F495242

General Info

Members Datasets Scaffolds Average Seq Length
1659 450 1659 167

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_219482_c1|nmdc:mga03n38_219482_c1_35_658
Length 207
Sequence MRAILAEPEVAEGPPPGYLHHLGASVSPSHAREEPVMVVSRTSTDAIVHLKDDHKEIRRLFERFEKAGEDAERTKGKLVDQIIELLTVHTYIENEVMYPRVRELLPDLEDDVLESYEEHHVADVLVMELSTMKPSDERFDAKTTVLIENVRHHMGEEEQEWFPKVREGLGRKTLQEIGAEMIAKRKKAPRRPSQPSALKKTVDAVIS

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
122 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
127 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
147 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
155 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
157 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
158 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
243 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
244 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
245 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
246 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
247 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
250 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
254 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
255 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
280 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
281 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
282 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
283 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
284 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
285 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
286 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
287 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
288 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
289 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
290 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
291 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
292 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
293 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
294 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
295 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
296 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
297 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
298 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
299 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
300 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
301 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
302 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
303 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
304 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
305 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
306 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
307 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
308 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
309 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
312 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
313 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
314 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
315 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
316 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
317 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
318 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
321 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
322 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
323 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
337 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
338 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
339 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
340 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
341 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
342 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
343 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
344 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
345 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
346 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
347 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
348 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
349 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
350 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
351 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
352 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
353 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
354 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
355 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
356 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
357 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
360 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
363 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
364 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
365 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
366 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
367 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
368 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
369 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
370 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
371 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
372 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
375 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
376 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
377 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
378 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
379 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
380 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
381 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
385 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
404 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
405 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
406 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
407 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
408 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
411 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
412 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
413 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
414 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
415 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
416 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
417 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
418 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
419 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
420 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
421 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
425 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
426 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
427 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
428 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
429 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
430 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
431 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
432 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
433 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
434 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
435 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
436 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
437 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
438 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
439 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
440 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
441 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
442 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
443 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
444 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
445 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
446 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
447 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
448 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
449 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
450 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 3.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 10.49
Rhizosphere 83.79
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1017512 3300000546 Bacteria 762
2 JGI24740J21852_10017875 3300001979 Bacteria 2527
3 JGI24739J22299_10191096 3300001989 Bacteria 602
4 JGI24737J22298_10058604 3300001990 Bacteria 1161
5 JGI24737J22298_10080800 3300001990 Bacteria 967
6 JGI24735J21928_10017880 3300002067 Bacteria 2190
7 JGI24735J21928_10059333 3300002067 Bacteria 1100
8 JGI24738J21930_10008533 3300002075 Bacteria 2329
9 JGI24744J21845_10001669 3300002077 Bacteria 4440
10 JGI24033J26618_1020901 3300002155 Bacteria 838
11 JGI24751J29686_10098432 3300002459 Bacteria 610
12 Ga0006777J48905_1076505 3300003308 Bacteria 695
13 rootH1_10015642 3300003316 Bacteria 1330
14 Ga0032354_1055520 3300003693 Bacteria 1926
15 Ga0032354_1060140 3300003693 Bacteria 1218
16 Ga0032354_1088022 3300003693 Bacteria 617
17 Ga0070658_10007596 3300005327 Bacteria 8748
18 Ga0070658_10070005 3300005327 Bacteria 2871
19 Ga0070683_100000621 3300005329 Bacteria 25523
20 Ga0070683_100022727 3300005329 Bacteria 5608
21 Ga0070683_100033100 3300005329 Bacteria 4711
22 Ga0070683_100036698 3300005329 Bacteria 4486
23 Ga0070683_100051966 3300005329 Bacteria 3796
24 Ga0070683_100228596 3300005329 Bacteria 1768
25 Ga0070683_100291920 3300005329 Bacteria 1551
26 Ga0070690_100039310 3300005330 Bacteria 2989
27 Ga0070690_100562373 3300005330 Bacteria 861
28 Ga0070670_100111063 3300005331 Bacteria 2362
29 Ga0070670_100648194 3300005331 Bacteria 947
30 Ga0070677_10185946 3300005333 Bacteria 993
31 Ga0068869_100108415 3300005334 Bacteria 2110
32 Ga0068869_100174356 3300005334 Unclassified 1682
33 Ga0068869_100336041 3300005334 Bacteria 1228
34 Ga0070666_10029814 3300005335 Bacteria 3589
35 Ga0070666_10300648 3300005335 Bacteria 1143
36 Ga0070680_100135161 3300005336 Bacteria 2065
37 Ga0070680_100234341 3300005336 Bacteria 1551
38 Ga0070682_100001730 3300005337 Bacteria 12142
39 Ga0070682_100009211 3300005337 Bacteria 5582
40 Ga0070682_100012666 3300005337 Bacteria 4839
41 Ga0070682_100052829 3300005337 Bacteria 2544
42 Ga0070682_100127839 3300005337 Bacteria 1716
43 Ga0070682_100149746 3300005337 Bacteria 1600
44 Ga0070682_100161965 3300005337 Bacteria 1546
45 Ga0070682_100364570 3300005337 Bacteria 1081
46 Ga0070682_100647527 3300005337 Bacteria 841
47 Ga0068868_100013115 3300005338 Bacteria 6070
48 Ga0068868_100200496 3300005338 Bacteria 1663
49 Ga0068868_100337713 3300005338 Bacteria 1287
50 Ga0068868_100404647 3300005338 Bacteria 1178
51 Ga0068868_100995770 3300005338 Bacteria 766
52 Ga0068868_101103695 3300005338 Bacteria 730
53 Ga0070660_100057054 3300005339 Bacteria 3024
54 Ga0070660_100175337 3300005339 Bacteria 1733
55 Ga0070660_101736747 3300005339 Bacteria 531
56 Ga0070689_100653848 3300005340 Bacteria 914
57 Ga0070689_100794683 3300005340 Bacteria 832
58 Ga0070691_10080876 3300005341 Bacteria 1591
59 Ga0070691_10204997 3300005341 Bacteria 1038
60 Ga0070691_10228041 3300005341 Unclassified 990
61 Ga0070687_100068918 3300005343 Bacteria 1893
62 Ga0070687_100124765 3300005343 Bacteria 1478
63 Ga0070661_100074390 3300005344 Bacteria 2502
64 Ga0070692_10000683 3300005345 Bacteria 10876
65 Ga0070692_10096163 3300005345 Bacteria 1617
66 Ga0070692_10130303 3300005345 Bacteria 1413
67 Ga0070692_10340328 3300005345 Bacteria 929
68 Ga0070668_100166036 3300005347 Bacteria 1794
69 Ga0070668_100788893 3300005347 Bacteria 843
70 Ga0070669_100071264 3300005353 Bacteria 2571
71 Ga0070669_101687811 3300005353 Bacteria 552
72 Ga0070675_100008013 3300005354 Bacteria 8189
73 Ga0070675_100269506 3300005354 Bacteria 1494
74 Ga0070675_100353760 3300005354 Bacteria 1303
75 Ga0070671_100063531 3300005355 Bacteria 3074
76 Ga0070671_100114780 3300005355 Bacteria 2264
77 Ga0070671_100489797 3300005355 Bacteria 1057
78 Ga0070671_100532601 3300005355 Bacteria 1012
79 Ga0070671_100916968 3300005355 Bacteria 766
80 Ga0070674_100010807 3300005356 Bacteria 5535
81 Ga0070674_100329526 3300005356 Bacteria 1227
82 Ga0070674_101265865 3300005356 Bacteria 657
83 Ga0070673_100110922 3300005364 Bacteria 2275
84 Ga0070673_100123265 3300005364 Bacteria 2165
85 Ga0070673_100189253 3300005364 Bacteria 1767
86 Ga0070688_100034853 3300005365 Bacteria 3053
87 Ga0070688_100071372 3300005365 Bacteria 2223
88 Ga0070659_100028058 3300005366 Bacteria 4343
89 Ga0070659_100032099 3300005366 Bacteria 4071
90 Ga0070659_100100880 3300005366 Bacteria 2323
91 Ga0070659_100364280 3300005366 Bacteria 1215
92 Ga0070659_101305082 3300005366 Bacteria 644
93 Ga0070667_100074626 3300005367 Bacteria 2893
94 Ga0070667_100081033 3300005367 Bacteria 2777
95 Ga0070667_100157296 3300005367 Bacteria 2000
96 Ga0070667_100165023 3300005367 Bacteria 1953
97 Ga0070667_100886514 3300005367 Bacteria 830
98 Ga0070667_101163492 3300005367 Bacteria 722
99 Ga0070703_10109877 3300005406 Unclassified 985
100 Ga0070703_10218345 3300005406 Bacteria 757
101 Ga0070709_10039132 3300005434 Bacteria 2908
102 Ga0070709_10067448 3300005434 Bacteria 2297
103 Ga0070714_100000014 3300005435 Bacteria 210194
104 Ga0070714_100078731 3300005435 Bacteria 2865
105 Ga0070714_100090048 3300005435 Bacteria 2686
106 Ga0070714_100093956 3300005435 Bacteria 2631
107 Ga0070714_100098254 3300005435 Bacteria 2575
108 Ga0070714_100167416 3300005435 Bacteria 1992
109 Ga0070714_100187524 3300005435 Bacteria 1885
110 Ga0070714_100322683 3300005435 Bacteria 1444
111 Ga0070714_101273975 3300005435 Bacteria 717
112 Ga0070713_100043070 3300005436 Bacteria 3688
113 Ga0070713_100073992 3300005436 Bacteria 2885
114 Ga0070713_100120294 3300005436 Bacteria 2302
115 Ga0070713_100133265 3300005436 Bacteria 2193
116 Ga0070713_100196371 3300005436 Bacteria 1820
117 Ga0070713_100257299 3300005436 Bacteria 1594
118 Ga0070713_100361185 3300005436 Bacteria 1349
119 Ga0070713_100920375 3300005436 Unclassified 841
120 Ga0070710_10002988 3300005437 Bacteria 8034
121 Ga0070710_10039714 3300005437 Bacteria 2590
122 Ga0070710_10070428 3300005437 Bacteria 2014
123 Ga0070710_10077900 3300005437 Bacteria 1927
124 Ga0070710_10106121 3300005437 Bacteria 1680
125 Ga0070710_10170914 3300005437 Bacteria 1354
126 Ga0070710_10313532 3300005437 Bacteria 1027
127 Ga0070710_10315567 3300005437 Bacteria 1024
128 Ga0070701_10000430 3300005438 Bacteria 14330
129 Ga0070711_100019881 3300005439 Bacteria 4318
130 Ga0070711_100214277 3300005439 Bacteria 1493
131 Ga0070705_100045044 3300005440 Bacteria 2536
132 Ga0070705_100105098 3300005440 Bacteria 1792
133 Ga0070705_100178071 3300005440 Bacteria 1438
134 Ga0070700_100000218 3300005441 Bacteria 31966
135 Ga0070700_100000965 3300005441 Bacteria 14203
136 Ga0070700_100066374 3300005441 Bacteria 2290
137 Ga0070700_100500132 3300005441 Bacteria 935
138 Ga0070694_100092723 3300005444 Bacteria 2122
139 Ga0070694_100142971 3300005444 Bacteria 1739
140 Ga0070694_100266237 3300005444 Bacteria 1302
141 Ga0070694_100532452 3300005444 Bacteria 939
142 Ga0070708_100473198 3300005445 Bacteria 1182
143 Ga0070663_100008736 3300005455 Bacteria 6245
144 Ga0070663_100025629 3300005455 Bacteria 3984
145 Ga0070663_100073227 3300005455 Bacteria 2498
146 Ga0070663_100384963 3300005455 Bacteria 1143
147 Ga0070663_100385817 3300005455 Bacteria 1142
148 Ga0070663_100941624 3300005455 Bacteria 748
149 Ga0070678_100159550 3300005456 Bacteria 1826
150 Ga0070678_100316914 3300005456 Bacteria 1330
151 Ga0070678_101413388 3300005456 Bacteria 650
152 Ga0070662_100011939 3300005457 Bacteria 5743
153 Ga0070662_100102894 3300005457 Bacteria 2165
154 Ga0070662_100390653 3300005457 Bacteria 1147
155 Ga0070681_11033171 3300005458 Bacteria 742
156 Ga0068867_100004208 3300005459 Bacteria 10128
157 Ga0068867_100141193 3300005459 Bacteria 1883
158 Ga0068867_100524579 3300005459 Bacteria 1022
159 Ga0068867_100691356 3300005459 Bacteria 899
160 Ga0070685_10247192 3300005466 Bacteria 1180
161 Ga0070685_10517042 3300005466 Unclassified 847
162 Ga0070698_100074742 3300005471 Bacteria 3394
163 Ga0070698_100300107 3300005471 Bacteria 1537
164 Ga0070679_100001808 3300005530 Bacteria 19287
165 Ga0070679_100181597 3300005530 Bacteria 2076
166 Ga0070679_100298389 3300005530 Bacteria 1562
167 Ga0070684_100002397 3300005535 Bacteria 13817
168 Ga0070684_100049562 3300005535 Bacteria 3645
169 Ga0070684_100065509 3300005535 Bacteria 3189
170 Ga0070684_100088992 3300005535 Bacteria 2744
171 Ga0070684_100098113 3300005535 Bacteria 2613
172 Ga0070684_100159050 3300005535 Bacteria 2049
173 Ga0070684_100196962 3300005535 Bacteria 1834
174 Ga0070684_100389154 3300005535 Bacteria 1285
175 Ga0068853_100042929 3300005539 Bacteria 3868
176 Ga0068853_100097719 3300005539 Bacteria 2592
177 Ga0068853_100606917 3300005539 Bacteria 1039
178 Ga0070672_100002245 3300005543 Bacteria 12184
179 Ga0070672_101040004 3300005543 Bacteria 727
180 Ga0070672_101223058 3300005543 Bacteria 669
181 Ga0070686_100026582 3300005544 Bacteria 3495
182 Ga0070686_100266148 3300005544 Bacteria 1258
183 Ga0070686_101006880 3300005544 Bacteria 684
184 Ga0070695_100045656 3300005545 Bacteria 2793
185 Ga0070695_100191032 3300005545 Bacteria 1457
186 Ga0070695_100500214 3300005545 Bacteria 940
187 Ga0070696_100054359 3300005546 Bacteria 2790
188 Ga0070696_100057338 3300005546 Bacteria 2718
189 Ga0070693_100014081 3300005547 Bacteria 4088
190 Ga0070693_100036327 3300005547 Bacteria 2738
191 Ga0070693_100468355 3300005547 Bacteria 888
192 Ga0070665_100039101 3300005548 Bacteria 4770
193 Ga0070665_100134015 3300005548 Bacteria 2479
194 Ga0070665_100285276 3300005548 Bacteria 1653
195 Ga0070665_100348829 3300005548 Bacteria 1485
196 Ga0070704_100505263 3300005549 Bacteria 1049
197 Ga0070704_100648602 3300005549 Bacteria 932
198 Ga0068855_100133040 3300005563 Bacteria 2839
199 Ga0068855_100199765 3300005563 Bacteria 2251
200 Ga0068855_100257774 3300005563 Bacteria 1944
201 Ga0068855_100376332 3300005563 Bacteria 1560
202 Ga0068855_101187623 3300005563 Bacteria 794
203 Ga0070664_100002454 3300005564 Bacteria 14930
204 Ga0070664_100380810 3300005564 Bacteria 1288
205 Ga0070664_100382555 3300005564 Bacteria 1285
206 Ga0070664_100580614 3300005564 Bacteria 1038
207 Ga0068857_100050154 3300005577 Bacteria 3703
208 Ga0068857_100099315 3300005577 Bacteria 2611
209 Ga0068857_100245779 3300005577 Bacteria 1639
210 Ga0068857_100249868 3300005577 Bacteria 1626
211 Ga0068857_100417519 3300005577 Bacteria 1250
212 Ga0068857_101334042 3300005577 Bacteria 697
213 Ga0068857_101389276 3300005577 Bacteria 683
214 Ga0068854_100356033 3300005578 Bacteria 1199
215 Ga0068854_100523006 3300005578 Bacteria 1002
216 Ga0068854_100787783 3300005578 Unclassified 828
217 Ga0068856_100051532 3300005614 Bacteria 4058
218 Ga0068856_100069607 3300005614 Bacteria 3480
219 Ga0068856_100124954 3300005614 Bacteria 2576
220 Ga0068856_100194564 3300005614 Bacteria 2042
221 Ga0068856_100385507 3300005614 Bacteria 1421
222 Ga0068856_100826987 3300005614 Unclassified 945
223 Ga0068856_101178636 3300005614 Bacteria 782
224 Ga0070702_100055487 3300005615 Bacteria 2284
225 Ga0070702_100084111 3300005615 Bacteria 1913
226 Ga0070702_100107815 3300005615 Bacteria 1721
227 Ga0070702_100246023 3300005615 Bacteria 1210
228 Ga0070702_100327441 3300005615 Bacteria 1070
229 Ga0068852_100003717 3300005616 Bacteria 10695
230 Ga0068852_100011959 3300005616 Bacteria 6565
231 Ga0068852_100101042 3300005616 Bacteria 2603
232 Ga0068852_100384804 3300005616 Bacteria 1377
233 Ga0068852_100384884 3300005616 Unclassified 1377
234 Ga0068852_100653861 3300005616 Bacteria 1059
235 Ga0068859_100165706 3300005617 Bacteria 2290
236 Ga0068859_100303019 3300005617 Bacteria 1691
237 Ga0068859_100469809 3300005617 Bacteria 1353
238 Ga0068859_100476164 3300005617 Bacteria 1344
239 Ga0068864_100062999 3300005618 Bacteria 3214
240 Ga0068864_100179000 3300005618 Bacteria 1937
241 Ga0068864_100233720 3300005618 Bacteria 1701
242 Ga0068864_100268324 3300005618 Bacteria 1589
243 Ga0068864_100275849 3300005618 Bacteria 1568
244 Ga0068864_101049415 3300005618 Bacteria 810
245 Ga0068866_10235113 3300005718 Bacteria 1113
246 Ga0068861_100010264 3300005719 Bacteria 6501
247 Ga0068861_100092973 3300005719 Bacteria 2384
248 Ga0068861_100299635 3300005719 Bacteria 1392
249 Ga0068851_10106595 3300005834 Bacteria 1492
250 Ga0068851_10160482 3300005834 Bacteria 1235
251 Ga0068870_10000655 3300005840 Bacteria 13196
252 Ga0068870_10100702 3300005840 Bacteria 1632
253 Ga0068870_10129845 3300005840 Bacteria 1462
254 Ga0068870_10374840 3300005840 Bacteria 919
255 Ga0068870_10770399 3300005840 Bacteria 670
256 Ga0068870_11009047 3300005840 Bacteria 594
257 Ga0068863_100038332 3300005841 Bacteria 4560
258 Ga0068863_100141365 3300005841 Bacteria 2300
259 Ga0068863_100473726 3300005841 Bacteria 1231
260 Ga0068863_100504805 3300005841 Bacteria 1191
261 Ga0068863_101547269 3300005841 Bacteria 672
262 Ga0068858_100184888 3300005842 Bacteria 1968
263 Ga0068858_100259514 3300005842 Bacteria 1651
264 Ga0068858_100319951 3300005842 Bacteria 1482
265 Ga0068858_100358610 3300005842 Bacteria 1397
266 Ga0068860_100000555 3300005843 Bacteria 45431
267 Ga0068860_100337765 3300005843 Bacteria 1481
268 Ga0068860_100369832 3300005843 Bacteria 1414
269 Ga0068860_100691861 3300005843 Bacteria 1029
270 Ga0068862_100014021 3300005844 Bacteria 6648
271 Ga0068862_101691098 3300005844 Bacteria 641
272 Ga0081539_10113294 3300005985 Bacteria 1361
273 Ga0070717_10025801 3300006028 Bacteria 4680
274 Ga0070717_10070997 3300006028 Bacteria 2903
275 Ga0070717_10099708 3300006028 Bacteria 2465
276 Ga0070717_10340210 3300006028 Bacteria 1340
277 Ga0070717_10455427 3300006028 Bacteria 1153
278 Ga0070717_10684433 3300006028 Bacteria 931
279 Ga0075365_10013096 3300006038 Bacteria 4946
280 Ga0075365_10021136 3300006038 Bacteria 4054
281 Ga0075365_10038376 3300006038 Bacteria 3113
282 Ga0075365_10058278 3300006038 Bacteria 2571
283 Ga0075365_10124116 3300006038 Bacteria 1783
284 Ga0075365_10180053 3300006038 Bacteria 1478
285 Ga0075365_10232311 3300006038 Bacteria 1295
286 Ga0075365_10419031 3300006038 Bacteria 945
287 Ga0075368_10012439 3300006042 Bacteria 3111
288 Ga0075368_10028309 3300006042 Bacteria 2164
289 Ga0075363_100012591 3300006048 Bacteria 4081
290 Ga0075363_100026182 3300006048 Bacteria 2981
291 Ga0075363_100031330 3300006048 Bacteria 2757
292 Ga0075363_100043827 3300006048 Bacteria 2368
293 Ga0075363_100051114 3300006048 Bacteria 2203
294 Ga0075364_10076571 3300006051 Bacteria 2207
295 Ga0075364_10177133 3300006051 Bacteria 1442
296 Ga0075364_10331992 3300006051 Bacteria 1036
297 Ga0075364_10354865 3300006051 Bacteria 1000
298 Ga0070715_10044150 3300006163 Bacteria 1883
299 Ga0070715_10235174 3300006163 Bacteria 950
300 Ga0070716_100073215 3300006173 Bacteria 2020
301 Ga0070716_100102256 3300006173 Bacteria 1759
302 Ga0070716_100234132 3300006173 Bacteria 1241
303 Ga0070716_100318719 3300006173 Bacteria 1088
304 Ga0070712_100002761 3300006175 Bacteria 10851
305 Ga0070712_100340523 3300006175 Bacteria 1224
306 Ga0070712_101489800 3300006175 Bacteria 591
307 Ga0075362_10097099 3300006177 Bacteria 1374
308 Ga0075367_10020632 3300006178 Bacteria 3673
309 Ga0075367_10057392 3300006178 Bacteria 2315
310 Ga0075367_10074064 3300006178 Bacteria 2053
311 Ga0097621_100239545 3300006237 Bacteria 1585
312 Ga0097621_100448828 3300006237 Bacteria 1161
313 Ga0075370_10058389 3300006353 Bacteria 2194
