1573
920 Ga0207709_10262608 3300025935 Bacteria 1267
921 Ga0207670_10015418 3300025936 Bacteria 4566
922 Ga0207670_10050297 3300025936 Bacteria 2792
923 Ga0207669_10061366 3300025937 Bacteria 2310
924 Ga0207669_10154658 3300025937 Bacteria 1611
925 Ga0207669_10175810 3300025937 Bacteria 1529
926 Ga0207669_10241525 3300025937 Bacteria 1339
927 Ga0207669_10243469 3300025937 Bacteria 1334
928 Ga0207669_10246999 3300025937 Bacteria 1326
929 Ga0207704_10005678 3300025938 Bacteria 5767
930 Ga0207704_10006884 3300025938 Bacteria 5335
931 Ga0207704_10012648 3300025938 Bacteria 4193
932 Ga0207704_10460681 3300025938 Bacteria 1017
933 Ga0207665_10033149 3300025939 Bacteria 3422
934 Ga0207665_10140526 3300025939 Bacteria 1721
935 Ga0207691_10000316 3300025940 Bacteria 48235
936 Ga0207691_10000338 3300025940 Bacteria 47065
937 Ga0207691_10001034 3300025940 Bacteria 27579
938 Ga0207691_10021310 3300025940 Bacteria 6120
939 Ga0207691_10022502 3300025940 Bacteria 5944
940 Ga0207691_10029470 3300025940 Bacteria 5135
941 Ga0207691_10030708 3300025940 Bacteria 5019
942 Ga0207691_10042058 3300025940 Bacteria 4214
943 Ga0207691_10109538 3300025940 Bacteria 2457
944 Ga0207691_10192109 3300025940 Bacteria 1780
945 Ga0207691_10352878 3300025940 Bacteria 1258
946 Ga0207711_10000164 3300025941 Bacteria 71542
947 Ga0207711_10002873 3300025941 Bacteria 15098
948 Ga0207711_10048728 3300025941 Bacteria 3625
949 Ga0207711_10366130 3300025941 Bacteria 1336
950 Ga0207711_10482233 3300025941 Bacteria 1155
951 Ga0207711_10590307 3300025941 Bacteria 1036
952 Ga0207711_10680992 3300025941 Bacteria 959
953 Ga0207689_10000136 3300025942 Bacteria 62820
954 Ga0207689_10000889 3300025942 Bacteria 28731
955 Ga0207689_10006468 3300025942 Bacteria 10353
956 Ga0207689_10008327 3300025942 Bacteria 9033
957 Ga0207689_10035481 3300025942 Bacteria 4143
958 Ga0207689_10107284 3300025942 Bacteria 2295
959 Ga0207689_10186836 3300025942 Bacteria 1709
960 Ga0207661_10013035 3300025944 Bacteria 6066
961 Ga0207661_10030076 3300025944 Bacteria 4179
962 Ga0207661_10050108 3300025944 Bacteria 3325
963 Ga0207661_10055964 3300025944 Bacteria 3165
964 Ga0207679_10003393 3300025945 Bacteria 9826
965 Ga0207679_10003765 3300025945 Bacteria 9398
966 Ga0207679_10021822 3300025945 Bacteria 4349
967 Ga0207679_10023459 3300025945 Bacteria 4220
968 Ga0207679_10048055 3300025945 Bacteria 3104
969 Ga0207679_10223762 3300025945 Bacteria 1584
970 Ga0207679_10250192 3300025945 Bacteria 1506
971 Ga0207679_10676334 3300025945 Bacteria 935
972 Ga0207667_10004085 3300025949 Bacteria 17932
973 Ga0207667_10004150 3300025949 Bacteria 17803
974 Ga0207667_10005013 3300025949 Bacteria 16183
975 Ga0207667_10027186 3300025949 Bacteria 6234
976 Ga0207667_10039264 3300025949 Bacteria 5046
977 Ga0207667_10046288 3300025949 Bacteria 4606
978 Ga0207667_10056153 3300025949 Bacteria 4137
979 Ga0207667_10060441 3300025949 Bacteria 3966
980 Ga0207667_10141143 3300025949 Bacteria 2480
981 Ga0207667_10177224 3300025949 Bacteria 2190
982 Ga0207667_10241642 3300025949 Bacteria 1848
983 Ga0207667_10442418 3300025949 Bacteria 1321
984 Ga0207667_10669534 3300025949 Bacteria 1042
985 Ga0207651_10007222 3300025960 Bacteria 5906
986 Ga0207651_10017942 3300025960 Bacteria 4196
987 Ga0207651_10023887 3300025960 Bacteria 3770
988 Ga0207651_10049282 3300025960 Bacteria 2852
989 Ga0207651_10053465 3300025960 Bacteria 2761
990 Ga0207651_10097968 3300025960 Bacteria 2167
991 Ga0207712_10012054 3300025961 Bacteria 5520
992 Ga0207712_10174793 3300025961 Bacteria 1682
993 Ga0207712_10301262 3300025961 Bacteria 1315
994 Ga0207668_10006032 3300025972 Bacteria 7145
995 Ga0207668_10007633 3300025972 Bacteria 6438
996 Ga0207668_10014248 3300025972 Bacteria 4918
997 Ga0207668_10022713 3300025972 Bacteria 4021
998 Ga0207668_10025826 3300025972 Bacteria 3806
999 Ga0207668_10044136 3300025972 Bacteria 3030
1000 Ga0207668_10271061 3300025972 Bacteria 1387
1001 Ga0207668_10607131 3300025972 Bacteria 953
1002 Ga0207668_10694170 3300025972 Bacteria 894
1003 Ga0207640_10032658 3300025981 Bacteria 3229
1004 Ga0207640_10093425 3300025981 Bacteria 2090
1005 Ga0207640_10154240 3300025981 Bacteria 1691
1006 Ga0207640_10167128 3300025981 Bacteria 1635
1007 Ga0207640_10227438 3300025981 Bacteria 1432
1008 Ga0207640_10333230 3300025981 Bacteria 1213
1009 Ga0207658_10002886 3300025986 Bacteria 12320
1010 Ga0207658_10010048 3300025986 Bacteria 6429
1011 Ga0207658_10011457 3300025986 Bacteria 6034
1012 Ga0207658_10056071 3300025986 Bacteria 2922
1013 Ga0207658_10180650 3300025986 Bacteria 1746
1014 Ga0207658_10208881 3300025986 Bacteria 1635
1015 Ga0207658_10324036 3300025986 Bacteria 1334
1016 Ga0207677_10000092 3300026023 Bacteria 73792
1017 Ga0207677_10035476 3300026023 Bacteria 3240
1018 Ga0207677_10059609 3300026023 Bacteria 2633
1019 Ga0207677_10169237 3300026023 Bacteria 1707
1020 Ga0207677_10545677 3300026023 Bacteria 1009
1021 Ga0207703_10000506 3300026035 Bacteria 40394
1022 Ga0207703_10004214 3300026035 Bacteria 11854
1023 Ga0207703_10014986 3300026035 Bacteria 6050
1024 Ga0207703_10081584 3300026035 Bacteria 2696
1025 Ga0207639_10132173 3300026041 Bacteria 2068
1026 Ga0207639_10157971 3300026041 Bacteria 1907
1027 Ga0207639_10237960 3300026041 Bacteria 1581
1028 Ga0207639_10276334 3300026041 Bacteria 1475
1029 Ga0207639_10351962 3300026041 Bacteria 1316
1030 Ga0207639_10357246 3300026041 Bacteria 1306
1031 Ga0207678_10002764 3300026067 Bacteria 15882
1032 Ga0207678_10005468 3300026067 Bacteria 11361
1033 Ga0207678_10007894 3300026067 Bacteria 9388
1034 Ga0207678_10014773 3300026067 Bacteria 6871
1035 Ga0207678_10133036 3300026067 Bacteria 2122
1036 Ga0207678_10150853 3300026067 Bacteria 1984
1037 Ga0207678_10441811 3300026067 Bacteria 1130
1038 Ga0207678_10477706 3300026067 Bacteria 1085
1039 Ga0207678_10484983 3300026067 Bacteria 1077
1040 Ga0207708_10000464 3300026075 Bacteria 31415
1041 Ga0207708_10022897 3300026075 Bacteria 4719
1042 Ga0207708_10041861 3300026075 Bacteria 3492
1043 Ga0207708_10496569 3300026075 Bacteria 1022
1044 Ga0207702_10002581 3300026078 Bacteria 17033
1045 Ga0207702_10010013 3300026078 Bacteria 7949
1046 Ga0207702_10011289 3300026078 Bacteria 7446
1047 Ga0207702_10013322 3300026078 Bacteria 6838
1048 Ga0207702_10067235 3300026078 Bacteria 3075
1049 Ga0207702_10109585 3300026078 Bacteria 2452
1050 Ga0207641_10003632 3300026088 Bacteria 13601
1051 Ga0207641_10005922 3300026088 Bacteria 10367
1052 Ga0207641_10008864 3300026088 Bacteria 8307
1053 Ga0207641_10011137 3300026088 Bacteria 7378
1054 Ga0207641_10044889 3300026088 Bacteria 3718
1055 Ga0207641_10046818 3300026088 Bacteria 3646
1056 Ga0207641_10127513 3300026088 Bacteria 2280
1057 Ga0207641_10156765 3300026088 Bacteria 2066
1058 Ga0207641_10247563 3300026088 Bacteria 1663
1059 Ga0207648_10000684 3300026089 Bacteria 37958
1060 Ga0207648_10001366 3300026089 Bacteria 26971
1061 Ga0207648_10004085 3300026089 Bacteria 15124
1062 Ga0207648_10008908 3300026089 Bacteria 9659
1063 Ga0207648_10050071 3300026089 Bacteria 3653
1064 Ga0207648_10063075 3300026089 Bacteria 3231
1065 Ga0207648_10232541 3300026089 Bacteria 1640
1066 Ga0207648_10256233 3300026089 Bacteria 1560
1067 Ga0207648_10338045 3300026089 Bacteria 1355
1068 Ga0207648_10459022 3300026089 Bacteria 1161
1069 Ga0207676_10000121 3300026095 Bacteria 68688
1070 Ga0207676_10004876 3300026095 Bacteria 9496
1071 Ga0207676_10010720 3300026095 Bacteria 6534
1072 Ga0207676_10021343 3300026095 Bacteria 4750
1073 Ga0207676_10029406 3300026095 Bacteria 4114
1074 Ga0207676_10031843 3300026095 Bacteria 3968
1075 Ga0207676_10044175 3300026095 Bacteria 3436
1076 Ga0207676_10090343 3300026095 Bacteria 2513
1077 Ga0207676_10232789 3300026095 Bacteria 1648
1078 Ga0207676_10344716 3300026095 Bacteria 1376
1079 Ga0207674_10000225 3300026116 Bacteria 70648
1080 Ga0207674_10001745 3300026116 Bacteria 27816
1081 Ga0207674_10003791 3300026116 Bacteria 18445
1082 Ga0207674_10005488 3300026116 Bacteria 15061
1083 Ga0207674_10006478 3300026116 Bacteria 13764
1084 Ga0207674_10047615 3300026116 Bacteria 4393
1085 Ga0207674_10130296 3300026116 Bacteria 2479
1086 Ga0207674_10155859 3300026116 Bacteria 2239
1087 Ga0207674_10476873 3300026116 Bacteria 1206
1088 Ga0207675_100000213 3300026118 Bacteria 54289
1089 Ga0207675_100000855 3300026118 Bacteria 30355
1090 Ga0207675_100037223 3300026118 Bacteria 4539
1091 Ga0207675_100057980 3300026118 Bacteria 3614
1092 Ga0207675_100159518 3300026118 Bacteria 2151
1093 Ga0207675_100159573 3300026118 Bacteria 2150
1094 Ga0207675_100180708 3300026118 Bacteria 2020
1095 Ga0207675_100434927 3300026118 Bacteria 1298
1096 Ga0207675_100473994 3300026118 Bacteria 1243
1097 Ga0207683_10000121 3300026121 Bacteria 64376
1098 Ga0207683_10000281 3300026121 Bacteria 45555
1099 Ga0207683_10003368 3300026121 Bacteria 13933
1100 Ga0207683_10006240 3300026121 Bacteria 10220
1101 Ga0207683_10008506 3300026121 Bacteria 8784
1102 Ga0207683_10010771 3300026121 Bacteria 7797
1103 Ga0207683_10071847 3300026121 Bacteria 3060
1104 Ga0207683_10310082 3300026121 Bacteria 1444
1105 Ga0207683_10545596 3300026121 Bacteria 1072
1106 Ga0207698_10003670 3300026142 Bacteria 9273
1107 Ga0207698_10010928 3300026142 Bacteria 5863
1108 Ga0207698_10032050 3300026142 Bacteria 3803
1109 Ga0207698_10205246 3300026142 Bacteria 1768
1110 Ga0207698_10281897 3300026142 Bacteria 1537
1111 Ga0207698_10314649 3300026142 Bacteria 1463
1112 Ga0207698_10505070 3300026142 Bacteria 1177
1113 Ga0209371_1010418 3300027312 Bacteria 2860
1114 Ga0209969_1012955 3300027360 Bacteria 1205
1115 Ga0209981_1005979 3300027378 Bacteria 1624
1116 Ga0209996_1001078 3300027395 Bacteria 3252
1117 Ga0209996_1009978 3300027395 Bacteria 1255
1118 Ga0210000_1018837 3300027462 Bacteria 1049
1119 Ga0209995_1005683 3300027471 Bacteria 2004
1120 Ga0209968_1000987 3300027526 Bacteria 4373
1121 Ga0209999_1006228 3300027543 Bacteria 2142
1122 Ga0209982_1013388 3300027552 Bacteria 1235
1123 Ga0209970_1000504 3300027614 Bacteria 6703
1124 Ga0209983_1008586 3300027665 Bacteria 2089
1125 Ga0209971_1009975 3300027682 Bacteria 2246
1126 Ga0209971_1022202 3300027682 Bacteria 1511
1127 Ga0209966_1000138 3300027695 Bacteria 30805
1128 Ga0209974_10002121 3300027876 Bacteria 7260
1129 Ga0209974_10024770 3300027876 Bacteria 1985
1130 Ga0209974_10027418 3300027876 Bacteria 1885
1131 Ga0209974_10062921 3300027876 Bacteria 1258
1132 Ga0207428_10013439 3300027907 Bacteria 7151
1133 Ga0207428_10177058 3300027907 Bacteria 1613
1134 Ga0268266_10014216 3300028379 Bacteria 6847
1135 Ga0268266_10022829 3300028379 Bacteria 5326
1136 Ga0268266_10048019 3300028379 Bacteria 3658
1137 Ga0268266_10299933 3300028379 Bacteria 1499
1138 Ga0268266_10498499 3300028379 Bacteria 1162
1139 Ga0268266_10510854 3300028379 Bacteria 1148
1140 Ga0268265_10050352 3300028380 Bacteria 3138
1141 Ga0268265_10053828 3300028380 Bacteria 3050
1142 Ga0268265_10073856 3300028380 Bacteria 2665
1143 Ga0268265_10290441 3300028380 Bacteria 1467
1144 Ga0268265_10700427 3300028380 Bacteria 978
1145 Ga0268264_10007565 3300028381 Bacteria 9061
1146 Ga0268264_10014520 3300028381 Bacteria 6472
1147 Ga0268264_10016351 3300028381 Bacteria 6075
1148 Ga0268264_10028647 3300028381 Bacteria 4558
1149 Ga0268264_10144510 3300028381 Bacteria 2125
1150 Ga0268264_10185110 3300028381 Bacteria 1894
1151 Ga0268264_10364201 3300028381 Bacteria 1380
1152 Ga0268264_10441999 3300028381 Bacteria 1258
1153 Ga0265336_10000040 3300028666 Bacteria 138266
1154 Ga0307515_10022881 3300028794 Bacteria 10992
1155 Ga0265324_10001969 3300029957 Bacteria 11010
1156 Ga0268256_1011174 3300030500 Bacteria 2860
1157 Ga0307511_10004027 3300030521 Bacteria 15028
1158 Ga0265760_10075064 3300031090 Bacteria 1041
1159 Ga0265320_10011984 3300031240 Bacteria 5074
1160 Ga0265339_10003247 3300031249 Bacteria 11394
1161 Ga0265331_10056087 3300031250 Bacteria 1872
1162 Ga0265316_10056387 3300031344 Bacteria 3069
1163 Ga0307513_10000014 3300031456 Bacteria 303157
1164 Ga0307509_10108266 3300031507 Bacteria 2793
1165 Ga0307408_100016188 3300031548 Bacteria 4972
1166 Ga0307408_100115037 3300031548 Bacteria 2074
1167 Ga0265313_10018912 3300031595 Bacteria 3853
1168 Ga0265313_10045468 3300031595 Bacteria 2138
1169 Ga0307508_10319699 3300031616 Bacteria 1144
1170 Ga0265314_10008372 3300031711 Bacteria 8863
1171 Ga0265342_10004326 3300031712 Bacteria 11240
1172 Ga0265342_10014320 3300031712 Bacteria 5269
1173 Ga0307516_10144330 3300031730 Bacteria 2147
1174 Ga0307413_10081564 3300031824 Bacteria 2074
1175 Ga0307413_10188359 3300031824 Bacteria 1479
1176 Ga0307410_10169969 3300031852 Bacteria 1642
1177 Ga0307410_10184959 3300031852 Bacteria 1580
1178 Ga0307406_10009098 3300031901 Bacteria 5558
1179 Ga0307406_10256170 3300031901 Bacteria 1321
1180 Ga0307407_10006322 3300031903 Bacteria 5246
1181 Ga0307407_10227006 3300031903 Bacteria 1266
1182 Ga0307412_10000059 3300031911 Bacteria 138772
1183 Ga0307412_10061948 3300031911 Bacteria 2517
1184 Ga0307412_10205611 3300031911 Bacteria 1498
1185 Ga0307409_100038309 3300031995 Bacteria 3544
1186 Ga0307416_100049321 3300032002 Bacteria 3347
1187 Ga0307416_100055199 3300032002 Bacteria 3198
1188 Ga0307416_100276979 3300032002 Bacteria 1651
1189 Ga0307416_100325020 3300032002 Bacteria 1543
1190 Ga0307416_100434728 3300032002 Bacteria 1361
1191 Ga0307416_101034194 3300032002 Bacteria 925
1192 Ga0307414_10072710 3300032004 Bacteria 2485
1193 Ga0307411_10006981 3300032005 Bacteria 5703
1194 Ga0307507_10069599 3300033179 Bacteria 3200
1195 Ga0373959_0009971 3300034820 Bacteria 1651
1196 Ga0373934_0010219 3300035086 Bacteria 3523
1197 Ga0373934_0144853 3300035086 Bacteria 972
1198 Ga0373923_0046028 3300035111 Bacteria 1813
1199 Ga0373923_0226649 3300035111 Bacteria 870
1200 Ga0373945_0015509 3300035116 Bacteria 2564
1201 Ga0373945_0026059 3300035116 Bacteria 2035
1202 Ga0373953_0009840 3300035117 Bacteria 3308
1203 Ga0373953_0067837 3300035117 Bacteria 1468
1204 Ga0373954_0010596 3300035118 Bacteria 4070
1205 Ga0373954_0025613 3300035118 Bacteria 2698
1206 Ga0373956_0004626 3300035119 Bacteria 5499
1207 Ga0373957_0024247 3300035120 Bacteria 2177
1208 Ga0373943_0008558 3300035170 Bacteria 4587
1209 Ga0373943_0034893 3300035170 Bacteria 2401
1210 Ga0373943_0038302 3300035170 Bacteria 2304
1211 Ga0373946_0011410 3300035171 Bacteria 3315
1212 Ga0373946_0032950 3300035171 Bacteria 2083
1213 Ga0373946_0135530 3300035171 Bacteria 1137
1214 Ga0373955_0111495 3300035172 Bacteria 1582
1215 Ga0373924_0042033 3300035410 Bacteria 1874
1216 Ga0373931_0004585 3300035691 Bacteria 6324
1217 Ga0373931_0008340 3300035691 Bacteria 4908
1218 Ga0373935_0069216 3300035692 Bacteria 2272
1219 Ga0373935_0205764 3300035692 Bacteria 1362
1220 Ga0373935_0363139 3300035692 Bacteria 1034
1221 Ga0373927_0019638 3300035695 Bacteria 4430
1222 Ga0373927_0057677 3300035695 Bacteria 2511
1223 Ga0373927_0105906 3300035695 Bacteria 1831
1224 Ga0373933_0022808 3300035724 Bacteria 3569
1225 Ga0373933_0293637 3300035724 Bacteria 1051
1226 Ga0373947_0010110 3300035725 Bacteria 5417
1227 Ga0373947_0024048 3300035725 Bacteria 3547
1228 Ga0373947_0549328 3300035725 Bacteria 786
1229 Ga0373937_0001683 3300036401 Bacteria 18592
1230 Ga0373937_0039849 3300036401 Bacteria 4281
1231 Ga0373937_0242898 3300036401 Bacteria 1697
1232 Ga0373937_0436245 3300036401 Bacteria 1243
1233 Ga0373925_0124205 3300037068 Bacteria 2006
1234 Ga0373925_0382290 3300037068 Bacteria 1146
1235 Ga0395899_0009973 3300037312 Bacteria 7285
1236 Ga0395899_0034497 3300037312 Bacteria 3800
1237 Ga0395899_0288594 3300037312 Bacteria 1114
1238 Ga0395900_0001667 3300037418 Bacteria 25970
1239 Ga0395900_0048750 3300037418 Bacteria 4363
1240 Ga0395900_0088562 3300037418 Bacteria 3182
1241 Ga0395900_0097779 3300037418 Bacteria 3016
1242 Ga0395900_0309033 3300037418 Bacteria 1564
1243 Ga0395900_0411504 3300037418 Bacteria 1314
1244 Ga0395898_0004523 3300037466 Bacteria 15190
1245 Ga0395898_0116565 3300037466 Bacteria 2559
1246 Ga0395898_0137478 3300037466 Bacteria 2339
1247 Ga0395905_0000071 3300037471 Bacteria 174580
1248 Ga0395905_0029519 3300037471 Bacteria 5166
1249 Ga0395905_0033370 3300037471 Bacteria 4835
1250 Ga0395905_0092936 3300037471 Bacteria 2829
1251 Ga0436364_1275388 3300037853 Bacteria 2804
1252 Ga0395901_0000095 3300038443 Bacteria 119290
1253 Ga0395901_0036040 3300038443 Bacteria 5112
1254 Ga0395901_0056760 3300038443 Bacteria 4073
1255 Ga0395901_0060912 3300038443 Bacteria 3928
1256 Ga0395901_0105442 3300038443 Bacteria 2958
1257 Ga0395901_0179409 3300038443 Bacteria 2221
1258 Ga0436365_0796717 3300039437 Bacteria 4335
1259 Ga0436361_0107660 3300039447 Bacteria 63286
1260 Ga0436361_0453531 3300039447 Bacteria 1496
1261 Ga0436361_0487098 3300039447 Bacteria 4252
1262 Ga0436361_0745691 3300039447 Bacteria 89622
1263 Ga0436361_0805654 3300039447 Bacteria 2054
1264 Ga0436361_1206467 3300039447 Bacteria 80244
1265 Ga0439465_0019172 3300041413 Bacteria 2139
1266 Ga0451798_0358443 3300041458 Bacteria 919
1267 Ga0451807_1547476 3300041486 Bacteria 930
1268 Ga0451853_2590518 3300041512 Bacteria 1538
1269 Ga0439435_0066000 3300042436 Bacteria 1063
1270 Ga0450893_0020799 3300042532 Bacteria 1130
1271 Ga0451577_0005590 3300042876 Bacteria 12795
1272 Ga0451577_0007354 3300042876 Bacteria 10826
1273 Ga0451577_0008741 3300042876 Bacteria 9820
1274 Ga0451577_0076280 3300042876 Bacteria 2989
1275 Ga0451577_0140387 3300042876 Bacteria 2171
1276 Ga0451577_0154158 3300042876 Bacteria 2067
1277 Ga0466969_0001965 3300044656 Bacteria 10990
1278 Ga0466972_0000084 3300044658 Bacteria 86336
1279 Ga0466972_0005185 3300044658 Bacteria 6524
1280 Ga0466982_0008424 3300044672 Bacteria 5185
1281 Ga0466965_0004304 3300044683 Bacteria 6325
1282 Ga0466965_0009948 3300044683 Bacteria 4425
1283 Ga0466966_0000586 3300044684 Bacteria 23168
1284 Ga0466966_0015399 3300044684 Bacteria 5056
1285 Ga0466961_0001415 3300044693 Bacteria 14877
1286 Ga0466961_0006560 3300044693 Bacteria 7395
1287 Ga0466961_0123640 3300044693 Bacteria 1624
1288 Ga0466963_0053293 3300044694 Bacteria 2686
1289 Ga0466964_0012708 3300044706 Bacteria 3187
1290 Ga0466964_0048842 3300044706 Bacteria 1731
1291 Ga0466964_0072036 3300044706 Bacteria 1463
1292 Ga0466964_0097806 3300044706 Bacteria 1288
1293 Ga0453684_0038361 3300044712 Bacteria 6552
1294 Ga0453684_0252699 3300044712 Bacteria 2024
1295 Ga0453684_0324555 3300044712 Bacteria 1742
1296 Ga0453684_0373913 3300044712 Bacteria 1601
1297 Ga0453684_0552277 3300044712 Bacteria 1268
1298 Ga0466971_0009896 3300044719 Bacteria 4164
1299 Ga0466960_0118273 3300044901 Bacteria 1385
1300 Ga0466960_0140072 3300044901 Bacteria 1284
1301 Ga0466960_0237523 3300044901 Bacteria 1008
1302 Ga0466959_0010505 3300045049 Bacteria 6621
1303 Ga0466959_0033595 3300045049 Bacteria 3794
1304 Ga0451576_0003357 3300045051 Bacteria 22176
1305 Ga0451576_0015971 3300045051 Bacteria 8299
1306 Ga0451576_0048382 3300045051 Bacteria 4467
1307 Ga0466958_0143803 3300045836 Bacteria 1502
1308 Ga0466958_0226025 3300045836 Bacteria 1195
1309 Ga0466967_0010897 3300045976 Bacteria 6850
1310 Ga0466967_0235320 3300045976 Bacteria 1745
1311 Ga0466967_0464283 3300045976 Bacteria 1239
1312 Ga0495592_0093928 3300046454 Bacteria 2147
1313 Ga0495603_0011710 3300046455 Bacteria 5308
1314 Ga0495590_0015933 3300046457 Bacteria 2718
1315 Ga0495591_001235 3300046458 Bacteria 16515
1316 Ga0495629_0011435 3300046459 Bacteria 6447
1317 Ga0495629_0013424 3300046459 Bacteria 5909
1318 Ga0495629_0025910 3300046459 Bacteria 4166
1319 Ga0495651_0031194 3300046462 Bacteria 4157
1320 Ga0495651_0077070 3300046462 Bacteria 2524
1321 Ga0495651_0199113 3300046462 Bacteria 1403
1322 Ga0495653_0035337 3300046463 Bacteria 3945
1323 Ga0495653_0101167 3300046463 Bacteria 2088