314 Ga0075370_10058918 3300006353 Bacteria 2184
315 Ga0075370_10246275 3300006353 Bacteria 1059
316 Ga0075370_10312842 3300006353 Bacteria 935
317 Ga0068871_100594828 3300006358 Bacteria 1006
318 Ga0068871_100912824 3300006358 Bacteria 814
319 Ga0068871_101131112 3300006358 Bacteria 733
320 Ga0075428_101066017 3300006844 Bacteria 854
321 Ga0075428_101766250 3300006844 Bacteria 644
322 Ga0075430_100356993 3300006846 Bacteria 1207
323 Ga0075431_100641776 3300006847 Bacteria 1043
324 Ga0075433_10622465 3300006852 Bacteria 947
325 Ga0075434_100111264 3300006871 Bacteria 2749
326 Ga0075434_100470001 3300006871 Bacteria 1279
327 Ga0075429_100746336 3300006880 Bacteria 857
328 Ga0068865_100001715 3300006881 Bacteria 12860
329 Ga0068865_100865369 3300006881 Bacteria 784
330 Ga0075436_100041243 3300006914 Bacteria 3184
331 Ga0075436_100044354 3300006914 Bacteria 3066
332 Ga0097620_100165697 3300006931 Bacteria 2290
333 Ga0097620_100169034 3300006931 Unclassified 2267
334 Ga0097620_100303009 3300006931 Bacteria 1691
335 Ga0097620_100469795 3300006931 Bacteria 1353
336 Ga0097620_100476182 3300006931 Bacteria 1344
337 Ga0075435_100227172 3300007076 Bacteria 1585
338 Ga0075435_100416549 3300007076 Bacteria 1157
339 Ga0099795_10027976 3300007788 Bacteria 1912
340 Ga0099795_10101633 3300007788 Bacteria 1129
341 Ga0105244_10066956 3300009036 Bacteria 1797
342 Ga0105240_10169590 3300009093 Bacteria 2586
343 Ga0111539_10005936 3300009094 Bacteria 15772
344 Ga0111539_10278577 3300009094 Bacteria 1946
345 Ga0111539_10745271 3300009094 Bacteria 1140
346 Ga0111539_10911763 3300009094 Bacteria 1022
347 Ga0111539_11385604 3300009094 Bacteria 816
348 Ga0105245_10002375 3300009098 Bacteria 17026
349 Ga0105245_10003533 3300009098 Bacteria 13975
350 Ga0105245_10010196 3300009098 Bacteria 8181
351 Ga0105245_10018880 3300009098 Bacteria 6033
352 Ga0105245_10033904 3300009098 Bacteria 4525
353 Ga0105245_10053785 3300009098 Bacteria 3614
354 Ga0105245_10115703 3300009098 Bacteria 2499
355 Ga0105245_10158882 3300009098 Bacteria 2143
356 Ga0105245_10263103 3300009098 Bacteria 1679
357 Ga0105245_10294814 3300009098 Bacteria 1590
358 Ga0105245_10626080 3300009098 Bacteria 1105
359 Ga0105245_10921431 3300009098 Bacteria 916
360 Ga0105245_11154200 3300009098 Bacteria 822
361 Ga0105245_11422523 3300009098 Bacteria 744
362 Ga0105245_11802178 3300009098 Bacteria 665
363 Ga0105247_10064705 3300009101 Bacteria 2273
364 Ga0105247_10069909 3300009101 Bacteria 2192
365 Ga0114129_10690270 3300009147 Bacteria 1313
366 Ga0114129_11370707 3300009147 Bacteria 874
367 Ga0105243_10001743 3300009148 Bacteria 18741
368 Ga0105243_10078527 3300009148 Bacteria 2688
369 Ga0105243_10126416 3300009148 Bacteria 2163
370 Ga0105243_10134591 3300009148 Bacteria 2101
371 Ga0105243_10139743 3300009148 Bacteria 2065
372 Ga0105243_10141105 3300009148 Bacteria 2056
373 Ga0105243_10160099 3300009148 Bacteria 1940
374 Ga0105243_10394066 3300009148 Bacteria 1284
375 Ga0105243_10678451 3300009148 Bacteria 1002
376 Ga0105241_10052775 3300009174 Bacteria 3106
377 Ga0105241_10071150 3300009174 Bacteria 2700
378 Ga0105241_10464217 3300009174 Bacteria 1122
379 Ga0105242_10048497 3300009176 Bacteria 3452
380 Ga0105242_10081866 3300009176 Bacteria 2700
381 Ga0105242_10887602 3300009176 Bacteria 890
382 Ga0105248_10035270 3300009177 Bacteria 5596
383 Ga0105248_10165958 3300009177 Bacteria 2489
384 Ga0105248_10235643 3300009177 Bacteria 2060
385 Ga0105248_10240393 3300009177 Bacteria 2038
386 Ga0105248_10301102 3300009177 Bacteria 1805
387 Ga0105248_10364547 3300009177 Bacteria 1627
388 Ga0105248_10442505 3300009177 Bacteria 1464
389 Ga0105237_10007425 3300009545 Bacteria 11998
390 Ga0105237_10405616 3300009545 Bacteria 1368
391 Ga0105237_10463880 3300009545 Unclassified 1273
392 Ga0105237_10806871 3300009545 Bacteria 945
393 Ga0105237_10963692 3300009545 Bacteria 860
394 Ga0105238_10094190 3300009551 Plasmid 2983
395 Ga0105238_10114466 3300009551 Bacteria 2676
396 Ga0105238_10167463 3300009551 Bacteria 2173
397 Ga0105238_10185184 3300009551 Bacteria 2058
398 Ga0105238_10402136 3300009551 Bacteria 1363
399 Ga0105238_10572821 3300009551 Bacteria 1135
400 Ga0105238_10751785 3300009551 Bacteria 989
401 Ga0105238_11163039 3300009551 Bacteria 795
402 Ga0105249_10025686 3300009553 Bacteria 5305
403 Ga0105249_10096522 3300009553 Bacteria 2774
404 Ga0105249_10099881 3300009553 Bacteria 2728
405 Ga0105249_10248227 3300009553 Bacteria 1763
406 Ga0105249_10909933 3300009553 Bacteria 947
407 Ga0105249_11051636 3300009553 Bacteria 884
408 Ga0105249_11439425 3300009553 Bacteria 761
409 Ga0105249_11641229 3300009553 Bacteria 715
410 Ga0130087_1094177 3300009828 Bacteria 1477
411 Ga0130084_1033988 3300009835 Bacteria 1477
412 Ga0130084_1090228 3300009835 Bacteria 1099
413 Ga0099796_10023027 3300010159 Bacteria 1940
414 Ga0105239_10007024 3300010375 Bacteria 12959
415 Ga0105239_10088444 3300010375 Bacteria 3416
416 Ga0105239_10088855 3300010375 Bacteria 3407
417 Ga0105239_10201229 3300010375 Bacteria 2231
418 Ga0105239_10277301 3300010375 Bacteria 1887
419 Ga0105239_10446200 3300010375 Bacteria 1467
420 Ga0105239_10477252 3300010375 Bacteria 1416
421 Ga0105239_11019560 3300010375 Bacteria 952
422 Ga0105239_11029287 3300010375 Bacteria 947
423 Ga0105246_10009352 3300011119 Bacteria 6039
424 Ga0105246_10036830 3300011119 Bacteria 3279
425 Ga0105246_10042578 3300011119 Bacteria 3076
426 Ga0105246_10156324 3300011119 Bacteria 1732
427 Ga0105246_10261547 3300011119 Bacteria 1379
428 Ga0105246_10263549 3300011119 Bacteria 1374
429 Ga0105246_10591122 3300011119 Bacteria 958
430 Ga0105246_10686914 3300011119 Bacteria 895
431 Ga0105246_10906196 3300011119 Bacteria 791
432 Ga0157343_1004036 3300012488 Bacteria 891
433 Ga0157347_1005731 3300012502 Bacteria 1195
434 Ga0157373_10118565 3300013100 Bacteria 1860
435 Ga0157373_10898619 3300013100 Bacteria 657
436 Ga0157371_10350364 3300013102 Unclassified 1075
437 Ga0157371_10469619 3300013102 Bacteria 926
438 Ga0157371_10596831 3300013102 Bacteria 821
439 Ga0157370_10106437 3300013104 Bacteria 2624
440 Ga0157370_10201543 3300013104 Bacteria 1846
441 Ga0157369_10030703 3300013105 Bacteria 5925
442 Ga0157369_10060269 3300013105 Bacteria 4092
443 Ga0157369_10078160 3300013105 Bacteria 3546
444 Ga0157369_10183147 3300013105 Bacteria 2203
445 Ga0157369_10216190 3300013105 Bacteria 2008
446 Ga0157369_10216632 3300013105 Bacteria 2005
447 Ga0157369_10370905 3300013105 Bacteria 1486
448 Ga0157369_10781700 3300013105 Bacteria 981
449 Ga0157369_10895405 3300013105 Bacteria 910
450 Ga0157369_10901399 3300013105 Bacteria 907
451 Ga0157369_11017571 3300013105 Bacteria 848
452 Ga0157369_11419311 3300013105 Bacteria 707
453 Ga0157374_10231013 3300013296 Bacteria 1817
454 Ga0157374_10402713 3300013296 Bacteria 1365
455 Ga0157374_10448677 3300013296 Bacteria 1291
456 Ga0157378_10076616 3300013297 Bacteria 3014
457 Ga0157378_10368765 3300013297 Bacteria 1407
458 Ga0163162_10157042 3300013306 Bacteria 2395
459 Ga0163162_10297958 3300013306 Bacteria 1744
460 Ga0163162_10328140 3300013306 Bacteria 1663
461 Ga0163162_10726653 3300013306 Bacteria 1113
462 Ga0163162_10779123 3300013306 Bacteria 1075
463 Ga0163162_11190116 3300013306 Bacteria 865
464 Ga0163162_11639283 3300013306 Bacteria 734
465 Ga0157372_10026780 3300013307 Bacteria 6276
466 Ga0157372_10092895 3300013307 Bacteria 3433
467 Ga0157372_10173767 3300013307 Unclassified 2493
468 Ga0157372_10358705 3300013307 Bacteria 1698
469 Ga0157372_10360477 3300013307 Bacteria 1694
470 Ga0157372_10455159 3300013307 Bacteria 1491
471 Ga0157372_10465086 3300013307 Bacteria 1474
472 Ga0157372_12027879 3300013307 Bacteria 661
473 Ga0157372_12119879 3300013307 Bacteria 646
474 Ga0157372_12620052 3300013307 Bacteria 579
475 Ga0157375_10015955 3300013308 Bacteria 6738
476 Ga0157375_10030942 3300013308 Bacteria 5052
477 Ga0157375_10061729 3300013308 Bacteria 3723
478 Ga0157375_10129168 3300013308 Bacteria 2645
479 Ga0157375_10256551 3300013308 Bacteria 1910
480 Ga0157375_10286767 3300013308 Bacteria 1809
481 Ga0157375_10292813 3300013308 Bacteria 1791
482 Ga0157375_10722642 3300013308 Bacteria 1149
483 Ga0157375_10752439 3300013308 Bacteria 1126
484 Ga0157375_11084740 3300013308 Bacteria 937
485 Ga0157375_11142740 3300013308 Bacteria 912
486 Ga0157375_11461098 3300013308 Bacteria 806
487 Ga0163163_10012916 3300014325 Bacteria 7624
488 Ga0163163_10046846 3300014325 Bacteria 4247
489 Ga0163163_10136645 3300014325 Bacteria 2492
490 Ga0163163_10210814 3300014325 Bacteria 1992
491 Ga0163163_10285528 3300014325 Bacteria 1702
492 Ga0163163_10642542 3300014325 Bacteria 1124
493 Ga0163163_10817395 3300014325 Bacteria 995
494 Ga0157380_10013665 3300014326 Bacteria 5928
495 Ga0157380_10024391 3300014326 Bacteria 4578
496 Ga0157380_10675829 3300014326 Bacteria 1034
497 Ga0157380_10792147 3300014326 Bacteria 964
498 Ga0157380_10829787 3300014326 Bacteria 944
499 Ga0157380_11279010 3300014326 Bacteria 780
500 Ga0157377_10018851 3300014745 Bacteria 3594
501 Ga0157377_10023311 3300014745 Bacteria 3278
502 Ga0157377_10053635 3300014745 Bacteria 2280
503 Ga0157377_10525488 3300014745 Bacteria 831
504 Ga0157379_10038903 3300014968 Bacteria 4243
505 Ga0157379_10046998 3300014968 Bacteria 3851
506 Ga0157379_10163628 3300014968 Bacteria 2008
507 Ga0157379_10199417 3300014968 Bacteria 1809
508 Ga0157376_10020836 3300014969 Bacteria 5081
509 Ga0157376_10022259 3300014969 Bacteria 4937
510 Ga0157376_10214624 3300014969 Bacteria 1778
511 Ga0157376_10453865 3300014969 Bacteria 1251
512 Ga0157376_10639493 3300014969 Bacteria 1063
513 Ga0157376_10707535 3300014969 Bacteria 1013
514 Ga0157376_10846717 3300014969 Bacteria 930
515 Ga0157376_11236181 3300014969 Bacteria 776
516 Ga0163161_10082919 3300017792 Bacteria 2363
517 Ga0163161_10239251 3300017792 Bacteria 1411
518 Ga0163161_11261605 3300017792 Bacteria 641
519 Ga0163161_11332961 3300017792 Bacteria 625
520 Ga0197907_10274704 3300020069 Bacteria 1079
521 Ga0197907_10559883 3300020069 Bacteria 959
522 Ga0197907_11226896 3300020069 Bacteria 1211
523 Ga0197907_11302917 3300020069 Bacteria 681
524 Ga0206356_10395291 3300020070 Bacteria 1234
525 Ga0206356_10648946 3300020070 Bacteria 1138
526 Ga0206356_11522207 3300020070 Bacteria 565
527 Ga0206356_11589931 3300020070 Bacteria 782
528 Ga0206349_1067878 3300020075 Bacteria 844
529 Ga0206349_1119117 3300020075 Bacteria 628
530 Ga0206349_1149250 3300020075 Bacteria 810
531 Ga0206349_1460009 3300020075 Bacteria 1149
532 Ga0206349_1882549 3300020075 Bacteria 702
533 Ga0206355_1187232 3300020076 Bacteria 1100
534 Ga0206355_1234758 3300020076 Bacteria 715
535 Ga0206355_1561896 3300020076 Bacteria 718
536 Ga0206351_10804799 3300020077 Bacteria 1428
537 Ga0206351_10941945 3300020077 Bacteria 1050
538 Ga0206352_10680863 3300020078 Bacteria 689
539 Ga0206352_11041443 3300020078 Bacteria 825
540 Ga0206350_10480067 3300020080 Bacteria 1473
541 Ga0206350_10539336 3300020080 Bacteria 614
542 Ga0206350_10686507 3300020080 Bacteria 831
543 Ga0206350_11179634 3300020080 Bacteria 898
544 Ga0206350_11495066 3300020080 Bacteria 667
545 Ga0206354_10195779 3300020081 Bacteria 1089
546 Ga0206354_10774667 3300020081 Bacteria 1325
547 Ga0206354_11516096 3300020081 Bacteria 623
548 Ga0206354_11603842 3300020081 Bacteria 3107
549 Ga0206353_10073491 3300020082 Bacteria 3227
550 Ga0206353_10607955 3300020082 Bacteria 770
551 Ga0206353_10732788 3300020082 Bacteria 1573
552 Ga0206353_10901837 3300020082 Bacteria 1132
553 Ga0206353_11013927 3300020082 Bacteria 2103
554 Ga0206353_11575710 3300020082 Bacteria 1420
555 Ga0154015_1130338 3300020610 Bacteria 623
556 Ga0154015_1253899 3300020610 Bacteria 1063
557 Ga0213876_10067302 3300021384 Bacteria 1891
558 Ga0213876_10248140 3300021384 Bacteria 946
559 Ga0213875_10024452 3300021388 Bacteria 2880
560 Ga0224712_10006130 3300022467 Bacteria 3401
561 Ga0224712_10011867 3300022467 Bacteria 2719
562 Ga0224712_10058336 3300022467 Bacteria 1529
563 Ga0224712_10085086 3300022467 Bacteria 1313
564 Ga0224712_10111099 3300022467 Bacteria 1175
565 Ga0224712_10137769 3300022467 Bacteria 1071
566 Ga0224712_10144348 3300022467 Bacteria 1050
567 Ga0224712_10596887 3300022467 Bacteria 539
568 Ga0224570_105942 3300022730 Bacteria 744
569 Ga0224571_105430 3300022734 Bacteria 838
570 Ga0224572_1001265 3300024225 Bacteria 3643
571 Ga0224572_1017311 3300024225 Bacteria 1383
572 Ga0207697_10063604 3300025315 Bacteria 1538
573 Ga0207697_10147967 3300025315 Bacteria 1021
574 Ga0207656_10143428 3300025321 Bacteria 1127
575 Ga0207653_10018889 3300025885 Bacteria 2171
576 Ga0207692_10026075 3300025898 Bacteria 2739
577 Ga0207692_10113078 3300025898 Bacteria 1508
578 Ga0207692_10124996 3300025898 Bacteria 1445
579 Ga0207692_10252026 3300025898 Bacteria 1058
580 Ga0207692_10288444 3300025898 Bacteria 995
581 Ga0207710_10156841 3300025900 Bacteria 1107
582 Ga0207688_10014002 3300025901 Bacteria 4361
583 Ga0207688_10014568 3300025901 Bacteria 4271
584 Ga0207688_10041324 3300025901 Bacteria 2565
585 Ga0207688_10091203 3300025901 Bacteria 1750
586 Ga0207688_10122392 3300025901 Bacteria 1519
587 Ga0207680_10104593 3300025903 Bacteria 1825
588 Ga0207647_10045186 3300025904 Bacteria 2749
589 Ga0207647_10121133 3300025904 Bacteria 1542
590 Ga0207685_10101245 3300025905 Bacteria 1232
591 Ga0207685_10124391 3300025905 Bacteria 1137
592 Ga0207685_10126858 3300025905 Bacteria 1128
593 Ga0207685_10236123 3300025905 Bacteria 877
594 Ga0207699_10001554 3300025906 Bacteria 10870
595 Ga0207699_10019598 3300025906 Bacteria 3611
596 Ga0207699_10026819 3300025906 Bacteria 3181
597 Ga0207699_10039747 3300025906 Bacteria 2705
598 Ga0207645_10186084 3300025907 Bacteria 1364
599 Ga0207645_10217736 3300025907 Bacteria 1258
600 Ga0207643_10002339 3300025908 Bacteria 10314
601 Ga0207643_10038330 3300025908 Bacteria 2692
602 Ga0207643_10058060 3300025908 Bacteria 2204
603 Ga0207643_10514159 3300025908 Bacteria 766
604 Ga0207705_10052878 3300025909 Bacteria 2925
605 Ga0207705_10146907 3300025909 Bacteria 1764
606 Ga0207705_10789566 3300025909 Bacteria 737
607 Ga0207684_10429024 3300025910 Bacteria 1135
608 Ga0207654_10061650 3300025911 Bacteria 2195
609 Ga0207654_10244730 3300025911 Bacteria 1200
610 Ga0207654_10366446 3300025911 Bacteria 995
611 Ga0207707_10487742 3300025912 Bacteria 1052
612 Ga0207707_10622033 3300025912 Bacteria 912
613 Ga0207695_10480376 3300025913 Bacteria 1125
614 Ga0207671_10112427 3300025914 Bacteria 2073
615 Ga0207671_10224356 3300025914 Bacteria 1473
616 Ga0207693_10046992 3300025915 Bacteria 3392
617 Ga0207693_10158932 3300025915 Bacteria 1778
618 Ga0207693_10164876 3300025915 Bacteria 1744
619 Ga0207693_10201679 3300025915 Bacteria 1564
620 Ga0207663_10272530 3300025916 Bacteria 1254
621 Ga0207663_10279590 3300025916 Bacteria 1239
622 Ga0207663_10506727 3300025916 Bacteria 938
623 Ga0207660_10137670 3300025917 Bacteria 1864
624 Ga0207660_10168416 3300025917 Bacteria 1694
625 Ga0207660_10410715 3300025917 Bacteria 1091
626 Ga0207662_10020059 3300025918 Bacteria 3813
627 Ga0207662_10105909 3300025918 Bacteria 1748
628 Ga0207662_10617849 3300025918 Bacteria 755
629 Ga0207657_10008239 3300025919 Bacteria 10609
630 Ga0207657_10072844 3300025919 Bacteria 2904
631 Ga0207657_10188875 3300025919 Bacteria 1663
632 Ga0207657_10259024 3300025919 Bacteria 1385
633 Ga0207649_10167496 3300025920 Bacteria 1527
634 Ga0207649_11045206 3300025920 Bacteria 643
635 Ga0207649_11398760 3300025920 Bacteria 554
636 Ga0207652_10057109 3300025921 Bacteria 3361
637 Ga0207652_10511797 3300025921 Bacteria 1080
638 Ga0207652_10687066 3300025921 Bacteria 914
639 Ga0207646_10245073 3300025922 Bacteria 1619
640 Ga0207681_10082205 3300025923 Bacteria 2276
641 Ga0207681_10171906 3300025923 Bacteria 1643
642 Ga0207694_10107362 3300025924 Bacteria 2218
643 Ga0207694_10342296 3300025924 Bacteria 1237
644 Ga0207694_10672915 3300025924 Bacteria 872
645 Ga0207694_10913766 3300025924 Bacteria 742
646 Ga0207650_10088313 3300025925 Bacteria 2364
647 Ga0207659_10002685 3300025926 Bacteria 10599
648 Ga0207659_10109929 3300025926 Bacteria 2094
649 Ga0207659_10555166 3300025926 Bacteria 976
650 Ga0207687_10005701 3300025927 Bacteria 8236
651 Ga0207687_10005785 3300025927 Bacteria 8183
652 Ga0207687_10018895 3300025927 Bacteria 4558
653 Ga0207687_10049654 3300025927 Bacteria 2918
654 Ga0207687_10076186 3300025927 Bacteria 2409
655 Ga0207687_10154110 3300025927 Bacteria 1756
656 Ga0207687_10249993 3300025927 Bacteria 1409
657 Ga0207687_10444755 3300025927 Bacteria 1074
658 Ga0207687_10642570 3300025927 Bacteria 897
659 Ga0207700_10001348 3300025928 Bacteria 13927
660 Ga0207700_10033985 3300025928 Bacteria 3655
661 Ga0207700_10038109 3300025928 Bacteria 3487
662 Ga0207700_10041395 3300025928 Bacteria 3370
663 Ga0207700_10041551 3300025928 Bacteria 3365
664 Ga0207700_10117710 3300025928 Bacteria 2149
665 Ga0207700_10212192 3300025928 Bacteria 1637
666 Ga0207700_10373747 3300025928 Bacteria 1245
667 Ga0207700_10485774 3300025928 Bacteria 1092
668 Ga0207700_10957515 3300025928 Bacteria 766
669 Ga0207700_11134651 3300025928 Bacteria 698
670 Ga0207664_10000001 3300025929 Bacteria 724213
671 Ga0207664_10029094 3300025929 Bacteria 4205
672 Ga0207664_10036476 3300025929 Bacteria 3801
673 Ga0207664_10055128 3300025929 Bacteria 3153
674 Ga0207664_10056656 3300025929 Bacteria 3113
675 Ga0207664_10060506 3300025929 Bacteria 3018
676 Ga0207664_10075566 3300025929 Bacteria 2724
677 Ga0207664_10096108 3300025929 Bacteria 2438
678 Ga0207664_10150442 3300025929 Bacteria 1977
679 Ga0207664_10172871 3300025929 Bacteria 1850
680 Ga0207664_10227100 3300025929 Bacteria 1621
681 Ga0207664_10484817 3300025929 Bacteria 1106
682 Ga0207664_10809896 3300025929 Bacteria 842
683 Ga0207664_11660984 3300025929 Bacteria 561
684 Ga0207644_10547571 3300025931 Bacteria 957
685 Ga0207644_10676823 3300025931 Bacteria 860
686 Ga0207644_11069850 3300025931 Bacteria 678
687 Ga0207690_10011376 3300025932 Bacteria 5322
688 Ga0207690_10226189 3300025932 Bacteria 1434
689 Ga0207690_10891272 3300025932 Bacteria 738
690 Ga0207706_10031312 3300025933 Bacteria 4739
691 Ga0207706_10288156 3300025933 Bacteria 1432
692 Ga0207706_11553911 3300025933 Bacteria 538
693 Ga0207686_10098839 3300025934 Bacteria 1944
694 Ga0207686_10286002 3300025934 Bacteria 1219
695 Ga0207709_10070466 3300025935 Bacteria 2217
696 Ga0207709_10210456 3300025935 Bacteria 1395
697 Ga0207709_10239209 3300025935 Bacteria 1320
698 Ga0207709_10437419 3300025935 Bacteria 1008
699 Ga0207709_10556677 3300025935 Unclassified 903
700 Ga0207709_10623582 3300025935 Bacteria 856
701 Ga0207709_10889094 3300025935 Bacteria 723
702 Ga0207670_10413748 3300025936 Bacteria 1080
703 Ga0207670_10638204 3300025936 Bacteria 877
704 Ga0207670_10707595 3300025936 Bacteria 834
705 Ga0207669_10079148 3300025937 Bacteria 2097
706 Ga0207669_10201686 3300025937 Bacteria 1445
707 Ga0207669_10286033 3300025937 Bacteria 1246
708 Ga0207669_10416813 3300025937 Bacteria 1056
709 Ga0207669_10547541 3300025937 Unclassified 933
710 Ga0207665_10234434 3300025939 Bacteria 1350
711 Ga0207665_10236568 3300025939 Bacteria 1344
712 Ga0207665_10617427 3300025939 Bacteria 848
713 Ga0207691_10002762 3300025940 Bacteria 17109
714 Ga0207691_10069401 3300025940 Bacteria 3183
715 Ga0207691_10296051 3300025940 Bacteria 1391
716 Ga0207711_10106206 3300025941 Bacteria 2491
717 Ga0207711_10164608 3300025941 Bacteria 2010
718 Ga0207711_10182013 3300025941 Bacteria 1911
719 Ga0207711_10329344 3300025941 Bacteria 1412
720 Ga0207711_10510641 3300025941 Bacteria 1120
721 Ga0207711_10604623 3300025941 Bacteria 1023
722 Ga0207711_10808267 3300025941 Bacteria 873
723 Ga0207711_10925525 3300025941 Bacteria 810
724 Ga0207689_10045141 3300025942 Bacteria 3644
725 Ga0207689_10053410 3300025942 Bacteria 3329
726 Ga0207689_10054878 3300025942 Bacteria 3280
727 Ga0207689_10285373 3300025942 Bacteria 1367
728 Ga0207689_10354307 3300025942 Bacteria 1220
729 Ga0207661_10009942 3300025944 Bacteria 6833
730 Ga0207661_10010718 3300025944 Bacteria 6607
731 Ga0207661_10052843 3300025944 Bacteria 3248
732 Ga0207661_10052955 3300025944 Bacteria 3245
733 Ga0207661_10119008 3300025944 Bacteria 2246
734 Ga0207661_10134434 3300025944 Bacteria 2123
735 Ga0207661_10213519 3300025944 Bacteria 1702
736 Ga0207661_10402778 3300025944 Bacteria 1241
737 Ga0207661_10927890 3300025944 Bacteria 802
738 Ga0207679_10017785 3300025945 Bacteria 4750
739 Ga0207679_10164572 3300025945 Bacteria 1820
740 Ga0207679_10801555 3300025945 Bacteria 859
741 Ga0207679_11614770 3300025945 Bacteria 594
742 Ga0207667_10091382 3300025949 Bacteria 3145
743 Ga0207667_10992944 3300025949 Bacteria 827
744 Ga0207651_10062428 3300025960 Bacteria 2597
745 Ga0207651_10467331 3300025960 Bacteria 1085
746 Ga0207712_10196720 3300025961 Bacteria 1595
747 Ga0207712_10355866 3300025961 Bacteria 1218
748 Ga0207712_10781578 3300025961 Bacteria 838
749 Ga0207668_10045150 3300025972 Bacteria 3003
750 Ga0207668_10121061 3300025972 Bacteria 1982
751 Ga0207668_10209915 3300025972 Bacteria 1557
752 Ga0207640_10012096 3300025981 Bacteria 4905
753 Ga0207640_10642737 3300025981 Bacteria 903
754 Ga0207658_10162954 3300025986 Bacteria 1829
755 Ga0207658_10208951 3300025986 Bacteria 1635
756 Ga0207658_10429276 3300025986 Bacteria 1167
757 Ga0207658_10636247 3300025986 Bacteria 961
758 Ga0207658_10672551 3300025986 Bacteria 934
759 Ga0207658_11319703 3300025986 Bacteria 660
760 Ga0207677_10009142 3300026023 Bacteria 5564
761 Ga0207677_10134871 3300026023 Bacteria 1880
762 Ga0207677_10346447 3300026023 Bacteria 1243
763 Ga0207677_10524461 3300026023 Bacteria 1028
764 Ga0207677_11333300 3300026023 Bacteria 660
765 Ga0207703_10032231 3300026035 Bacteria 4147
766 Ga0207703_10183654 3300026035 Bacteria 1847
767 Ga0207703_10228344 3300026035 Bacteria 1668
768 Ga0207639_10014227 3300026041 Bacteria 5588
769 Ga0207639_10051426 3300026041 Bacteria 3134
770 Ga0207678_10017601 3300026067 Bacteria 6274
771 Ga0207678_10053961 3300026067 Bacteria 3462
772 Ga0207678_10077027 3300026067 Bacteria 2856
773 Ga0207678_10083217 3300026067 Bacteria 2737
774 Ga0207678_10363517 3300026067 Bacteria 1249
775 Ga0207708_10000011 3300026075 Bacteria 214227
776 Ga0207708_10002163 3300026075 Bacteria 14509
777 Ga0207708_10091105 3300026075 Bacteria 2351
778 Ga0207708_10093904 3300026075 Bacteria 2315
779 Ga0207708_10132770 3300026075 Bacteria 1948
780 Ga0207702_10065728 3300026078 Bacteria 3107
781 Ga0207702_10090151 3300026078 Bacteria 2682
782 Ga0207702_10111066 3300026078 Bacteria 2437
783 Ga0207702_10245398 3300026078 Bacteria 1679
784 Ga0207702_10365973 3300026078 Bacteria 1383
785 Ga0207702_10488916 3300026078 Bacteria 1198
786 Ga0207702_11229938 3300026078 Unclassified 743
787 Ga0207702_11439432 3300026078 Bacteria 683
788 Ga0207641_10098376 3300026088 Bacteria 2573
789 Ga0207641_10265318 3300026088 Bacteria 1609
790 Ga0207641_10347686 3300026088 Bacteria 1412
791 Ga0207641_10384156 3300026088 Bacteria 1345
792 Ga0207641_10589195 3300026088 Bacteria 1088
793 Ga0207641_11031076 3300026088 Bacteria 820
794 Ga0207648_10012625 3300026089 Bacteria 7902
795 Ga0207648_10315307 3300026089 Bacteria 1404
796 Ga0207648_10432235 3300026089 Bacteria 1197
797 Ga0207648_10698658 3300026089 Bacteria 940
798 Ga0207648_10853906 3300026089 Bacteria 849
799 Ga0207676_10102117 3300026095 Bacteria 2380
800 Ga0207676_10210416 3300026095 Bacteria 1725
801 Ga0207676_10252841 3300026095 Bacteria 1587
802 Ga0207674_10045694 3300026116 Bacteria 4502
803 Ga0207674_10126735 3300026116 Bacteria 2519
804 Ga0207674_10182720 3300026116 Bacteria 2048
805 Ga0207674_10231269 3300026116 Bacteria 1796
806 Ga0207674_10264675 3300026116 Bacteria 1667
807 Ga0207674_10363583 3300026116 Bacteria 1399