1324 Ga0495650_0003970 3300046471 Bacteria 10396
1325 Ga0495650_0009757 3300046471 Bacteria 5433
1326 Ga0495650_0104765 3300046471 Bacteria 1058
1327 Ga0495580_0098520 3300046472 Bacteria 2033
1328 Ga0495580_0128610 3300046472 Bacteria 1757
1329 Ga0495580_0296523 3300046472 Bacteria 1101
1330 Ga0495582_0009817 3300046473 Bacteria 5272
1331 Ga0495639_0067302 3300046475 Bacteria 1649
1332 Ga0495662_0036255 3300046476 Bacteria 2380
1333 Ga0495662_0084613 3300046476 Bacteria 1544
1334 Ga0495664_0037859 3300046477 Bacteria 2847
1335 Ga0495664_0045779 3300046477 Bacteria 2595
1336 Ga0495664_0059767 3300046477 Bacteria 2269
1337 Ga0495585_0015782 3300046492 Bacteria 4386
1338 Ga0495596_0010328 3300046500 Bacteria 4068
1339 Ga0495583_0000046 3300046506 Bacteria 218059
1340 Ga0495583_0003496 3300046506 Bacteria 11897
1341 Ga0495606_0008997 3300046507 Bacteria 8542
1342 Ga0495606_0009638 3300046507 Bacteria 8135
1343 Ga0495606_0200061 3300046507 Bacteria 1139
1344 Ga0495608_0020916 3300046511 Bacteria 4494
1345 Ga0495610_0000624 3300046512 Bacteria 35024
1346 Ga0495618_0005918 3300046514 Bacteria 7430
1347 Ga0495618_0192781 3300046514 Bacteria 1292
1348 Ga0495620_0002905 3300046515 Bacteria 9845
1349 Ga0495628_0005536 3300046516 Bacteria 11055
1350 Ga0495630_0024678 3300046517 Bacteria 4443
1351 Ga0495630_0159312 3300046517 Bacteria 1718
1352 Ga0495666_0004392 3300046526 Bacteria 7126
1353 Ga0495642_0016251 3300046528 Bacteria 2899
1354 Ga0495642_0025549 3300046528 Bacteria 2341
1355 Ga0495652_0002282 3300046529 Bacteria 20011
1356 Ga0495665_0018812 3300046531 Bacteria 3711
1357 Ga0495665_0022165 3300046531 Bacteria 3415
1358 Ga0495665_0115993 3300046531 Bacteria 1403
1359 Ga0495640_0003666 3300046533 Bacteria 12347
1360 Ga0495640_0036801 3300046533 Bacteria 3456
1361 Ga0495586_0087879 3300046535 Bacteria 1714
1362 Ga0495587_0079172 3300046536 Bacteria 1906
1363 Ga0495587_0092093 3300046536 Bacteria 1750
1364 Ga0495598_0092816 3300046537 Bacteria 987
1365 Ga0495597_0001164 3300046542 Bacteria 19754
1366 Ga0495645_0040975 3300046543 Bacteria 3377
1367 Ga0495622_0000017 3300046557 Bacteria 176313
1368 Ga0495622_0075510 3300046557 Bacteria 1553
1369 Ga0495667_0080883 3300046559 Bacteria 2112
1370 Ga0495668_0177672 3300046616 Bacteria 1166
1371 Ga0495634_0070757 3300046642 Bacteria 2299
1372 Ga0495625_0000720 3300046660 Bacteria 46548
1373 Ga0495625_0002351 3300046660 Bacteria 20624
1374 Ga0495625_0108423 3300046660 Bacteria 1900
1375 Ga0495635_0020342 3300046663 Bacteria 4623
1376 Ga0495635_0087455 3300046663 Bacteria 2132
1377 Ga0495635_0405936 3300046663 Bacteria 904
1378 Ga0495599_0118722 3300046678 Bacteria 1644
1379 Ga0495599_0219791 3300046678 Bacteria 1163
1380 Ga0495623_0001196 3300046679 Bacteria 17603
1381 Ga0495623_0003843 3300046679 Bacteria 9901
1382 Ga0495623_0016582 3300046679 Bacteria 4758
1383 Ga0495646_0032940 3300046680 Bacteria 3222
1384 Ga0495647_0010822 3300046681 Bacteria 3115
1385 Ga0495658_0011509 3300046683 Bacteria 4452
1386 Ga0495669_0006842 3300046684 Bacteria 4772
1387 Ga0495669_0155922 3300046684 Bacteria 1082
1388 Ga0495613_0061262 3300046689 Bacteria 2755
1389 Ga0495613_0132585 3300046689 Bacteria 1783
1390 Ga0495671_0028235 3300046692 Bacteria 2893
1391 Ga0495671_0137725 3300046692 Bacteria 1190
1392 Ga0495649_0001661 3300046694 Bacteria 16548
1393 Ga0495649_0012734 3300046694 Bacteria 4880
1394 Ga0495589_0024749 3300046794 Bacteria 3050
1395 Ga0495600_0022736 3300046809 Bacteria 4029
1396 Ga0495600_0028081 3300046809 Bacteria 3639
1397 Ga0495600_0225339 3300046809 Bacteria 1198
1398 Ga0495660_0079063 3300046810 Bacteria 1728
1399 Ga0495581_0069288 3300047315 Bacteria 2039
1400 Ga0495604_0029323 3300047317 Bacteria 4377
1401 Ga0495604_0038276 3300047317 Bacteria 3773
1402 Ga0495674_0004590 3300047319 Bacteria 13282
1403 Ga0495674_0028010 3300047319 Bacteria 5143
1404 Ga0495674_0121639 3300047319 Bacteria 2204
1405 Ga0495672_0065420 3300047320 Bacteria 2078
1406 Ga0495672_0215345 3300047320 Bacteria 951
1407 Ga0495676_0008883 3300047321 Bacteria 9179
1408 Ga0495680_0002429 3300047322 Bacteria 19072
1409 Ga0495680_0108235 3300047322 Bacteria 2063
1410 Ga0495680_0233566 3300047322 Bacteria 1308
1411 Ga0495683_0010627 3300047323 Bacteria 4857
1412 Ga0495683_0014936 3300047323 Bacteria 4044
1413 Ga0495683_0050651 3300047323 Bacteria 2077
1414 Ga0495683_0198432 3300047323 Bacteria 906
1415 Ga0495687_000018 3300047443 Bacteria 342973
1416 Ga0495687_016907 3300047443 Bacteria 3656
1417 Ga0495687_017543 3300047443 Bacteria 3566
1418 Ga0495675_0011625 3300047444 Bacteria 5527
1419 Ga0495675_0022924 3300047444 Bacteria 3979
1420 Ga0495675_0084521 3300047444 Bacteria 1996
1421 Ga0495675_0149768 3300047444 Bacteria 1442
1422 Ga0495679_001857 3300047446 Bacteria 11385
1423 Ga0495673_0003863 3300047469 Bacteria 9660
1424 Ga0495593_0031662 3300047673 Bacteria 2887
1425 Ga0495593_0034509 3300047673 Bacteria 2751
1426 Ga0495602_0004432 3300048088 Bacteria 14658
1427 Ga0495602_0049627 3300048088 Bacteria 3756
1428 Ga0495602_0475822 3300048088 Bacteria 877
1429 Ga0495614_0003119 3300048089 Bacteria 7386
1430 Ga0496100_0000932 3300048903 Bacteria 13978
1431 Ga0496101_0035342 3300048904 Bacteria 3534
1432 Ga0496101_0048175 3300048904 Bacteria 3062
1433 Ga0496101_0076536 3300048904 Bacteria 2465
1434 Ga0496101_0128333 3300048904 Bacteria 1923
1435 Ga0496102_0005827 3300048905 Bacteria 10481
1436 Ga0496102_0013163 3300048905 Bacteria 7157
1437 Ga0496102_0029208 3300048905 Bacteria 4932
1438 Ga0496102_0101051 3300048905 Bacteria 2679
1439 Ga0496102_0128891 3300048905 Bacteria 2366
1440 Ga0496102_0684922 3300048905 Bacteria 948
1441 Ga0496103_0000360 3300048906 Bacteria 41308
1442 Ga0496103_0017085 3300048906 Bacteria 4338
1443 Ga0496103_0157698 3300048906 Bacteria 1455
1444 Ga0496104_0008205 3300048907 Bacteria 9271
1445 Ga0496104_0055939 3300048907 Bacteria 3730
1446 Ga0496104_0107203 3300048907 Bacteria 2677
1447 Ga0496104_0187626 3300048907 Bacteria 1978
1448 Ga0496104_0295484 3300048907 Bacteria 1532
1449 Ga0496105_0225702 3300048908 Bacteria 1523
1450 Ga0496105_0236571 3300048908 Bacteria 1483
1451 Ga0496105_0269350 3300048908 Bacteria 1376
1452 Ga0496105_0522566 3300048908 Bacteria 929
1453 Ga0496106_0002881 3300048909 Bacteria 12786
1454 Ga0496106_0005706 3300048909 Bacteria 9208
1455 Ga0496106_0037670 3300048909 Bacteria 3618
1456 Ga0496106_0075317 3300048909 Bacteria 2585
1457 Ga0496107_0021554 3300048910 Bacteria 4554
1458 Ga0496107_0263252 3300048910 Bacteria 1283
1459 Ga0496107_0626397 3300048910 Bacteria 794
1460 Ga0496108_0002202 3300048911 Bacteria 15604
1461 Ga0496108_0152356 3300048911 Bacteria 1995
1462 Ga0496108_0202704 3300048911 Bacteria 1722
1463 Ga0496109_0017843 3300048912 Bacteria 6226
1464 Ga0496109_0042598 3300048912 Bacteria 4113
1465 Ga0496109_0232224 3300048912 Bacteria 1736
1466 Ga0496109_0334805 3300048912 Bacteria 1429
1467 Ga0496109_0423774 3300048912 Bacteria 1257
1468 Ga0496110_0026929 3300048913 Bacteria 4924
1469 Ga0496110_0060777 3300048913 Bacteria 3333
1470 Ga0496110_0237863 3300048913 Bacteria 1657
1471 Ga0496110_0756156 3300048913 Bacteria 875
1472 Ga0496111_0018131 3300048914 Bacteria 4873
1473 Ga0496111_0179064 3300048914 Bacteria 1576
1474 Ga0496111_0272509 3300048914 Bacteria 1255
1475 Ga0496111_0312054 3300048914 Bacteria 1165
1476 Ga0496111_0431633 3300048914 Bacteria 973
1477 Ga0496112_0002417 3300048915 Bacteria 15038
1478 Ga0496112_0007505 3300048915 Bacteria 9682
1479 Ga0496112_0011630 3300048915 Bacteria 8049
1480 Ga0496112_0021278 3300048915 Bacteria 6166
1481 Ga0496112_0024005 3300048915 Bacteria 5834
1482 Ga0496112_0807209 3300048915 Bacteria 863
1483 Ga0496113_0003212 3300048916 Bacteria 9742
1484 Ga0496113_0080747 3300048916 Bacteria 2491
1485 Ga0496113_0635835 3300048916 Bacteria 854
1486 Ga0496114_0032563 3300048917 Bacteria 4292
1487 Ga0496114_0045449 3300048917 Bacteria 3648
1488 Ga0496114_0159642 3300048917 Bacteria 1960
1489 Ga0496114_0462092 3300048917 Bacteria 1124
1490 Ga0496115_0267060 3300048918 Bacteria 1406
1491 Ga0496115_0422515 3300048918 Bacteria 1080
1492 Ga0496116_0001434 3300048919 Bacteria 26780
1493 Ga0496116_0003129 3300048919 Bacteria 16611
1494 Ga0496117_0002321 3300048920 Bacteria 24382
1495 Ga0496117_0003647 3300048920 Bacteria 17731
1496 Ga0496117_0015333 3300048920 Bacteria 6540
1497 Ga0496117_0090755 3300048920 Bacteria 1967
1498 Ga0496118_0000167 3300048921 Bacteria 119146
1499 Ga0496118_0026815 3300048921 Bacteria 4896
1500 Ga0496119_0067523 3300048922 Bacteria 2109
1501 Ga0496120_0066373 3300048923 Bacteria 1996
1502 Ga0496121_0002717 3300048924 Bacteria 26409
1503 Ga0496121_0008605 3300048924 Bacteria 11948
1504 Ga0496121_0035577 3300048924 Bacteria 4460
1505 Ga0496121_0187320 3300048924 Bacteria 1487
1506 Ga0496122_0001194 3300048925 Bacteria 44317
1507 Ga0496122_0006237 3300048925 Bacteria 13796
1508 Ga0496122_0209967 3300048925 Bacteria 1129
1509 Ga0496123_0000532 3300048926 Bacteria 65557
1510 Ga0496123_0006105 3300048926 Bacteria 11810
1511 Ga0496123_0178168 3300048926 Bacteria 1113
1512 Ga0496124_0010208 3300048927 Bacteria 9542
1513 Ga0496124_0263491 3300048927 Bacteria 1267
1514 Ga0496125_0002955 3300048928 Bacteria 21369
1515 Ga0496125_0007063 3300048928 Bacteria 11996
1516 Ga0496125_0069394 3300048928 Bacteria 2766
1517 Ga0496126_0000031 3300048929 Bacteria 373371
1518 Ga0496126_0223632 3300048929 Bacteria 1580
1519 Ga0496126_0238121 3300048929 Bacteria 1522
1520 Ga0495682_0048755 3300049460 Bacteria 1543
1521 Ga0501032_0006231 3300049569 Bacteria 8778
1522 Ga0501033_0003584 3300049570 Bacteria 12688
1523 Ga0501033_0028951 3300049570 Bacteria 4162
1524 Ga0501034_0001085 3300049571 Bacteria 38426
1525 Ga0501034_0006814 3300049571 Bacteria 12219
1526 Ga0501034_0023666 3300049571 Bacteria 6256
1527 Ga0501034_0031655 3300049571 Bacteria 5373