808 Ga0207675_100018425 3300026118 Bacteria 6510
809 Ga0207675_100046878 3300026118 Bacteria 4037
810 Ga0207675_100051571 3300026118 Bacteria 3839
811 Ga0207675_100283745 3300026118 Bacteria 1609
812 Ga0207675_100468868 3300026118 Bacteria 1250
813 Ga0207675_101224039 3300026118 Bacteria 771
814 Ga0207683_10025760 3300026121 Bacteria 5073
815 Ga0207683_10040662 3300026121 Bacteria 4058
816 Ga0207683_10072135 3300026121 Bacteria 3054
817 Ga0207683_10193624 3300026121 Bacteria 1847
818 Ga0207683_10273405 3300026121 Bacteria 1543
819 Ga0207698_10026194 3300026142 Bacteria 4122
820 Ga0207698_10229234 3300026142 Bacteria 1685
821 Ga0207698_10306623 3300026142 Bacteria 1481
822 Ga0207698_10474023 3300026142 Bacteria 1213
823 Ga0207698_10607197 3300026142 Bacteria 1079
824 Ga0207698_10651066 3300026142 Bacteria 1044
825 Ga0207698_11404918 3300026142 Bacteria 713
826 Ga0209813_10014321 3300027866 Bacteria 2134
827 Ga0207428_10119983 3300027907 Bacteria 2017
828 Ga0207428_10174340 3300027907 Bacteria 1627
829 Ga0268266_10003864 3300028379 Bacteria 14608
830 Ga0268266_10269382 3300028379 Bacteria 1580
831 Ga0268266_10276998 3300028379 Bacteria 1559
832 Ga0268266_10741507 3300028379 Bacteria 948
833 Ga0268266_10752940 3300028379 Bacteria 940
834 Ga0268266_11047589 3300028379 Bacteria 789
835 Ga0268265_10045436 3300028380 Bacteria 3277
836 Ga0268265_10713828 3300028380 Bacteria 970
837 Ga0268265_10898515 3300028380 Bacteria 870
838 Ga0268265_11168954 3300028380 Bacteria 766
839 Ga0268264_10000264 3300028381 Bacteria 93499
840 Ga0268264_10304973 3300028381 Bacteria 1500
841 Ga0268264_11103204 3300028381 Bacteria 802
842 Ga0268264_11345633 3300028381 Bacteria 724
843 Ga0307513_10000508 3300031456 Bacteria 56049
844 Ga0307513_10007891 3300031456 Bacteria 13715
845 Ga0307513_10011555 3300031456 Bacteria 10966
846 Ga0307513_10060465 3300031456 Bacteria 4017
847 Ga0307408_100111435 3300031548 Bacteria 2103
848 Ga0307408_101235498 3300031548 Bacteria 698
849 Ga0307408_102226803 3300031548 Bacteria 530
850 Ga0307405_10747101 3300031731 Bacteria 815
851 Ga0307405_10759591 3300031731 Bacteria 808
852 Ga0307413_10006443 3300031824 Bacteria 5362
853 Ga0307413_10022743 3300031824 Bacteria 3385
854 Ga0307413_10071234 3300031824 Bacteria 2190
855 Ga0307413_10125675 3300031824 Bacteria 1746
856 Ga0307413_10203731 3300031824 Bacteria 1431
857 Ga0307413_10218604 3300031824 Bacteria 1390
858 Ga0307413_10221778 3300031824 Bacteria 1382
859 Ga0307413_10242640 3300031824 Bacteria 1331
860 Ga0307413_10997895 3300031824 Bacteria 717
861 Ga0307413_11447768 3300031824 Bacteria 606
862 Ga0307413_11875909 3300031824 Bacteria 538
863 Ga0307410_10012731 3300031852 Bacteria 4878
864 Ga0307410_10186785 3300031852 Bacteria 1573
865 Ga0307410_10772198 3300031852 Bacteria 815
866 Ga0307406_10053040 3300031901 Bacteria 2582
867 Ga0307406_10930708 3300031901 Bacteria 742
868 Ga0307407_10011542 3300031903 Bacteria 4209
869 Ga0307407_10085592 3300031903 Bacteria 1918
870 Ga0307407_10186079 3300031903 Bacteria 1380
871 Ga0307407_10578558 3300031903 Bacteria 833
872 Ga0307412_10152961 3300031911 Bacteria 1705
873 Ga0307412_10494679 3300031911 Bacteria 1017
874 Ga0307409_100008477 3300031995 Bacteria 6243
875 Ga0307409_100010285 3300031995 Bacteria 5805
876 Ga0307409_100024537 3300031995 Bacteria 4208
877 Ga0307409_100042630 3300031995 Bacteria 3400
878 Ga0307409_100050679 3300031995 Bacteria 3172
879 Ga0307409_100101280 3300031995 Bacteria 2390
880 Ga0307409_100202723 3300031995 Bacteria 1776
881 Ga0307409_100459413 3300031995 Bacteria 1231
882 Ga0307409_100965915 3300031995 Bacteria 868
883 Ga0307416_100007123 3300032002 Bacteria 7070
884 Ga0307416_100022786 3300032002 Bacteria 4530
885 Ga0307416_100076501 3300032002 Bacteria 2806
886 Ga0307416_100130086 3300032002 Bacteria 2264
887 Ga0307416_100155958 3300032002 Bacteria 2102
888 Ga0307416_100232190 3300032002 Bacteria 1779
889 Ga0307416_100614196 3300032002 Bacteria 1168
890 Ga0307416_100952266 3300032002 Bacteria 960
891 Ga0307416_101206468 3300032002 Bacteria 862
892 Ga0307416_101336827 3300032002 Bacteria 822
893 Ga0307414_10030398 3300032004 Bacteria 3528
894 Ga0307414_10491690 3300032004 Bacteria 1084
895 Ga0307414_11280809 3300032004 Bacteria 680
896 Ga0307411_10011526 3300032005 Bacteria 4778
897 Ga0307411_10044178 3300032005 Bacteria 2856
898 Ga0307411_10076468 3300032005 Bacteria 2289
899 Ga0307411_10275489 3300032005 Bacteria 1336
900 Ga0307411_10477802 3300032005 Bacteria 1049
901 Ga0307415_100000779 3300032126 Bacteria 14445
902 Ga0307415_100029734 3300032126 Bacteria 3496
903 Ga0307415_100160725 3300032126 Bacteria 1741
904 Ga0307415_100203734 3300032126 Bacteria 1572
905 Ga0307415_100289873 3300032126 Bacteria 1350
906 Ga0307415_100665156 3300032126 Bacteria 935
907 Ga0307415_102014729 3300032126 Bacteria 562
908 Ga0307507_10099579 3300033179 Bacteria 2441
909 Ga0373950_0031966 3300034818 Bacteria 978
910 Ga0373950_0038829 3300034818 Bacteria 905
911 Ga0373934_0000210 3300035086 Bacteria 21376
912 Ga0373934_0007222 3300035086 Bacteria 4119
913 Ga0373934_0036164 3300035086 Bacteria 1944
914 Ga0373934_0061188 3300035086 Archaea 1500
915 Ga0373940_0048927 3300035088 Bacteria 1182
916 Ga0373944_0006109 3300035089 Bacteria 3191
917 Ga0373944_0088376 3300035089 Bacteria 1033
918 Ga0373944_0180950 3300035089 Bacteria 756
919 Ga0373949_0023477 3300035090 Bacteria 1428
920 Ga0373949_0111055 3300035090 Bacteria 761
921 Ga0373951_0058113 3300035091 Bacteria 964
922 Ga0373952_0083332 3300035092 Bacteria 820
923 Ga0373923_0014288 3300035111 Bacteria 2981
924 Ga0373923_0071029 3300035111 Bacteria 1495
925 Ga0373932_0060337 3300035112 Bacteria 1151
926 Ga0373936_0050965 3300035113 Bacteria 1675
927 Ga0373936_0107431 3300035113 Bacteria 1182
928 Ga0373936_0130172 3300035113 Bacteria 1081
929 Ga0373936_0330706 3300035113 Bacteria 691
930 Ga0373945_0009798 3300035116 Bacteria 3143
931 Ga0373945_0011140 3300035116 Bacteria 2969
932 Ga0373953_0000868 3300035117 Bacteria 8490
933 Ga0373953_0036727 3300035117 Archaea 1931
934 Ga0373953_0079458 3300035117 Bacteria 1362
935 Ga0373953_0123579 3300035117 Bacteria 1100
936 Ga0373954_0249922 3300035118 Bacteria 873
937 Ga0373954_0460516 3300035118 Bacteria 630
938 Ga0373956_0021757 3300035119 Bacteria 2737
939 Ga0373956_0169238 3300035119 Bacteria 1031
940 Ga0373957_0000726 3300035120 Bacteria 8563
941 Ga0373957_0153318 3300035120 Bacteria 946
942 Ga0373960_0103278 3300035121 Bacteria 926
943 Ga0373943_0003609 3300035170 Bacteria 7040
944 Ga0373943_0120851 3300035170 Bacteria 1392
945 Ga0373943_0312560 3300035170 Bacteria 894
946 Ga0373943_0523126 3300035170 Bacteria 695
947 Ga0373946_0113043 3300035171 Bacteria 1231
948 Ga0373946_0417600 3300035171 Bacteria 679
949 Ga0373955_0001291 3300035172 Bacteria 10668
950 Ga0373955_0003087 3300035172 Bacteria 7285
951 Ga0373955_0033614 3300035172 Bacteria 2702
952 Ga0373955_0042911 3300035172 Bacteria 2431
953 Ga0373955_0356396 3300035172 Unclassified 886
954 Ga0373955_0774462 3300035172 Bacteria 589
955 Ga0373962_0001189 3300035242 Bacteria 6089
956 Ga0373962_0012390 3300035242 Bacteria 2148
957 Ga0373924_0002657 3300035410 Bacteria 6030
958 Ga0373924_0031945 3300035410 Bacteria 2119
959 Ga0373924_0038505 3300035410 Bacteria 1951
960 Ga0373931_0126308 3300035691 Bacteria 1467
961 Ga0373931_0243177 3300035691 Bacteria 1092
962 Ga0373931_0606414 3300035691 Bacteria 716
963 Ga0373935_0000345 3300035692 Bacteria 23566
964 Ga0373935_0020925 3300035692 Bacteria 4002
965 Ga0373935_0073444 3300035692 Bacteria 2210
966 Ga0373935_0158935 3300035692 Bacteria 1539
967 Ga0373927_0220573 3300035695 Bacteria 1246
968 Ga0373927_0599353 3300035695 Bacteria 728
969 Ga0373927_0665594 3300035695 Bacteria 688
970 Ga0373933_0000006 3300035724 Bacteria 125141
971 Ga0373933_0003973 3300035724 Bacteria 8166
972 Ga0373933_0013241 3300035724 Bacteria 4569
973 Ga0373933_0069026 3300035724 Bacteria 2147
974 Ga0373933_0409255 3300035724 Bacteria 885
975 Ga0373933_0563768 3300035724 Bacteria 747
976 Ga0373947_0005100 3300035725 Bacteria 7694
977 Ga0373947_0063465 3300035725 Bacteria 2250
978 Ga0373947_0113029 3300035725 Bacteria 1718
979 Ga0373937_0000137 3300036401 Bacteria 70670
980 Ga0373937_0002187 3300036401 Bacteria 16350
981 Ga0373937_0018581 3300036401 Bacteria 6210
982 Ga0373937_0018693 3300036401 Bacteria 6192
983 Ga0373937_0020307 3300036401 Bacteria 5955
984 Ga0373937_0023641 3300036401 Bacteria 5537
985 Ga0373937_0113297 3300036401 Bacteria 2523
986 Ga0373937_0154223 3300036401 Archaea 2152
987 Ga0373937_0268423 3300036401 Bacteria 1610
988 Ga0373937_0288411 3300036401 Bacteria 1550
989 Ga0373937_0607300 3300036401 Bacteria 1038
990 Ga0373925_0021166 3300037068 Bacteria 4739
991 Ga0373925_0030879 3300037068 Bacteria 3934
992 Ga0373925_0116853 3300037068 Bacteria 2067
993 Ga0373925_0179724 3300037068 Bacteria 1674
994 Ga0373925_0201829 3300037068 Bacteria 1581
995 Ga0373925_0288280 3300037068 Bacteria 1323
996 Ga0395899_0672582 3300037312 Bacteria 652
997 Ga0395900_0441920 3300037418 Bacteria 1258
998 Ga0395898_0229556 3300037466 Bacteria 1770
999 Ga0395898_0420208 3300037466 Bacteria 1274
1000 Ga0436364_0398604 3300037853 Bacteria 4787
1001 Ga0436364_1032678 3300037853 Bacteria 8596
1002 Ga0395901_0065718 3300038443 Bacteria 3777
1003 Ga0395901_0605682 3300038443 Bacteria 1104
1004 Ga0242420_079410 3300038996 Bacteria 676
1005 Ga0436365_0046910 3300039437 Bacteria 1880
1006 Ga0436365_0857152 3300039437 Bacteria 1004
1007 Ga0436365_1108359 3300039437 Bacteria 1290
1008 Ga0436365_1152858 3300039437 Bacteria 669
1009 Ga0436365_1927719 3300039437 Bacteria 1305
1010 Ga0436361_0112084 3300039447 Bacteria 1823
1011 Ga0436362_1063301 3300039453 Bacteria 1092
1012 Ga0439465_0305087 3300041413 Bacteria 596
1013 Ga0451787_334395 3300041441 Bacteria 1552
1014 Ga0451789_1099777 3300041443 Bacteria 577
1015 Ga0451789_1194784 3300041443 Bacteria 3543
1016 Ga0451791_0326259 3300041451 Bacteria 4409
1017 Ga0451795_0336166 3300041456 Bacteria 2019
1018 Ga0451798_0581057 3300041458 Bacteria 688
1019 Ga0451800_0909946 3300041459 Bacteria 1147
1020 Ga0451800_1539529 3300041459 Bacteria 790
1021 Ga0451802_0832046 3300041460 Bacteria 566
1022 Ga0451804_0009137 3300041463 Bacteria 624
1023 Ga0451807_1443748 3300041486 Bacteria 3465
1024 Ga0451833_0542245 3300041491 Bacteria 1256
1025 Ga0451833_1104584 3300041491 Bacteria 730
1026 Ga0451841_1249366 3300041498 Bacteria 2603
1027 Ga0451843_0706055 3300041509 Bacteria 617
1028 Ga0451853_0059067 3300041512 Bacteria 3290
1029 Ga0451853_2162457 3300041512 Bacteria 1726
1030 Ga0451853_2241375 3300041512 Bacteria 1532
1031 Ga0451853_3519876 3300041512 Bacteria 674
1032 Ga0451853_4110058 3300041512 Bacteria 3062
1033 Ga0450907_005712 3300042146 Bacteria 2095
1034 Ga0439434_0199694 3300042435 Bacteria 674
1035 Ga0466972_0012257 3300044658 Bacteria 4309
1036 Ga0466972_0111275 3300044658 Bacteria 1294
1037 Ga0466972_0276257 3300044658 Bacteria 785
1038 Ga0466965_0007022 3300044683 Bacteria 5155
1039 Ga0466965_0080239 3300044683 Bacteria 1649
1040 Ga0466966_0000254 3300044684 Bacteria 35383
1041 Ga0466966_0022536 3300044684 Bacteria 4132
1042 Ga0466966_0048604 3300044684 Bacteria 2702
1043 Ga0466966_0805191 3300044684 Bacteria 566
1044 Ga0466961_0003881 3300044693 Bacteria 9342
1045 Ga0466961_0054227 3300044693 Bacteria 2557
1046 Ga0466961_0117952 3300044693 Bacteria 1667
1047 Ga0466961_0174462 3300044693 Bacteria 1336
1048 Ga0466961_0193174 3300044693 Bacteria 1261
1049 Ga0466961_0514929 3300044693 Bacteria 722
1050 Ga0466963_0017024 3300044694 Bacteria 4527
1051 Ga0466963_0025916 3300044694 Bacteria 3744
1052 Ga0466963_0125405 3300044694 Bacteria 1770
1053 Ga0466963_0247608 3300044694 Bacteria 1251
1054 Ga0466963_0248232 3300044694 Bacteria 1249
1055 Ga0466963_0407207 3300044694 Bacteria 959
1056 Ga0466963_0677522 3300044694 Bacteria 728
1057 Ga0466964_0002025 3300044706 Bacteria 7130
1058 Ga0466964_0029455 3300044706 Bacteria 2168
1059 Ga0466964_0045688 3300044706 Bacteria 1783
1060 Ga0466971_0020706 3300044719 Bacteria 2924
1061 Ga0466971_0025463 3300044719 Bacteria 2642
1062 Ga0466971_0269924 3300044719 Bacteria 813
1063 Ga0466968_0054265 3300044735 Bacteria 1718
1064 Ga0466970_0001454 3300044765 Bacteria 11454
1065 Ga0466970_0074976 3300044765 Bacteria 1822
1066 Ga0466970_0095113 3300044765 Bacteria 1619
1067 Ga0466970_0118801 3300044765 Bacteria 1447
1068 Ga0466970_0213020 3300044765 Bacteria 1077
1069 Ga0466970_0221867 3300044765 Bacteria 1055
1070 Ga0466957_0032628 3300044842 Bacteria 3119
1071 Ga0466957_0080022 3300044842 Bacteria 2034
1072 Ga0466957_0080446 3300044842 Bacteria 2028
1073 Ga0466957_0109145 3300044842 Bacteria 1753
1074 Ga0466957_0340060 3300044842 Bacteria 1016
1075 Ga0466957_0433751 3300044842 Bacteria 903
1076 Ga0466960_0032019 3300044901 Bacteria 2430
1077 Ga0466960_0110243 3300044901 Bacteria 1429
1078 Ga0466959_0036277 3300045049 Bacteria 3643
1079 Ga0466959_0127981 3300045049 Bacteria 1801
1080 Ga0466959_0158625 3300045049 Bacteria 1591
1081 Ga0466959_0262435 3300045049 Bacteria 1189
1082 Ga0466959_0791141 3300045049 Bacteria 634
1083 Ga0451576_0062295 3300045051 Bacteria 3889
1084 Ga0466958_0018262 3300045836 Bacteria 4068
1085 Ga0466958_0026711 3300045836 Bacteria 3413
1086 Ga0466958_0128239 3300045836 Bacteria 1591
1087 Ga0466958_0159705 3300045836 Bacteria 1423
1088 Ga0466958_0230721 3300045836 Bacteria 1182
1089 Ga0466958_0636527 3300045836 Bacteria 694
1090 Ga0466967_0001244 3300045976 Bacteria 14401
1091 Ga0466967_0010475 3300045976 Bacteria 6959
1092 Ga0466967_0031381 3300045976 Bacteria 4472
1093 Ga0466967_0031669 3300045976 Bacteria 4455
1094 Ga0466967_0059330 3300045976 Bacteria 3386
1095 Ga0466967_0216867 3300045976 Bacteria 1817
1096 Ga0466967_0302285 3300045976 Bacteria 1540
1097 Ga0466967_0403876 3300045976 Bacteria 1330
1098 Ga0466967_0460444 3300045976 Bacteria 1244
1099 Ga0466967_0524838 3300045976 Bacteria 1164
1100 Ga0466967_0534701 3300045976 Bacteria 1153
1101 Ga0466967_0926867 3300045976 Bacteria 867
1102 Ga0495592_0000414 3300046454 Bacteria 32501
1103 Ga0495592_0002084 3300046454 Bacteria 14096
1104 Ga0495592_0020666 3300046454 Bacteria 5009
1105 Ga0495592_0025336 3300046454 Bacteria 4503
1106 Ga0495592_0263567 3300046454 Unclassified 1134
1107 Ga0495592_0313729 3300046454 Bacteria 1015
1108 Ga0495592_0463896 3300046454 Bacteria 792
1109 Ga0495603_0006371 3300046455 Bacteria 7059
1110 Ga0495603_0156662 3300046455 Bacteria 1322
1111 Ga0495629_0005848 3300046459 Bacteria 9175
1112 Ga0495629_0035405 3300046459 Bacteria 3528
1113 Ga0495629_0616618 3300046459 Bacteria 725
1114 Ga0495641_0001585 3300046461 Bacteria 19249
1115 Ga0495641_0025839 3300046461 Bacteria 2877
1116 Ga0495641_0034297 3300046461 Bacteria 2400
1117 Ga0495641_0131708 3300046461 Bacteria 1116
1118 Ga0495651_0000082 3300046462 Bacteria 69575
1119 Ga0495651_0001462 3300046462 Bacteria 18262
1120 Ga0495651_0002623 3300046462 Bacteria 13920
1121 Ga0495651_0029487 3300046462 Bacteria 4279
1122 Ga0495651_0040566 3300046462 Bacteria 3619
1123 Ga0495651_0260018 3300046462 Bacteria 1181
1124 Ga0495651_0300011 3300046462 Bacteria 1078
1125 Ga0495651_0341184 3300046462 Bacteria 993
1126 Ga0495653_0004390 3300046463 Bacteria 11400
1127 Ga0495653_0009576 3300046463 Bacteria 7924
1128 Ga0495653_0010689 3300046463 Bacteria 7516
1129 Ga0495653_0013109 3300046463 Bacteria 6758
1130 Ga0495653_0067618 3300046463 Bacteria 2682
1131 Ga0495653_0083589 3300046463 Bacteria 2353
1132 Ga0495653_0198465 3300046463 Bacteria 1363
1133 Ga0495580_0001983 3300046472 Bacteria 18002
1134 Ga0495580_0453603 3300046472 Bacteria 860
1135 Ga0495582_0003190 3300046473 Bacteria 9216
1136 Ga0495582_0027257 3300046473 Bacteria 3131
1137 Ga0495582_0411502 3300046473 Bacteria 780
1138 Ga0495639_0033577 3300046475 Bacteria 2292
1139 Ga0495639_0062443 3300046475 Bacteria 1709
1140 Ga0495639_0109404 3300046475 Bacteria 1310
1141 Ga0495639_0183081 3300046475 Bacteria 1021
1142 Ga0495662_0002412 3300046476 Bacteria 9389
1143 Ga0495662_0258737 3300046476 Bacteria 857
1144 Ga0495664_0004566 3300046477 Bacteria 7574
1145 Ga0495664_0007420 3300046477 Bacteria 6088
1146 Ga0495664_0017488 3300046477 Bacteria 4100
1147 Ga0495664_0021722 3300046477 Bacteria 3709
1148 Ga0495664_0022974 3300046477 Bacteria 3616
1149 Ga0495664_0063180 3300046477 Bacteria 2206
1150 Ga0495664_0077953 3300046477 Bacteria 1984
1151 Ga0495664_0122383 3300046477 Bacteria 1573
1152 Ga0495664_0211043 3300046477 Bacteria 1176
1153 Ga0495585_0378671 3300046492 Bacteria 684
1154 Ga0495594_0077223 3300046499 Bacteria 1858
1155 Ga0495608_0000197 3300046511 Bacteria 42719
1156 Ga0495608_0001419 3300046511 Bacteria 17051
1157 Ga0495608_0001665 3300046511 Bacteria 15968
1158 Ga0495608_0019913 3300046511 Bacteria 4614
1159 Ga0495608_0243784 3300046511 Bacteria 1122
1160 Ga0495608_0500403 3300046511 Bacteria 736
1161 Ga0495616_0302079 3300046513 Bacteria 676
1162 Ga0495618_0010006 3300046514 Bacteria 5735
1163 Ga0495618_0058958 3300046514 Bacteria 2432
1164 Ga0495618_0067901 3300046514 Bacteria 2267
1165 Ga0495618_0128320 3300046514 Bacteria 1623
1166 Ga0495618_0139793 3300046514 Bacteria 1549
1167 Ga0495618_0179769 3300046514 Bacteria 1344
1168 Ga0495618_0185252 3300046514 Bacteria 1322
1169 Ga0495618_0675188 3300046514 Bacteria 609
1170 Ga0495628_0001990 3300046516 Bacteria 18532
1171 Ga0495628_0004952 3300046516 Bacteria 11712
1172 Ga0495628_0008387 3300046516 Bacteria 8862
1173 Ga0495628_0040586 3300046516 Bacteria 3718
1174 Ga0495628_0053522 3300046516 Bacteria 3185
1175 Ga0495628_0064041 3300046516 Bacteria 2879
1176 Ga0495628_0384693 3300046516 Bacteria 1027
1177 Ga0495630_0006267 3300046517 Bacteria 8445
1178 Ga0495630_0016439 3300046517 Bacteria 5407
1179 Ga0495630_0067099 3300046517 Bacteria 2696
1180 Ga0495630_0130159 3300046517 Bacteria 1911
1181 Ga0495630_0257821 3300046517 Bacteria 1332
1182 Ga0495630_0851892 3300046517 Bacteria 695
1183 Ga0495630_1157602 3300046517 Bacteria 585
1184 Ga0495630_1217950 3300046517 Bacteria 569
1185 Ga0495631_0027308 3300046518 Bacteria 2613
1186 Ga0495666_0010355 3300046526 Bacteria 4648
1187 Ga0495666_0321311 3300046526 Bacteria 699
1188 Ga0495652_0001081 3300046529 Bacteria 30869
1189 Ga0495652_0009274 3300046529 Bacteria 8942
1190 Ga0495652_0011047 3300046529 Bacteria 8183
1191 Ga0495652_0062544 3300046529 Bacteria 3138
1192 Ga0495652_0066447 3300046529 Bacteria 3026
1193 Ga0495652_0073725 3300046529 Bacteria 2841
1194 Ga0495652_0138417 3300046529 Bacteria 1917
1195 Ga0495652_0141216 3300046529 Bacteria 1894
1196 Ga0495652_0144989 3300046529 Bacteria 1863
1197 Ga0495665_0001285 3300046531 Bacteria 13405
1198 Ga0495665_0249191 3300046531 Bacteria 915
1199 Ga0495640_0001411 3300046533 Bacteria 18929
1200 Ga0495640_0015089 3300046533 Bacteria 5819
1201 Ga0495640_0017783 3300046533 Bacteria 5290
1202 Ga0495640_0019271 3300046533 Bacteria 5038
1203 Ga0495640_0063723 3300046533 Bacteria 2495
1204 Ga0495640_0515004 3300046533 Bacteria 727
1205 Ga0495640_0600635 3300046533 Bacteria 665
1206 Ga0495586_0082648 3300046535 Bacteria 1766
1207 Ga0495587_0000399 3300046536 Bacteria 30718
1208 Ga0495587_0001259 3300046536 Bacteria 16827
1209 Ga0495587_0010486 3300046536 Bacteria 5895
1210 Ga0495587_0014116 3300046536 Bacteria 5015
1211 Ga0495587_0107347 3300046536 Bacteria 1605
1212 Ga0495587_0129506 3300046536 Bacteria 1443
1213 Ga0495587_0278727 3300046536 Bacteria 937
1214 Ga0495587_0543254 3300046536 Unclassified 641
1215 Ga0495621_0016943 3300046539 Bacteria 2347
1216 Ga0495645_0012801 3300046543 Bacteria 5920
1217 Ga0495645_0017558 3300046543 Bacteria 5125
1218 Ga0495645_0034859 3300046543 Bacteria 3669
1219 Ga0495645_0056171 3300046543 Bacteria 2858
1220 Ga0495645_0065763 3300046543 Bacteria 2623
1221 Ga0495645_0143260 3300046543 Bacteria 1666
1222 Ga0495645_0309319 3300046543 Bacteria 1029
1223 Ga0495667_0000048 3300046559 Bacteria 117509
1224 Ga0495667_0001264 3300046559 Bacteria 16586
1225 Ga0495667_0008686 3300046559 Bacteria 6896
1226 Ga0495667_0018263 3300046559 Bacteria 4737
1227 Ga0495667_0091028 3300046559 Bacteria 1976
1228 Ga0495667_0436448 3300046559 Bacteria 823
1229 Ga0495667_0646063 3300046559 Bacteria 657
1230 Ga0495656_0115306 3300046615 Bacteria 1262
1231 Ga0495668_0323693 3300046616 Bacteria 846
1232 Ga0495634_0006178 3300046642 Bacteria 9121
1233 Ga0495634_0006412 3300046642 Bacteria 8941
1234 Ga0495634_0020747 3300046642 Bacteria 4655
1235 Ga0495634_0042017 3300046642 Bacteria 3103
1236 Ga0495634_0045361 3300046642 Bacteria 2972
1237 Ga0495635_0002660 3300046663 Bacteria 12213
1238 Ga0495635_0005981 3300046663 Bacteria 8491
1239 Ga0495635_0007047 3300046663 Bacteria 7857
1240 Ga0495635_0152482 3300046663 Bacteria 1573
1241 Ga0495635_0249606 3300046663 Bacteria 1196
1242 Ga0495635_0259115 3300046663 Bacteria 1171
1243 Ga0495635_0583574 3300046663 Bacteria 731
1244 Ga0495588_0097094 3300046674 Bacteria 1546
1245 Ga0495657_0001687 3300046675 Bacteria 18908
1246 Ga0495657_0003776 3300046675 Bacteria 12263
1247 Ga0495657_0016863 3300046675 Bacteria 5311
1248 Ga0495657_0019208 3300046675 Bacteria 4934
1249 Ga0495657_0048956 3300046675 Bacteria 2849
1250 Ga0495657_0079572 3300046675 Bacteria 2122
1251 Ga0495599_0000023 3300046678 Bacteria 125139
1252 Ga0495599_0000479 3300046678 Bacteria 22810
1253 Ga0495599_0012232 3300046678 Bacteria 5285
1254 Ga0495599_0020085 3300046678 Bacteria 4161
1255 Ga0495599_0187678 3300046678 Bacteria 1272
1256 Ga0495599_0573833 3300046678 Bacteria 659
1257 Ga0495599_0697194 3300046678 Bacteria 585
1258 Ga0495623_0000407 3300046679 Bacteria 28359
1259 Ga0495623_0019112 3300046679 Bacteria 4426
1260 Ga0495623_0041329 3300046679 Bacteria 2941
1261 Ga0495623_0409424 3300046679 Unclassified 728
1262 Ga0495646_0018409 3300046680 Bacteria 4423
1263 Ga0495646_0034156 3300046680 Bacteria 3159
1264 Ga0495646_0124791 3300046680 Bacteria 1454
1265 Ga0495646_0132793 3300046680 Bacteria 1400
1266 Ga0495646_0310415 3300046680 Bacteria 832
1267 Ga0495647_0009913 3300046681 Bacteria 3236
1268 Ga0495647_0080001 3300046681 Bacteria 1324
1269 Ga0495647_0142562 3300046681 Bacteria 1023
1270 Ga0495658_0004654 3300046683 Bacteria 6751
1271 Ga0495658_0055284 3300046683 Bacteria 2261
1272 Ga0495613_0031384 3300046689 Bacteria 3946
1273 Ga0495613_0042458 3300046689 Bacteria 3364
1274 Ga0495613_0098197 3300046689 Bacteria 2116
1275 Ga0495613_0255348 3300046689 Bacteria 1222
1276 Ga0495613_0370300 3300046689 Bacteria 981
1277 Ga0495624_0008027 3300046690 Bacteria 7393
1278 Ga0495624_0151147 3300046690 Bacteria 1420
1279 Ga0495624_0309930 3300046690 Bacteria 951
1280 Ga0495624_0475877 3300046690 Bacteria 748
1281 Ga0495624_0627191 3300046690 Bacteria 640
1282 Ga0495600_0001597 3300046809 Bacteria 12607
1283 Ga0495600_0010255 3300046809 Bacteria 5808
1284 Ga0495600_0035682 3300046809 Bacteria 3231
1285 Ga0495600_0069215 3300046809 Bacteria 2306
1286 Ga0495600_0127680 3300046809 Bacteria 1653
1287 Ga0495600_0154928 3300046809 Bacteria 1482
1288 Ga0495600_0424487 3300046809 Bacteria 825
1289 Ga0495600_0506848 3300046809 Bacteria 741
1290 Ga0495581_0050907 3300047315 Bacteria 2392
1291 Ga0495581_0130627 3300047315 Bacteria 1463
1292 Ga0495581_0306536 3300047315 Bacteria 928
1293 Ga0495581_0319844 3300047315 Bacteria 907
1294 Ga0495604_0000037 3300047317 Bacteria 125140
1295 Ga0495604_0004777 3300047317 Bacteria 10741
1296 Ga0495604_0012260 3300047317 Bacteria 6814
1297 Ga0495604_0041854 3300047317 Bacteria 3591
1298 Ga0495604_0053644 3300047317 Bacteria 3114
1299 Ga0495604_0177559 3300047317 Bacteria 1492
1300 Ga0495604_0238685 3300047317 Bacteria 1244
1301 Ga0495674_0002832 3300047319 Bacteria 16854
1302 Ga0495674_0008773 3300047319 Bacteria 9618
1303 Ga0495674_0025913 3300047319 Bacteria 5367
1304 Ga0495674_0056103 3300047319 Bacteria 3452
1305 Ga0495674_0058943 3300047319 Bacteria 3354
1306 Ga0495674_0059950 3300047319 Bacteria 3322
1307 Ga0495674_0063952 3300047319 Bacteria 3199
1308 Ga0495674_0111901 3300047319 Bacteria 2314
1309 Ga0495674_0215190 3300047319 Bacteria 1590
1310 Ga0495674_0590860 3300047319 Bacteria 880
1311 Ga0495674_0644045 3300047319 Bacteria 836
1312 Ga0495674_0870841 3300047319 Bacteria 697
1313 Ga0495676_0000878 3300047321 Bacteria 25093
1314 Ga0495676_0047354 3300047321 Bacteria 3477
1315 Ga0495676_0173760 3300047321 Bacteria 1514
1316 Ga0495676_0196374 3300047321 Bacteria 1405
1317 Ga0495676_0531602 3300047321 Bacteria 770
1318 Ga0495676_1000804 3300047321 Bacteria 533
1319 Ga0495680_0000240 3300047322 Bacteria 60299
1320 Ga0495680_0005370 3300047322 Bacteria 12082
1321 Ga0495680_0005403 3300047322 Bacteria 12032
1322 Ga0495680_0017806 3300047322 Bacteria 6048
1323 Ga0495680_0053571 3300047322 Bacteria 3138
1324 Ga0495680_0304183 3300047322 Bacteria 1119
1325 Ga0495675_0002696 3300047444 Bacteria 10639
1326 Ga0495675_0060519 3300047444 Bacteria 2400
1327 Ga0495675_0066698 3300047444 Bacteria 2275
1328 Ga0495684_0001577 3300047471 Bacteria 18280
1329 Ga0495684_0002951 3300047471 Bacteria 13392
1330 Ga0495684_0010870 3300047471 Bacteria 7038
1331 Ga0495684_0026743 3300047471 Bacteria 4433
1332 Ga0495684_0134582 3300047471 Bacteria 1855
1333 Ga0495684_0187960 3300047471 Bacteria 1528
1334 Ga0495593_0002021 3300047673 Bacteria 12099
1335 Ga0495593_0068733 3300047673 Bacteria 1843
1336 Ga0495593_0153507 3300047673 Bacteria 1164
1337 Ga0495593_0196504 3300047673 Bacteria 1014
1338 Ga0495602_0000127 3300048088 Bacteria 71692
1339 Ga0495602_0000747 3300048088 Bacteria 30870
1340 Ga0495602_0026192 3300048088 Bacteria 5628
1341 Ga0495602_0049938 3300048088 Bacteria 3742
1342 Ga0495602_0090835 3300048088 Bacteria 2535
1343 Ga0495602_0126744 3300048088 Bacteria 2044
1344 Ga0495602_0382440 3300048088 Bacteria 1008
1345 Ga0495614_0014688 3300048089 Bacteria 3424
1346 Ga0495614_0044566 3300048089 Bacteria 1903
1347 Ga0495614_0135780 3300048089 Bacteria 1091
1348 Ga0496100_0020230 3300048903 Bacteria 3987
1349 Ga0496100_0046444 3300048903 Bacteria 2792
1350 Ga0496100_0058598 3300048903 Bacteria 2528
1351 Ga0496100_0097216 3300048903 Bacteria 2022
1352 Ga0496100_0102633 3300048903 Bacteria 1974
1353 Ga0496100_0359116 3300048903 Bacteria 1102
1354 Ga0496100_0483308 3300048903 Bacteria 953
1355 Ga0496100_0547419 3300048903 Bacteria 895
1356 Ga0496101_0079182 3300048904 Bacteria 2426
1357 Ga0496101_0141298 3300048904 Bacteria 1835
1358 Ga0496101_0250779 3300048904 Bacteria 1379
1359 Ga0496101_0282009 3300048904 Bacteria 1299
1360 Ga0496101_0284742 3300048904 Bacteria 1292
1361 Ga0496101_0336855 3300048904 Bacteria 1184
1362 Ga0496101_0428380 3300048904 Bacteria 1043
1363 Ga0496101_0761066 3300048904 Unclassified 764
1364 Ga0496102_0039972 3300048905 Bacteria 4241
1365 Ga0496102_0071090 3300048905 Bacteria 3195
1366 Ga0496102_0090893 3300048905 Bacteria 2825
1367 Ga0496102_0104061 3300048905 Bacteria 2640
1368 Ga0496102_0105457 3300048905 Bacteria 2622
1369 Ga0496102_0223047 3300048905 Bacteria 1777
1370 Ga0496102_0260987 3300048905 Bacteria 1633
1371 Ga0496102_0287045 3300048905 Bacteria 1551
1372 Ga0496102_0817476 3300048905 Bacteria 854
1373 Ga0496102_1100773 3300048905 Bacteria 714
1374 Ga0496103_0027127 3300048906 Bacteria 3469
1375 Ga0496103_0038590 3300048906 Bacteria 2931
1376 Ga0496103_0090992 3300048906 Bacteria 1925
1377 Ga0496103_0295172 3300048906 Bacteria 1043
1378 Ga0496103_0343531 3300048906 Bacteria 960
1379 Ga0496103_0409929 3300048906 Bacteria 870
1380 Ga0496103_0969712 3300048906 Bacteria 530
1381 Ga0496104_0001248 3300048907 Bacteria 21904
1382 Ga0496104_0014199 3300048907 Bacteria 7187
1383 Ga0496104_0036274 3300048907 Bacteria 4609
1384 Ga0496104_0123116 3300048907 Bacteria 2490
1385 Ga0496104_0200500 3300048907 Bacteria 1907
1386 Ga0496104_0200702 3300048907 Bacteria 1906
1387 Ga0496104_0320309 3300048907 Bacteria 1463
1388 Ga0496104_0327571 3300048907 Bacteria 1445
1389 Ga0496104_0366140 3300048907 Bacteria 1354
1390 Ga0496104_0601661 3300048907 Bacteria 1010
1391 Ga0496105_0002306 3300048908 Bacteria 13847
1392 Ga0496105_0042487 3300048908 Bacteria 3747
1393 Ga0496105_0053191 3300048908 Bacteria 3344
1394 Ga0496105_0073711 3300048908 Bacteria 2820
1395 Ga0496105_0166821 3300048908 Bacteria 1806
1396 Ga0496105_0233427 3300048908 Bacteria 1494
1397 Ga0496105_0257489 3300048908 Bacteria 1412
1398 Ga0496105_0276079 3300048908 Bacteria 1356
1399 Ga0496105_0300097 3300048908 Unclassified 1291
1400 Ga0496105_0409586 3300048908 Bacteria 1075
1401 Ga0496106_0044120 3300048909 Bacteria 3346
1402 Ga0496106_0105314 3300048909 Bacteria 2192
1403 Ga0496106_0134677 3300048909 Bacteria 1939
1404 Ga0496106_0201667 3300048909 Bacteria 1583
1405 Ga0496106_0474673 3300048909 Bacteria 1005
1406 Ga0496106_0538543 3300048909 Bacteria 937
1407 Ga0496106_0843351 3300048909 Bacteria 726
1408 Ga0496107_0010754 3300048910 Bacteria 6364
1409 Ga0496107_0013442 3300048910 Bacteria 5721
1410 Ga0496107_0106053 3300048910 Bacteria 2063
1411 Ga0496107_0529450 3300048910 Bacteria 873
1412 Ga0496107_0631409 3300048910 Bacteria 790
1413 Ga0496108_0013671 3300048911 Bacteria 6627
1414 Ga0496108_0017333 3300048911 Bacteria 5890
1415 Ga0496108_0021669 3300048911 Bacteria 5282
1416 Ga0496108_0026090 3300048911 Bacteria 4819
1417 Ga0496108_0042188 3300048911 Bacteria 3809
1418 Ga0496108_0064088 3300048911 Bacteria 3095
1419 Ga0496108_0094332 3300048911 Bacteria 2547
1420 Ga0496108_0109195 3300048911 Bacteria 2364
1421 Ga0496108_0153743 3300048911 Bacteria 1986
1422 Ga0496108_0175539 3300048911 Bacteria 1855
1423 Ga0496108_0179259 3300048911 Bacteria 1834
1424 Ga0496108_0179899 3300048911 Bacteria 1831
1425 Ga0496108_0184352 3300048911 Bacteria 1808
1426 Ga0496108_0194240 3300048911 Bacteria 1760
1427 Ga0496108_0423168 3300048911 Bacteria 1163
1428 Ga0496109_0001999 3300048912 Bacteria 16906
1429 Ga0496109_0005552 3300048912 Bacteria 10562
1430 Ga0496109_0005717 3300048912 Bacteria 10409
1431 Ga0496109_0022693 3300048912 Bacteria 5559
1432 Ga0496109_0023912 3300048912 Bacteria 5426
1433 Ga0496109_0047449 3300048912 Bacteria 3905
1434 Ga0496109_0076558 3300048912 Bacteria 3077
1435 Ga0496109_0095872 3300048912 Bacteria 2748
1436 Ga0496109_0098296 3300048912 Bacteria 2713
1437 Ga0496109_0099859 3300048912 Bacteria 2692
1438 Ga0496109_0124769 3300048912 Bacteria 2400
1439 Ga0496109_0154730 3300048912 Bacteria 2147
1440 Ga0496109_0332286 3300048912 Bacteria 1435
1441 Ga0496109_0590985 3300048912 Bacteria 1046
1442 Ga0496109_0612788 3300048912 Bacteria 1025
1443 Ga0496109_1603861 3300048912 Bacteria 585
1444 Ga0496109_1682381 3300048912 Bacteria 568
1445 Ga0496110_0016049 3300048913 Bacteria 6244
1446 Ga0496110_0018153 3300048913 Bacteria 5893
1447 Ga0496110_0026060 3300048913 Bacteria 4999
1448 Ga0496110_0032474 3300048913 Bacteria 4509
1449 Ga0496110_0050849 3300048913 Bacteria 3640
1450 Ga0496110_0061981 3300048913 Bacteria 3302
1451 Ga0496110_0093992 3300048913 Bacteria 2684
1452 Ga0496110_0115471 3300048913 Bacteria 2416
1453 Ga0496110_0119173 3300048913 Bacteria 2377
1454 Ga0496110_0229706 3300048913 Bacteria 1687
1455 Ga0496110_0356101 3300048913 Bacteria 1333
1456 Ga0496110_0368599 3300048913 Bacteria 1309
1457 Ga0496110_0418240 3300048913 Bacteria 1222
1458 Ga0496110_0542490 3300048913 Bacteria 1057
1459 Ga0496110_0701619 3300048913 Bacteria 913
1460 Ga0496110_0708465 3300048913 Bacteria 908
1461 Ga0496110_1505380 3300048913 Bacteria 583
1462 Ga0496111_0005468 3300048914 Bacteria 8145
1463 Ga0496111_0009514 3300048914 Bacteria 6492
1464 Ga0496111_0018508 3300048914 Bacteria 4826
1465 Ga0496111_0025312 3300048914 Bacteria 4187
1466 Ga0496111_0074190 3300048914 Bacteria 2478
1467 Ga0496111_0105869 3300048914 Bacteria 2070
1468 Ga0496111_0134852 3300048914 Bacteria 1828
1469 Ga0496111_0177689 3300048914 Bacteria 1582
1470 Ga0496111_0201385 3300048914 Bacteria 1480
1471 Ga0496111_0227026 3300048914 Bacteria 1387
1472 Ga0496111_0292472 3300048914 Bacteria 1208
1473 Ga0496112_0021834 3300048915 Bacteria 6091
1474 Ga0496112_0044981 3300048915 Bacteria 4327
1475 Ga0496112_0155826 3300048915 Bacteria 2251
1476 Ga0496112_0179372 3300048915 Bacteria 2082
1477 Ga0496112_0307349 3300048915 Bacteria 1531
1478 Ga0496112_0448880 3300048915 Bacteria 1227
1479 Ga0496112_0881186 3300048915 Bacteria 818
1480 Ga0496112_1263419 3300048915 Bacteria 654
1481 Ga0496113_0078904 3300048916 Bacteria 2519
1482 Ga0496113_0079569 3300048916 Bacteria 2509
1483 Ga0496113_0174690 3300048916 Bacteria 1702
1484 Ga0496113_0229055 3300048916 Bacteria 1482
1485 Ga0496113_0274908 3300048916 Bacteria 1347
1486 Ga0496113_0334564 3300048916 Bacteria 1214
1487 Ga0496113_0427281 3300048916 Bacteria 1064
1488 Ga0496113_0472126 3300048916 Bacteria 1008
1489 Ga0496114_0003622 3300048917 Bacteria 11877
1490 Ga0496114_0003988 3300048917 Bacteria 11398
1491 Ga0496114_0016584 3300048917 Bacteria 5938
1492 Ga0496114_0033164 3300048917 Bacteria 4253
1493 Ga0496114_0035267 3300048917 Bacteria 4130
1494 Ga0496114_0037568 3300048917 Bacteria 4005
1495 Ga0496114_0044142 3300048917 Bacteria 3698
1496 Ga0496114_0048111 3300048917 Bacteria 3547
1497 Ga0496114_0074072 3300048917 Bacteria 2866
1498 Ga0496114_0080231 3300048917 Bacteria 2756
1499 Ga0496114_0171723 3300048917 Bacteria 1890
1500 Ga0496114_0184220 3300048917 Bacteria 1824
1501 Ga0496114_0185805 3300048917 Bacteria 1816
1502 Ga0496114_0282991 3300048917 Bacteria 1462
1503 Ga0496114_0287420 3300048917 Bacteria 1450
1504 Ga0496114_0668769 3300048917 Bacteria 912
1505 Ga0496115_0016372 3300048918 Bacteria 5645
1506 Ga0496115_0072557 3300048918 Bacteria 2793
1507 Ga0496115_0074088 3300048918 Bacteria 2764
1508 Ga0496115_0197645 3300048918 Bacteria 1661
1509 Ga0496115_0280705 3300048918 Bacteria 1367
1510 Ga0496115_0985983 3300048918 Bacteria 645
1511 Ga0496122_0046009 3300048925 Bacteria 3385
1512 Ga0496123_0104017 3300048926 Bacteria 1643
1513 Ga0496124_0463188 3300048927 Bacteria 861
1514 Ga0496124_0513596 3300048927 Bacteria 800
1515 Ga0496126_0001416 3300048929 Bacteria 37926
1516 Ga0496126_0071755 3300048929 Bacteria 3082
1517 Ga0496126_1035044 3300048929 Bacteria 614
1518 Ga0501305_072301 3300049161 Bacteria 608
1519 Ga0501291_013080 3300049514 Bacteria 1223
1520 Ga0501316_037290 3300049532 Bacteria 668
1521 Ga0501321_003613 3300049537 Bacteria 1428
1522 Ga0501325_042647 3300049541 Bacteria 557
1523 Ga0501031_0012768 3300049568 Bacteria 5488
1524 Ga0501032_0656645 3300049569 Bacteria 666
1525 Ga0501033_0236350 3300049570 Bacteria 1297
1526 Ga0501034_0123156 3300049571 Bacteria 2579
1527 Ga0501034_0135476 3300049571 Bacteria 2444
1528 Ga0501036_0043959 3300049572 Bacteria 3783
1529 Ga0501036_0284043 3300049572 Bacteria 1385
1530 Ga0501037_0243253 3300049573 Bacteria 1261
1531 Ga0501038_0038054 3300049574 Bacteria 4214
1532 Ga0501038_0609363 3300049574 Bacteria 825
1533 Ga0501039_0106794 3300049575 Bacteria 2187
1534 Ga0501039_0155078 3300049575 Bacteria 1799
1535 Ga0501039_0286102 3300049575 Bacteria 1296
1536 Ga0501039_0470018 3300049575 Bacteria 987
1537 Ga0501040_0034155 3300049576 Bacteria 3446
1538 Ga0501041_0062992 3300049577 Bacteria 2271
1539 Ga0501041_0194138 3300049577 Bacteria 1272
1540 Ga0501042_0010460 3300049578 Bacteria 6225
1541 Ga0501043_0794983 3300049579 Bacteria 685
1542 Ga0501046_0196220 3300049580 Bacteria 1504
1543 Ga0501046_0570389 3300049580 Bacteria 805
1544 Ga0501047_0194000 3300049581 Bacteria 1894
1545 Ga0501048_0031953 3300049582 Bacteria 3805
1546 Ga0501048_0563860 3300049582 Bacteria 817
1547 Ga0501067_0007666 3300049583 Bacteria 6001
1548 Ga0501067_0021583 3300049583 Bacteria 3563
1549 Ga0501067_0258303 3300049583 Bacteria 970
1550 Ga0501068_0022890 3300049584 Bacteria 3658
1551 Ga0501068_0023954 3300049584 Bacteria 3581
1552 Ga0501068_0263239 3300049584 Bacteria 1100
1553 Ga0501069_0130358 3300049585 Bacteria 1439
1554 Ga0501069_0159602 3300049585 Bacteria 1298
1555 Ga0501069_0548275 3300049585 Bacteria 692
1556 Ga0501070_0061808 3300049586 Bacteria 3103
1557 Ga0501071_0018655 3300049587 Bacteria 4808
1558 Ga0501072_0234004 3300049588 Bacteria 1463
1559 Ga0501074_0007694 3300049590 Bacteria 7803
1560 Ga0501075_0087600 3300049591 Bacteria 2360
1561 Ga0501075_0397103 3300049591 Bacteria 1051
1562 Ga0501076_0247499 3300049592 Bacteria 1458
1563 Ga0501209_240869 3300049656 Bacteria 564
1564 Ga0501240_087657 3300049673 Bacteria 584
1565 Ga0501250_008378 3300049680 Bacteria 1139
1566 Ga0501250_013695 3300049680 Bacteria 976
1567 Ga0501256_007866 3300049685 Bacteria 985
1568 Ga0501221_088383 3300049704 Bacteria 755
1569 Ga0501245_034443 3300049708 Bacteria 849
1570 Ga0501079_0391553 3300049741 Bacteria 1090
1571 Ga0501080_0486509 3300049742 Bacteria 1104
1572 Ga0501080_0998959 3300049742 Bacteria 726
1573 Ga0501080_1190372 3300049742 Bacteria 655
1574 Ga0501081_0638674 3300049743 Bacteria 798
1575 Ga0501081_0709696 3300049743 Bacteria 755
1576 Ga0501035_0442828 3300049822 Bacteria 1076
1577 Ga0501044_0304336 3300049823 Bacteria 1522
1578 Ga0501044_0364445 3300049823 Bacteria 1363
1579 Ga0501045_0022474 3300049824 Bacteria 4517
1580 Ga0501045_0088686 3300049824 Bacteria 2285
1581 Ga0501212_045883 3300049851 Bacteria 731
1582 nmdc:mga03683_39773_c1 3300050489 Bacteria 1926
1583 nmdc:mga03n38_123397_c1 3300050490 Bacteria 1276
1584 nmdc:mga03n38_194005_c1 3300050490 Bacteria 1048
1585 nmdc:mga03n38_219482_c1 3300050490 Bacteria 992
1586 nmdc:mga03n38_305925_c1 3300050490 Bacteria 855
1587 nmdc:mga03n38_569609_c1 3300050490 Bacteria 642
1588 nmdc:mga00v17_139512_c1 3300050491 Bacteria 1553
1589 nmdc:mga00v17_215890_c1 3300050491 Bacteria 1242
1590 nmdc:mga00v17_26313_c1 3300050491 Bacteria 3389
1591 nmdc:mga00v17_299739_c1 3300050491 Bacteria 1044
1592 nmdc:mga0yw44_1017790_c1 3300050492 Bacteria 561
1593 nmdc:mga0yw44_178061_c1 3300050492 Bacteria 1398
1594 nmdc:mga0yw44_229738_c2 3300050492 Bacteria 890
1595 nmdc:mga0yw44_384082_c1 3300050492 Bacteria 948
1596 nmdc:mga0yw44_43780_c1 3300050492 Bacteria 2675
1597 nmdc:mga0yw44_52423_c1 3300050492 Bacteria 2473
1598 nmdc:mga0yw44_524822_c1 3300050492 Bacteria 804
1599 nmdc:mga0yw44_550391_c1 3300050492 Bacteria 784
1600 nmdc:mga0yw44_862200_c1 3300050492 Bacteria 615
1601 nmdc:mga0yw44_89590_c1 3300050492 Bacteria 1942
1602 nmdc:mga0yw44_9125_c1 3300050492 Bacteria 4991
1603 nmdc:mga0yw44_9407_c1 3300050492 Bacteria 4939
1604 nmdc:mga06z11_133687_c1 3300050494 Bacteria 1396
1605 nmdc:mga06z11_252029_c1 3300050494 Bacteria 1040
1606 nmdc:mga06z11_357532_c1 3300050494 Bacteria 875
1607 nmdc:mga06z11_50015_c1 3300050494 Bacteria 2135
1608 nmdc:mga04h51_236682_c1 3300050495 Bacteria 728
1609 nmdc:mga04h51_41157_c1 3300050495 Bacteria 1509
1610 nmdc:mga07m45_146265_c1 3300050496 Bacteria 1370
1611 nmdc:mga07m45_257343_c1 3300050496 Bacteria 1015
1612 nmdc:mga07m45_34402_c1 3300050496 Bacteria 2816
1613 nmdc:mga07m45_529515_c1 3300050496 Bacteria 682
1614 nmdc:mga05p37_992141_c1 3300050507 Bacteria 893
1615 nmdc:mga09592_304569_c1 3300050508 Bacteria 1381
1616 nmdc:mga08y16_1213314_c1 3300050511 Bacteria 724
1617 nmdc:mga08y16_493536_c1 3300050511 Bacteria 1245
1618 nmdc:mga08y16_8960_c1 3300050511 Bacteria 10508
1619 nmdc:mga08y16_969961_c1 3300050511 Bacteria 832
1620 nmdc:mga0n895_172353_c1 3300050512 Bacteria 2196
1621 nmdc:mga0n895_82332_c1 3300050512 Bacteria 3208
1622 nmdc:mga0rr50_177049_c1 3300050513 Bacteria 1741
1623 nmdc:mga0rr50_194951_c1 3300050513 Bacteria 1662
1624 nmdc:mga0rr50_22754_c1 3300050513 Bacteria 4308
1625 nmdc:mga08x19_103780_c1 3300050514 Bacteria 1889
1626 nmdc:mga08x19_116038_c1 3300050514 Bacteria 1790
1627 nmdc:mga0a205_31162_c1 3300050515 Bacteria 5108
1628 Ga0495601_0008337 3300053077 Bacteria 6120
1629 Ga0495601_0014439 3300053077 Bacteria 4760
1630 Ga0495601_0079128 3300053077 Bacteria 2107
1631 Ga0495601_0205272 3300053077 Bacteria 1287
1632 Ga0495601_0219697 3300053077 Bacteria 1241
1633 Ga0495612_0004187 3300053078 Bacteria 5980
1634 Ga0495612_0023389 3300053078 Bacteria 2479
1635 Ga0495612_0081860 3300053078 Bacteria 1357
1636 Ga0495612_0136966 3300053078 Bacteria 1060
1637 Ga0495612_0153294 3300053078 Bacteria 1004
1638 Ga0495655_0204502 3300053083 Bacteria 647
1639 Ga0495595_0008237 3300053084 Bacteria 4281
1640 Ga0495595_0028049 3300053084 Bacteria 2512
1641 Ga0495595_0031444 3300053084 Bacteria 2385
1642 Ga0495595_0144015 3300053084 Bacteria 1170
1643 Ga0495619_0004247 3300053085 Bacteria 9132
1644 Ga0495619_0062043 3300053085 Bacteria 2488
1645 Ga0495619_0206890 3300053085 Bacteria 1359
1646 Ga0495619_0351091 3300053085 Bacteria 1020
1647 Ga0495619_0694468 3300053085 Bacteria 692
1648 Ga0495619_0889847 3300053085 Bacteria 599
1649 Ga0500644_0000029 3300053088 Bacteria 90532
1650 Ga0500593_000018 3300053117 Bacteria 55948
1651 Ga0500573_0039297 3300053140 Bacteria 2733
1652 Ga0501084_0176448 3300054114 Bacteria 1804
1653 Ga0501084_0272241 3300054114 Bacteria 1430
1654 Ga0501082_0098185 3300060353 Bacteria 2533
1655 Ga0501082_0782077 3300060353 Bacteria 835
1656 Ga0466962_0063362 3300061719 Bacteria 1765
1657 Ga0466962_0154951 3300061719 Bacteria 1112
1658 Ga0530510_0314690 3300061734 Bacteria 1173
1659 Ga0530510_0498279 3300061734 Bacteria 923

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0125405 Ga0466963_0125405_1087_1644 155
2 3300044842 Ga0466957_0433751 Ga0466957_0433751_128_685 155
3 3300039437 Ga0436365_1108359 Ga0436365_1108359_484_996 159
4 3300009098 Ga0105245_11422523 Ga0105245_114225232 163
5 3300003693 Ga0032354_1060140 Ga0032354_10601401 165
6 3300005338 Ga0068868_100995770 Ga0068868_1009957701 165
7 3300000546 LJNas_1017512 LJNas_10175121 166
8 3300001979 JGI24740J21852_10017875 JGI24740J21852_100178753 166
9 3300001989 JGI24739J22299_10191096 JGI24739J22299_101910961 166
10 3300001990 JGI24737J22298_10058604 JGI24737J22298_100586043 166
11 3300001990 JGI24737J22298_10080800 JGI24737J22298_100808001 166
12 3300002067 JGI24735J21928_10017880 JGI24735J21928_100178803 166
13 3300002067 JGI24735J21928_10059333 JGI24735J21928_100593332 166
14 3300002075 JGI24738J21930_10008533 JGI24738J21930_100085334 166
15 3300002077 JGI24744J21845_10001669 JGI24744J21845_100016695 166
16 3300002155 JGI24033J26618_1020901 JGI24033J26618_10209012 166
17 3300002459 JGI24751J29686_10098432 JGI24751J29686_100984321 166
18 3300003308 Ga0006777J48905_1076505 Ga0006777J48905_10765051 166
19 3300003316 rootH1_10015642 rootH1_100156422 166
20 3300003693 Ga0032354_1055520 Ga0032354_10555203 166
21 3300003693 Ga0032354_1088022 Ga0032354_10880221 166
22 3300005327 Ga0070658_10007596 Ga0070658_100075965 166
23 3300005327 Ga0070658_10070005 Ga0070658_100700051 166
24 3300005329 Ga0070683_100000621 Ga0070683_1000006215 166
25 3300005329 Ga0070683_100022727 Ga0070683_1000227275 166
26 3300005329 Ga0070683_100033100 Ga0070683_1000331006 166
27 3300005329 Ga0070683_100036698 Ga0070683_1000366984 166
28 3300005329 Ga0070683_100051966 Ga0070683_1000519665 166
29 3300005329 Ga0070683_100228596 Ga0070683_1002285962 166
30 3300005329 Ga0070683_100291920 Ga0070683_1002919202 166
31 3300005330 Ga0070690_100039310 Ga0070690_1000393102 166
32 3300005330 Ga0070690_100562373 Ga0070690_1005623731 166
33 3300005331 Ga0070670_100111063 Ga0070670_1001110632 166
34 3300005331 Ga0070670_100648194 Ga0070670_1006481941 166
35 3300005333 Ga0070677_10185946 Ga0070677_101859462 166
36 3300005334 Ga0068869_100108415 Ga0068869_1001084155 166
37 3300005334 Ga0068869_100174356 Ga0068869_1001743563 166
38 3300005334 Ga0068869_100336041 Ga0068869_1003360413 166
39 3300005335 Ga0070666_10029814 Ga0070666_100298145 166
40 3300005335 Ga0070666_10300648 Ga0070666_103006481 166
41 3300005336 Ga0070680_100135161 Ga0070680_1001351613 166
42 3300005336 Ga0070680_100234341 Ga0070680_1002343412 166
43 3300005337 Ga0070682_100001730 Ga0070682_1000017308 166
44 3300005337 Ga0070682_100009211 Ga0070682_1000092114 166
45 3300005337 Ga0070682_100012666 Ga0070682_1000126665 166
46 3300005337 Ga0070682_100052829 Ga0070682_1000528291 166
47 3300005337 Ga0070682_100127839 Ga0070682_1001278392 166
48 3300005337 Ga0070682_100149746 Ga0070682_1001497463 166
49 3300005337 Ga0070682_100161965 Ga0070682_1001619652 166
50 3300005337 Ga0070682_100364570 Ga0070682_1003645701 166
51 3300005337 Ga0070682_100647527 Ga0070682_1006475271 166
52 3300005338 Ga0068868_100013115 Ga0068868_1000131156 166
53 3300005338 Ga0068868_100200496 Ga0068868_1002004961 166
54 3300005338 Ga0068868_100337713 Ga0068868_1003377131 166
55 3300005338 Ga0068868_100404647 Ga0068868_1004046471 166
56 3300005338 Ga0068868_101103695 Ga0068868_1011036951 166
57 3300005339 Ga0070660_100057054 Ga0070660_1000570542 166
58 3300005339 Ga0070660_100175337 Ga0070660_1001753372 166
59 3300005339 Ga0070660_101736747 Ga0070660_1017367471 166
60 3300005340 Ga0070689_100653848 Ga0070689_1006538481 166
61 3300005340 Ga0070689_100794683 Ga0070689_1007946831 166
62 3300005341 Ga0070691_10080876 Ga0070691_100808761 166
63 3300005341 Ga0070691_10204997 Ga0070691_102049971 166
64 3300005341 Ga0070691_10228041 Ga0070691_102280412 166
65 3300005343 Ga0070687_100068918 Ga0070687_1000689183 166
66 3300005343 Ga0070687_100124765 Ga0070687_1001247652 166
67 3300005344 Ga0070661_100074390 Ga0070661_1000743902 166
68 3300005345 Ga0070692_10000683 Ga0070692_100006834 166
69 3300005345 Ga0070692_10096163 Ga0070692_100961633 166
70 3300005345 Ga0070692_10130303 Ga0070692_101303032 166
71 3300005345 Ga0070692_10340328 Ga0070692_103403281 166
72 3300005347 Ga0070668_100166036 Ga0070668_1001660361 166
73 3300005347 Ga0070668_100788893 Ga0070668_1007888931 166
74 3300005353 Ga0070669_100071264 Ga0070669_1000712642 166
75 3300005353 Ga0070669_101687811 Ga0070669_1016878111 166
76 3300005354 Ga0070675_100008013 Ga0070675_1000080133 166
77 3300005354 Ga0070675_100269506 Ga0070675_1002695062 166
78 3300005354 Ga0070675_100353760 Ga0070675_1003537601 166
79 3300005355 Ga0070671_100063531 Ga0070671_1000635313 166
80 3300005355 Ga0070671_100114780 Ga0070671_1001147802 166
81 3300005355 Ga0070671_100489797 Ga0070671_1004897972 166
82 3300005355 Ga0070671_100532601 Ga0070671_1005326012 166
83 3300005355 Ga0070671_100916968 Ga0070671_1009169682 166
84 3300005356 Ga0070674_100010807 Ga0070674_1000108075 166
85 3300005356 Ga0070674_100329526 Ga0070674_1003295262 166
86 3300005356 Ga0070674_101265865 Ga0070674_1012658651 166
87 3300005364 Ga0070673_100110922 Ga0070673_1001109224 166
88 3300005364 Ga0070673_100123265 Ga0070673_1001232651 166
89 3300005364 Ga0070673_100189253 Ga0070673_1001892532 166
90 3300005365 Ga0070688_100034853 Ga0070688_1000348532 166
91 3300005365 Ga0070688_100071372 Ga0070688_1000713725 166
92 3300005366 Ga0070659_100028058 Ga0070659_1000280582 166
93 3300005366 Ga0070659_100032099 Ga0070659_1000320995 166
94 3300005366 Ga0070659_100100880 Ga0070659_1001008802 166
95 3300005366 Ga0070659_100364280 Ga0070659_1003642802 166
96 3300005366 Ga0070659_101305082 Ga0070659_1013050821 166
97 3300005367 Ga0070667_100074626 Ga0070667_1000746263 166
98 3300005367 Ga0070667_100081033 Ga0070667_1000810332 166
99 3300005367 Ga0070667_100157296 Ga0070667_1001572962 166
100 3300005367 Ga0070667_100165023 Ga0070667_1001650232 166
101 3300005367 Ga0070667_100886514 Ga0070667_1008865141 166
102 3300005367 Ga0070667_101163492 Ga0070667_1011634921 166
103 3300005406 Ga0070703_10109877 Ga0070703_101098772 166
104 3300005406 Ga0070703_10218345 Ga0070703_102183451 166
105 3300005434 Ga0070709_10039132 Ga0070709_100391322 166