1528 Ga0501034_0141472 3300049571 Bacteria 2385
1529 Ga0501036_0001771 3300049572 Bacteria 16761
1530 Ga0501037_0004252 3300049573 Bacteria 10376
1531 Ga0501037_0089918 3300049573 Bacteria 2221
1532 Ga0501037_0246304 3300049573 Bacteria 1252
1533 Ga0501038_0000494 3300049574 Bacteria 34711
1534 Ga0501038_0509482 3300049574 Bacteria 919
1535 Ga0501039_0392240 3300049575 Bacteria 1090
1536 Ga0501040_0191592 3300049576 Bacteria 1451
1537 Ga0501042_0095808 3300049578 Bacteria 2132
1538 Ga0501042_0120643 3300049578 Bacteria 1888
1539 Ga0501042_0230434 3300049578 Bacteria 1336
1540 Ga0501043_0001194 3300049579 Bacteria 22852
1541 Ga0501043_0100387 3300049579 Bacteria 2275
1542 Ga0501046_0002440 3300049580 Bacteria 17427
1543 Ga0501047_0004711 3300049581 Bacteria 12827
1544 Ga0501047_0020936 3300049581 Bacteria 6282
1545 Ga0501048_0088518 3300049582 Bacteria 2184
1546 Ga0501048_0307881 3300049582 Bacteria 1127
1547 Ga0501067_0015301 3300049583 Bacteria 4245
1548 Ga0501067_0178771 3300049583 Bacteria 1182
1549 Ga0501068_0000813 3300049584 Bacteria 16219
1550 Ga0501068_0370192 3300049584 Bacteria 922
1551 Ga0501071_0151491 3300049587 Bacteria 1730
1552 Ga0501072_0031458 3300049588 Bacteria 4154
1553 Ga0501072_0190902 3300049588 Bacteria 1634
1554 Ga0501073_0001692 3300049589 Bacteria 16336
1555 Ga0501073_0007913 3300049589 Bacteria 7886
1556 Ga0501074_0070330 3300049590 Bacteria 2516
1557 Ga0501074_0114150 3300049590 Bacteria 1932
1558 Ga0501074_0235881 3300049590 Bacteria 1302
1559 Ga0501076_0013746 3300049592 Bacteria 6074
1560 Ga0501076_0363433 3300049592 Bacteria 1189
1561 Ga0501079_0054792 3300049741 Bacteria 3076
1562 Ga0501080_0000614 3300049742 Bacteria 28250
1563 Ga0501080_0001764 3300049742 Bacteria 18566
1564 Ga0501080_0026131 3300049742 Bacteria 5424
1565 Ga0501080_0093075 3300049742 Bacteria 2799
1566 Ga0501081_0002070 3300049743 Bacteria 12509
1567 Ga0501083_0016784 3300049744 Bacteria 5114
1568 Ga0501083_0026400 3300049744 Bacteria 4014
1569 Ga0501083_0044081 3300049744 Bacteria 3020
1570 Ga0501035_0034907 3300049822 Bacteria 4568
1571 Ga0501035_0082472 3300049822 Bacteria 2837
1572 Ga0501035_0137165 3300049822 Bacteria 2129
1573 Ga0501035_0294525 3300049822 Bacteria 1369
1574 Ga0501044_0000236 3300049823 Bacteria 69634
1575 Ga0501044_0012609 3300049823 Bacteria 9154
1576 nmdc:mga03683_22708_c1 3300050489 Bacteria 2434
1577 nmdc:mga03683_245360_c1 3300050489 Bacteria 831
1578 nmdc:mga00v17_14882_c1 3300050491 Bacteria 4352
1579 nmdc:mga00v17_46477_c1 3300050491 Bacteria 2626
1580 nmdc:mga0yw44_26020_c1 3300050492 Bacteria 3337
1581 nmdc:mga0yw44_80260_c1 3300050492 Bacteria 2043
1582 nmdc:mga0k408_16840_c1 3300050493 Bacteria 4063
1583 nmdc:mga0k408_21004_c2 3300050493 Bacteria 2525
1584 nmdc:mga0k408_96283_c1 3300050493 Bacteria 1742
1585 nmdc:mga07m45_19107_c2 3300050496 Bacteria 2846
1586 nmdc:mga07m45_51636_c1 3300050496 Bacteria 2319
1587 nmdc:mga05p37_42889_c1 3300050507 Bacteria 5561
1588 nmdc:mga05p37_807231_c1 3300050507 Bacteria 1025
1589 nmdc:mga09592_16785_c1 3300050508 Bacteria 5993
1590 nmdc:mga09592_254596_c1 3300050508 Bacteria 1522
1591 nmdc:mga09592_59925_c1 3300050508 Bacteria 3218
1592 nmdc:mga0qj67_23454_c1 3300050509 Bacteria 4748
1593 nmdc:mga0qj67_381204_c1 3300050509 Bacteria 1139
1594 nmdc:mga06r32_60240_c1 3300050510 Bacteria 3653
1595 nmdc:mga08y16_140934_c1 3300050511 Bacteria 2507
1596 nmdc:mga08y16_189783_c1 3300050511 Bacteria 2132
1597 nmdc:mga08y16_26937_c1 3300050511 Bacteria 6058
1598 nmdc:mga08y16_456734_c1 3300050511 Bacteria 1302
1599 nmdc:mga08y16_965338_c1 3300050511 Bacteria 834
1600 nmdc:mga0n895_401234_c1 3300050512 Bacteria 1387
1601 nmdc:mga0n895_4460_c1 3300050512 Bacteria 11501
1602 nmdc:mga0n895_45248_c1 3300050512 Bacteria 4294
1603 nmdc:mga0rr50_16136_c1 3300050513 Bacteria 4950
1604 nmdc:mga0rr50_304249_c1 3300050513 Bacteria 1334
1605 nmdc:mga0rr50_398644_c1 3300050513 Bacteria 1162
1606 nmdc:mga08x19_46547_c1 3300050514 Bacteria 2774
1607 nmdc:mga0a205_8120_c1 3300050515 Bacteria 9537
1608 Ga0495612_0080658 3300053078 Bacteria 1367
1609 Ga0500635_0000440 3300053080 Bacteria 12001
1610 Ga0495595_0091601 3300053084 Bacteria 1459
1611 Ga0495619_0026499 3300053085 Bacteria 3729
1612 Ga0500644_0011531 3300053088 Bacteria 2417
1613 Ga0500566_0149636 3300053094 Bacteria 1229
1614 Ga0500566_0183242 3300053094 Bacteria 1072
1615 Ga0500593_000087 3300053117 Bacteria 33673
1616 Ga0500595_014220 3300053119 Bacteria 3025
1617 Ga0500655_035102 3300053133 Bacteria 974
1618 Ga0500658_0049219 3300053134 Bacteria 1717
1619 Ga0500604_0000278 3300053151 Bacteria 14267
1620 Ga0500616_0000520 3300053153 Bacteria 48822
1621 Ga0500616_0007851 3300053153 Bacteria 6715
1622 Ga0500627_0009870 3300053158 Bacteria 3458
1623 Ga0500627_0192198 3300053158 Bacteria 916
1624 Ga0500638_138050 3300053162 Bacteria 1098
1625 Ga0500645_000100 3300053730 Bacteria 68299
1626 Ga0500645_002016 3300053730 Bacteria 9498
1627 Ga0500609_002189 3300053731 Bacteria 2791
1628 Ga0501084_0385692 3300054114 Bacteria 1184
1629 Ga0500661_001464 3300055283 Bacteria 4430
1630 Ga0587077_008909 3300059493 Bacteria 1508
1631 Ga0587086_005942 3300059507 Bacteria 1342
1632 Ga0587088_006045 3300059508 Bacteria 1616
1633 Ga0587092_036494 3300059512 Bacteria 837
1634 Ga0587094_016727 3300059513 Bacteria 1025
1635 Ga0587117_016677 3300059627 Bacteria 980
1636 Ga0587068_003730 3300059641 Bacteria 1971
1637 Ga0587072_016692 3300059643 Bacteria 1259
1638 Ga0587075_021123 3300059644 Bacteria 968
1639 Ga0587076_000599 3300059645 Bacteria 3090
1640 Ga0587078_000752 3300059646 Bacteria 2625
1641 Ga0587078_016808 3300059646 Bacteria 894
1642 Ga0587100_001375 3300059648 Bacteria 1412
1643 Ga0587102_000802 3300059649 Bacteria 1969
1644 Ga0587071_008180 3300060344 Bacteria 1689
1645 Ga0587111_0000638 3300060346 Bacteria 3564
1646 Ga0587111_0001949 3300060346 Bacteria 2638
1647 Ga0530510_0126595 3300061734 Bacteria 1878
1648 2509126550 2508501125 Bacteria 7208311
1649 2511245773 2511231002 Bacteria 5042903
1650 2512929184 2512875016 Bacteria 6529530
1651 2563065098 2562617112 Bacteria 10918404
1652 2588514463 2588253730 Bacteria 6881675
1653 2644028937 2643221603 Bacteria 6147767
1654 2713481915 2711768613 Bacteria 11048459
1655 2738821071 2738541296 Bacteria 7285013
1656 2738833553 2738541298 Bacteria 7286732
1657 2738876960 2738541306 Bacteria 7284992
1658 2739055841 2738541337 Bacteria 6183410
1659 2739186709 2738543002 Bacteria 7284546
1660 2739223553 2738543008 Bacteria 7282815
1661 2819595283 2818991445 Bacteria 4955017
1662 2857366159 2857357740 Bacteria 9937880
1663 2876367258 2876363079 Bacteria 6544991
1664 2884812645 2884811622 Bacteria 5552861
1665 2884841125 2884836552 Bacteria 5219991
1666 2884856000 2884852848 Bacteria 5221161
1667 2896157075 2896154374 Bacteria 5221518
1668 2903453272 2903448605 Bacteria 7357801
1669 2903526749 2903521522 Bacteria 6525694
1670 2903530632 2903528002 Bacteria 6586099
1671 2919704873 2919704043 Bacteria 5560311
1672 2921655269 2921643360 Bacteria 11448031
1673 2937850916 2937848649 Bacteria 6983481
1674 2945939366 2945934425 Bacteria 7444609
1675 2963650051 2963644680 Bacteria 6530403
1676 2968086638 2968083720 Bacteria 7351627
1677 2977923891 2977922695 Bacteria 6956781
1678 2990706709 2990703756 Bacteria 7715990
1679 3004213329 3004211236 Bacteria 7417683
1680 3004221402 3004218560 Bacteria 7421728
1681 3004334607 3004334049 Bacteria 8449246
1682 637078942 637000159 Bacteria 7596297
1683 642424633 641736151 Bacteria 7477263
1684 642620539 642555113 Bacteria 8214658
1685 Ga0207690_10430213
1686 JGI24740J21852_10001143
1687 JGI24740J21852_10010597
1688 JGI24739J22299_10009570
1689 JGI24748J21848_1020814
1690 JGI24738J21930_10000443
1691 JGI25155J39150_1000366
1692 JGI25156J39149_1000649
1693 JGI25156J39149_1000693
1694 JGI25156J39149_1001347
1695 JGI25156J39149_1007814
1696 JGI25154J39366_1000534
1697 JGI25154J39366_1001866
1698 JGI25157J39369_1000566
1699 JGI25157J39369_1000665
1700 JGI25164J39214_1006209
1701 JGI25150J39212_1007383
1702 JGI25159J45721_1000689
1703 JGI25159J45721_1016659
1704 JGI25151J46595_10001030
1705 JGI25151J46595_10014571
1706 rootH1_10010127
1707 rootL2_10062439
1708 rootL2_10086809
1709 rootH1_10005148
1710 JGI25160J50197_1000305
1711 JGI25161J50226_1000018
1712 Ga0055539_1001771
1713 Ga0055532_1000453
1714 Ga0055525_1000004
1715 Ga0055535_1008682
1716 Ga0055542_1001255
1717 Ga0055529_1000806
1718 Ga0055537_1000008
1719 Ga0055537_1016554
1720 Ga0055524_1000083
1721 Ga0055534_1001337
1722 Ga0055528_1000652
1723 Ga0055530_10000211
1724 Ga0055540_1000012
1725 Ga0055540_1014922
1726 Ga0055531_10000181
1727 Ga0055531_10004842
1728 Ga0055531_10013006
1729 Ga0055543_1000418
1730 Ga0065165_1002315
1731 Ga0065165_1004913
1732 Ga0065712_10020755
1733 Ga0065712_10133994
1734 Ga0065715_10136268
1735 Ga0065715_10159109
1736 Ga0065715_10161730
1737 Ga0065715_10173334
1738 Ga0065715_10236508
1739 Ga0065715_10282474
1740 Ga0065707_10207925
1741 Ga0065707_10324178
1742 Ga0070658_10031442
1743 Ga0070658_10054387
1744 Ga0070658_10136621
1745 Ga0070658_10141460
1746 Ga0070658_10214779
1747 Ga0070676_10003185
1748 Ga0070676_10011669
1749 Ga0070676_10060407
1750 Ga0070676_10423806
1751 Ga0070683_100015001
1752 Ga0070683_100024314
1753 Ga0070683_100061006
1754 Ga0070690_100000658
1755 Ga0070690_100001010
1756 Ga0070690_100199390
1757 Ga0070670_100002859
1758 Ga0070670_100011705
1759 Ga0070670_100012920
1760 Ga0070670_100025473
1761 Ga0070670_100048045
1762 Ga0070670_100061382
1763 Ga0070670_100111928
1764 Ga0070670_100158846
1765 Ga0070677_10000636
1766 Ga0070677_10060316
1767 Ga0068869_100000751
1768 Ga0068869_100004117
1769 Ga0068869_100037455
1770 Ga0068869_100091480
1771 Ga0070666_10001025
1772 Ga0070666_10001481
1773 Ga0070666_10017038
1774 Ga0070666_10095964
1775 Ga0070666_10271727
1776 Ga0070680_100076067
1777 Ga0070680_100085318
1778 Ga0070680_100189634
1779 Ga0070682_100151070
1780 Ga0068868_100007511
1781 Ga0068868_100008375
1782 Ga0068868_100062121
1783 Ga0068868_100108488
1784 Ga0068868_100176122
1785 Ga0068868_100239544
1786 Ga0070660_100028688
1787 Ga0070660_100039542
1788 Ga0070660_100051494
1789 Ga0070660_100243343
1790 Ga0070660_100321432
1791 Ga0070660_100703085
1792 Ga0070689_100040979
1793 Ga0070689_100079947
1794 Ga0070689_100110933
1795 Ga0070689_100286962
1796 Ga0070687_100050151
1797 Ga0070687_100255918
1798 Ga0070661_100007597
1799 Ga0070661_100010061
1800 Ga0070661_100021144
1801 Ga0070661_100029562
1802 Ga0070661_100041032
1803 Ga0070661_100070345
1804 Ga0070661_100097608
1805 Ga0070661_100237008
1806 Ga0070661_100374968
1807 Ga0070692_10005718
1808 Ga0070692_10038658
1809 Ga0070668_100001025
1810 Ga0070668_100002685
1811 Ga0070668_100003032
1812 Ga0070668_100003427
1813 Ga0070668_100005260
1814 Ga0070668_100019396
1815 Ga0070668_100082717
1816 Ga0070668_100123554
1817 Ga0070668_100146879
1818 Ga0070668_100264040
1819 Ga0070668_100324228
1820 Ga0070669_100001889
1821 Ga0070669_100015790
1822 Ga0070669_100065004
1823 Ga0070669_100105418
1824 Ga0070675_100004878
1825 Ga0070675_100006068
1826 Ga0070675_100012545
1827 Ga0070675_100015597
1828 Ga0070675_100049855
1829 Ga0070675_100542111
1830 Ga0070671_100007740
1831 Ga0070671_100008568
1832 Ga0070671_100008695
1833 Ga0070671_100021169
1834 Ga0070671_100048504
1835 Ga0070671_100106418
1836 Ga0070671_100118613
1837 Ga0070671_100172511
1838 Ga0070674_100000692
1839 Ga0070674_100020957
1840 Ga0070674_100095654
1841 Ga0070674_100144238
1842 Ga0070674_100172176
1843 Ga0070674_100234743
1844 Ga0070674_100656702
1845 Ga0070673_100000093
1846 Ga0070673_100006849
1847 Ga0070673_100035677
1848 Ga0070673_100037281
1849 Ga0070673_100104922
1850 Ga0070673_100117265
1851 Ga0070673_100385301
1852 Ga0070688_100000489
1853 Ga0070688_100015178
1854 Ga0070688_100048466
1855 Ga0070659_100025885
1856 Ga0070659_100045936
1857 Ga0070659_100097304
1858 Ga0070659_100097699
1859 Ga0070659_100107236
1860 Ga0070659_100227542
1861 Ga0070659_100243677
1862 Ga0070659_100246176
1863 Ga0070667_100025931
1864 Ga0070667_100038812
1865 Ga0070667_100042408
1866 Ga0070667_100107435
1867 Ga0070667_100113340
1868 Ga0070667_100128822
1869 Ga0070667_100243386
1870 Ga0070667_100354586
1871 Ga0070709_10001884
1872 Ga0070709_10430527
1873 Ga0070709_10514817
1874 Ga0070709_10654168
1875 Ga0070714_100054946
1876 Ga0070714_100208731
1877 Ga0070714_100223740
1878 Ga0070714_100574091
1879 Ga0070713_100000090
1880 Ga0070713_100000232
1881 Ga0070713_100074644
1882 Ga0070713_100135900
1883 Ga0070710_10006281
1884 Ga0070710_10008791
1885 Ga0070701_10006039
1886 Ga0070701_10361097
1887 Ga0070711_100001221
1888 Ga0070711_100046861
1889 Ga0070711_100078585
1890 Ga0070711_100153118
1891 Ga0070705_100209676
1892 Ga0070700_100000303
1893 Ga0070700_100064955
1894 Ga0070694_100047176
1895 Ga0070694_100153287
1896 Ga0070708_100018603
1897 Ga0070708_100314955
1898 Ga0070663_100004067
1899 Ga0070663_100004262
1900 Ga0070663_100030299
1901 Ga0070663_100113582
1902 Ga0070663_100627904
1903 Ga0070678_100000443
1904 Ga0070678_100020775
1905 Ga0070678_100037888
1906 Ga0070678_100040788
1907 Ga0070678_100144929
1908 Ga0070678_100296457
1909 Ga0070662_100001239
1910 Ga0070662_100320583
1911 Ga0070681_10018539
1912 Ga0070681_10020974
1913 Ga0070681_10068268
1914 Ga0070681_10121863
1915 Ga0070681_10179611
1916 Ga0070681_10318999
1917 Ga0070681_10472338
1918 Ga0068867_100003718
1919 Ga0068867_100012127
1920 Ga0068867_100063788
1921 Ga0068867_100081929
1922 Ga0068867_100088186
1923 Ga0068867_100104340
1924 Ga0068867_100311605
1925 Ga0068867_100692307
1926 Ga0070685_10017407
1927 Ga0070685_10044934
1928 Ga0070707_100012578
1929 Ga0070707_100036043
1930 Ga0070698_100006372
1931 Ga0070699_100014042
1932 Ga0070699_100015841
1933 Ga0070699_100031664
1934 Ga0070679_100014667
1935 Ga0070679_100016933
1936 Ga0070679_100034615
1937 Ga0070679_100054314
1938 Ga0070679_100069820
1939 Ga0070679_100083680
1940 Ga0070679_100094597
1941 Ga0070679_100291703
1942 Ga0070684_100040489
1943 Ga0070684_100128155
1944 Ga0070684_100238681
1945 Ga0070684_100266198
1946 Ga0068853_100006808
1947 Ga0068853_100012679
1948 Ga0068853_100023777
1949 Ga0068853_100065974
1950 Ga0068853_100068629
1951 Ga0068853_100114281
1952 Ga0068853_100169928
1953 Ga0068853_100192279
1954 Ga0070672_100008459
1955 Ga0070672_100012894
1956 Ga0070672_100023150
1957 Ga0070672_100044451
1958 Ga0070672_100048369
1959 Ga0070672_100118482
1960 Ga0070672_100139581
1961 Ga0070672_100199153
1962 Ga0070672_100483261
1963 Ga0070672_100500838
1964 Ga0070686_100000467
1965 Ga0070686_100020587
1966 Ga0070686_100041405
1967 Ga0070695_100010817
1968 Ga0070695_100114746
1969 Ga0070695_100168682
1970 Ga0070696_100005244
1971 Ga0070696_100031225
1972 Ga0070696_100052416
1973 Ga0070696_100177991
1974 Ga0070693_100003921
1975 Ga0070693_100056503
1976 Ga0070693_100110896
1977 Ga0070693_100178663
1978 Ga0070693_100248092
1979 Ga0070665_100004030
1980 Ga0070665_100008150
1981 Ga0070665_100019341
1982 Ga0070665_100020459
1983 Ga0070665_100094903
1984 Ga0070665_100207987
1985 Ga0070665_100231823
1986 Ga0070704_100027154
1987 Ga0070704_100036676
1988 Ga0070704_100108747
1989 Ga0070704_100148002
1990 Ga0070704_100748199
1991 Ga0068855_100002732
1992 Ga0068855_100006426
1993 Ga0068855_100011358
1994 Ga0068855_100037906
1995 Ga0068855_100041199
1996 Ga0068855_100073548
1997 Ga0068855_100110829
1998 Ga0068855_100225491
1999 Ga0068855_100258827
2000 Ga0068855_100386964
2001 Ga0068855_100488557
2002 Ga0068855_100642241
2003 Ga0070664_100000511
2004 Ga0070664_100004503
2005 Ga0070664_100005335
2006 Ga0070664_100060960
2007 Ga0070664_100246528
2008 Ga0070664_100448929
2009 Ga0068857_100034228
2010 Ga0068857_100087269
2011 Ga0068857_100096956
2012 Ga0068857_100112499
2013 Ga0068857_100134701
2014 Ga0068857_100287017
2015 Ga0068854_100017225
2016 Ga0068854_100141708
2017 Ga0068854_100250260
2018 Ga0068854_100416182
2019 Ga0068856_100007158
2020 Ga0068856_100011352
2021 Ga0068856_100017996
2022 Ga0068856_100026025
2023 Ga0068856_100059727
2024 Ga0068856_100065608
2025 Ga0068856_100129068
2026 Ga0068856_100151921
2027 Ga0070702_100003215
2028 Ga0070702_100039684
2029 Ga0070702_100511699
2030 Ga0068852_100006625
2031 Ga0068852_100010689
2032 Ga0068852_100043293
2033 Ga0068852_100281497
2034 Ga0068852_100294195
2035 Ga0068852_100359607
2036 Ga0068852_100371297
2037 Ga0068852_100372797
2038 Ga0068852_100639553
2039 Ga0068859_100006866
2040 Ga0068859_100007090
2041 Ga0068859_100020538
2042 Ga0068859_100022814
2043 Ga0068859_100108822
2044 Ga0068859_100143840
2045 Ga0068859_100151458
2046 Ga0068859_100168489
2047 Ga0068859_100296861
2048 Ga0068859_100777206
2049 Ga0068864_100001045
2050 Ga0068864_100003588
2051 Ga0068864_100006726
2052 Ga0068864_100010086
2053 Ga0068864_100043765
2054 Ga0068864_100507111
2055 Ga0068864_100562841
2056 Ga0068864_100668327
2057 Ga0068866_10000316
2058 Ga0068866_10006289
2059 Ga0068866_10026634
2060 Ga0068866_10075337
2061 Ga0068866_10168736
2062 Ga0068861_100000641
2063 Ga0068861_100009372
2064 Ga0068861_100020224
2065 Ga0068861_100100178
2066 Ga0068861_100276739
2067 Ga0068851_10001933
2068 Ga0068851_10002235
2069 Ga0068851_10003453
2070 Ga0068851_10009319
2071 Ga0068851_10037904
2072 Ga0068870_10000992
2073 Ga0068870_10008695
2074 Ga0068870_10009180
2075 Ga0068870_10064048
2076 Ga0068870_10116494
2077 Ga0068863_100001612
2078 Ga0068863_100008594
2079 Ga0068863_100009929
2080 Ga0068863_100011872
2081 Ga0068863_100020431
2082 Ga0068863_100048728
2083 Ga0068863_100152542
2084 Ga0068863_100541631
2085 Ga0068863_100712763
2086 Ga0068858_100001394
2087 Ga0068858_100003984
2088 Ga0068858_100012410
2089 Ga0068858_100027086
2090 Ga0068858_100071779
2091 Ga0068858_100095063
2092 Ga0068858_100513268
2093 Ga0068860_100007907
2094 Ga0068860_100026090
2095 Ga0068860_100173252
2096 Ga0068860_100221184
2097 Ga0068860_100444357
2098 Ga0068860_100656937
2099 Ga0068860_100970631
2100 Ga0068862_100012477
2101 Ga0068862_100037785
2102 Ga0068862_100054258
2103 Ga0068862_100068067
2104 Ga0068862_100132704
2105 Ga0068862_100402356
2106 Ga0068862_100451163
2107 Ga0068862_100539113
2108 Ga0081539_10014013
2109 Ga0081539_10075730
2110 Ga0075365_10014803
2111 Ga0075364_10033552
2112 Ga0075364_10082235
2113 Ga0070715_10019852
2114 Ga0070716_100009938
2115 Ga0070712_100014827
2116 Ga0070712_100217889
2117 Ga0075362_10005914
2118 Ga0075367_10015782
2119 Ga0075366_10058047
2120 Ga0075366_10070800
2121 Ga0075366_10083060
2122 Ga0075366_10098296
2123 Ga0097621_100000222
2124 Ga0097621_100070761
2125 Ga0097621_100087886
2126 Ga0097621_100104130
2127 Ga0097621_100161963
2128 Ga0097621_100166019
2129 Ga0097621_100316941
2130 Ga0097621_100516248
2131 Ga0097621_100589834
2132 Ga0075370_10072397
2133 Ga0075370_10079849
2134 Ga0068871_100001148
2135 Ga0068871_100001249
2136 Ga0068871_100026132
2137 Ga0068871_100039054
2138 Ga0068871_100040602
2139 Ga0068871_100055400
2140 Ga0068871_100092820
2141 Ga0068871_100199020
2142 Ga0068871_100210433
2143 Ga0068871_100251524
2144 Ga0068871_100256318
2145 Ga0068871_100271002
2146 Ga0075428_100015381
2147 Ga0075428_100155710
2148 Ga0075428_100205522
2149 Ga0075428_100784239
2150 Ga0075430_100161418
2151 Ga0075430_100240986
2152 Ga0075431_100001453
2153 Ga0075433_10003142
2154 Ga0075434_100017017
2155 Ga0075434_100109799
2156 Ga0075434_100244584
2157 Ga0075434_100441960
2158 Ga0075429_100010169
2159 Ga0075429_100064786
2160 Ga0075429_100258042
2161 Ga0068865_100003115
2162 Ga0068865_100007315
2163 Ga0068865_100164022
2164 Ga0068865_100180113
2165 Ga0075436_100017723
2166 Ga0097620_100006866
2167 Ga0097620_100007090
2168 Ga0097620_100020536
2169 Ga0097620_100022816
2170 Ga0097620_100108827
2171 Ga0097620_100143836