106 3300005434 Ga0070709_10067448 Ga0070709_100674482 166
107 3300005435 Ga0070714_100000014 Ga0070714_10000001415 166
108 3300005435 Ga0070714_100078731 Ga0070714_1000787314 166
109 3300005435 Ga0070714_100090048 Ga0070714_1000900483 166
110 3300005435 Ga0070714_100093956 Ga0070714_1000939562 166
111 3300005435 Ga0070714_100098254 Ga0070714_1000982545 166
112 3300005435 Ga0070714_100167416 Ga0070714_1001674162 166
113 3300005435 Ga0070714_100187524 Ga0070714_1001875242 166
114 3300005435 Ga0070714_100322683 Ga0070714_1003226833 166
115 3300005435 Ga0070714_101273975 Ga0070714_1012739751 166
116 3300005436 Ga0070713_100043070 Ga0070713_1000430703 166
117 3300005436 Ga0070713_100073992 Ga0070713_1000739922 166
118 3300005436 Ga0070713_100120294 Ga0070713_1001202943 166
119 3300005436 Ga0070713_100133265 Ga0070713_1001332653 166
120 3300005436 Ga0070713_100196371 Ga0070713_1001963712 166
121 3300005436 Ga0070713_100257299 Ga0070713_1002572992 166
122 3300005436 Ga0070713_100361185 Ga0070713_1003611851 166
123 3300005436 Ga0070713_100920375 Ga0070713_1009203752 166
124 3300005437 Ga0070710_10002988 Ga0070710_100029883 166
125 3300005437 Ga0070710_10039714 Ga0070710_100397144 166
126 3300005437 Ga0070710_10070428 Ga0070710_100704282 166
127 3300005437 Ga0070710_10077900 Ga0070710_100779002 166
128 3300005437 Ga0070710_10106121 Ga0070710_101061212 166
129 3300005437 Ga0070710_10170914 Ga0070710_101709142 166
130 3300005437 Ga0070710_10313532 Ga0070710_103135322 166
131 3300005437 Ga0070710_10315567 Ga0070710_103155671 166
132 3300005438 Ga0070701_10000430 Ga0070701_100004304 166
133 3300005439 Ga0070711_100019881 Ga0070711_1000198817 166
134 3300005439 Ga0070711_100214277 Ga0070711_1002142772 166
135 3300005440 Ga0070705_100045044 Ga0070705_1000450442 166
136 3300005440 Ga0070705_100105098 Ga0070705_1001050981 166
137 3300005440 Ga0070705_100178071 Ga0070705_1001780712 166
138 3300005441 Ga0070700_100000218 Ga0070700_1000002183 166
139 3300005441 Ga0070700_100000965 Ga0070700_10000096514 166
140 3300005441 Ga0070700_100066374 Ga0070700_1000663742 166
141 3300005441 Ga0070700_100500132 Ga0070700_1005001321 166
142 3300005444 Ga0070694_100092723 Ga0070694_1000927232 166
143 3300005444 Ga0070694_100142971 Ga0070694_1001429711 166
144 3300005444 Ga0070694_100266237 Ga0070694_1002662371 166
145 3300005444 Ga0070694_100532452 Ga0070694_1005324522 166
146 3300005445 Ga0070708_100473198 Ga0070708_1004731982 166
147 3300005455 Ga0070663_100008736 Ga0070663_1000087362 166
148 3300005455 Ga0070663_100025629 Ga0070663_1000256294 166
149 3300005455 Ga0070663_100073227 Ga0070663_1000732272 166
150 3300005455 Ga0070663_100384963 Ga0070663_1003849632 166
151 3300005455 Ga0070663_100385817 Ga0070663_1003858172 166
152 3300005455 Ga0070663_100941624 Ga0070663_1009416242 166
153 3300005456 Ga0070678_100159550 Ga0070678_1001595501 166
154 3300005456 Ga0070678_100316914 Ga0070678_1003169142 166
155 3300005456 Ga0070678_101413388 Ga0070678_1014133881 166
156 3300005457 Ga0070662_100011939 Ga0070662_1000119395 166
157 3300005457 Ga0070662_100102894 Ga0070662_1001028943 166
158 3300005457 Ga0070662_100390653 Ga0070662_1003906532 166
159 3300005458 Ga0070681_11033171 Ga0070681_110331711 166
160 3300005459 Ga0068867_100004208 Ga0068867_10000420810 166
161 3300005459 Ga0068867_100141193 Ga0068867_1001411931 166
162 3300005459 Ga0068867_100524579 Ga0068867_1005245792 166
163 3300005459 Ga0068867_100691356 Ga0068867_1006913562 166
164 3300005466 Ga0070685_10247192 Ga0070685_102471922 166
165 3300005466 Ga0070685_10517042 Ga0070685_105170421 166
166 3300005471 Ga0070698_100074742 Ga0070698_1000747422 166
167 3300005471 Ga0070698_100300107 Ga0070698_1003001071 166
168 3300005530 Ga0070679_100001808 Ga0070679_1000018085 166
169 3300005530 Ga0070679_100181597 Ga0070679_1001815972 166
170 3300005530 Ga0070679_100298389 Ga0070679_1002983891 166
171 3300005535 Ga0070684_100002397 Ga0070684_10000239715 166
172 3300005535 Ga0070684_100049562 Ga0070684_1000495624 166
173 3300005535 Ga0070684_100065509 Ga0070684_1000655094 166
174 3300005535 Ga0070684_100088992 Ga0070684_1000889924 166
175 3300005535 Ga0070684_100098113 Ga0070684_1000981132 166
176 3300005535 Ga0070684_100159050 Ga0070684_1001590502 166
177 3300005535 Ga0070684_100196962 Ga0070684_1001969623 166
178 3300005535 Ga0070684_100389154 Ga0070684_1003891542 166
179 3300005539 Ga0068853_100042929 Ga0068853_1000429295 166
180 3300005539 Ga0068853_100097719 Ga0068853_1000977193 166
181 3300005539 Ga0068853_100606917 Ga0068853_1006069172 166
182 3300005543 Ga0070672_100002245 Ga0070672_10000224512 166
183 3300005543 Ga0070672_101040004 Ga0070672_1010400042 166
184 3300005543 Ga0070672_101223058 Ga0070672_1012230582 166
185 3300005544 Ga0070686_100026582 Ga0070686_1000265822 166
186 3300005544 Ga0070686_100266148 Ga0070686_1002661482 166
187 3300005544 Ga0070686_101006880 Ga0070686_1010068801 166
188 3300005545 Ga0070695_100045656 Ga0070695_1000456561 166
189 3300005545 Ga0070695_100191032 Ga0070695_1001910321 166
190 3300005545 Ga0070695_100500214 Ga0070695_1005002141 166
191 3300005546 Ga0070696_100054359 Ga0070696_1000543594 166
192 3300005546 Ga0070696_100057338 Ga0070696_1000573382 166
193 3300005547 Ga0070693_100014081 Ga0070693_1000140814 166
194 3300005547 Ga0070693_100036327 Ga0070693_1000363274 166
195 3300005547 Ga0070693_100468355 Ga0070693_1004683552 166
196 3300005548 Ga0070665_100039101 Ga0070665_1000391015 166
197 3300005548 Ga0070665_100134015 Ga0070665_1001340153 166
198 3300005548 Ga0070665_100285276 Ga0070665_1002852763 166
199 3300005548 Ga0070665_100348829 Ga0070665_1003488292 166
200 3300005549 Ga0070704_100505263 Ga0070704_1005052631 166
201 3300005549 Ga0070704_100648602 Ga0070704_1006486022 166
202 3300005563 Ga0068855_100133040 Ga0068855_1001330401 166
203 3300005563 Ga0068855_100199765 Ga0068855_1001997652 166
204 3300005563 Ga0068855_100257774 Ga0068855_1002577743 166
205 3300005563 Ga0068855_100376332 Ga0068855_1003763324 166
206 3300005563 Ga0068855_101187623 Ga0068855_1011876231 166
207 3300005564 Ga0070664_100002454 Ga0070664_10000245416 166
208 3300005564 Ga0070664_100380810 Ga0070664_1003808102 166
209 3300005564 Ga0070664_100382555 Ga0070664_1003825553 166
210 3300005564 Ga0070664_100580614 Ga0070664_1005806142 166
211 3300005577 Ga0068857_100050154 Ga0068857_1000501544 166
212 3300005577 Ga0068857_100099315 Ga0068857_1000993153 166
213 3300005577 Ga0068857_100245779 Ga0068857_1002457792 166
214 3300005577 Ga0068857_100249868 Ga0068857_1002498682 166
215 3300005577 Ga0068857_100417519 Ga0068857_1004175192 166
216 3300005577 Ga0068857_101334042 Ga0068857_1013340422 166
217 3300005577 Ga0068857_101389276 Ga0068857_1013892761 166
218 3300005578 Ga0068854_100356033 Ga0068854_1003560332 166
219 3300005578 Ga0068854_100523006 Ga0068854_1005230061 166
220 3300005578 Ga0068854_100787783 Ga0068854_1007877831 166
221 3300005614 Ga0068856_100051532 Ga0068856_1000515323 166
222 3300005614 Ga0068856_100069607 Ga0068856_1000696075 166
223 3300005614 Ga0068856_100124954 Ga0068856_1001249542 166
224 3300005614 Ga0068856_100194564 Ga0068856_1001945642 166
225 3300005614 Ga0068856_100385507 Ga0068856_1003855071 166
226 3300005614 Ga0068856_100826987 Ga0068856_1008269872 166
227 3300005614 Ga0068856_101178636 Ga0068856_1011786362 166
228 3300005615 Ga0070702_100055487 Ga0070702_1000554872 166
229 3300005615 Ga0070702_100084111 Ga0070702_1000841113 166
230 3300005615 Ga0070702_100107815 Ga0070702_1001078152 166
231 3300005615 Ga0070702_100246023 Ga0070702_1002460232 166
232 3300005615 Ga0070702_100327441 Ga0070702_1003274412 166
233 3300005616 Ga0068852_100003717 Ga0068852_10000371711 166
234 3300005616 Ga0068852_100011959 Ga0068852_1000119595 166
235 3300005616 Ga0068852_100101042 Ga0068852_1001010422 166
236 3300005616 Ga0068852_100384804 Ga0068852_1003848042 166
237 3300005616 Ga0068852_100384884 Ga0068852_1003848842 166
238 3300005616 Ga0068852_100653861 Ga0068852_1006538612 166
239 3300005617 Ga0068859_100165706 Ga0068859_1001657062 166
240 3300005617 Ga0068859_100303019 Ga0068859_1003030191 166
241 3300005617 Ga0068859_100469809 Ga0068859_1004698092 166
242 3300005617 Ga0068859_100476164 Ga0068859_1004761642 166
243 3300005618 Ga0068864_100062999 Ga0068864_1000629994 166
244 3300005618 Ga0068864_100179000 Ga0068864_1001790001 166
245 3300005618 Ga0068864_100233720 Ga0068864_1002337202 166
246 3300005618 Ga0068864_100268324 Ga0068864_1002683243 166
247 3300005618 Ga0068864_100275849 Ga0068864_1002758492 166
248 3300005618 Ga0068864_101049415 Ga0068864_1010494151 166
249 3300005718 Ga0068866_10235113 Ga0068866_102351132 166
250 3300005719 Ga0068861_100010264 Ga0068861_1000102646 166
251 3300005719 Ga0068861_100092973 Ga0068861_1000929732 166
252 3300005719 Ga0068861_100299635 Ga0068861_1002996352 166
253 3300005834 Ga0068851_10106595 Ga0068851_101065952 166
254 3300005834 Ga0068851_10160482 Ga0068851_101604822 166
255 3300005840 Ga0068870_10000655 Ga0068870_100006554 166
256 3300005840 Ga0068870_10100702 Ga0068870_101007023 166
257 3300005840 Ga0068870_10129845 Ga0068870_101298452 166
258 3300005840 Ga0068870_10374840 Ga0068870_103748402 166
259 3300005840 Ga0068870_10770399 Ga0068870_107703991 166
260 3300005840 Ga0068870_11009047 Ga0068870_110090471 166
261 3300005841 Ga0068863_100038332 Ga0068863_1000383325 166
262 3300005841 Ga0068863_100141365 Ga0068863_1001413652 166
263 3300005841 Ga0068863_100473726 Ga0068863_1004737261 166
264 3300005841 Ga0068863_100504805 Ga0068863_1005048052 166
265 3300005841 Ga0068863_101547269 Ga0068863_1015472691 166
266 3300005842 Ga0068858_100184888 Ga0068858_1001848881 166
267 3300005842 Ga0068858_100259514 Ga0068858_1002595144 166
268 3300005842 Ga0068858_100319951 Ga0068858_1003199512 166
269 3300005842 Ga0068858_100358610 Ga0068858_1003586102 166
270 3300005843 Ga0068860_100000555 Ga0068860_10000055538 166
271 3300005843 Ga0068860_100337765 Ga0068860_1003377653 166
272 3300005843 Ga0068860_100369832 Ga0068860_1003698322 166
273 3300005843 Ga0068860_100691861 Ga0068860_1006918612 166
274 3300005844 Ga0068862_100014021 Ga0068862_1000140216 166
275 3300005844 Ga0068862_101691098 Ga0068862_1016910981 166
276 3300005985 Ga0081539_10113294 Ga0081539_101132942 166
277 3300006028 Ga0070717_10025801 Ga0070717_100258017 166
278 3300006028 Ga0070717_10070997 Ga0070717_100709972 166
279 3300006028 Ga0070717_10099708 Ga0070717_100997082 166
280 3300006028 Ga0070717_10340210 Ga0070717_103402102 166
281 3300006028 Ga0070717_10455427 Ga0070717_104554272 166
282 3300006028 Ga0070717_10684433 Ga0070717_106844332 166
283 3300006038 Ga0075365_10013096 Ga0075365_100130963 166
284 3300006038 Ga0075365_10021136 Ga0075365_100211362 166
285 3300006038 Ga0075365_10038376 Ga0075365_100383763 166
286 3300006038 Ga0075365_10058278 Ga0075365_100582782 166
287 3300006038 Ga0075365_10124116 Ga0075365_101241162 166
288 3300006038 Ga0075365_10180053 Ga0075365_101800533 166
289 3300006038 Ga0075365_10232311 Ga0075365_102323111 166
290 3300006038 Ga0075365_10419031 Ga0075365_104190312 166
291 3300006042 Ga0075368_10012439 Ga0075368_100124393 166
292 3300006042 Ga0075368_10028309 Ga0075368_100283094 166
293 3300006048 Ga0075363_100012591 Ga0075363_1000125912 166
294 3300006048 Ga0075363_100026182 Ga0075363_1000261822 166
295 3300006048 Ga0075363_100031330 Ga0075363_1000313302 166
296 3300006048 Ga0075363_100043827 Ga0075363_1000438272 166
297 3300006048 Ga0075363_100051114 Ga0075363_1000511143 166
298 3300006051 Ga0075364_10076571 Ga0075364_100765712 166
299 3300006051 Ga0075364_10177133 Ga0075364_101771331 166
300 3300006051 Ga0075364_10331992 Ga0075364_103319922 166
301 3300006051 Ga0075364_10354865 Ga0075364_103548652 166
302 3300006163 Ga0070715_10044150 Ga0070715_100441503 166
303 3300006163 Ga0070715_10235174 Ga0070715_102351742 166
304 3300006173 Ga0070716_100073215 Ga0070716_1000732153 166
305 3300006173 Ga0070716_100102256 Ga0070716_1001022562 166
306 3300006173 Ga0070716_100234132 Ga0070716_1002341322 166
307 3300006173 Ga0070716_100318719 Ga0070716_1003187191 166
308 3300006175 Ga0070712_100002761 Ga0070712_10000276118 166
309 3300006175 Ga0070712_100340523 Ga0070712_1003405231 166
310 3300006175 Ga0070712_101489800 Ga0070712_1014898001 166
311 3300006177 Ga0075362_10097099 Ga0075362_100970992 166
312 3300006178 Ga0075367_10020632 Ga0075367_100206322 166
313 3300006178 Ga0075367_10057392 Ga0075367_100573924 166
314 3300006178 Ga0075367_10074064 Ga0075367_100740643 166
315 3300006237 Ga0097621_100239545 Ga0097621_1002395453 166
316 3300006237 Ga0097621_100448828 Ga0097621_1004488282 166
317 3300006353 Ga0075370_10058389 Ga0075370_100583892 166
318 3300006353 Ga0075370_10058918 Ga0075370_100589182 166
319 3300006353 Ga0075370_10246275 Ga0075370_102462752 166
320 3300006353 Ga0075370_10312842 Ga0075370_103128421 166
321 3300006358 Ga0068871_100594828 Ga0068871_1005948281 166
322 3300006358 Ga0068871_100912824 Ga0068871_1009128241 166
323 3300006358 Ga0068871_101131112 Ga0068871_1011311121 166
324 3300006844 Ga0075428_101066017 Ga0075428_1010660172 166
325 3300006844 Ga0075428_101766250 Ga0075428_1017662501 166
326 3300006846 Ga0075430_100356993 Ga0075430_1003569931 166
327 3300006847 Ga0075431_100641776 Ga0075431_1006417762 166
328 3300006852 Ga0075433_10622465 Ga0075433_106224652 166
329 3300006871 Ga0075434_100111264 Ga0075434_1001112642 166
330 3300006871 Ga0075434_100470001 Ga0075434_1004700013 166
331 3300006880 Ga0075429_100746336 Ga0075429_1007463361 166
332 3300006881 Ga0068865_100001715 Ga0068865_1000017155 166
333 3300006881 Ga0068865_100865369 Ga0068865_1008653692 166
334 3300006914 Ga0075436_100041243 Ga0075436_1000412433 166
335 3300006914 Ga0075436_100044354 Ga0075436_1000443543 166
336 3300006931 Ga0097620_100165697 Ga0097620_1001656972 166
337 3300006931 Ga0097620_100169034 Ga0097620_1001690343 166
338 3300006931 Ga0097620_100303009 Ga0097620_1003030091 166
339 3300006931 Ga0097620_100469795 Ga0097620_1004697952 166
340 3300006931 Ga0097620_100476182 Ga0097620_1004761822 166
341 3300007076 Ga0075435_100227172 Ga0075435_1002271722 166
342 3300007076 Ga0075435_100416549 Ga0075435_1004165492 166
343 3300007788 Ga0099795_10027976 Ga0099795_100279762 166
344 3300007788 Ga0099795_10101633 Ga0099795_101016331 166
345 3300009036 Ga0105244_10066956 Ga0105244_100669563 166
346 3300009093 Ga0105240_10169590 Ga0105240_101695902 166
347 3300009094 Ga0111539_10005936 Ga0111539_1000593613 166
348 3300009094 Ga0111539_10278577 Ga0111539_102785771 166
349 3300009094 Ga0111539_10745271 Ga0111539_107452713 166
350 3300009094 Ga0111539_10911763 Ga0111539_109117632 166
351 3300009094 Ga0111539_11385604 Ga0111539_113856041 166
352 3300009098 Ga0105245_10002375 Ga0105245_100023756 166
353 3300009098 Ga0105245_10003533 Ga0105245_100035331 166
354 3300009098 Ga0105245_10010196 Ga0105245_1001019610 166
355 3300009098 Ga0105245_10018880 Ga0105245_100188804 166
356 3300009098 Ga0105245_10033904 Ga0105245_100339045 166
357 3300009098 Ga0105245_10053785 Ga0105245_100537853 166
358 3300009098 Ga0105245_10115703 Ga0105245_101157032 166
359 3300009098 Ga0105245_10158882 Ga0105245_101588822 166
360 3300009098 Ga0105245_10263103 Ga0105245_102631032 166
361 3300009098 Ga0105245_10294814 Ga0105245_102948142 166
362 3300009098 Ga0105245_10626080 Ga0105245_106260802 166
363 3300009098 Ga0105245_10921431 Ga0105245_109214312 166
364 3300009098 Ga0105245_11154200 Ga0105245_111542001 166
365 3300009098 Ga0105245_11802178 Ga0105245_118021781 166
366 3300009101 Ga0105247_10064705 Ga0105247_100647054 166
367 3300009101 Ga0105247_10069909 Ga0105247_100699091 166
368 3300009147 Ga0114129_10690270 Ga0114129_106902702 166
369 3300009147 Ga0114129_11370707 Ga0114129_113707071 166
370 3300009148 Ga0105243_10001743 Ga0105243_1000174317 166
371 3300009148 Ga0105243_10078527 Ga0105243_100785272 166
372 3300009148 Ga0105243_10126416 Ga0105243_101264162 166
373 3300009148 Ga0105243_10134591 Ga0105243_101345912 166
374 3300009148 Ga0105243_10139743 Ga0105243_101397431 166
375 3300009148 Ga0105243_10141105 Ga0105243_101411052 166
376 3300009148 Ga0105243_10160099 Ga0105243_101600991 166
377 3300009148 Ga0105243_10394066 Ga0105243_103940662 166
378 3300009148 Ga0105243_10678451 Ga0105243_106784512 166
379 3300009174 Ga0105241_10052775 Ga0105241_100527752 166
380 3300009174 Ga0105241_10071150 Ga0105241_100711502 166
381 3300009174 Ga0105241_10464217 Ga0105241_104642172 166
382 3300009176 Ga0105242_10048497 Ga0105242_100484974 166
383 3300009176 Ga0105242_10081866 Ga0105242_100818662 166
384 3300009176 Ga0105242_10887602 Ga0105242_108876021 166
385 3300009177 Ga0105248_10035270 Ga0105248_100352704 166
386 3300009177 Ga0105248_10165958 Ga0105248_101659583 166
387 3300009177 Ga0105248_10235643 Ga0105248_102356432 166
388 3300009177 Ga0105248_10240393 Ga0105248_102403933 166
389 3300009177 Ga0105248_10301102 Ga0105248_103011022 166
390 3300009177 Ga0105248_10364547 Ga0105248_103645471 166
391 3300009177 Ga0105248_10442505 Ga0105248_104425052 166
392 3300009545 Ga0105237_10007425 Ga0105237_100074253 166
393 3300009545 Ga0105237_10405616 Ga0105237_104056161 166
394 3300009545 Ga0105237_10463880 Ga0105237_104638802 166
395 3300009545 Ga0105237_10806871 Ga0105237_108068711 166
396 3300009545 Ga0105237_10963692 Ga0105237_109636922 166
397 3300009551 Ga0105238_10094190 Ga0105238_100941904 166
398 3300009551 Ga0105238_10114466 Ga0105238_101144664 166
399 3300009551 Ga0105238_10167463 Ga0105238_101674631 166
400 3300009551 Ga0105238_10185184 Ga0105238_101851842 166
401 3300009551 Ga0105238_10402136 Ga0105238_104021362 166
402 3300009551 Ga0105238_10572821 Ga0105238_105728212 166
403 3300009551 Ga0105238_10751785 Ga0105238_107517852 166
404 3300009551 Ga0105238_11163039 Ga0105238_111630392 166
405 3300009553 Ga0105249_10025686 Ga0105249_100256866 166
406 3300009553 Ga0105249_10096522 Ga0105249_100965222 166
407 3300009553 Ga0105249_10099881 Ga0105249_100998815 166
408 3300009553 Ga0105249_10248227 Ga0105249_102482272 166
409 3300009553 Ga0105249_10909933 Ga0105249_109099332 166
410 3300009553 Ga0105249_11051636 Ga0105249_110516361 166
411 3300009553 Ga0105249_11439425 Ga0105249_114394252 166
412 3300009553 Ga0105249_11641229 Ga0105249_116412291 166
413 3300009828 Ga0130087_1094177 Ga0130087_10941773 166
414 3300009835 Ga0130084_1033988 Ga0130084_10339883 166
415 3300009835 Ga0130084_1090228 Ga0130084_10902283 166
416 3300010159 Ga0099796_10023027 Ga0099796_100230272 166
417 3300010375 Ga0105239_10007024 Ga0105239_100070244 166
418 3300010375 Ga0105239_10088444 Ga0105239_100884445 166
419 3300010375 Ga0105239_10088855 Ga0105239_100888554 166
420 3300010375 Ga0105239_10201229 Ga0105239_102012292 166
421 3300010375 Ga0105239_10277301 Ga0105239_102773012 166
422 3300010375 Ga0105239_10446200 Ga0105239_104462002 166
423 3300010375 Ga0105239_10477252 Ga0105239_104772522 166
424 3300010375 Ga0105239_11019560 Ga0105239_110195602 166
425 3300010375 Ga0105239_11029287 Ga0105239_110292872 166
426 3300011119 Ga0105246_10009352 Ga0105246_100093527 166
427 3300011119 Ga0105246_10036830 Ga0105246_100368304 166
428 3300011119 Ga0105246_10042578 Ga0105246_100425782 166
429 3300011119 Ga0105246_10156324 Ga0105246_101563243 166
430 3300011119 Ga0105246_10261547 Ga0105246_102615472 166
431 3300011119 Ga0105246_10263549 Ga0105246_102635492 166
432 3300011119 Ga0105246_10591122 Ga0105246_105911221 166
433 3300011119 Ga0105246_10686914 Ga0105246_106869141 166
434 3300011119 Ga0105246_10906196 Ga0105246_109061961 166
435 3300012488 Ga0157343_1004036 Ga0157343_10040361 166
436 3300012502 Ga0157347_1005731 Ga0157347_10057311 166
437 3300013100 Ga0157373_10118565 Ga0157373_101185651 166
438 3300013100 Ga0157373_10898619 Ga0157373_108986191 166
439 3300013102 Ga0157371_10350364 Ga0157371_103503642 166
440 3300013102 Ga0157371_10469619 Ga0157371_104696192 166
441 3300013102 Ga0157371_10596831 Ga0157371_105968311 166
442 3300013104 Ga0157370_10106437 Ga0157370_101064372 166
443 3300013104 Ga0157370_10201543 Ga0157370_102015432 166
444 3300013105 Ga0157369_10030703 Ga0157369_100307035 166
445 3300013105 Ga0157369_10060269 Ga0157369_100602691 166
446 3300013105 Ga0157369_10078160 Ga0157369_100781603 166
447 3300013105 Ga0157369_10183147 Ga0157369_101831471 166
448 3300013105 Ga0157369_10216190 Ga0157369_102161902 166
449 3300013105 Ga0157369_10216632 Ga0157369_102166322 166
450 3300013105 Ga0157369_10370905 Ga0157369_103709051 166
451 3300013105 Ga0157369_10781700 Ga0157369_107817002 166
452 3300013105 Ga0157369_10895405 Ga0157369_108954051 166
453 3300013105 Ga0157369_10901399 Ga0157369_109013992 166
454 3300013105 Ga0157369_11017571 Ga0157369_110175712 166
455 3300013105 Ga0157369_11419311 Ga0157369_114193111 166
456 3300013296 Ga0157374_10231013 Ga0157374_102310133 166
457 3300013296 Ga0157374_10402713 Ga0157374_104027131 166
458 3300013296 Ga0157374_10448677 Ga0157374_104486772 166
459 3300013297 Ga0157378_10076616 Ga0157378_100766164 166
460 3300013297 Ga0157378_10368765 Ga0157378_103687651 166
461 3300013306 Ga0163162_10157042 Ga0163162_101570422 166
462 3300013306 Ga0163162_10297958 Ga0163162_102979582 166
463 3300013306 Ga0163162_10328140 Ga0163162_103281402 166
464 3300013306 Ga0163162_10726653 Ga0163162_107266533 166
465 3300013306 Ga0163162_10779123 Ga0163162_107791231 166
466 3300013306 Ga0163162_11190116 Ga0163162_111901161 166
467 3300013306 Ga0163162_11639283 Ga0163162_116392832 166
468 3300013307 Ga0157372_10026780 Ga0157372_100267809 166
469 3300013307 Ga0157372_10092895 Ga0157372_100928952 166
470 3300013307 Ga0157372_10173767 Ga0157372_101737674 166
471 3300013307 Ga0157372_10358705 Ga0157372_103587052 166
472 3300013307 Ga0157372_10360477 Ga0157372_103604772 166
473 3300013307 Ga0157372_10455159 Ga0157372_104551591 166
474 3300013307 Ga0157372_10465086 Ga0157372_104650862 166
475 3300013307 Ga0157372_12027879 Ga0157372_120278791 166
476 3300013307 Ga0157372_12119879 Ga0157372_121198791 166
477 3300013307 Ga0157372_12620052 Ga0157372_126200521 166
478 3300013308 Ga0157375_10015955 Ga0157375_100159554 166
479 3300013308 Ga0157375_10030942 Ga0157375_100309422 166
480 3300013308 Ga0157375_10061729 Ga0157375_100617294 166
481 3300013308 Ga0157375_10129168 Ga0157375_101291682 166
482 3300013308 Ga0157375_10256551 Ga0157375_102565513 166
483 3300013308 Ga0157375_10286767 Ga0157375_102867671 166
484 3300013308 Ga0157375_10292813 Ga0157375_102928133 166
485 3300013308 Ga0157375_10722642 Ga0157375_107226421 166
486 3300013308 Ga0157375_10752439 Ga0157375_107524392 166
487 3300013308 Ga0157375_11084740 Ga0157375_110847402 166
488 3300013308 Ga0157375_11142740 Ga0157375_111427402 166
489 3300013308 Ga0157375_11461098 Ga0157375_114610981 166
490 3300014325 Ga0163163_10012916 Ga0163163_100129162 166
491 3300014325 Ga0163163_10046846 Ga0163163_100468463 166
492 3300014325 Ga0163163_10136645 Ga0163163_101366454 166
493 3300014325 Ga0163163_10210814 Ga0163163_102108142 166
494 3300014325 Ga0163163_10285528 Ga0163163_102855282 166
495 3300014325 Ga0163163_10642542 Ga0163163_106425422 166
496 3300014325 Ga0163163_10817395 Ga0163163_108173952 166
497 3300014326 Ga0157380_10013665 Ga0157380_100136654 166
498 3300014326 Ga0157380_10024391 Ga0157380_100243914 166
499 3300014326 Ga0157380_10675829 Ga0157380_106758292 166
500 3300014326 Ga0157380_10792147 Ga0157380_107921472 166
501 3300014326 Ga0157380_10829787 Ga0157380_108297872 166
502 3300014326 Ga0157380_11279010 Ga0157380_112790101 166
503 3300014745 Ga0157377_10018851 Ga0157377_100188514 166
504 3300014745 Ga0157377_10023311 Ga0157377_100233111 166
505 3300014745 Ga0157377_10053635 Ga0157377_100536353 166
506 3300014745 Ga0157377_10525488 Ga0157377_105254881 166
507 3300014968 Ga0157379_10038903 Ga0157379_100389037 166