2172 Ga0097620_100151465
2173 Ga0097620_100168485
2174 Ga0097620_100296871
2175 Ga0097620_100777229
2176 Ga0079104_1011832
2177 Ga0075435_100098787
2178 Ga0075435_100432494
2179 Ga0099794_10029281
2180 Ga0105251_10002743
2181 Ga0105251_10052734
2182 Ga0105244_10037827
2183 Ga0105250_10041045
2184 Ga0105240_10005332
2185 Ga0105240_10007963
2186 Ga0105240_10010948
2187 Ga0105240_10051986
2188 Ga0105240_10052944
2189 Ga0105240_10055478
2190 Ga0105240_10087772
2191 Ga0105240_10103262
2192 Ga0105240_10153782
2193 Ga0111539_10035571
2194 Ga0111539_10109472
2195 Ga0111539_10149924
2196 Ga0105245_10007734
2197 Ga0105245_10018004
2198 Ga0105245_10108032
2199 Ga0105245_10311179
2200 Ga0105245_10539931
2201 Ga0105245_10849444
2202 Ga0105247_10054934
2203 Ga0105247_10094990
2204 Ga0114129_10063609
2205 Ga0114129_10179602
2206 Ga0114129_10535004
2207 Ga0105243_10001049
2208 Ga0105243_10113509
2209 Ga0105243_10117717
2210 Ga0105243_10194756
2211 Ga0105243_10444280
2212 Ga0105241_10004999
2213 Ga0105241_10011388
2214 Ga0105241_10133171
2215 Ga0105241_10169090
2216 Ga0105241_10191296
2217 Ga0105241_10211915
2218 Ga0105242_10008617
2219 Ga0105242_10033636
2220 Ga0105242_10049504
2221 Ga0105242_10068530
2222 Ga0105242_10135717
2223 Ga0105248_10001582
2224 Ga0105248_10017598
2225 Ga0105248_10051646
2226 Ga0105248_10092385
2227 Ga0105248_10206169
2228 Ga0105248_10210479
2229 Ga0105248_10407780
2230 Ga0105248_10411363
2231 Ga0105248_10656181
2232 Ga0105237_10251541
2233 Ga0105237_10296207
2234 Ga0105237_10754237
2235 Ga0105237_10901748
2236 Ga0105238_10018816
2237 Ga0105238_10020373
2238 Ga0105238_10022414
2239 Ga0105238_10024425
2240 Ga0105238_10188701
2241 Ga0105238_10275015
2242 Ga0105238_10294372
2243 Ga0105238_10592306
2244 Ga0105249_10032924
2245 Ga0105249_10044049
2246 Ga0105249_10152779
2247 Ga0105249_10487632
2248 Ga0105249_10807548
2249 Ga0105249_11066178
2250 Ga0105239_10062662
2251 Ga0105239_10071336
2252 Ga0105239_10226037
2253 Ga0105239_10229772
2254 Ga0105239_10295711
2255 Ga0105239_10381096
2256 Ga0105239_10385023
2257 Ga0105239_10741509
2258 Ga0105246_10170701
2259 Ga0105246_10184760
2260 Ga0157315_1004490
2261 Ga0157327_1001229
2262 Ga0157373_10002207
2263 Ga0157373_10003362
2264 Ga0157373_10078122
2265 Ga0157371_10006571
2266 Ga0157371_10072528
2267 Ga0157371_10080385
2268 Ga0157370_10006295
2269 Ga0157370_10021285
2270 Ga0157370_10055287
2271 Ga0157370_10069027
2272 Ga0157370_10092677
2273 Ga0157370_10136259
2274 Ga0157370_10324205
2275 Ga0157370_10352702
2276 Ga0157369_10024453
2277 Ga0157369_10082302
2278 Ga0157369_10082556
2279 Ga0157369_10085636
2280 Ga0157369_10108729
2281 Ga0157369_10447990
2282 Ga0157369_10478192
2283 Ga0157369_10565825
2284 Ga0157374_10000101
2285 Ga0157374_10002126
2286 Ga0157374_10043144
2287 Ga0157374_10055941
2288 Ga0157374_10131964
2289 Ga0157374_10248666
2290 Ga0157374_10383346
2291 Ga0157374_10549002
2292 Ga0157378_10007717
2293 Ga0157378_10024000
2294 Ga0157378_10028450
2295 Ga0157378_10049210
2296 Ga0157378_10085967
2297 Ga0157378_10241503
2298 Ga0157378_10548527
2299 Ga0157378_10737532
2300 Ga0163162_10003900
2301 Ga0163162_10006452
2302 Ga0163162_10018193
2303 Ga0163162_10044644
2304 Ga0163162_10065842
2305 Ga0163162_10080823
2306 Ga0163162_10201339
2307 Ga0163162_10255263
2308 Ga0163162_10446604
2309 Ga0163162_10456554
2310 Ga0163162_10558562
2311 Ga0157372_10002893
2312 Ga0157372_10045423
2313 Ga0157372_10145144
2314 Ga0157372_10179119
2315 Ga0157372_10181975
2316 Ga0157372_10194953
2317 Ga0157372_10359702
2318 Ga0157372_10367836
2319 Ga0157372_10554664
2320 Ga0157375_10007225
2321 Ga0157375_10018533
2322 Ga0157375_10060413
2323 Ga0157375_10098277
2324 Ga0157375_10117652
2325 Ga0157375_10132095
2326 Ga0157375_10185804
2327 Ga0157375_10270160
2328 Ga0157375_10521293
2329 Ga0157375_10638439
2330 Ga0157375_10713847
2331 Ga0157375_10749460
2332 Ga0163163_10006567
2333 Ga0163163_10037640
2334 Ga0163163_10057777
2335 Ga0163163_10108091
2336 Ga0163163_10330598
2337 Ga0163163_10541784
2338 Ga0163163_10838443
2339 Ga0157380_10000735
2340 Ga0157380_10240499
2341 Ga0157380_10833778
2342 Ga0182008_10023345
2343 Ga0157377_10007059
2344 Ga0157377_10328090
2345 Ga0157379_10000336
2346 Ga0157379_10003104
2347 Ga0157379_10045727
2348 Ga0157379_10287156
2349 Ga0157376_10001583
2350 Ga0157376_10003640
2351 Ga0157376_10010988
2352 Ga0157376_10072403
2353 Ga0157376_10076850
2354 Ga0182006_1024307
2355 Ga0182007_10030018
2356 Ga0183361_10004
2357 Ga0163161_10025976
2358 Ga0163161_10044095
2359 Ga0163161_10222345
2360 Ga0163161_10250839
2361 Ga0163161_10634731
2362 Ga0206353_10397806
2363 Ga0213872_10000081
2364 Ga0213872_10000104
2365 Ga0213872_10000132
2366 Ga0213872_10011708
2367 Ga0213872_10020413
2368 Ga0213872_10158401
2369 Ga0213876_10013450
2370 Ga0209435_100080
2371 Ga0209436_117651
2372 Ga0209672_102997
2373 Ga0209147_100004
2374 Ga0209563_100013
2375 Ga0207427_100271
2376 Ga0209437_100117
2377 Ga0209258_100759
2378 Ga0209258_100788
2379 Ga0209258_103781
2380 Ga0207425_1004618
2381 Ga0209646_1000060
2382 Ga0209646_1000481
2383 Ga0209026_1000049
2384 Ga0209026_1000729
2385 Ga0209677_100823
2386 Ga0209677_108638
2387 Ga0209148_1000037
2388 Ga0209148_1016699
2389 Ga0209759_1000033
2390 Ga0209759_1000272
2391 Ga0209759_1000440
2392 Ga0209759_1000815
2393 Ga0209759_1004244
2394 Ga0209759_1007678
2395 Ga0209565_1000004
2396 Ga0209565_1000418
2397 Ga0209455_1000458
2398 Ga0209455_1000622
2399 Ga0209673_1000074
2400 Ga0209130_1000050
2401 Ga0209130_1000584
2402 Ga0209675_1000044
2403 Ga0209675_1002560
2404 Ga0209675_1011851
2405 Ga0209676_1000029
2406 Ga0209025_1000342
2407 Ga0209025_1001851
2408 Ga0209025_1004094
2409 Ga0209025_1004428
2410 Ga0209025_1006692
2411 Ga0209025_1006807
2412 Ga0209564_1000470
2413 Ga0209564_1003476
2414 Ga0209564_1003544
2415 Ga0209758_1009604
2416 Ga0209050_1000003
2417 Ga0209050_1002573
2418 Ga0209050_1002886
2419 Ga0209050_1008201
2420 Ga0209050_1038283
2421 Ga0209256_1000001
2422 Ga0209256_1000544
2423 Ga0207426_1000071
2424 Ga0207426_1001953
2425 Ga0207426_1003763
2426 Ga0209051_1000003
2427 Ga0209051_1003446
2428 Ga0209051_1009661
2429 Ga0209051_1019129
2430 Ga0209257_1000018
2431 Ga0209257_1000053
2432 Ga0209257_1000631
2433 Ga0207697_10003163
2434 Ga0207697_10061877
2435 Ga0207697_10099563
2436 Ga0207656_10015731
2437 Ga0207656_10021969
2438 Ga0207656_10050527
2439 Ga0207713_1004266
2440 Ga0207682_10000082
2441 Ga0207682_10006577
2442 Ga0207682_10041075
2443 Ga0207692_10008129
2444 Ga0207692_10024545
2445 Ga0207692_10026320
2446 Ga0207642_10000717
2447 Ga0207642_10008923
2448 Ga0207642_10056540
2449 Ga0207642_10110619
2450 Ga0207688_10042752
2451 Ga0207680_10009521
2452 Ga0207680_10028537
2453 Ga0207680_10148196
2454 Ga0207680_10358753
2455 Ga0207680_10362137
2456 Ga0207647_10039064
2457 Ga0207647_10085536
2458 Ga0207647_10187394
2459 Ga0207685_10001009
2460 Ga0207699_10172160
2461 Ga0207645_10002355
2462 Ga0207645_10004888
2463 Ga0207645_10010285
2464 Ga0207645_10130449
2465 Ga0207645_10139442
2466 Ga0207643_10001052
2467 Ga0207643_10002227
2468 Ga0207643_10011695
2469 Ga0207643_10046825
2470 Ga0207643_10053897
2471 Ga0207705_10065907
2472 Ga0207705_10108271
2473 Ga0207705_10440134
2474 Ga0207654_10008575
2475 Ga0207654_10058591
2476 Ga0207707_10028631
2477 Ga0207707_10061747
2478 Ga0207707_10081154
2479 Ga0207707_10343921
2480 Ga0207707_10560417
2481 Ga0207707_10635345
2482 Ga0207707_10728006
2483 Ga0207695_10004475
2484 Ga0207695_10025394
2485 Ga0207695_10057658
2486 Ga0207695_10104980
2487 Ga0207695_10371774
2488 Ga0207671_10032166
2489 Ga0207671_10052856
2490 Ga0207671_10144116
2491 Ga0207671_10321588
2492 Ga0207693_10000069
2493 Ga0207693_10017171
2494 Ga0207693_10080225
2495 Ga0207663_10036233
2496 Ga0207663_10053178
2497 Ga0207663_10059764
2498 Ga0207660_10041498
2499 Ga0207660_10080430
2500 Ga0207660_10098692
2501 Ga0207660_10168581
2502 Ga0207660_10196280
2503 Ga0207662_10010039
2504 Ga0207662_10018980
2505 Ga0207662_10054338
2506 Ga0207662_10300986
2507 Ga0207657_10000151
2508 Ga0207657_10012062
2509 Ga0207657_10039663
2510 Ga0207657_10077361
2511 Ga0207657_10155946
2512 Ga0207657_10208633
2513 Ga0207657_10292766
2514 Ga0207649_10005808
2515 Ga0207649_10013767
2516 Ga0207649_10041017
2517 Ga0207649_10056859
2518 Ga0207649_10239042
2519 Ga0207649_10598454
2520 Ga0207652_10013663
2521 Ga0207652_10047545
2522 Ga0207652_10052888
2523 Ga0207652_10066044
2524 Ga0207652_10079488
2525 Ga0207652_10187611
2526 Ga0207652_10342584
2527 Ga0207646_10009271
2528 Ga0207646_10524256
2529 Ga0207681_10011576
2530 Ga0207681_10034634
2531 Ga0207681_10137865
2532 Ga0207681_10171093
2533 Ga0207681_10190689
2534 Ga0207681_10206539
2535 Ga0207681_10235430
2536 Ga0207681_10472107
2537 Ga0207694_10020992
2538 Ga0207694_10027012
2539 Ga0207694_10047563
2540 Ga0207694_10062916
2541 Ga0207694_10167502
2542 Ga0207694_10184149
2543 Ga0207694_10219451
2544 Ga0207694_10247277
2545 Ga0207650_10004791
2546 Ga0207650_10011760
2547 Ga0207650_10034508
2548 Ga0207650_10042217
2549 Ga0207650_10074583
2550 Ga0207650_10079443
2551 Ga0207650_10080023
2552 Ga0207650_10085248
2553 Ga0207650_10094146
2554 Ga0207650_10134148
2555 Ga0207650_10178986
2556 Ga0207650_10404321
2557 Ga0207659_10007542
2558 Ga0207659_10008038
2559 Ga0207659_10028928
2560 Ga0207659_10032593
2561 Ga0207659_10068289
2562 Ga0207659_10103945
2563 Ga0207659_10414818
2564 Ga0207659_10701947
2565 Ga0207659_10720696
2566 Ga0207659_10796364
2567 Ga0207687_10001955
2568 Ga0207687_10003815
2569 Ga0207687_10177980
2570 Ga0207700_10000065
2571 Ga0207700_10007518
2572 Ga0207700_10297979
2573 Ga0207664_10081146
2574 Ga0207664_10113619
2575 Ga0207664_10311233
2576 Ga0207664_10415902
2577 Ga0207664_10623080
2578 Ga0207644_10013680
2579 Ga0207644_10027774
2580 Ga0207644_10104092
2581 Ga0207644_10115397
2582 Ga0207644_10171596
2583 Ga0207644_10477413