508 3300014968 Ga0157379_10046998 Ga0157379_100469982 166
509 3300014968 Ga0157379_10163628 Ga0157379_101636283 166
510 3300014968 Ga0157379_10199417 Ga0157379_101994172 166
511 3300014969 Ga0157376_10020836 Ga0157376_100208366 166
512 3300014969 Ga0157376_10022259 Ga0157376_100222591 166
513 3300014969 Ga0157376_10214624 Ga0157376_102146241 166
514 3300014969 Ga0157376_10453865 Ga0157376_104538652 166
515 3300014969 Ga0157376_10639493 Ga0157376_106394932 166
516 3300014969 Ga0157376_10707535 Ga0157376_107075351 166
517 3300014969 Ga0157376_10846717 Ga0157376_108467172 166
518 3300014969 Ga0157376_11236181 Ga0157376_112361812 166
519 3300017792 Ga0163161_10082919 Ga0163161_100829193 166
520 3300017792 Ga0163161_10239251 Ga0163161_102392512 166
521 3300017792 Ga0163161_11261605 Ga0163161_112616051 166
522 3300017792 Ga0163161_11332961 Ga0163161_113329611 166
523 3300020069 Ga0197907_10274704 Ga0197907_102747042 166
524 3300020069 Ga0197907_10559883 Ga0197907_105598832 166
525 3300020069 Ga0197907_11226896 Ga0197907_112268962 166
526 3300020069 Ga0197907_11302917 Ga0197907_113029171 166
527 3300020070 Ga0206356_10395291 Ga0206356_103952911 166
528 3300020070 Ga0206356_10648946 Ga0206356_106489462 166
529 3300020070 Ga0206356_11522207 Ga0206356_115222071 166
530 3300020070 Ga0206356_11589931 Ga0206356_115899312 166
531 3300020075 Ga0206349_1067878 Ga0206349_10678781 166
532 3300020075 Ga0206349_1119117 Ga0206349_11191171 166
533 3300020075 Ga0206349_1149250 Ga0206349_11492502 166
534 3300020075 Ga0206349_1460009 Ga0206349_14600092 166
535 3300020075 Ga0206349_1882549 Ga0206349_18825491 166
536 3300020076 Ga0206355_1187232 Ga0206355_11872323 166
537 3300020076 Ga0206355_1234758 Ga0206355_12347581 166
538 3300020076 Ga0206355_1561896 Ga0206355_15618961 166
539 3300020077 Ga0206351_10804799 Ga0206351_108047993 166
540 3300020077 Ga0206351_10941945 Ga0206351_109419451 166
541 3300020078 Ga0206352_10680863 Ga0206352_106808631 166
542 3300020078 Ga0206352_11041443 Ga0206352_110414432 166
543 3300020080 Ga0206350_10480067 Ga0206350_104800673 166
544 3300020080 Ga0206350_10539336 Ga0206350_105393361 166
545 3300020080 Ga0206350_10686507 Ga0206350_106865072 166
546 3300020080 Ga0206350_11179634 Ga0206350_111796342 166
547 3300020080 Ga0206350_11495066 Ga0206350_114950661 166
548 3300020081 Ga0206354_10195779 Ga0206354_101957792 166
549 3300020081 Ga0206354_10774667 Ga0206354_107746673 166
550 3300020081 Ga0206354_11516096 Ga0206354_115160961 166
551 3300020081 Ga0206354_11603842 Ga0206354_116038422 166
552 3300020082 Ga0206353_10073491 Ga0206353_100734915 166
553 3300020082 Ga0206353_10607955 Ga0206353_106079552 166
554 3300020082 Ga0206353_10732788 Ga0206353_107327882 166
555 3300020082 Ga0206353_10901837 Ga0206353_109018371 166
556 3300020082 Ga0206353_11013927 Ga0206353_110139273 166
557 3300020082 Ga0206353_11575710 Ga0206353_115757103 166
558 3300020610 Ga0154015_1130338 Ga0154015_11303381 166
559 3300020610 Ga0154015_1253899 Ga0154015_12538993 166
560 3300021384 Ga0213876_10067302 Ga0213876_100673021 166
561 3300021384 Ga0213876_10248140 Ga0213876_102481402 166
562 3300021388 Ga0213875_10024452 Ga0213875_100244523 166
563 3300022467 Ga0224712_10006130 Ga0224712_100061303 166
564 3300022467 Ga0224712_10011867 Ga0224712_100118672 166
565 3300022467 Ga0224712_10058336 Ga0224712_100583362 166
566 3300022467 Ga0224712_10085086 Ga0224712_100850861 166
567 3300022467 Ga0224712_10111099 Ga0224712_101110992 166
568 3300022467 Ga0224712_10137769 Ga0224712_101377691 166
569 3300022467 Ga0224712_10144348 Ga0224712_101443482 166
570 3300022467 Ga0224712_10596887 Ga0224712_105968871 166
571 3300022730 Ga0224570_105942 Ga0224570_1059421 166
572 3300022734 Ga0224571_105430 Ga0224571_1054301 166
573 3300024225 Ga0224572_1001265 Ga0224572_10012654 166
574 3300024225 Ga0224572_1017311 Ga0224572_10173111 166
575 3300025315 Ga0207697_10063604 Ga0207697_100636041 166
576 3300025315 Ga0207697_10147967 Ga0207697_101479671 166
577 3300025321 Ga0207656_10143428 Ga0207656_101434281 166
578 3300025885 Ga0207653_10018889 Ga0207653_100188892 166
579 3300025898 Ga0207692_10026075 Ga0207692_100260754 166
580 3300025898 Ga0207692_10113078 Ga0207692_101130782 166
581 3300025898 Ga0207692_10124996 Ga0207692_101249962 166
582 3300025898 Ga0207692_10252026 Ga0207692_102520261 166
583 3300025898 Ga0207692_10288444 Ga0207692_102884442 166
584 3300025900 Ga0207710_10156841 Ga0207710_101568412 166
585 3300025901 Ga0207688_10014002 Ga0207688_100140024 166
586 3300025901 Ga0207688_10014568 Ga0207688_100145685 166
587 3300025901 Ga0207688_10041324 Ga0207688_100413241 166
588 3300025901 Ga0207688_10091203 Ga0207688_100912032 166
589 3300025901 Ga0207688_10122392 Ga0207688_101223922 166
590 3300025903 Ga0207680_10104593 Ga0207680_101045932 166
591 3300025904 Ga0207647_10045186 Ga0207647_100451865 166
592 3300025904 Ga0207647_10121133 Ga0207647_101211333 166
593 3300025905 Ga0207685_10101245 Ga0207685_101012451 166
594 3300025905 Ga0207685_10124391 Ga0207685_101243912 166
595 3300025905 Ga0207685_10126858 Ga0207685_101268582 166
596 3300025905 Ga0207685_10236123 Ga0207685_102361232 166
597 3300025906 Ga0207699_10001554 Ga0207699_1000155416 166
598 3300025906 Ga0207699_10019598 Ga0207699_100195982 166
599 3300025906 Ga0207699_10026819 Ga0207699_100268192 166
600 3300025906 Ga0207699_10039747 Ga0207699_100397471 166
601 3300025907 Ga0207645_10186084 Ga0207645_101860841 166
602 3300025907 Ga0207645_10217736 Ga0207645_102177362 166
603 3300025908 Ga0207643_10002339 Ga0207643_100023399 166
604 3300025908 Ga0207643_10038330 Ga0207643_100383303 166
605 3300025908 Ga0207643_10058060 Ga0207643_100580601 166
606 3300025908 Ga0207643_10514159 Ga0207643_105141592 166
607 3300025909 Ga0207705_10052878 Ga0207705_100528782 166
608 3300025909 Ga0207705_10146907 Ga0207705_101469072 166
609 3300025909 Ga0207705_10789566 Ga0207705_107895661 166
610 3300025910 Ga0207684_10429024 Ga0207684_104290241 166
611 3300025911 Ga0207654_10061650 Ga0207654_100616502 166
612 3300025911 Ga0207654_10244730 Ga0207654_102447302 166
613 3300025911 Ga0207654_10366446 Ga0207654_103664462 166
614 3300025912 Ga0207707_10487742 Ga0207707_104877421 166
615 3300025912 Ga0207707_10622033 Ga0207707_106220331 166
616 3300025913 Ga0207695_10480376 Ga0207695_104803761 166
617 3300025914 Ga0207671_10112427 Ga0207671_101124272 166
618 3300025914 Ga0207671_10224356 Ga0207671_102243562 166
619 3300025915 Ga0207693_10046992 Ga0207693_100469924 166
620 3300025915 Ga0207693_10158932 Ga0207693_101589322 166
621 3300025915 Ga0207693_10164876 Ga0207693_101648761 166
622 3300025915 Ga0207693_10201679 Ga0207693_102016791 166
623 3300025916 Ga0207663_10272530 Ga0207663_102725302 166
624 3300025916 Ga0207663_10279590 Ga0207663_102795901 166
625 3300025916 Ga0207663_10506727 Ga0207663_105067272 166
626 3300025917 Ga0207660_10137670 Ga0207660_101376702 166
627 3300025917 Ga0207660_10168416 Ga0207660_101684162 166
628 3300025917 Ga0207660_10410715 Ga0207660_104107151 166
629 3300025918 Ga0207662_10020059 Ga0207662_100200593 166
630 3300025918 Ga0207662_10105909 Ga0207662_101059091 166
631 3300025918 Ga0207662_10617849 Ga0207662_106178492 166
632 3300025919 Ga0207657_10008239 Ga0207657_100082397 166
633 3300025919 Ga0207657_10072844 Ga0207657_100728442 166
634 3300025919 Ga0207657_10188875 Ga0207657_101888752 166
635 3300025919 Ga0207657_10259024 Ga0207657_102590242 166
636 3300025920 Ga0207649_10167496 Ga0207649_101674962 166
637 3300025920 Ga0207649_11045206 Ga0207649_110452061 166
638 3300025920 Ga0207649_11398760 Ga0207649_113987601 166
639 3300025921 Ga0207652_10057109 Ga0207652_100571092 166
640 3300025921 Ga0207652_10511797 Ga0207652_105117971 166
641 3300025921 Ga0207652_10687066 Ga0207652_106870662 166
642 3300025922 Ga0207646_10245073 Ga0207646_102450732 166
643 3300025923 Ga0207681_10082205 Ga0207681_100822052 166
644 3300025923 Ga0207681_10171906 Ga0207681_101719063 166
645 3300025924 Ga0207694_10107362 Ga0207694_101073622 166
646 3300025924 Ga0207694_10342296 Ga0207694_103422961 166
647 3300025924 Ga0207694_10672915 Ga0207694_106729151 166
648 3300025924 Ga0207694_10913766 Ga0207694_109137661 166
649 3300025925 Ga0207650_10088313 Ga0207650_100883132 166
650 3300025926 Ga0207659_10002685 Ga0207659_100026855 166
651 3300025926 Ga0207659_10109929 Ga0207659_101099292 166
652 3300025926 Ga0207659_10555166 Ga0207659_105551662 166
653 3300025927 Ga0207687_10005701 Ga0207687_100057014 166
654 3300025927 Ga0207687_10005785 Ga0207687_100057856 166
655 3300025927 Ga0207687_10018895 Ga0207687_100188954 166
656 3300025927 Ga0207687_10049654 Ga0207687_100496543 166
657 3300025927 Ga0207687_10076186 Ga0207687_100761861 166
658 3300025927 Ga0207687_10154110 Ga0207687_101541103 166
659 3300025927 Ga0207687_10249993 Ga0207687_102499932 166
660 3300025927 Ga0207687_10444755 Ga0207687_104447552 166
661 3300025927 Ga0207687_10642570 Ga0207687_106425702 166
662 3300025928 Ga0207700_10001348 Ga0207700_1000134821 166
663 3300025928 Ga0207700_10033985 Ga0207700_100339851 166
664 3300025928 Ga0207700_10038109 Ga0207700_100381095 166
665 3300025928 Ga0207700_10041395 Ga0207700_100413952 166
666 3300025928 Ga0207700_10041551 Ga0207700_100415516 166
667 3300025928 Ga0207700_10117710 Ga0207700_101177102 166
668 3300025928 Ga0207700_10212192 Ga0207700_102121922 166
669 3300025928 Ga0207700_10373747 Ga0207700_103737471 166
670 3300025928 Ga0207700_10485774 Ga0207700_104857742 166
671 3300025928 Ga0207700_10957515 Ga0207700_109575151 166
672 3300025928 Ga0207700_11134651 Ga0207700_111346511 166
673 3300025929 Ga0207664_10000001 Ga0207664_1000000153 166
674 3300025929 Ga0207664_10029094 Ga0207664_100290944 166
675 3300025929 Ga0207664_10036476 Ga0207664_100364763 166
676 3300025929 Ga0207664_10055128 Ga0207664_100551283 166
677 3300025929 Ga0207664_10056656 Ga0207664_100566563 166
678 3300025929 Ga0207664_10060506 Ga0207664_100605064 166
679 3300025929 Ga0207664_10075566 Ga0207664_100755663 166
680 3300025929 Ga0207664_10096108 Ga0207664_100961082 166
681 3300025929 Ga0207664_10150442 Ga0207664_101504422 166
682 3300025929 Ga0207664_10172871 Ga0207664_101728712 166
683 3300025929 Ga0207664_10227100 Ga0207664_102271003 166
684 3300025929 Ga0207664_10484817 Ga0207664_104848172 166
685 3300025929 Ga0207664_10809896 Ga0207664_108098962 166
686 3300025929 Ga0207664_11660984 Ga0207664_116609841 166
687 3300025931 Ga0207644_10547571 Ga0207644_105475711 166
688 3300025931 Ga0207644_10676823 Ga0207644_106768232 166
689 3300025931 Ga0207644_11069850 Ga0207644_110698501 166
690 3300025932 Ga0207690_10011376 Ga0207690_100113762 166
691 3300025932 Ga0207690_10226189 Ga0207690_102261893 166
692 3300025932 Ga0207690_10891272 Ga0207690_108912721 166
693 3300025933 Ga0207706_10031312 Ga0207706_100313122 166
694 3300025933 Ga0207706_10288156 Ga0207706_102881562 166
695 3300025933 Ga0207706_11553911 Ga0207706_115539111 166
696 3300025934 Ga0207686_10098839 Ga0207686_100988393 166
697 3300025934 Ga0207686_10286002 Ga0207686_102860023 166
698 3300025935 Ga0207709_10070466 Ga0207709_100704662 166
699 3300025935 Ga0207709_10210456 Ga0207709_102104561 166
700 3300025935 Ga0207709_10239209 Ga0207709_102392092 166
701 3300025935 Ga0207709_10437419 Ga0207709_104374191 166
702 3300025935 Ga0207709_10556677 Ga0207709_105566772 166
703 3300025935 Ga0207709_10623582 Ga0207709_106235821 166
704 3300025935 Ga0207709_10889094 Ga0207709_108890942 166
705 3300025936 Ga0207670_10413748 Ga0207670_104137482 166
706 3300025936 Ga0207670_10638204 Ga0207670_106382042 166
707 3300025936 Ga0207670_10707595 Ga0207670_107075952 166
708 3300025937 Ga0207669_10079148 Ga0207669_100791483 166
709 3300025937 Ga0207669_10201686 Ga0207669_102016863 166
710 3300025937 Ga0207669_10286033 Ga0207669_102860332 166
711 3300025937 Ga0207669_10416813 Ga0207669_104168132 166
712 3300025937 Ga0207669_10547541 Ga0207669_105475412 166
713 3300025939 Ga0207665_10234434 Ga0207665_102344341 166
714 3300025939 Ga0207665_10236568 Ga0207665_102365681 166
715 3300025939 Ga0207665_10617427 Ga0207665_106174271 166
716 3300025940 Ga0207691_10002762 Ga0207691_100027625 166
717 3300025940 Ga0207691_10069401 Ga0207691_100694012 166
718 3300025940 Ga0207691_10296051 Ga0207691_102960512 166
719 3300025941 Ga0207711_10106206 Ga0207711_101062064 166
720 3300025941 Ga0207711_10164608 Ga0207711_101646082 166
721 3300025941 Ga0207711_10182013 Ga0207711_101820133 166
722 3300025941 Ga0207711_10329344 Ga0207711_103293442 166
723 3300025941 Ga0207711_10510641 Ga0207711_105106411 166
724 3300025941 Ga0207711_10604623 Ga0207711_106046232 166
725 3300025941 Ga0207711_10808267 Ga0207711_108082671 166
726 3300025941 Ga0207711_10925525 Ga0207711_109255251 166
727 3300025942 Ga0207689_10045141 Ga0207689_100451413 166
728 3300025942 Ga0207689_10053410 Ga0207689_100534102 166
729 3300025942 Ga0207689_10054878 Ga0207689_100548782 166
730 3300025942 Ga0207689_10285373 Ga0207689_102853732 166
731 3300025942 Ga0207689_10354307 Ga0207689_103543072 166
732 3300025944 Ga0207661_10009942 Ga0207661_100099424 166
733 3300025944 Ga0207661_10010718 Ga0207661_100107182 166
734 3300025944 Ga0207661_10052843 Ga0207661_100528433 166
735 3300025944 Ga0207661_10052955 Ga0207661_100529554 166
736 3300025944 Ga0207661_10119008 Ga0207661_101190082 166
737 3300025944 Ga0207661_10134434 Ga0207661_101344342 166
738 3300025944 Ga0207661_10213519 Ga0207661_102135194 166
739 3300025944 Ga0207661_10402778 Ga0207661_104027782 166
740 3300025944 Ga0207661_10927890 Ga0207661_109278901 166
741 3300025945 Ga0207679_10017785 Ga0207679_100177854 166
742 3300025945 Ga0207679_10164572 Ga0207679_101645722 166
743 3300025945 Ga0207679_10801555 Ga0207679_108015551 166
744 3300025945 Ga0207679_11614770 Ga0207679_116147701 166
745 3300025949 Ga0207667_10091382 Ga0207667_100913824 166
746 3300025949 Ga0207667_10992944 Ga0207667_109929441 166
747 3300025960 Ga0207651_10062428 Ga0207651_100624282 166
748 3300025960 Ga0207651_10467331 Ga0207651_104673311 166
749 3300025961 Ga0207712_10196720 Ga0207712_101967202 166
750 3300025961 Ga0207712_10355866 Ga0207712_103558661 166
751 3300025961 Ga0207712_10781578 Ga0207712_107815781 166
752 3300025972 Ga0207668_10045150 Ga0207668_100451503 166
753 3300025972 Ga0207668_10121061 Ga0207668_101210613 166
754 3300025972 Ga0207668_10209915 Ga0207668_102099151 166
755 3300025981 Ga0207640_10012096 Ga0207640_100120964 166
756 3300025981 Ga0207640_10642737 Ga0207640_106427371 166
757 3300025986 Ga0207658_10162954 Ga0207658_101629542 166
758 3300025986 Ga0207658_10208951 Ga0207658_102089511 166
759 3300025986 Ga0207658_10429276 Ga0207658_104292762 166
760 3300025986 Ga0207658_10636247 Ga0207658_106362472 166
761 3300025986 Ga0207658_10672551 Ga0207658_106725512 166
762 3300025986 Ga0207658_11319703 Ga0207658_113197032 166
763 3300026023 Ga0207677_10009142 Ga0207677_100091424 166
764 3300026023 Ga0207677_10134871 Ga0207677_101348712 166
765 3300026023 Ga0207677_10346447 Ga0207677_103464471 166
766 3300026023 Ga0207677_10524461 Ga0207677_105244611 166
767 3300026023 Ga0207677_11333300 Ga0207677_113333001 166
768 3300026035 Ga0207703_10032231 Ga0207703_100322314 166
769 3300026035 Ga0207703_10183654 Ga0207703_101836541 166
770 3300026035 Ga0207703_10228344 Ga0207703_102283442 166
771 3300026041 Ga0207639_10014227 Ga0207639_100142276 166
772 3300026041 Ga0207639_10051426 Ga0207639_100514262 166
773 3300026067 Ga0207678_10017601 Ga0207678_100176012 166
774 3300026067 Ga0207678_10053961 Ga0207678_100539613 166
775 3300026067 Ga0207678_10077027 Ga0207678_100770272 166
776 3300026067 Ga0207678_10083217 Ga0207678_100832175 166
777 3300026067 Ga0207678_10363517 Ga0207678_103635172 166
778 3300026075 Ga0207708_10000011 Ga0207708_1000001142 166
779 3300026075 Ga0207708_10002163 Ga0207708_100021635 166
780 3300026075 Ga0207708_10091105 Ga0207708_100911053 166
781 3300026075 Ga0207708_10093904 Ga0207708_100939042 166
782 3300026075 Ga0207708_10132770 Ga0207708_101327703 166
783 3300026078 Ga0207702_10065728 Ga0207702_100657282 166
784 3300026078 Ga0207702_10090151 Ga0207702_100901514 166
785 3300026078 Ga0207702_10111066 Ga0207702_101110662 166
786 3300026078 Ga0207702_10245398 Ga0207702_102453982 166
787 3300026078 Ga0207702_10365973 Ga0207702_103659732 166
788 3300026078 Ga0207702_10488916 Ga0207702_104889161 166
789 3300026078 Ga0207702_11229938 Ga0207702_112299381 166
790 3300026078 Ga0207702_11439432 Ga0207702_114394321 166
791 3300026088 Ga0207641_10098376 Ga0207641_100983763 166
792 3300026088 Ga0207641_10265318 Ga0207641_102653182 166
793 3300026088 Ga0207641_10347686 Ga0207641_103476861 166
794 3300026088 Ga0207641_10384156 Ga0207641_103841561 166
795 3300026088 Ga0207641_10589195 Ga0207641_105891952 166
796 3300026088 Ga0207641_11031076 Ga0207641_110310761 166
797 3300026089 Ga0207648_10012625 Ga0207648_100126254 166
798 3300026089 Ga0207648_10315307 Ga0207648_103153072 166
799 3300026089 Ga0207648_10432235 Ga0207648_104322352 166
800 3300026089 Ga0207648_10698658 Ga0207648_106986581 166
801 3300026089 Ga0207648_10853906 Ga0207648_108539061 166
802 3300026095 Ga0207676_10102117 Ga0207676_101021173 166
803 3300026095 Ga0207676_10210416 Ga0207676_102104162 166
804 3300026095 Ga0207676_10252841 Ga0207676_102528412 166
805 3300026116 Ga0207674_10045694 Ga0207674_100456942 166
806 3300026116 Ga0207674_10126735 Ga0207674_101267353 166
807 3300026116 Ga0207674_10182720 Ga0207674_101827202 166
808 3300026116 Ga0207674_10231269 Ga0207674_102312692 166
809 3300026116 Ga0207674_10264675 Ga0207674_102646752 166
810 3300026116 Ga0207674_10363583 Ga0207674_103635832 166
811 3300026118 Ga0207675_100018425 Ga0207675_1000184255 166
812 3300026118 Ga0207675_100046878 Ga0207675_1000468783 166
813 3300026118 Ga0207675_100051571 Ga0207675_1000515712 166
814 3300026118 Ga0207675_100283745 Ga0207675_1002837452 166
815 3300026118 Ga0207675_100468868 Ga0207675_1004688681 166
816 3300026118 Ga0207675_101224039 Ga0207675_1012240391 166
817 3300026121 Ga0207683_10025760 Ga0207683_100257603 166
818 3300026121 Ga0207683_10040662 Ga0207683_100406624 166
819 3300026121 Ga0207683_10072135 Ga0207683_100721353 166
820 3300026121 Ga0207683_10193624 Ga0207683_101936242 166
821 3300026121 Ga0207683_10273405 Ga0207683_102734051 166
822 3300026142 Ga0207698_10026194 Ga0207698_100261945 166
823 3300026142 Ga0207698_10229234 Ga0207698_102292342 166
824 3300026142 Ga0207698_10306623 Ga0207698_103066232 166
825 3300026142 Ga0207698_10474023 Ga0207698_104740232 166
826 3300026142 Ga0207698_10607197 Ga0207698_106071971 166
827 3300026142 Ga0207698_10651066 Ga0207698_106510661 166
828 3300026142 Ga0207698_11404918 Ga0207698_114049181 166
829 3300027866 Ga0209813_10014321 Ga0209813_100143212 166
830 3300027907 Ga0207428_10119983 Ga0207428_101199831 166
831 3300027907 Ga0207428_10174340 Ga0207428_101743402 166
832 3300028379 Ga0268266_10003864 Ga0268266_1000386416 166
833 3300028379 Ga0268266_10269382 Ga0268266_102693822 166
834 3300028379 Ga0268266_10276998 Ga0268266_102769982 166
835 3300028379 Ga0268266_10741507 Ga0268266_107415072 166
836 3300028379 Ga0268266_10752940 Ga0268266_107529402 166
837 3300028379 Ga0268266_11047589 Ga0268266_110475891 166
838 3300028380 Ga0268265_10045436 Ga0268265_100454362 166
839 3300028380 Ga0268265_10713828 Ga0268265_107138282 166
840 3300028380 Ga0268265_10898515 Ga0268265_108985152 166
841 3300028380 Ga0268265_11168954 Ga0268265_111689542 166
842 3300028381 Ga0268264_10000264 Ga0268264_1000026437 166
843 3300028381 Ga0268264_10304973 Ga0268264_103049732 166
844 3300028381 Ga0268264_11103204 Ga0268264_111032041 166
845 3300028381 Ga0268264_11345633 Ga0268264_113456331 166
846 3300031456 Ga0307513_10000508 Ga0307513_1000050865 166
847 3300031456 Ga0307513_10007891 Ga0307513_100078915 166
848 3300031456 Ga0307513_10011555 Ga0307513_100115555 166
849 3300031456 Ga0307513_10060465 Ga0307513_100604653 166
850 3300031548 Ga0307408_100111435 Ga0307408_1001114351 166
851 3300031548 Ga0307408_101235498 Ga0307408_1012354981 166
852 3300031548 Ga0307408_102226803 Ga0307408_1022268031 166
853 3300031731 Ga0307405_10747101 Ga0307405_107471011 166
854 3300031731 Ga0307405_10759591 Ga0307405_107595911 166
855 3300031824 Ga0307413_10006443 Ga0307413_100064438 166
856 3300031824 Ga0307413_10022743 Ga0307413_100227432 166
857 3300031824 Ga0307413_10071234 Ga0307413_100712342 166
858 3300031824 Ga0307413_10125675 Ga0307413_101256752 166
859 3300031824 Ga0307413_10203731 Ga0307413_102037311 166
860 3300031824 Ga0307413_10218604 Ga0307413_102186042 166
861 3300031824 Ga0307413_10221778 Ga0307413_102217782 166
862 3300031824 Ga0307413_10242640 Ga0307413_102426401 166
863 3300031824 Ga0307413_10997895 Ga0307413_109978951 166
864 3300031824 Ga0307413_11447768 Ga0307413_114477681 166
865 3300031824 Ga0307413_11875909 Ga0307413_118759091 166
866 3300031852 Ga0307410_10012731 Ga0307410_100127314 166
867 3300031852 Ga0307410_10186785 Ga0307410_101867852 166
868 3300031852 Ga0307410_10772198 Ga0307410_107721981 166
869 3300031901 Ga0307406_10053040 Ga0307406_100530402 166
870 3300031901 Ga0307406_10930708 Ga0307406_109307082 166
871 3300031903 Ga0307407_10011542 Ga0307407_100115424 166
872 3300031903 Ga0307407_10085592 Ga0307407_100855922 166
873 3300031903 Ga0307407_10186079 Ga0307407_101860792 166
874 3300031903 Ga0307407_10578558 Ga0307407_105785581 166
875 3300031911 Ga0307412_10152961 Ga0307412_101529612 166
876 3300031911 Ga0307412_10494679 Ga0307412_104946791 166
877 3300031995 Ga0307409_100008477 Ga0307409_1000084776 166
878 3300031995 Ga0307409_100010285 Ga0307409_1000102856 166
879 3300031995 Ga0307409_100024537 Ga0307409_1000245375 166
880 3300031995 Ga0307409_100042630 Ga0307409_1000426302 166
881 3300031995 Ga0307409_100050679 Ga0307409_1000506791 166
882 3300031995 Ga0307409_100101280 Ga0307409_1001012801 166
883 3300031995 Ga0307409_100202723 Ga0307409_1002027232 166
884 3300031995 Ga0307409_100459413 Ga0307409_1004594132 166
885 3300031995 Ga0307409_100965915 Ga0307409_1009659151 166
886 3300032002 Ga0307416_100007123 Ga0307416_1000071237 166
887 3300032002 Ga0307416_100022786 Ga0307416_1000227865 166
888 3300032002 Ga0307416_100076501 Ga0307416_1000765014 166
889 3300032002 Ga0307416_100130086 Ga0307416_1001300864 166
890 3300032002 Ga0307416_100155958 Ga0307416_1001559583 166
891 3300032002 Ga0307416_100232190 Ga0307416_1002321902 166
892 3300032002 Ga0307416_100614196 Ga0307416_1006141961 166
893 3300032002 Ga0307416_100952266 Ga0307416_1009522661 166
894 3300032002 Ga0307416_101206468 Ga0307416_1012064681 166
895 3300032002 Ga0307416_101336827 Ga0307416_1013368271 166
896 3300032004 Ga0307414_10030398 Ga0307414_100303987 166
897 3300032004 Ga0307414_10491690 Ga0307414_104916901 166
898 3300032004 Ga0307414_11280809 Ga0307414_112808092 166
899 3300032005 Ga0307411_10011526 Ga0307411_100115268 166
900 3300032005 Ga0307411_10044178 Ga0307411_100441784 166
901 3300032005 Ga0307411_10076468 Ga0307411_100764682 166
902 3300032005 Ga0307411_10275489 Ga0307411_102754891 166
903 3300032005 Ga0307411_10477802 Ga0307411_104778022 166
904 3300032126 Ga0307415_100000779 Ga0307415_1000007799 166
905 3300032126 Ga0307415_100029734 Ga0307415_1000297341 166
906 3300032126 Ga0307415_100160725 Ga0307415_1001607253 166
907 3300032126 Ga0307415_100203734 Ga0307415_1002037341 166
908 3300032126 Ga0307415_100289873 Ga0307415_1002898732 166
909 3300032126 Ga0307415_100665156 Ga0307415_1006651562 166
910 3300032126 Ga0307415_102014729 Ga0307415_1020147291 166
911 3300033179 Ga0307507_10099579 Ga0307507_100995793 166
912 3300034818 Ga0373950_0031966 Ga0373950_0031966_13_543 166
913 3300034818 Ga0373950_0038829 Ga0373950_0038829_79_579 166