2584 Ga0207690_10002121
2585 Ga0207690_10164032
2586 Ga0207690_10171859
2587 Ga0207690_10184497
2588 Ga0207690_10201593
2589 Ga0207690_10357628
2590 Ga0207706_10000045
2591 Ga0207706_10019809
2592 Ga0207706_10046407
2593 Ga0207706_10149404
2594 Ga0207706_10191005
2595 Ga0207686_10000845
2596 Ga0207686_10014544
2597 Ga0207686_10035797
2598 Ga0207686_10037045
2599 Ga0207686_10045954
2600 Ga0207686_10095494
2601 Ga0207709_10014580
2602 Ga0207709_10027760
2603 Ga0207709_10159096
2604 Ga0207709_10262608
2605 Ga0207670_10015418
2606 Ga0207670_10050297
2607 Ga0207669_10061366
2608 Ga0207669_10154658
2609 Ga0207669_10175810
2610 Ga0207669_10241525
2611 Ga0207669_10243469
2612 Ga0207669_10246999
2613 Ga0207704_10005678
2614 Ga0207704_10006884
2615 Ga0207704_10012648
2616 Ga0207704_10460681
2617 Ga0207665_10033149
2618 Ga0207665_10140526
2619 Ga0207691_10000316
2620 Ga0207691_10000338
2621 Ga0207691_10001034
2622 Ga0207691_10021310
2623 Ga0207691_10022502
2624 Ga0207691_10029470
2625 Ga0207691_10030708
2626 Ga0207691_10042058
2627 Ga0207691_10109538
2628 Ga0207691_10192109
2629 Ga0207691_10352878
2630 Ga0207711_10000164
2631 Ga0207711_10002873
2632 Ga0207711_10048728
2633 Ga0207711_10366130
2634 Ga0207711_10482233
2635 Ga0207711_10590307
2636 Ga0207711_10680992
2637 Ga0207689_10000136
2638 Ga0207689_10000889
2639 Ga0207689_10006468
2640 Ga0207689_10008327
2641 Ga0207689_10035481
2642 Ga0207689_10107284
2643 Ga0207689_10186836
2644 Ga0207661_10013035
2645 Ga0207661_10030076
2646 Ga0207661_10050108
2647 Ga0207661_10055964
2648 Ga0207679_10003393
2649 Ga0207679_10003765
2650 Ga0207679_10021822
2651 Ga0207679_10023459
2652 Ga0207679_10048055
2653 Ga0207679_10223762
2654 Ga0207679_10250192
2655 Ga0207679_10676334
2656 Ga0207667_10004085
2657 Ga0207667_10004150
2658 Ga0207667_10005013
2659 Ga0207667_10027186
2660 Ga0207667_10039264
2661 Ga0207667_10046288
2662 Ga0207667_10056153
2663 Ga0207667_10060441
2664 Ga0207667_10141143
2665 Ga0207667_10177224
2666 Ga0207667_10241642
2667 Ga0207667_10442418
2668 Ga0207667_10669534
2669 Ga0207651_10007222
2670 Ga0207651_10017942
2671 Ga0207651_10023887
2672 Ga0207651_10049282
2673 Ga0207651_10053465
2674 Ga0207651_10097968
2675 Ga0207712_10012054
2676 Ga0207712_10174793
2677 Ga0207712_10301262
2678 Ga0207668_10006032
2679 Ga0207668_10007633
2680 Ga0207668_10014248
2681 Ga0207668_10022713
2682 Ga0207668_10025826
2683 Ga0207668_10044136
2684 Ga0207668_10271061
2685 Ga0207668_10607131
2686 Ga0207668_10694170
2687 Ga0207640_10032658
2688 Ga0207640_10093425
2689 Ga0207640_10154240
2690 Ga0207640_10167128
2691 Ga0207640_10227438
2692 Ga0207640_10333230
2693 Ga0207658_10002886
2694 Ga0207658_10010048
2695 Ga0207658_10011457
2696 Ga0207658_10056071
2697 Ga0207658_10180650
2698 Ga0207658_10208881
2699 Ga0207658_10324036
2700 Ga0207677_10000092
2701 Ga0207677_10035476
2702 Ga0207677_10059609
2703 Ga0207677_10169237
2704 Ga0207677_10545677
2705 Ga0207703_10000506
2706 Ga0207703_10004214
2707 Ga0207703_10014986
2708 Ga0207703_10081584
2709 Ga0207639_10132173
2710 Ga0207639_10157971
2711 Ga0207639_10237960
2712 Ga0207639_10276334
2713 Ga0207639_10351962
2714 Ga0207639_10357246
2715 Ga0207678_10002764
2716 Ga0207678_10005468
2717 Ga0207678_10007894
2718 Ga0207678_10014773
2719 Ga0207678_10133036
2720 Ga0207678_10150853
2721 Ga0207678_10441811
2722 Ga0207678_10477706
2723 Ga0207678_10484983
2724 Ga0207708_10000464
2725 Ga0207708_10022897
2726 Ga0207708_10041861
2727 Ga0207708_10496569
2728 Ga0207702_10002581
2729 Ga0207702_10010013
2730 Ga0207702_10011289
2731 Ga0207702_10013322
2732 Ga0207702_10067235
2733 Ga0207702_10109585
2734 Ga0207641_10003632
2735 Ga0207641_10005922
2736 Ga0207641_10008864
2737 Ga0207641_10011137
2738 Ga0207641_10044889
2739 Ga0207641_10046818
2740 Ga0207641_10127513
2741 Ga0207641_10156765
2742 Ga0207641_10247563
2743 Ga0207648_10000684
2744 Ga0207648_10001366
2745 Ga0207648_10004085
2746 Ga0207648_10008908
2747 Ga0207648_10050071
2748 Ga0207648_10063075
2749 Ga0207648_10232541
2750 Ga0207648_10256233
2751 Ga0207648_10338045
2752 Ga0207648_10459022
2753 Ga0207676_10000121
2754 Ga0207676_10004876
2755 Ga0207676_10010720
2756 Ga0207676_10021343
2757 Ga0207676_10029406
2758 Ga0207676_10031843
2759 Ga0207676_10044175
2760 Ga0207676_10090343
2761 Ga0207676_10232789
2762 Ga0207676_10344716
2763 Ga0207674_10000225
2764 Ga0207674_10001745
2765 Ga0207674_10003791
2766 Ga0207674_10005488
2767 Ga0207674_10006478
2768 Ga0207674_10047615
2769 Ga0207674_10130296
2770 Ga0207674_10155859
2771 Ga0207674_10476873
2772 Ga0207675_100000213
2773 Ga0207675_100000855
2774 Ga0207675_100037223
2775 Ga0207675_100057980
2776 Ga0207675_100159518
2777 Ga0207675_100159573
2778 Ga0207675_100180708
2779 Ga0207675_100434927
2780 Ga0207675_100473994
2781 Ga0207683_10000121
2782 Ga0207683_10000281
2783 Ga0207683_10003368
2784 Ga0207683_10006240
2785 Ga0207683_10008506
2786 Ga0207683_10010771
2787 Ga0207683_10071847
2788 Ga0207683_10310082
2789 Ga0207683_10545596
2790 Ga0207698_10003670
2791 Ga0207698_10010928
2792 Ga0207698_10032050
2793 Ga0207698_10205246
2794 Ga0207698_10281897
2795 Ga0207698_10314649
2796 Ga0207698_10505070
2797 Ga0209371_1010418
2798 Ga0209969_1012955
2799 Ga0209981_1005979
2800 Ga0209996_1001078
2801 Ga0209996_1009978
2802 Ga0210000_1018837
2803 Ga0209995_1005683
2804 Ga0209968_1000987
2805 Ga0209999_1006228
2806 Ga0209982_1013388
2807 Ga0209970_1000504
2808 Ga0209983_1008586
2809 Ga0209971_1009975
2810 Ga0209971_1022202
2811 Ga0209966_1000138
2812 Ga0209974_10002121
2813 Ga0209974_10024770
2814 Ga0209974_10027418
2815 Ga0209974_10062921
2816 Ga0207428_10013439
2817 Ga0207428_10177058
2818 Ga0268266_10014216
2819 Ga0268266_10022829
2820 Ga0268266_10048019
2821 Ga0268266_10299933
2822 Ga0268266_10498499
2823 Ga0268266_10510854
2824 Ga0268265_10050352
2825 Ga0268265_10053828
2826 Ga0268265_10073856
2827 Ga0268265_10290441
2828 Ga0268265_10700427
2829 Ga0268264_10007565
2830 Ga0268264_10014520
2831 Ga0268264_10016351
2832 Ga0268264_10028647
2833 Ga0268264_10144510
2834 Ga0268264_10185110
2835 Ga0268264_10364201
2836 Ga0268264_10441999
2837 Ga0265336_10000040
2838 Ga0307515_10022881
2839 Ga0265324_10001969
2840 Ga0268256_1011174
2841 Ga0307511_10004027
2842 Ga0265760_10075064
2843 Ga0265320_10011984
2844 Ga0265339_10003247
2845 Ga0265331_10056087
2846 Ga0265316_10056387
2847 Ga0307513_10000014
2848 Ga0307509_10108266
2849 Ga0307408_100016188
2850 Ga0307408_100115037
2851 Ga0265313_10018912
2852 Ga0265313_10045468
2853 Ga0307508_10319699
2854 Ga0265314_10008372
2855 Ga0265342_10004326
2856 Ga0265342_10014320
2857 Ga0307516_10144330
2858 Ga0307413_10081564
2859 Ga0307413_10188359
2860 Ga0307410_10169969
2861 Ga0307410_10184959
2862 Ga0307406_10009098
2863 Ga0307406_10256170
2864 Ga0307407_10006322
2865 Ga0307407_10227006
2866 Ga0307412_10000059
2867 Ga0307412_10061948
2868 Ga0307412_10205611
2869 Ga0307409_100038309
2870 Ga0307416_100049321
2871 Ga0307416_100055199
2872 Ga0307416_100276979
2873 Ga0307416_100325020
2874 Ga0307416_100434728
2875 Ga0307416_101034194
2876 Ga0307414_10072710
2877 Ga0307411_10006981
2878 Ga0307507_10069599
2879 Ga0373959_0009971
2880 Ga0373934_0010219
2881 Ga0373934_0144853
2882 Ga0373923_0046028
2883 Ga0373923_0226649
2884 Ga0373945_0015509
2885 Ga0373945_0026059
2886 Ga0373953_0009840
2887 Ga0373953_0067837
2888 Ga0373954_0010596
2889 Ga0373954_0025613
2890 Ga0373956_0004626
2891 Ga0373957_0024247
2892 Ga0373943_0008558
2893 Ga0373943_0034893
2894 Ga0373943_0038302
2895 Ga0373946_0011410
2896 Ga0373946_0032950
2897 Ga0373946_0135530
2898 Ga0373955_0111495
2899 Ga0373924_0042033
2900 Ga0373931_0004585
2901 Ga0373931_0008340
2902 Ga0373935_0069216
2903 Ga0373935_0205764
2904 Ga0373935_0363139
2905 Ga0373927_0019638
2906 Ga0373927_0057677
2907 Ga0373927_0105906
2908 Ga0373933_0022808
2909 Ga0373933_0293637
2910 Ga0373947_0010110
2911 Ga0373947_0024048
2912 Ga0373947_0549328
2913 Ga0373937_0001683
2914 Ga0373937_0039849
2915 Ga0373937_0242898
2916 Ga0373937_0436245
2917 Ga0373925_0124205
2918 Ga0373925_0382290
2919 Ga0395899_0009973
2920 Ga0395899_0034497
2921 Ga0395899_0288594
2922 Ga0395900_0001667
2923 Ga0395900_0048750
2924 Ga0395900_0088562
2925 Ga0395900_0097779
2926 Ga0395900_0309033
2927 Ga0395900_0411504
2928 Ga0395898_0004523
2929 Ga0395898_0116565
2930 Ga0395898_0137478
2931 Ga0395905_0000071
2932 Ga0395905_0029519
2933 Ga0395905_0033370
2934 Ga0395905_0092936
2935 Ga0436364_1275388
2936 Ga0395901_0000095
2937 Ga0395901_0036040
2938 Ga0395901_0056760
2939 Ga0395901_0060912
2940 Ga0395901_0105442
2941 Ga0395901_0179409
2942 Ga0436365_0796717
2943 Ga0436361_0107660
2944 Ga0436361_0453531
2945 Ga0436361_0487098
2946 Ga0436361_0745691
2947 Ga0436361_0805654
2948 Ga0436361_1206467
2949 Ga0439465_0019172
2950 Ga0451798_0358443
2951 Ga0451807_1547476
2952 Ga0451853_2590518
2953 Ga0439435_0066000
2954 Ga0450893_0020799
2955 Ga0451577_0005590
2956 Ga0451577_0007354
2957 Ga0451577_0008741
2958 Ga0451577_0076280
2959 Ga0451577_0140387
2960 Ga0451577_0154158
2961 Ga0466969_0001965
2962 Ga0466972_0000084
2963 Ga0466972_0005185
2964 Ga0466982_0008424
2965 Ga0466965_0004304
2966 Ga0466965_0009948
2967 Ga0466966_0000586
2968 Ga0466966_0015399
2969 Ga0466961_0001415
2970 Ga0466961_0006560
2971 Ga0466961_0123640
2972 Ga0466963_0053293
2973 Ga0466964_0012708
2974 Ga0466964_0048842
2975 Ga0466964_0072036
2976 Ga0466964_0097806
2977 Ga0453684_0038361
2978 Ga0453684_0252699
2979 Ga0453684_0324555
2980 Ga0453684_0373913
2981 Ga0453684_0552277
2982 Ga0466971_0009896
2983 Ga0466960_0118273
2984 Ga0466960_0140072
2985 Ga0466960_0237523
2986 Ga0466959_0010505
2987 Ga0466959_0033595
2988 Ga0451576_0003357
2989 Ga0451576_0015971
2990 Ga0451576_0048382
2991 Ga0466958_0143803
2992 Ga0466958_0226025
2993 Ga0466967_0010897
2994 Ga0466967_0235320
2995 Ga0466967_0464283
2996 Ga0495592_0093928
2997 Ga0495603_0011710
2998 Ga0495590_0015933
2999 Ga0495591_001235
3000 Ga0495629_0011435
3001 Ga0495629_0013424
3002 Ga0495629_0025910
3003 Ga0495651_0031194
3004 Ga0495651_0077070
3005 Ga0495651_0199113
3006 Ga0495653_0035337
3007 Ga0495653_0101167
3008 Ga0495650_0003970
3009 Ga0495650_0009757
3010 Ga0495650_0104765
3011 Ga0495580_0098520
3012 Ga0495580_0128610
3013 Ga0495580_0296523
3014 Ga0495582_0009817
3015 Ga0495639_0067302
3016 Ga0495662_0036255
3017 Ga0495662_0084613
3018 Ga0495664_0037859
3019 Ga0495664_0045779
3020 Ga0495664_0059767
3021 Ga0495585_0015782
3022 Ga0495596_0010328
3023 Ga0495583_0000046
3024 Ga0495583_0003496
3025 Ga0495606_0008997
3026 Ga0495606_0009638
3027 Ga0495606_0200061
3028 Ga0495608_0020916
3029 Ga0495610_0000624
3030 Ga0495618_0005918
3031 Ga0495618_0192781
3032 Ga0495620_0002905
3033 Ga0495628_0005536
3034 Ga0495630_0024678
3035 Ga0495630_0159312
3036 Ga0495666_0004392
3037 Ga0495642_0016251
3038 Ga0495642_0025549
3039 Ga0495652_0002282
3040 Ga0495665_0018812
3041 Ga0495665_0022165
3042 Ga0495665_0115993
3043 Ga0495640_0003666
3044 Ga0495640_0036801
3045 Ga0495586_0087879
3046 Ga0495587_0079172
3047 Ga0495587_0092093
3048 Ga0495598_0092816
3049 Ga0495597_0001164
3050 Ga0495645_0040975
3051 Ga0495622_0000017
3052 Ga0495622_0075510
3053 Ga0495667_0080883
3054 Ga0495668_0177672
3055 Ga0495634_0070757
3056 Ga0495625_0000720
3057 Ga0495625_0002351
3058 Ga0495625_0108423
3059 Ga0495635_0020342
3060 Ga0495635_0087455
3061 Ga0495635_0405936
3062 Ga0495599_0118722
3063 Ga0495599_0219791
3064 Ga0495623_0001196
3065 Ga0495623_0003843
3066 Ga0495623_0016582
3067 Ga0495646_0032940
3068 Ga0495647_0010822
3069 Ga0495658_0011509
3070 Ga0495669_0006842
3071 Ga0495669_0155922
3072 Ga0495613_0061262
3073 Ga0495613_0132585
3074 Ga0495671_0028235
3075 Ga0495671_0137725
3076 Ga0495649_0001661
3077 Ga0495649_0012734
3078 Ga0495589_0024749
3079 Ga0495600_0022736
3080 Ga0495600_0028081
3081 Ga0495600_0225339
3082 Ga0495660_0079063
3083 Ga0495581_0069288
3084 Ga0495604_0029323
3085 Ga0495604_0038276
3086 Ga0495674_0004590
3087 Ga0495674_0028010
3088 Ga0495674_0121639
3089 Ga0495672_0065420
3090 Ga0495672_0215345
3091 Ga0495676_0008883
3092 Ga0495680_0002429
3093 Ga0495680_0108235
3094 Ga0495680_0233566
3095 Ga0495683_0010627
3096 Ga0495683_0014936
3097 Ga0495683_0050651
3098 Ga0495683_0198432
3099 Ga0495687_000018
3100 Ga0495687_016907
3101 Ga0495687_017543
3102 Ga0495675_0011625
3103 Ga0495675_0022924
3104 Ga0495675_0084521
3105 Ga0495675_0149768
3106 Ga0495679_001857
3107 Ga0495673_0003863
3108 Ga0495593_0031662
3109 Ga0495593_0034509
3110 Ga0495602_0004432
3111 Ga0495602_0049627
3112 Ga0495602_0475822
3113 Ga0495614_0003119
3114 Ga0496100_0000932
3115 Ga0496101_0035342
3116 Ga0496101_0048175
3117 Ga0496101_0076536
3118 Ga0496101_0128333
3119 Ga0496102_0005827
3120 Ga0496102_0013163
3121 Ga0496102_0029208
3122 Ga0496102_0101051
3123 Ga0496102_0128891
3124 Ga0496102_0684922
3125 Ga0496103_0000360
3126 Ga0496103_0017085
3127 Ga0496103_0157698
3128 Ga0496104_0008205
3129 Ga0496104_0055939
3130 Ga0496104_0107203
3131 Ga0496104_0187626
3132 Ga0496104_0295484
3133 Ga0496105_0225702
3134 Ga0496105_0236571
3135 Ga0496105_0269350
3136 Ga0496105_0522566
3137 Ga0496106_0002881
3138 Ga0496106_0005706
3139 Ga0496106_0037670
3140 Ga0496106_0075317
3141 Ga0496107_0021554
3142 Ga0496107_0263252
3143 Ga0496107_0626397
3144 Ga0496108_0002202
3145 Ga0496108_0152356
3146 Ga0496108_0202704
3147 Ga0496109_0017843
3148 Ga0496109_0042598
3149 Ga0496109_0232224
3150 Ga0496109_0334805
3151 Ga0496109_0423774
3152 Ga0496110_0026929
3153 Ga0496110_0060777
3154 Ga0496110_0237863
3155 Ga0496110_0756156
3156 Ga0496111_0018131
3157 Ga0496111_0179064
3158 Ga0496111_0272509
3159 Ga0496111_0312054
3160 Ga0496111_0431633
3161 Ga0496112_0002417
3162 Ga0496112_0007505
3163 Ga0496112_0011630
3164 Ga0496112_0021278
3165 Ga0496112_0024005
3166 Ga0496112_0807209
3167 Ga0496113_0003212
3168 Ga0496113_0080747
3169 Ga0496113_0635835
3170 Ga0496114_0032563
3171 Ga0496114_0045449
3172 Ga0496114_0159642
3173 Ga0496114_0462092
3174 Ga0496115_0267060
3175 Ga0496115_0422515
3176 Ga0496116_0001434
3177 Ga0496116_0003129
3178 Ga0496117_0002321
3179 Ga0496117_0003647
3180 Ga0496117_0015333
3181 Ga0496117_0090755
3182 Ga0496118_0000167
3183 Ga0496118_0026815
3184 Ga0496119_0067523
3185 Ga0496120_0066373
3186 Ga0496121_0002717
3187 Ga0496121_0008605
3188 Ga0496121_0035577
3189 Ga0496121_0187320
3190 Ga0496122_0001194
3191 Ga0496122_0006237
3192 Ga0496122_0209967
3193 Ga0496123_0000532
3194 Ga0496123_0006105
3195 Ga0496123_0178168
3196 Ga0496124_0010208
3197 Ga0496124_0263491
3198 Ga0496125_0002955
3199 Ga0496125_0007063
3200 Ga0496125_0069394
3201 Ga0496126_0000031
3202 Ga0496126_0223632
3203 Ga0496126_0238121
3204 Ga0495682_0048755
3205 Ga0501032_0006231
3206 Ga0501033_0003584
3207 Ga0501033_0028951
3208 Ga0501034_0001085
3209 Ga0501034_0006814
3210 Ga0501034_0023666
3211 Ga0501034_0031655
3212 Ga0501034_0141472
3213 Ga0501036_0001771
3214 Ga0501037_0004252
3215 Ga0501037_0089918
3216 Ga0501037_0246304
3217 Ga0501038_0000494
3218 Ga0501038_0509482
3219 Ga0501039_0392240
3220 Ga0501040_0191592
3221 Ga0501042_0095808
3222 Ga0501042_0120643
3223 Ga0501042_0230434
3224 Ga0501043_0001194
3225 Ga0501043_0100387
3226 Ga0501046_0002440
3227 Ga0501047_0004711
3228 Ga0501047_0020936
3229 Ga0501048_0088518
3230 Ga0501048_0307881
3231 Ga0501067_0015301
3232 Ga0501067_0178771
3233 Ga0501068_0000813
3234 Ga0501068_0370192
3235 Ga0501071_0151491
3236 Ga0501072_0031458
3237 Ga0501072_0190902
3238 Ga0501073_0001692
3239 Ga0501073_0007913
3240 Ga0501074_0070330
3241 Ga0501074_0114150
3242 Ga0501074_0235881
3243 Ga0501076_0013746
3244 Ga0501076_0363433
3245 Ga0501079_0054792
3246 Ga0501080_0000614
3247 Ga0501080_0001764
3248 Ga0501080_0026131
3249 Ga0501080_0093075
3250 Ga0501081_0002070
3251 Ga0501083_0016784
3252 Ga0501083_0026400
3253 Ga0501083_0044081
3254 Ga0501035_0034907
3255 Ga0501035_0082472
3256 Ga0501035_0137165
3257 Ga0501035_0294525
3258 Ga0501044_0000236
3259 Ga0501044_0012609
3260 nmdc:mga03683_22708_c1
3261 nmdc:mga03683_245360_c1
3262 nmdc:mga00v17_14882_c1
3263 nmdc:mga00v17_46477_c1
3264 nmdc:mga0yw44_26020_c1
3265 nmdc:mga0yw44_80260_c1
3266 nmdc:mga0k408_16840_c1
3267 nmdc:mga0k408_21004_c2
3268 nmdc:mga0k408_96283_c1
3269 nmdc:mga07m45_19107_c2
3270 nmdc:mga07m45_51636_c1
3271 nmdc:mga05p37_42889_c1
3272 nmdc:mga05p37_807231_c1
3273 nmdc:mga09592_16785_c1
3274 nmdc:mga09592_254596_c1
3275 nmdc:mga09592_59925_c1
3276 nmdc:mga0qj67_23454_c1
3277 nmdc:mga0qj67_381204_c1
3278 nmdc:mga06r32_60240_c1
3279 nmdc:mga08y16_140934_c1
3280 nmdc:mga08y16_189783_c1
3281 nmdc:mga08y16_26937_c1
3282 nmdc:mga08y16_456734_c1
3283 nmdc:mga08y16_965338_c1
3284 nmdc:mga0n895_401234_c1
3285 nmdc:mga0n895_4460_c1
3286 nmdc:mga0n895_45248_c1
3287 nmdc:mga0rr50_16136_c1
3288 nmdc:mga0rr50_304249_c1
3289 nmdc:mga0rr50_398644_c1
3290 nmdc:mga08x19_46547_c1
3291 nmdc:mga0a205_8120_c1
3292 Ga0495612_0080658
3293 Ga0500635_0000440
3294 Ga0495595_0091601
3295 Ga0495619_0026499
3296 Ga0500644_0011531
3297 Ga0500566_0149636
3298 Ga0500566_0183242
3299 Ga0500593_000087
3300 Ga0500595_014220
3301 Ga0500655_035102
3302 Ga0500658_0049219
3303 Ga0500604_0000278
3304 Ga0500616_0000520
3305 Ga0500616_0007851
3306 Ga0500627_0009870
3307 Ga0500627_0192198
3308 Ga0500638_138050
3309 Ga0500645_000100
3310 Ga0500645_002016
3311 Ga0500609_002189
3312 Ga0501084_0385692
3313 Ga0500661_001464
3314 Ga0587077_008909
3315 Ga0587086_005942
3316 Ga0587088_006045
3317 Ga0587092_036494
3318 Ga0587094_016727
3319 Ga0587117_016677
3320 Ga0587068_003730
3321 Ga0587072_016692
3322 Ga0587075_021123
3323 Ga0587076_000599
3324 Ga0587078_000752
3325 Ga0587078_016808
3326 Ga0587100_001375
3327 Ga0587102_000802
3328 Ga0587071_008180
3329 Ga0587111_0000638
3330 Ga0587111_0001949
3331 Ga0530510_0126595
3332 2509126550
3333 2511245773
3334 2512929184
3335 2563065098
3336 2588514463
3337 2644028937
3338 2713481915
3339 2738821071
3340 2738833553
3341 2738876960
3342 2739055841
3343 2739186709
3344 2739223553
3345 2819595283
3346 2857366159
3347 2876367258
3348 2884812645
3349 2884841125
3350 2884856000
3351 2896157075
3352 2903453272
3353 2903526749
3354 2903530632
3355 2919704873
3356 2921655269
3357 2937850916
3358 2945939366
3359 2963650051
3360 2968086638
3361 2977923891
3362 2990706709
3363 3004213329
3364 3004221402
3365 3004334607
3366 637078942
3367 642424633
3368 642620539

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

36

230

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

276

0.93

PF08659

KR

KR domain

37

216

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9851 1 246
7tzp-assembly3.cif.gz_G crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh 0.981 1 246
4nbw-assembly1.cif.gz_D crystal structure of fabg from plesiocystis pacifica 0.9807 6 246
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9799 1 246
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9795 3 243
ID Description Score Start End Superfamily
4nbwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9807 6 246 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.98 6 246 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9778 1 243 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9755 1 245 3.40.50.720
2rhcB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9755 6 245 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4R1UFC0-F1-model_v4 deleted 0.999 1 246
AF-A0A522V0P9-F1-model_v4 3-oxoacyl-ACP reductase FabG (EC 1.1.1.100) 0.9933 1 246 GO:0004316
GO:0006633
GO:0048038
AF-A0A5E4K4M7-F1-model_v4 L-rhamnose 1-dehydrogenase (NADP(+)) (EC 1.1.1.377) 0.993 1 246 GO:0004316
GO:0006633
GO:0051287
AF-A0A6G0ZWC7-F1-model_v4 deleted 0.9927 2 246
AF-A0A2N2E2P3-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9922 1 246 GO:0004316
GO:0006633
GO:0051287

Map