914 3300035086 Ga0373934_0000210 Ga0373934_0000210_16095_16595 166
915 3300035086 Ga0373934_0007222 Ga0373934_0007222_453_953 166
916 3300035086 Ga0373934_0036164 Ga0373934_0036164_287_787 166
917 3300035086 Ga0373934_0061188 Ga0373934_0061188_787_1287 166
918 3300035088 Ga0373940_0048927 Ga0373940_0048927_115_645 166
919 3300035089 Ga0373944_0006109 Ga0373944_0006109_2615_3115 166
920 3300035089 Ga0373944_0088376 Ga0373944_0088376_153_653 166
921 3300035089 Ga0373944_0180950 Ga0373944_0180950_232_732 166
922 3300035090 Ga0373949_0023477 Ga0373949_0023477_650_1150 166
923 3300035090 Ga0373949_0111055 Ga0373949_0111055_187_687 166
924 3300035091 Ga0373951_0058113 Ga0373951_0058113_434_934 166
925 3300035092 Ga0373952_0083332 Ga0373952_0083332_12_512 166
926 3300035111 Ga0373923_0014288 Ga0373923_0014288_493_993 166
927 3300035111 Ga0373923_0071029 Ga0373923_0071029_541_1041 166
928 3300035112 Ga0373932_0060337 Ga0373932_0060337_186_686 166
929 3300035113 Ga0373936_0050965 Ga0373936_0050965_511_1053 166
930 3300035113 Ga0373936_0107431 Ga0373936_0107431_96_596 166
931 3300035113 Ga0373936_0130172 Ga0373936_0130172_416_916 166
932 3300035113 Ga0373936_0330706 Ga0373936_0330706_132_632 166
933 3300035116 Ga0373945_0009798 Ga0373945_0009798_1651_2151 166
934 3300035116 Ga0373945_0011140 Ga0373945_0011140_1657_2199 166
935 3300035117 Ga0373953_0000868 Ga0373953_0000868_6157_6657 166
936 3300035117 Ga0373953_0036727 Ga0373953_0036727_606_1106 166
937 3300035117 Ga0373953_0079458 Ga0373953_0079458_54_554 166
938 3300035117 Ga0373953_0123579 Ga0373953_0123579_564_1064 166
939 3300035118 Ga0373954_0249922 Ga0373954_0249922_321_821 166
940 3300035118 Ga0373954_0460516 Ga0373954_0460516_82_582 166
941 3300035119 Ga0373956_0021757 Ga0373956_0021757_901_1401 166
942 3300035119 Ga0373956_0169238 Ga0373956_0169238_66_566 166
943 3300035120 Ga0373957_0000726 Ga0373957_0000726_731_1231 166
944 3300035120 Ga0373957_0153318 Ga0373957_0153318_147_647 166
945 3300035121 Ga0373960_0103278 Ga0373960_0103278_88_588 166
946 3300035170 Ga0373943_0003609 Ga0373943_0003609_5156_5656 166
947 3300035170 Ga0373943_0120851 Ga0373943_0120851_861_1361 166
948 3300035170 Ga0373943_0312560 Ga0373943_0312560_20_520 166
949 3300035170 Ga0373943_0523126 Ga0373943_0523126_183_683 166
950 3300035171 Ga0373946_0113043 Ga0373946_0113043_367_867 166
951 3300035171 Ga0373946_0417600 Ga0373946_0417600_145_645 166
952 3300035172 Ga0373955_0001291 Ga0373955_0001291_1977_2477 166
953 3300035172 Ga0373955_0003087 Ga0373955_0003087_4388_4888 166
954 3300035172 Ga0373955_0033614 Ga0373955_0033614_916_1416 166
955 3300035172 Ga0373955_0042911 Ga0373955_0042911_851_1393 166
956 3300035172 Ga0373955_0356396 Ga0373955_0356396_320_820 166
957 3300035172 Ga0373955_0774462 Ga0373955_0774462_64_564 166
958 3300035242 Ga0373962_0001189 Ga0373962_0001189_4607_5107 166
959 3300035242 Ga0373962_0012390 Ga0373962_0012390_37_537 166
960 3300035410 Ga0373924_0002657 Ga0373924_0002657_1949_2449 166
961 3300035410 Ga0373924_0031945 Ga0373924_0031945_758_1258 166
962 3300035410 Ga0373924_0038505 Ga0373924_0038505_601_1143 166
963 3300035691 Ga0373931_0126308 Ga0373931_0126308_781_1281 166
964 3300035691 Ga0373931_0243177 Ga0373931_0243177_420_920 166
965 3300035691 Ga0373931_0606414 Ga0373931_0606414_74_574 166
966 3300035692 Ga0373935_0000345 Ga0373935_0000345_4815_5315 166
967 3300035692 Ga0373935_0020925 Ga0373935_0020925_1006_1548 166
968 3300035692 Ga0373935_0073444 Ga0373935_0073444_342_842 166
969 3300035692 Ga0373935_0158935 Ga0373935_0158935_620_1120 166
970 3300035695 Ga0373927_0220573 Ga0373927_0220573_486_986 166
971 3300035695 Ga0373927_0599353 Ga0373927_0599353_195_695 166
972 3300035695 Ga0373927_0665594 Ga0373927_0665594_91_591 166
973 3300035724 Ga0373933_0000006 Ga0373933_0000006_10973_11473 166
974 3300035724 Ga0373933_0003973 Ga0373933_0003973_1762_2262 166
975 3300035724 Ga0373933_0013241 Ga0373933_0013241_3073_3573 166
976 3300035724 Ga0373933_0069026 Ga0373933_0069026_413_913 166
977 3300035724 Ga0373933_0409255 Ga0373933_0409255_337_837 166
978 3300035724 Ga0373933_0563768 Ga0373933_0563768_51_593 166
979 3300035725 Ga0373947_0005100 Ga0373947_0005100_1344_1844 166
980 3300035725 Ga0373947_0063465 Ga0373947_0063465_1004_1504 166
981 3300035725 Ga0373947_0113029 Ga0373947_0113029_512_1012 166
982 3300036401 Ga0373937_0000137 Ga0373937_0000137_2043_2543 166
983 3300036401 Ga0373937_0002187 Ga0373937_0002187_14260_14760 166
984 3300036401 Ga0373937_0018581 Ga0373937_0018581_212_712 166
985 3300036401 Ga0373937_0018693 Ga0373937_0018693_321_863 166
986 3300036401 Ga0373937_0020307 Ga0373937_0020307_1318_1818 166
987 3300036401 Ga0373937_0023641 Ga0373937_0023641_4187_4687 166
988 3300036401 Ga0373937_0113297 Ga0373937_0113297_1385_1885 166
989 3300036401 Ga0373937_0154223 Ga0373937_0154223_1422_1922 166
990 3300036401 Ga0373937_0268423 Ga0373937_0268423_371_871 166
991 3300036401 Ga0373937_0288411 Ga0373937_0288411_636_1136 166
992 3300036401 Ga0373937_0607300 Ga0373937_0607300_310_810 166
993 3300037068 Ga0373925_0021166 Ga0373925_0021166_799_1299 166
994 3300037068 Ga0373925_0030879 Ga0373925_0030879_1834_2334 166
995 3300037068 Ga0373925_0116853 Ga0373925_0116853_688_1188 166
996 3300037068 Ga0373925_0179724 Ga0373925_0179724_304_831 166
997 3300037068 Ga0373925_0201829 Ga0373925_0201829_336_836 166
998 3300037068 Ga0373925_0288280 Ga0373925_0288280_653_1153 166
999 3300037312 Ga0395899_0672582 Ga0395899_0672582_14_514 166
1000 3300037418 Ga0395900_0441920 Ga0395900_0441920_17_517 166
1001 3300037466 Ga0395898_0229556 Ga0395898_0229556_574_1074 166
1002 3300037466 Ga0395898_0420208 Ga0395898_0420208_48_548 166
1003 3300037853 Ga0436364_0398604 Ga0436364_0398604_4159_4659 166
1004 3300037853 Ga0436364_1032678 Ga0436364_1032678_4822_5322 166
1005 3300038443 Ga0395901_0065718 Ga0395901_0065718_965_1465 166
1006 3300038443 Ga0395901_0605682 Ga0395901_0605682_538_1083 166
1007 3300038996 Ga0242420_079410 Ga0242420_079410_123_623 166
1008 3300039437 Ga0436365_0046910 Ga0436365_0046910_143_643 166
1009 3300039437 Ga0436365_0857152 Ga0436365_0857152_198_713 166
1010 3300039437 Ga0436365_1152858 Ga0436365_1152858_51_551 166
1011 3300039437 Ga0436365_1927719 Ga0436365_1927719_456_956 166
1012 3300039447 Ga0436361_0112084 Ga0436361_0112084_1145_1645 166
1013 3300039453 Ga0436362_1063301 Ga0436362_1063301_59_574 166
1014 3300041413 Ga0439465_0305087 Ga0439465_0305087_84_584 166
1015 3300041441 Ga0451787_334395 Ga0451787_334395_63_563 166
1016 3300041443 Ga0451789_1099777 Ga0451789_1099777_35_535 166
1017 3300041443 Ga0451789_1194784 Ga0451789_1194784_835_1335 166
1018 3300041451 Ga0451791_0326259 Ga0451791_0326259_2284_2784 166
1019 3300041456 Ga0451795_0336166 Ga0451795_0336166_1233_1733 166
1020 3300041458 Ga0451798_0581057 Ga0451798_0581057_111_611 166
1021 3300041459 Ga0451800_0909946 Ga0451800_0909946_382_882 166
1022 3300041459 Ga0451800_1539529 Ga0451800_1539529_171_671 166
1023 3300041460 Ga0451802_0832046 Ga0451802_0832046_27_527 166
1024 3300041463 Ga0451804_0009137 Ga0451804_0009137_40_540 166
1025 3300041486 Ga0451807_1443748 Ga0451807_1443748_2347_2847 166
1026 3300041491 Ga0451833_0542245 Ga0451833_0542245_469_969 166
1027 3300041491 Ga0451833_1104584 Ga0451833_1104584_173_673 166
1028 3300041498 Ga0451841_1249366 Ga0451841_1249366_1446_1946 166
1029 3300041509 Ga0451843_0706055 Ga0451843_0706055_29_529 166
1030 3300041512 Ga0451853_0059067 Ga0451853_0059067_777_1277 166
1031 3300041512 Ga0451853_2162457 Ga0451853_2162457_87_587 166
1032 3300041512 Ga0451853_2241375 Ga0451853_2241375_261_776 166
1033 3300041512 Ga0451853_3519876 Ga0451853_3519876_16_516 166
1034 3300041512 Ga0451853_4110058 Ga0451853_4110058_1327_1827 166
1035 3300042146 Ga0450907_005712 Ga0450907_005712_1206_1727 166
1036 3300042435 Ga0439434_0199694 Ga0439434_0199694_159_659 166
1037 3300044658 Ga0466972_0012257 Ga0466972_0012257_2763_3263 166
1038 3300044658 Ga0466972_0111275 Ga0466972_0111275_69_569 166
1039 3300044658 Ga0466972_0276257 Ga0466972_0276257_13_513 166
1040 3300044683 Ga0466965_0007022 Ga0466965_0007022_3590_4090 166
1041 3300044683 Ga0466965_0080239 Ga0466965_0080239_817_1317 166
1042 3300044684 Ga0466966_0000254 Ga0466966_0000254_8998_9498 166
1043 3300044684 Ga0466966_0022536 Ga0466966_0022536_3132_3641 166
1044 3300044684 Ga0466966_0048604 Ga0466966_0048604_2009_2509 166
1045 3300044684 Ga0466966_0805191 Ga0466966_0805191_22_522 166
1046 3300044693 Ga0466961_0003881 Ga0466961_0003881_3816_4316 166
1047 3300044693 Ga0466961_0054227 Ga0466961_0054227_371_871 166
1048 3300044693 Ga0466961_0117952 Ga0466961_0117952_761_1270 166
1049 3300044693 Ga0466961_0174462 Ga0466961_0174462_74_574 166
1050 3300044693 Ga0466961_0193174 Ga0466961_0193174_695_1195 166
1051 3300044693 Ga0466961_0514929 Ga0466961_0514929_56_556 166
1052 3300044694 Ga0466963_0017024 Ga0466963_0017024_2860_3360 166
1053 3300044694 Ga0466963_0025916 Ga0466963_0025916_3231_3731 166
1054 3300044694 Ga0466963_0247608 Ga0466963_0247608_126_626 166
1055 3300044694 Ga0466963_0248232 Ga0466963_0248232_26_526 166
1056 3300044694 Ga0466963_0407207 Ga0466963_0407207_175_675 166
1057 3300044694 Ga0466963_0677522 Ga0466963_0677522_212_712 166
1058 3300044706 Ga0466964_0002025 Ga0466964_0002025_2196_2696 166
1059 3300044706 Ga0466964_0029455 Ga0466964_0029455_25_525 166
1060 3300044706 Ga0466964_0045688 Ga0466964_0045688_747_1247 166
1061 3300044719 Ga0466971_0020706 Ga0466971_0020706_1528_2028 166
1062 3300044719 Ga0466971_0025463 Ga0466971_0025463_1017_1517 166
1063 3300044719 Ga0466971_0269924 Ga0466971_0269924_39_539 166
1064 3300044735 Ga0466968_0054265 Ga0466968_0054265_1139_1639 166
1065 3300044765 Ga0466970_0001454 Ga0466970_0001454_2877_3377 166
1066 3300044765 Ga0466970_0074976 Ga0466970_0074976_394_894 166
1067 3300044765 Ga0466970_0095113 Ga0466970_0095113_646_1146 166
1068 3300044765 Ga0466970_0118801 Ga0466970_0118801_391_891 166
1069 3300044765 Ga0466970_0213020 Ga0466970_0213020_565_1065 166
1070 3300044765 Ga0466970_0221867 Ga0466970_0221867_102_602 166
1071 3300044842 Ga0466957_0032628 Ga0466957_0032628_623_1123 166
1072 3300044842 Ga0466957_0080022 Ga0466957_0080022_820_1320 166
1073 3300044842 Ga0466957_0080446 Ga0466957_0080446_1238_1738 166
1074 3300044842 Ga0466957_0109145 Ga0466957_0109145_743_1243 166
1075 3300044842 Ga0466957_0340060 Ga0466957_0340060_396_896 166
1076 3300044901 Ga0466960_0032019 Ga0466960_0032019_201_701 166
1077 3300044901 Ga0466960_0110243 Ga0466960_0110243_131_631 166
1078 3300045049 Ga0466959_0036277 Ga0466959_0036277_1765_2265 166
1079 3300045049 Ga0466959_0127981 Ga0466959_0127981_408_908 166
1080 3300045049 Ga0466959_0158625 Ga0466959_0158625_682_1182 166
1081 3300045049 Ga0466959_0262435 Ga0466959_0262435_402_902 166
1082 3300045049 Ga0466959_0791141 Ga0466959_0791141_43_543 166
1083 3300045051 Ga0451576_0062295 Ga0451576_0062295_2376_2876 166
1084 3300045836 Ga0466958_0018262 Ga0466958_0018262_1763_2263 166
1085 3300045836 Ga0466958_0026711 Ga0466958_0026711_1026_1526 166
1086 3300045836 Ga0466958_0128239 Ga0466958_0128239_489_989 166
1087 3300045836 Ga0466958_0159705 Ga0466958_0159705_56_556 166
1088 3300045836 Ga0466958_0230721 Ga0466958_0230721_522_1022 166
1089 3300045836 Ga0466958_0636527 Ga0466958_0636527_137_637 166
1090 3300045976 Ga0466967_0001244 Ga0466967_0001244_251_751 166
1091 3300045976 Ga0466967_0010475 Ga0466967_0010475_5002_5502 166
1092 3300045976 Ga0466967_0031381 Ga0466967_0031381_3424_3924 166
1093 3300045976 Ga0466967_0031669 Ga0466967_0031669_2057_2557 166
1094 3300045976 Ga0466967_0059330 Ga0466967_0059330_56_556 166
1095 3300045976 Ga0466967_0216867 Ga0466967_0216867_1070_1570 166
1096 3300045976 Ga0466967_0302285 Ga0466967_0302285_938_1438 166
1097 3300045976 Ga0466967_0403876 Ga0466967_0403876_618_1118 166
1098 3300045976 Ga0466967_0460444 Ga0466967_0460444_225_785 166
1099 3300045976 Ga0466967_0524838 Ga0466967_0524838_586_1086 166
1100 3300045976 Ga0466967_0534701 Ga0466967_0534701_441_941 166
1101 3300045976 Ga0466967_0926867 Ga0466967_0926867_316_816 166
1102 3300046454 Ga0495592_0000414 Ga0495592_0000414_28302_28802 166
1103 3300046454 Ga0495592_0002084 Ga0495592_0002084_11885_12427 166
1104 3300046454 Ga0495592_0020666 Ga0495592_0020666_1980_2480 166
1105 3300046454 Ga0495592_0025336 Ga0495592_0025336_2619_3119 166
1106 3300046454 Ga0495592_0263567 Ga0495592_0263567_333_833 166
1107 3300046454 Ga0495592_0313729 Ga0495592_0313729_106_606 166
1108 3300046454 Ga0495592_0463896 Ga0495592_0463896_152_652 166
1109 3300046455 Ga0495603_0006371 Ga0495603_0006371_3813_4313 166
1110 3300046455 Ga0495603_0156662 Ga0495603_0156662_773_1273 166
1111 3300046459 Ga0495629_0005848 Ga0495629_0005848_4819_5319 166
1112 3300046459 Ga0495629_0035405 Ga0495629_0035405_1136_1636 166
1113 3300046459 Ga0495629_0616618 Ga0495629_0616618_77_577 166
1114 3300046461 Ga0495641_0001585 Ga0495641_0001585_17365_17865 166
1115 3300046461 Ga0495641_0025839 Ga0495641_0025839_1037_1537 166
1116 3300046461 Ga0495641_0034297 Ga0495641_0034297_1706_2206 166
1117 3300046461 Ga0495641_0131708 Ga0495641_0131708_22_522 166
1118 3300046462 Ga0495651_0000082 Ga0495651_0000082_60236_60736 166
1119 3300046462 Ga0495651_0001462 Ga0495651_0001462_13324_13866 166
1120 3300046462 Ga0495651_0002623 Ga0495651_0002623_4575_5075 166
1121 3300046462 Ga0495651_0029487 Ga0495651_0029487_30_530 166
1122 3300046462 Ga0495651_0040566 Ga0495651_0040566_2481_2981 166
1123 3300046462 Ga0495651_0260018 Ga0495651_0260018_152_652 166
1124 3300046462 Ga0495651_0300011 Ga0495651_0300011_326_826 166
1125 3300046462 Ga0495651_0341184 Ga0495651_0341184_38_538 166
1126 3300046463 Ga0495653_0004390 Ga0495653_0004390_6711_7211 166
1127 3300046463 Ga0495653_0009576 Ga0495653_0009576_1885_2385 166
1128 3300046463 Ga0495653_0010689 Ga0495653_0010689_1385_1927 166
1129 3300046463 Ga0495653_0013109 Ga0495653_0013109_690_1190 166
1130 3300046463 Ga0495653_0067618 Ga0495653_0067618_1340_1840 166
1131 3300046463 Ga0495653_0083589 Ga0495653_0083589_1795_2295 166
1132 3300046463 Ga0495653_0198465 Ga0495653_0198465_817_1317 166
1133 3300046472 Ga0495580_0001983 Ga0495580_0001983_1227_1727 166
1134 3300046472 Ga0495580_0453603 Ga0495580_0453603_147_647 166
1135 3300046473 Ga0495582_0003190 Ga0495582_0003190_8640_9140 166
1136 3300046473 Ga0495582_0027257 Ga0495582_0027257_2298_2798 166
1137 3300046473 Ga0495582_0411502 Ga0495582_0411502_60_560 166
1138 3300046475 Ga0495639_0033577 Ga0495639_0033577_1159_1665 166
1139 3300046475 Ga0495639_0062443 Ga0495639_0062443_121_621 166
1140 3300046475 Ga0495639_0109404 Ga0495639_0109404_337_891 166
1141 3300046475 Ga0495639_0183081 Ga0495639_0183081_348_848 166
1142 3300046476 Ga0495662_0002412 Ga0495662_0002412_555_1055 166
1143 3300046476 Ga0495662_0258737 Ga0495662_0258737_316_816 166
1144 3300046477 Ga0495664_0004566 Ga0495664_0004566_847_1347 166
1145 3300046477 Ga0495664_0007420 Ga0495664_0007420_4192_4692 166
1146 3300046477 Ga0495664_0017488 Ga0495664_0017488_1832_2332 166
1147 3300046477 Ga0495664_0021722 Ga0495664_0021722_2489_2989 166
1148 3300046477 Ga0495664_0022974 Ga0495664_0022974_1324_1866 166
1149 3300046477 Ga0495664_0063180 Ga0495664_0063180_1543_2043 166
1150 3300046477 Ga0495664_0077953 Ga0495664_0077953_377_877 166
1151 3300046477 Ga0495664_0122383 Ga0495664_0122383_907_1407 166
1152 3300046477 Ga0495664_0211043 Ga0495664_0211043_28_528 166
1153 3300046492 Ga0495585_0378671 Ga0495585_0378671_69_569 166
1154 3300046499 Ga0495594_0077223 Ga0495594_0077223_974_1474 166
1155 3300046511 Ga0495608_0000197 Ga0495608_0000197_28303_28803 166
1156 3300046511 Ga0495608_0001419 Ga0495608_0001419_11999_12499 166
1157 3300046511 Ga0495608_0001665 Ga0495608_0001665_4415_4957 166
1158 3300046511 Ga0495608_0019913 Ga0495608_0019913_4075_4575 166
1159 3300046511 Ga0495608_0243784 Ga0495608_0243784_101_601 166
1160 3300046511 Ga0495608_0500403 Ga0495608_0500403_112_612 166
1161 3300046513 Ga0495616_0302079 Ga0495616_0302079_124_624 166
1162 3300046514 Ga0495618_0010006 Ga0495618_0010006_1043_1543 166
1163 3300046514 Ga0495618_0058958 Ga0495618_0058958_1092_1592 166
1164 3300046514 Ga0495618_0067901 Ga0495618_0067901_321_863 166
1165 3300046514 Ga0495618_0128320 Ga0495618_0128320_177_677 166
1166 3300046514 Ga0495618_0139793 Ga0495618_0139793_664_1164 166
1167 3300046514 Ga0495618_0179769 Ga0495618_0179769_568_1068 166
1168 3300046514 Ga0495618_0185252 Ga0495618_0185252_628_1134 166
1169 3300046514 Ga0495618_0675188 Ga0495618_0675188_89_589 166
1170 3300046516 Ga0495628_0001990 Ga0495628_0001990_8509_9009 166
1171 3300046516 Ga0495628_0004952 Ga0495628_0004952_5857_6399 166
1172 3300046516 Ga0495628_0008387 Ga0495628_0008387_1607_2107 166
1173 3300046516 Ga0495628_0040586 Ga0495628_0040586_1834_2334 166
1174 3300046516 Ga0495628_0053522 Ga0495628_0053522_899_1399 166
1175 3300046516 Ga0495628_0064041 Ga0495628_0064041_1191_1691 166
1176 3300046516 Ga0495628_0384693 Ga0495628_0384693_25_525 166
1177 3300046517 Ga0495630_0006267 Ga0495630_0006267_1397_1897 166
1178 3300046517 Ga0495630_0016439 Ga0495630_0016439_2682_3224 166
1179 3300046517 Ga0495630_0067099 Ga0495630_0067099_1736_2236 166
1180 3300046517 Ga0495630_0130159 Ga0495630_0130159_386_892 166
1181 3300046517 Ga0495630_0257821 Ga0495630_0257821_533_1033 166
1182 3300046517 Ga0495630_0851892 Ga0495630_0851892_91_591 166
1183 3300046517 Ga0495630_1157602 Ga0495630_1157602_42_542 166
1184 3300046517 Ga0495630_1217950 Ga0495630_1217950_53_553 166
1185 3300046518 Ga0495631_0027308 Ga0495631_0027308_1509_2015 166
1186 3300046526 Ga0495666_0010355 Ga0495666_0010355_3984_4484 166
1187 3300046526 Ga0495666_0321311 Ga0495666_0321311_58_600 166
1188 3300046529 Ga0495652_0001081 Ga0495652_0001081_28260_28760 166
1189 3300046529 Ga0495652_0009274 Ga0495652_0009274_5559_6059 166
1190 3300046529 Ga0495652_0011047 Ga0495652_0011047_3516_4058 166
1191 3300046529 Ga0495652_0062544 Ga0495652_0062544_274_774 166
1192 3300046529 Ga0495652_0066447 Ga0495652_0066447_1658_2158 166
1193 3300046529 Ga0495652_0073725 Ga0495652_0073725_416_916 166
1194 3300046529 Ga0495652_0138417 Ga0495652_0138417_513_1013 166
1195 3300046529 Ga0495652_0141216 Ga0495652_0141216_1146_1646 166
1196 3300046529 Ga0495652_0144989 Ga0495652_0144989_251_751 166
1197 3300046531 Ga0495665_0001285 Ga0495665_0001285_1636_2136 166
1198 3300046531 Ga0495665_0249191 Ga0495665_0249191_368_868 166
1199 3300046533 Ga0495640_0001411 Ga0495640_0001411_15039_15581 166
1200 3300046533 Ga0495640_0015089 Ga0495640_0015089_246_746 166
1201 3300046533 Ga0495640_0017783 Ga0495640_0017783_3408_3908 166
1202 3300046533 Ga0495640_0019271 Ga0495640_0019271_78_578 166
1203 3300046533 Ga0495640_0063723 Ga0495640_0063723_751_1251 166
1204 3300046533 Ga0495640_0515004 Ga0495640_0515004_202_702 166
1205 3300046533 Ga0495640_0600635 Ga0495640_0600635_16_516 166
1206 3300046535 Ga0495586_0082648 Ga0495586_0082648_1136_1636 166
1207 3300046536 Ga0495587_0000399 Ga0495587_0000399_28276_28776 166
1208 3300046536 Ga0495587_0001259 Ga0495587_0001259_4415_4957 166
1209 3300046536 Ga0495587_0010486 Ga0495587_0010486_4410_4910 166
1210 3300046536 Ga0495587_0014116 Ga0495587_0014116_4318_4818 166
1211 3300046536 Ga0495587_0107347 Ga0495587_0107347_855_1355 166
1212 3300046536 Ga0495587_0129506 Ga0495587_0129506_820_1320 166
1213 3300046536 Ga0495587_0278727 Ga0495587_0278727_309_809 166
1214 3300046536 Ga0495587_0543254 Ga0495587_0543254_25_525 166
1215 3300046539 Ga0495621_0016943 Ga0495621_0016943_1380_1880 166
1216 3300046543 Ga0495645_0012801 Ga0495645_0012801_4558_5058 166
1217 3300046543 Ga0495645_0017558 Ga0495645_0017558_4040_4582 166
1218 3300046543 Ga0495645_0034859 Ga0495645_0034859_2655_3155 166
1219 3300046543 Ga0495645_0056171 Ga0495645_0056171_1526_2026 166
1220 3300046543 Ga0495645_0065763 Ga0495645_0065763_530_1030 166
1221 3300046543 Ga0495645_0143260 Ga0495645_0143260_790_1296 166
1222 3300046543 Ga0495645_0309319 Ga0495645_0309319_70_570 166
1223 3300046559 Ga0495667_0000048 Ga0495667_0000048_114551_115051 166
1224 3300046559 Ga0495667_0001264 Ga0495667_0001264_9991_10533 166
1225 3300046559 Ga0495667_0008686 Ga0495667_0008686_1369_1869 166
1226 3300046559 Ga0495667_0018263 Ga0495667_0018263_839_1339 166
1227 3300046559 Ga0495667_0091028 Ga0495667_0091028_1396_1896 166
1228 3300046559 Ga0495667_0436448 Ga0495667_0436448_259_759 166
1229 3300046559 Ga0495667_0646063 Ga0495667_0646063_99_599 166
1230 3300046615 Ga0495656_0115306 Ga0495656_0115306_454_960 166
1231 3300046616 Ga0495668_0323693 Ga0495668_0323693_85_585 166
1232 3300046642 Ga0495634_0006178 Ga0495634_0006178_1248_1748 166
1233 3300046642 Ga0495634_0006412 Ga0495634_0006412_1115_1615 166
1234 3300046642 Ga0495634_0020747 Ga0495634_0020747_129_671 166
1235 3300046642 Ga0495634_0042017 Ga0495634_0042017_804_1304 166
1236 3300046642 Ga0495634_0045361 Ga0495634_0045361_331_831 166
1237 3300046663 Ga0495635_0002660 Ga0495635_0002660_1921_2421 166
1238 3300046663 Ga0495635_0005981 Ga0495635_0005981_5169_5669 166
1239 3300046663 Ga0495635_0007047 Ga0495635_0007047_1444_1986 166
1240 3300046663 Ga0495635_0152482 Ga0495635_0152482_652_1152 166
1241 3300046663 Ga0495635_0249606 Ga0495635_0249606_631_1131 166
1242 3300046663 Ga0495635_0259115 Ga0495635_0259115_251_751 166
1243 3300046663 Ga0495635_0583574 Ga0495635_0583574_218_718 166
1244 3300046674 Ga0495588_0097094 Ga0495588_0097094_1006_1506 166
1245 3300046675 Ga0495657_0001687 Ga0495657_0001687_10105_10605 166
1246 3300046675 Ga0495657_0003776 Ga0495657_0003776_9625_10125 166
1247 3300046675 Ga0495657_0016863 Ga0495657_0016863_365_907 166
1248 3300046675 Ga0495657_0019208 Ga0495657_0019208_3586_4086 166
1249 3300046675 Ga0495657_0048956 Ga0495657_0048956_16_516 166
1250 3300046675 Ga0495657_0079572 Ga0495657_0079572_807_1307 166
1251 3300046678 Ga0495599_0000023 Ga0495599_0000023_113666_114166 166
1252 3300046678 Ga0495599_0000479 Ga0495599_0000479_11857_12399 166
1253 3300046678 Ga0495599_0012232 Ga0495599_0012232_1660_2160 166
1254 3300046678 Ga0495599_0020085 Ga0495599_0020085_2619_3119 166
1255 3300046678 Ga0495599_0187678 Ga0495599_0187678_258_758 166
1256 3300046678 Ga0495599_0573833 Ga0495599_0573833_120_620 166
1257 3300046678 Ga0495599_0697194 Ga0495599_0697194_71_571 166
1258 3300046679 Ga0495623_0000407 Ga0495623_0000407_10899_11399 166
1259 3300046679 Ga0495623_0019112 Ga0495623_0019112_306_806 166
1260 3300046679 Ga0495623_0041329 Ga0495623_0041329_1333_1833 166
1261 3300046679 Ga0495623_0409424 Ga0495623_0409424_133_633 166
1262 3300046680 Ga0495646_0018409 Ga0495646_0018409_3471_4013 166
1263 3300046680 Ga0495646_0034156 Ga0495646_0034156_1718_2218 166
1264 3300046680 Ga0495646_0124791 Ga0495646_0124791_611_1111 166
1265 3300046680 Ga0495646_0132793 Ga0495646_0132793_303_809 166
1266 3300046680 Ga0495646_0310415 Ga0495646_0310415_48_548 166
1267 3300046681 Ga0495647_0009913 Ga0495647_0009913_2718_3218 166
1268 3300046681 Ga0495647_0080001 Ga0495647_0080001_221_721 166
1269 3300046681 Ga0495647_0142562 Ga0495647_0142562_436_936 166
1270 3300046683 Ga0495658_0004654 Ga0495658_0004654_5631_6131 166
1271 3300046683 Ga0495658_0055284 Ga0495658_0055284_1146_1646 166
1272 3300046689 Ga0495613_0031384 Ga0495613_0031384_1234_1734 166
1273 3300046689 Ga0495613_0042458 Ga0495613_0042458_1031_1531 166
1274 3300046689 Ga0495613_0098197 Ga0495613_0098197_405_947 166
1275 3300046689 Ga0495613_0255348 Ga0495613_0255348_544_1044 166
1276 3300046689 Ga0495613_0370300 Ga0495613_0370300_50_550 166
1277 3300046690 Ga0495624_0008027 Ga0495624_0008027_5851_6351 166
1278 3300046690 Ga0495624_0151147 Ga0495624_0151147_473_973 166
1279 3300046690 Ga0495624_0309930 Ga0495624_0309930_345_845 166
1280 3300046690 Ga0495624_0475877 Ga0495624_0475877_74_580 166
1281 3300046690 Ga0495624_0627191 Ga0495624_0627191_99_599 166
1282 3300046809 Ga0495600_0001597 Ga0495600_0001597_2010_2510 166
1283 3300046809 Ga0495600_0010255 Ga0495600_0010255_1414_1914 166
1284 3300046809 Ga0495600_0035682 Ga0495600_0035682_1949_2449 166
1285 3300046809 Ga0495600_0069215 Ga0495600_0069215_386_928 166
1286 3300046809 Ga0495600_0127680 Ga0495600_0127680_360_866 166
1287 3300046809 Ga0495600_0154928 Ga0495600_0154928_95_595 166
1288 3300046809 Ga0495600_0424487 Ga0495600_0424487_192_692 166
1289 3300046809 Ga0495600_0506848 Ga0495600_0506848_179_679 166
1290 3300047315 Ga0495581_0050907 Ga0495581_0050907_850_1350 166
1291 3300047315 Ga0495581_0130627 Ga0495581_0130627_913_1413 166
1292 3300047315 Ga0495581_0306536 Ga0495581_0306536_22_522 166
1293 3300047315 Ga0495581_0319844 Ga0495581_0319844_253_753 166
1294 3300047317 Ga0495604_0000037 Ga0495604_0000037_113669_114169 166
1295 3300047317 Ga0495604_0004777 Ga0495604_0004777_4396_4938 166
1296 3300047317 Ga0495604_0012260 Ga0495604_0012260_1986_2486 166
1297 3300047317 Ga0495604_0041854 Ga0495604_0041854_2256_2756 166
1298 3300047317 Ga0495604_0053644 Ga0495604_0053644_387_887 166
1299 3300047317 Ga0495604_0177559 Ga0495604_0177559_814_1314 166
1300 3300047317 Ga0495604_0238685 Ga0495604_0238685_31_531 166
1301 3300047319 Ga0495674_0002832 Ga0495674_0002832_2705_3205 166
1302 3300047319 Ga0495674_0008773 Ga0495674_0008773_8427_8969 166
1303 3300047319 Ga0495674_0025913 Ga0495674_0025913_3216_3716 166
1304 3300047319 Ga0495674_0056103 Ga0495674_0056103_680_1180 166
1305 3300047319 Ga0495674_0058943 Ga0495674_0058943_774_1274 166
1306 3300047319 Ga0495674_0059950 Ga0495674_0059950_1148_1648 166
1307 3300047319 Ga0495674_0063952 Ga0495674_0063952_910_1410 166
1308 3300047319 Ga0495674_0111901 Ga0495674_0111901_1721_2221 166
1309 3300047319 Ga0495674_0215190 Ga0495674_0215190_767_1273 166
1310 3300047319 Ga0495674_0590860 Ga0495674_0590860_250_750 166
1311 3300047319 Ga0495674_0644045 Ga0495674_0644045_321_821 166
1312 3300047319 Ga0495674_0870841 Ga0495674_0870841_150_650 166
1313 3300047321 Ga0495676_0000878 Ga0495676_0000878_4033_4533 166
1314 3300047321 Ga0495676_0047354 Ga0495676_0047354_863_1363 166
1315 3300047321 Ga0495676_0173760 Ga0495676_0173760_790_1290 166
1316 3300047321 Ga0495676_0196374 Ga0495676_0196374_873_1373 166
1317 3300047321 Ga0495676_0531602 Ga0495676_0531602_220_720 166
1318 3300047321 Ga0495676_1000804 Ga0495676_1000804_10_510 166
1319 3300047322 Ga0495680_0000240 Ga0495680_0000240_3683_4183 166
1320 3300047322 Ga0495680_0005370 Ga0495680_0005370_7150_7692 166
1321 3300047322 Ga0495680_0005403 Ga0495680_0005403_6701_7201 166
1322 3300047322 Ga0495680_0017806 Ga0495680_0017806_1356_1856 166
1323 3300047322 Ga0495680_0053571 Ga0495680_0053571_1863_2363 166
1324 3300047322 Ga0495680_0304183 Ga0495680_0304183_479_979 166
1325 3300047444 Ga0495675_0002696 Ga0495675_0002696_8393_8893 166
1326 3300047444 Ga0495675_0060519 Ga0495675_0060519_1303_1803 166
1327 3300047444 Ga0495675_0066698 Ga0495675_0066698_1675_2175 166
1328 3300047471 Ga0495684_0001577 Ga0495684_0001577_13324_13866 166
1329 3300047471 Ga0495684_0002951 Ga0495684_0002951_11496_11996 166
1330 3300047471 Ga0495684_0010870 Ga0495684_0010870_5209_5709 166
1331 3300047471 Ga0495684_0026743 Ga0495684_0026743_3795_4295 166
1332 3300047471 Ga0495684_0134582 Ga0495684_0134582_1277_1777 166
1333 3300047471 Ga0495684_0187960 Ga0495684_0187960_639_1139 166
1334 3300047673 Ga0495593_0002021 Ga0495593_0002021_6274_6774 166
1335 3300047673 Ga0495593_0068733 Ga0495593_0068733_1132_1638 166
1336 3300047673 Ga0495593_0153507 Ga0495593_0153507_586_1086 166
1337 3300047673 Ga0495593_0196504 Ga0495593_0196504_246_746 166
1338 3300048088 Ga0495602_0000127 Ga0495602_0000127_60220_60720 166
1339 3300048088 Ga0495602_0000747 Ga0495602_0000747_18444_18986 166
1340 3300048088 Ga0495602_0026192 Ga0495602_0026192_1757_2257 166
1341 3300048088 Ga0495602_0049938 Ga0495602_0049938_1102_1602 166
1342 3300048088 Ga0495602_0090835 Ga0495602_0090835_1294_1794 166
1343 3300048088 Ga0495602_0126744 Ga0495602_0126744_1156_1662 166
1344 3300048088 Ga0495602_0382440 Ga0495602_0382440_437_937 166
1345 3300048089 Ga0495614_0014688 Ga0495614_0014688_1180_1680 166
1346 3300048089 Ga0495614_0044566 Ga0495614_0044566_1034_1534 166
1347 3300048089 Ga0495614_0135780 Ga0495614_0135780_292_798 166
1348 3300048903 Ga0496100_0020230 Ga0496100_0020230_885_1385 166
1349 3300048903 Ga0496100_0046444 Ga0496100_0046444_731_1231 166
1350 3300048903 Ga0496100_0058598 Ga0496100_0058598_1134_1634 166
1351 3300048903 Ga0496100_0097216 Ga0496100_0097216_1409_1909 166
1352 3300048903 Ga0496100_0102633 Ga0496100_0102633_1339_1839 166
1353 3300048903 Ga0496100_0359116 Ga0496100_0359116_321_821 166
1354 3300048903 Ga0496100_0483308 Ga0496100_0483308_84_584 166
1355 3300048903 Ga0496100_0547419 Ga0496100_0547419_155_655 166
1356 3300048904 Ga0496101_0079182 Ga0496101_0079182_871_1371 166
1357 3300048904 Ga0496101_0141298 Ga0496101_0141298_614_1114 166
1358 3300048904 Ga0496101_0250779 Ga0496101_0250779_795_1295 166
1359 3300048904 Ga0496101_0282009 Ga0496101_0282009_68_568 166
1360 3300048904 Ga0496101_0284742 Ga0496101_0284742_176_676 166
1361 3300048904 Ga0496101_0336855 Ga0496101_0336855_304_804 166
1362 3300048904 Ga0496101_0428380 Ga0496101_0428380_137_679 166
1363 3300048904 Ga0496101_0761066 Ga0496101_0761066_228_728 166
1364 3300048905 Ga0496102_0039972 Ga0496102_0039972_1137_1637 166
1365 3300048905 Ga0496102_0071090 Ga0496102_0071090_60_566 166
1366 3300048905 Ga0496102_0090893 Ga0496102_0090893_1796_2296 166
1367 3300048905 Ga0496102_0104061 Ga0496102_0104061_1817_2317 166
1368 3300048905 Ga0496102_0105457 Ga0496102_0105457_1577_2077 166
1369 3300048905 Ga0496102_0223047 Ga0496102_0223047_1256_1756 166
1370 3300048905 Ga0496102_0260987 Ga0496102_0260987_805_1305 166
1371 3300048905 Ga0496102_0287045 Ga0496102_0287045_206_706 166
1372 3300048905 Ga0496102_0817476 Ga0496102_0817476_141_641 166
1373 3300048905 Ga0496102_1100773 Ga0496102_1100773_93_593 166
1374 3300048906 Ga0496103_0027127 Ga0496103_0027127_2302_2802 166
1375 3300048906 Ga0496103_0038590 Ga0496103_0038590_1643_2143 166
1376 3300048906 Ga0496103_0090992 Ga0496103_0090992_299_799 166
1377 3300048906 Ga0496103_0295172 Ga0496103_0295172_463_963 166
1378 3300048906 Ga0496103_0343531 Ga0496103_0343531_54_554 166
1379 3300048906 Ga0496103_0409929 Ga0496103_0409929_333_833 166
1380 3300048906 Ga0496103_0969712 Ga0496103_0969712_20_520 166
1381 3300048907 Ga0496104_0001248 Ga0496104_0001248_12346_12846 166
1382 3300048907 Ga0496104_0014199 Ga0496104_0014199_5549_6112 166
1383 3300048907 Ga0496104_0036274 Ga0496104_0036274_2161_2661 166
1384 3300048907 Ga0496104_0123116 Ga0496104_0123116_1870_2370 166
1385 3300048907 Ga0496104_0200500 Ga0496104_0200500_391_891 166
1386 3300048907 Ga0496104_0200702 Ga0496104_0200702_944_1444 166
1387 3300048907 Ga0496104_0320309 Ga0496104_0320309_777_1319 166
1388 3300048907 Ga0496104_0327571 Ga0496104_0327571_672_1172 166
1389 3300048907 Ga0496104_0366140 Ga0496104_0366140_566_1066 166
1390 3300048907 Ga0496104_0601661 Ga0496104_0601661_198_698 166
1391 3300048908 Ga0496105_0002306 Ga0496105_0002306_6698_7198 166
1392 3300048908 Ga0496105_0042487 Ga0496105_0042487_1936_2436 166
1393 3300048908 Ga0496105_0053191 Ga0496105_0053191_667_1209 166
1394 3300048908 Ga0496105_0073711 Ga0496105_0073711_942_1442 166
1395 3300048908 Ga0496105_0166821 Ga0496105_0166821_1047_1547 166
1396 3300048908 Ga0496105_0233427 Ga0496105_0233427_173_673 166
1397 3300048908 Ga0496105_0257489 Ga0496105_0257489_148_711 166
1398 3300048908 Ga0496105_0276079 Ga0496105_0276079_582_1082 166
1399 3300048908 Ga0496105_0300097 Ga0496105_0300097_240_740 166
1400 3300048908 Ga0496105_0409586 Ga0496105_0409586_497_997 166
1401 3300048909 Ga0496106_0044120 Ga0496106_0044120_1833_2333 166
1402 3300048909 Ga0496106_0105314 Ga0496106_0105314_1134_1634 166
1403 3300048909 Ga0496106_0134677 Ga0496106_0134677_819_1319 166
1404 3300048909 Ga0496106_0201667 Ga0496106_0201667_148_648 166
1405 3300048909 Ga0496106_0474673 Ga0496106_0474673_106_606 166
1406 3300048909 Ga0496106_0538543 Ga0496106_0538543_40_540 166
1407 3300048909 Ga0496106_0843351 Ga0496106_0843351_186_686 166
1408 3300048910 Ga0496107_0010754 Ga0496107_0010754_134_634 166
1409 3300048910 Ga0496107_0013442 Ga0496107_0013442_429_929 166
1410 3300048910 Ga0496107_0106053 Ga0496107_0106053_1421_1921 166
1411 3300048910 Ga0496107_0529450 Ga0496107_0529450_336_836 166
1412 3300048910 Ga0496107_0631409 Ga0496107_0631409_218_718 166
1413 3300048911 Ga0496108_0013671 Ga0496108_0013671_5132_5632 166
1414 3300048911 Ga0496108_0017333 Ga0496108_0017333_3407_3907 166
1415 3300048911 Ga0496108_0021669 Ga0496108_0021669_1664_2227 166
1416 3300048911 Ga0496108_0026090 Ga0496108_0026090_3828_4328 166
1417 3300048911 Ga0496108_0042188 Ga0496108_0042188_1125_1625 166
1418 3300048911 Ga0496108_0064088 Ga0496108_0064088_85_585 166
1419 3300048911 Ga0496108_0094332 Ga0496108_0094332_1768_2268 166
1420 3300048911 Ga0496108_0109195 Ga0496108_0109195_1836_2336 166
1421 3300048911 Ga0496108_0153743 Ga0496108_0153743_1291_1791 166
1422 3300048911 Ga0496108_0175539 Ga0496108_0175539_640_1140 166
1423 3300048911 Ga0496108_0179259 Ga0496108_0179259_346_888 166
1424 3300048911 Ga0496108_0179899 Ga0496108_0179899_738_1238 166
1425 3300048911 Ga0496108_0184352 Ga0496108_0184352_855_1355 166
1426 3300048911 Ga0496108_0194240 Ga0496108_0194240_150_650 166
1427 3300048911 Ga0496108_0423168 Ga0496108_0423168_226_726 166
1428 3300048912 Ga0496109_0001999 Ga0496109_0001999_14926_15426 166
1429 3300048912 Ga0496109_0005552 Ga0496109_0005552_8072_8572 166
1430 3300048912 Ga0496109_0005717 Ga0496109_0005717_8571_9071 166
1431 3300048912 Ga0496109_0022693 Ga0496109_0022693_3547_4047 166
1432 3300048912 Ga0496109_0023912 Ga0496109_0023912_3633_4133 166
1433 3300048912 Ga0496109_0047449 Ga0496109_0047449_2680_3180 166
1434 3300048912 Ga0496109_0076558 Ga0496109_0076558_686_1186 166
1435 3300048912 Ga0496109_0095872 Ga0496109_0095872_195_695 166
1436 3300048912 Ga0496109_0098296 Ga0496109_0098296_888_1451 166
1437 3300048912 Ga0496109_0099859 Ga0496109_0099859_1238_1738 166
1438 3300048912 Ga0496109_0124769 Ga0496109_0124769_1419_1919 166
1439 3300048912 Ga0496109_0154730 Ga0496109_0154730_1305_1805 166
1440 3300048912 Ga0496109_0332286 Ga0496109_0332286_230_730 166
1441 3300048912 Ga0496109_0590985 Ga0496109_0590985_416_916 166
1442 3300048912 Ga0496109_0612788 Ga0496109_0612788_282_782 166
1443 3300048912 Ga0496109_1603861 Ga0496109_1603861_64_564 166
1444 3300048912 Ga0496109_1682381 Ga0496109_1682381_57_557 166
1445 3300048913 Ga0496110_0016049 Ga0496110_0016049_894_1457 166
1446 3300048913 Ga0496110_0018153 Ga0496110_0018153_3347_3847 166
1447 3300048913 Ga0496110_0026060 Ga0496110_0026060_672_1172 166
1448 3300048913 Ga0496110_0032474 Ga0496110_0032474_2981_3481 166
1449 3300048913 Ga0496110_0050849 Ga0496110_0050849_1451_1951 166
1450 3300048913 Ga0496110_0061981 Ga0496110_0061981_2466_2966 166
1451 3300048913 Ga0496110_0093992 Ga0496110_0093992_532_1032 166
1452 3300048913 Ga0496110_0115471 Ga0496110_0115471_1661_2161 166
1453 3300048913 Ga0496110_0119173 Ga0496110_0119173_1862_2362 166
1454 3300048913 Ga0496110_0229706 Ga0496110_0229706_407_907 166
1455 3300048913 Ga0496110_0356101 Ga0496110_0356101_656_1156 166
1456 3300048913 Ga0496110_0368599 Ga0496110_0368599_27_551 166
1457 3300048913 Ga0496110_0418240 Ga0496110_0418240_342_842 166
1458 3300048913 Ga0496110_0542490 Ga0496110_0542490_102_602 166
1459 3300048913 Ga0496110_0701619 Ga0496110_0701619_259_801 166
1460 3300048913 Ga0496110_0708465 Ga0496110_0708465_219_746 166
1461 3300048913 Ga0496110_1505380 Ga0496110_1505380_71_571 166
1462 3300048914 Ga0496111_0005468 Ga0496111_0005468_567_1067 166
1463 3300048914 Ga0496111_0009514 Ga0496111_0009514_1142_1705 166
1464 3300048914 Ga0496111_0018508 Ga0496111_0018508_735_1235 166
1465 3300048914 Ga0496111_0025312 Ga0496111_0025312_2414_2914 166
1466 3300048914 Ga0496111_0074190 Ga0496111_0074190_236_736 166
1467 3300048914 Ga0496111_0105869 Ga0496111_0105869_536_1036 166
1468 3300048914 Ga0496111_0134852 Ga0496111_0134852_496_996 166
1469 3300048914 Ga0496111_0177689 Ga0496111_0177689_539_1039 166
1470 3300048914 Ga0496111_0201385 Ga0496111_0201385_873_1373 166
1471 3300048914 Ga0496111_0227026 Ga0496111_0227026_424_924 166
1472 3300048914 Ga0496111_0292472 Ga0496111_0292472_134_676 166
1473 3300048915 Ga0496112_0021834 Ga0496112_0021834_4324_4824 166
1474 3300048915 Ga0496112_0044981 Ga0496112_0044981_1872_2372 166
1475 3300048915 Ga0496112_0155826 Ga0496112_0155826_176_676 166
1476 3300048915 Ga0496112_0179372 Ga0496112_0179372_522_1085 166
1477 3300048915 Ga0496112_0307349 Ga0496112_0307349_86_586 166
1478 3300048915 Ga0496112_0448880 Ga0496112_0448880_218_718 166
1479 3300048915 Ga0496112_0881186 Ga0496112_0881186_143_643 166
1480 3300048915 Ga0496112_1263419 Ga0496112_1263419_36_578 166
1481 3300048916 Ga0496113_0078904 Ga0496113_0078904_1044_1544 166
1482 3300048916 Ga0496113_0079569 Ga0496113_0079569_667_1167 166
1483 3300048916 Ga0496113_0174690 Ga0496113_0174690_148_648 166
1484 3300048916 Ga0496113_0229055 Ga0496113_0229055_957_1457 166
1485 3300048916 Ga0496113_0274908 Ga0496113_0274908_745_1308 166
1486 3300048916 Ga0496113_0334564 Ga0496113_0334564_25_525 166
1487 3300048916 Ga0496113_0427281 Ga0496113_0427281_495_995 166
1488 3300048916 Ga0496113_0472126 Ga0496113_0472126_46_546 166
1489 3300048917 Ga0496114_0003622 Ga0496114_0003622_1736_2236 166
1490 3300048917 Ga0496114_0003988 Ga0496114_0003988_9587_10087 166
1491 3300048917 Ga0496114_0016584 Ga0496114_0016584_4931_5431 166
1492 3300048917 Ga0496114_0033164 Ga0496114_0033164_1640_2140 166
1493 3300048917 Ga0496114_0035267 Ga0496114_0035267_2732_3232 166
1494 3300048917 Ga0496114_0037568 Ga0496114_0037568_2189_2689 166
1495 3300048917 Ga0496114_0044142 Ga0496114_0044142_2944_3444 166
1496 3300048917 Ga0496114_0048111 Ga0496114_0048111_2862_3362 166
1497 3300048917 Ga0496114_0074072 Ga0496114_0074072_2292_2798 166
1498 3300048917 Ga0496114_0080231 Ga0496114_0080231_109_609 166
1499 3300048917 Ga0496114_0171723 Ga0496114_0171723_194_694 166
1500 3300048917 Ga0496114_0184220 Ga0496114_0184220_1006_1506 166
1501 3300048917 Ga0496114_0185805 Ga0496114_0185805_1202_1702 166
1502 3300048917 Ga0496114_0282991 Ga0496114_0282991_18_518 166
1503 3300048917 Ga0496114_0287420 Ga0496114_0287420_44_607 166
1504 3300048917 Ga0496114_0668769 Ga0496114_0668769_296_796 166
1505 3300048918 Ga0496115_0016372 Ga0496115_0016372_454_954 166
1506 3300048918 Ga0496115_0072557 Ga0496115_0072557_2064_2564 166
1507 3300048918 Ga0496115_0074088 Ga0496115_0074088_2038_2538 166
1508 3300048918 Ga0496115_0197645 Ga0496115_0197645_585_1085 166
1509 3300048918 Ga0496115_0280705 Ga0496115_0280705_437_937 166
1510 3300048918 Ga0496115_0985983 Ga0496115_0985983_98_598 166
1511 3300048925 Ga0496122_0046009 Ga0496122_0046009_2191_2691 166
1512 3300048926 Ga0496123_0104017 Ga0496123_0104017_401_901 166
1513 3300048927 Ga0496124_0463188 Ga0496124_0463188_186_686 166
1514 3300048927 Ga0496124_0513596 Ga0496124_0513596_14_514 166
1515 3300048929 Ga0496126_0001416 Ga0496126_0001416_815_1315 166
1516 3300048929 Ga0496126_0071755 Ga0496126_0071755_879_1379 166
1517 3300048929 Ga0496126_1035044 Ga0496126_1035044_82_582 166
1518 3300049161 Ga0501305_072301 Ga0501305_072301_92_592 166
1519 3300049514 Ga0501291_013080 Ga0501291_013080_528_1028 166
1520 3300049532 Ga0501316_037290 Ga0501316_037290_79_579 166
1521 3300049537 Ga0501321_003613 Ga0501321_003613_363_863 166
1522 3300049541 Ga0501325_042647 Ga0501325_042647_32_532 166
1523 3300049568 Ga0501031_0012768 Ga0501031_0012768_4675_5175 166
1524 3300049569 Ga0501032_0656645 Ga0501032_0656645_38_538 166
1525 3300049570 Ga0501033_0236350 Ga0501033_0236350_282_782 166
1526 3300049571 Ga0501034_0123156 Ga0501034_0123156_1791_2291 166
1527 3300049571 Ga0501034_0135476 Ga0501034_0135476_425_925 166
1528 3300049572 Ga0501036_0043959 Ga0501036_0043959_3088_3588 166
1529 3300049572 Ga0501036_0284043 Ga0501036_0284043_268_768 166
1530 3300049573 Ga0501037_0243253 Ga0501037_0243253_330_830 166
1531 3300049574 Ga0501038_0038054 Ga0501038_0038054_3549_4049 166
1532 3300049574 Ga0501038_0609363 Ga0501038_0609363_299_799 166
1533 3300049575 Ga0501039_0106794 Ga0501039_0106794_1192_1710 166
1534 3300049575 Ga0501039_0155078 Ga0501039_0155078_573_1073 166
1535 3300049575 Ga0501039_0286102 Ga0501039_0286102_231_731 166
1536 3300049575 Ga0501039_0470018 Ga0501039_0470018_414_914 166
1537 3300049576 Ga0501040_0034155 Ga0501040_0034155_2414_2914 166
1538 3300049577 Ga0501041_0062992 Ga0501041_0062992_1531_2031 166
1539 3300049577 Ga0501041_0194138 Ga0501041_0194138_483_983 166
1540 3300049578 Ga0501042_0010460 Ga0501042_0010460_1894_2394 166
1541 3300049579 Ga0501043_0794983 Ga0501043_0794983_154_654 166
1542 3300049580 Ga0501046_0196220 Ga0501046_0196220_257_757 166
1543 3300049580 Ga0501046_0570389 Ga0501046_0570389_90_590 166
1544 3300049581 Ga0501047_0194000 Ga0501047_0194000_1105_1605 166
1545 3300049582 Ga0501048_0031953 Ga0501048_0031953_3026_3526 166
1546 3300049582 Ga0501048_0563860 Ga0501048_0563860_230_730 166
1547 3300049583 Ga0501067_0007666 Ga0501067_0007666_496_996 166
1548 3300049583 Ga0501067_0021583 Ga0501067_0021583_1027_1527 166
1549 3300049583 Ga0501067_0258303 Ga0501067_0258303_26_526 166
1550 3300049584 Ga0501068_0022890 Ga0501068_0022890_857_1462 166
1551 3300049584 Ga0501068_0023954 Ga0501068_0023954_2693_3193 166
1552 3300049584 Ga0501068_0263239 Ga0501068_0263239_58_558 166
1553 3300049585 Ga0501069_0130358 Ga0501069_0130358_765_1265 166
1554 3300049585 Ga0501069_0159602 Ga0501069_0159602_23_628 166
1555 3300049585 Ga0501069_0548275 Ga0501069_0548275_176_676 166
1556 3300049586 Ga0501070_0061808 Ga0501070_0061808_410_910 166
1557 3300049587 Ga0501071_0018655 Ga0501071_0018655_3832_4332 166
1558 3300049588 Ga0501072_0234004 Ga0501072_0234004_242_742 166
1559 3300049590 Ga0501074_0007694 Ga0501074_0007694_7243_7743 166
1560 3300049591 Ga0501075_0087600 Ga0501075_0087600_154_654 166
1561 3300049591 Ga0501075_0397103 Ga0501075_0397103_515_1015 166
1562 3300049592 Ga0501076_0247499 Ga0501076_0247499_535_1035 166
1563 3300049656 Ga0501209_240869 Ga0501209_240869_38_538 166
1564 3300049673 Ga0501240_087657 Ga0501240_087657_64_564 166
1565 3300049680 Ga0501250_008378 Ga0501250_008378_150_650 166
1566 3300049680 Ga0501250_013695 Ga0501250_013695_12_512 166
1567 3300049685 Ga0501256_007866 Ga0501256_007866_454_954 166
1568 3300049704 Ga0501221_088383 Ga0501221_088383_151_651 166
1569 3300049708 Ga0501245_034443 Ga0501245_034443_11_511 166
1570 3300049741 Ga0501079_0391553 Ga0501079_0391553_531_1031 166
1571 3300049742 Ga0501080_0486509 Ga0501080_0486509_475_975 166
1572 3300049742 Ga0501080_0998959 Ga0501080_0998959_49_549 166
1573 3300049742 Ga0501080_1190372 Ga0501080_1190372_69_569 166
1574 3300049743 Ga0501081_0638674 Ga0501081_0638674_128_628 166
1575 3300049743 Ga0501081_0709696 Ga0501081_0709696_95_595 166
1576 3300049822 Ga0501035_0442828 Ga0501035_0442828_18_518 166
1577 3300049823 Ga0501044_0304336 Ga0501044_0304336_526_1026 166
1578 3300049823 Ga0501044_0364445 Ga0501044_0364445_783_1283 166
1579 3300049824 Ga0501045_0022474 Ga0501045_0022474_3705_4205 166
1580 3300049824 Ga0501045_0088686 Ga0501045_0088686_412_912 166
1581 3300049851 Ga0501212_045883 Ga0501212_045883_164_664 166
1582 3300050489 nmdc:mga03683_39773_c1 nmdc:mga03683_39773_c1_1204_1704 166
1583 3300050490 nmdc:mga03n38_123397_c1 nmdc:mga03n38_123397_c1_583_1083 166
1584 3300050490 nmdc:mga03n38_194005_c1 nmdc:mga03n38_194005_c1_145_666 166
1585 3300050490 nmdc:mga03n38_219482_c1 nmdc:mga03n38_219482_c1_35_658 166
1586 3300050490 nmdc:mga03n38_305925_c1 nmdc:mga03n38_305925_c1_202_717 166
1587 3300050490 nmdc:mga03n38_569609_c1 nmdc:mga03n38_569609_c1_28_528 166
1588 3300050491 nmdc:mga00v17_139512_c1 nmdc:mga00v17_139512_c1_677_1177 166
1589 3300050491 nmdc:mga00v17_215890_c1 nmdc:mga00v17_215890_c1_600_1100 166
1590 3300050491 nmdc:mga00v17_26313_c1 nmdc:mga00v17_26313_c1_2004_2519 166
1591 3300050491 nmdc:mga00v17_299739_c1 nmdc:mga00v17_299739_c1_104_625 166
1592 3300050492 nmdc:mga0yw44_1017790_c1 nmdc:mga0yw44_1017790_c1_33_533 166
1593 3300050492 nmdc:mga0yw44_178061_c1 nmdc:mga0yw44_178061_c1_872_1372 166
1594 3300050492 nmdc:mga0yw44_229738_c2 nmdc:mga0yw44_229738_c2_98_619 166
1595 3300050492 nmdc:mga0yw44_384082_c1 nmdc:mga0yw44_384082_c1_43_543 166
1596 3300050492 nmdc:mga0yw44_43780_c1 nmdc:mga0yw44_43780_c1_1472_1972 166
1597 3300050492 nmdc:mga0yw44_52423_c1 nmdc:mga0yw44_52423_c1_574_1074 166
1598 3300050492 nmdc:mga0yw44_524822_c1 nmdc:mga0yw44_524822_c1_36_551 166
1599 3300050492 nmdc:mga0yw44_550391_c1 nmdc:mga0yw44_550391_c1_252_752 166
1600 3300050492 nmdc:mga0yw44_862200_c1 nmdc:mga0yw44_862200_c1_50_565 166
1601 3300050492 nmdc:mga0yw44_89590_c1 nmdc:mga0yw44_89590_c1_559_1059 166
1602 3300050492 nmdc:mga0yw44_9125_c1 nmdc:mga0yw44_9125_c1_2570_3070 166
1603 3300050492 nmdc:mga0yw44_9407_c1 nmdc:mga0yw44_9407_c1_1597_2100 166
1604 3300050494 nmdc:mga06z11_133687_c1 nmdc:mga06z11_133687_c1_459_980 166
1605 3300050494 nmdc:mga06z11_252029_c1 nmdc:mga06z11_252029_c1_228_728 166
1606 3300050494 nmdc:mga06z11_357532_c1 nmdc:mga06z11_357532_c1_228_743 166
1607 3300050494 nmdc:mga06z11_50015_c1 nmdc:mga06z11_50015_c1_1334_1834 166
1608 3300050495 nmdc:mga04h51_236682_c1 nmdc:mga04h51_236682_c1_141_641 166
1609 3300050495 nmdc:mga04h51_41157_c1 nmdc:mga04h51_41157_c1_871_1392 166
1610 3300050496 nmdc:mga07m45_146265_c1 nmdc:mga07m45_146265_c1_230_730 166
1611 3300050496 nmdc:mga07m45_257343_c1 nmdc:mga07m45_257343_c1_445_960 166
1612 3300050496 nmdc:mga07m45_34402_c1 nmdc:mga07m45_34402_c1_692_1207 166
1613 3300050496 nmdc:mga07m45_529515_c1 nmdc:mga07m45_529515_c1_75_575 166
1614 3300050507 nmdc:mga05p37_992141_c1 nmdc:mga05p37_992141_c1_123_623 166
1615 3300050508 nmdc:mga09592_304569_c1 nmdc:mga09592_304569_c1_501_1001 166
1616 3300050511 nmdc:mga08y16_1213314_c1 nmdc:mga08y16_1213314_c1_129_629 166
1617 3300050511 nmdc:mga08y16_493536_c1 nmdc:mga08y16_493536_c1_114_614 166
1618 3300050511 nmdc:mga08y16_8960_c1 nmdc:mga08y16_8960_c1_627_1127 166
1619 3300050511 nmdc:mga08y16_969961_c1 nmdc:mga08y16_969961_c1_102_602 166
1620 3300050512 nmdc:mga0n895_172353_c1 nmdc:mga0n895_172353_c1_77_577 166
1621 3300050512 nmdc:mga0n895_82332_c1 nmdc:mga0n895_82332_c1_112_612 166
1622 3300050513 nmdc:mga0rr50_177049_c1 nmdc:mga0rr50_177049_c1_511_1011 166
1623 3300050513 nmdc:mga0rr50_194951_c1 nmdc:mga0rr50_194951_c1_280_780 166
1624 3300050513 nmdc:mga0rr50_22754_c1 nmdc:mga0rr50_22754_c1_2112_2612 166
1625 3300050514 nmdc:mga08x19_103780_c1 nmdc:mga08x19_103780_c1_195_695 166
1626 3300050514 nmdc:mga08x19_116038_c1 nmdc:mga08x19_116038_c1_973_1473 166
1627 3300050515 nmdc:mga0a205_31162_c1 nmdc:mga0a205_31162_c1_51_551 166
1628 3300053077 Ga0495601_0008337 Ga0495601_0008337_1480_2022 166
1629 3300053077 Ga0495601_0014439 Ga0495601_0014439_3411_3911 166
1630 3300053077 Ga0495601_0079128 Ga0495601_0079128_530_1030 166
1631 3300053077 Ga0495601_0205272 Ga0495601_0205272_166_666 166
1632 3300053077 Ga0495601_0219697 Ga0495601_0219697_642_1142 166
1633 3300053078 Ga0495612_0004187 Ga0495612_0004187_4061_4561 166
1634 3300053078 Ga0495612_0023389 Ga0495612_0023389_658_1158 166
1635 3300053078 Ga0495612_0081860 Ga0495612_0081860_208_708 166
1636 3300053078 Ga0495612_0136966 Ga0495612_0136966_21_521 166
1637 3300053078 Ga0495612_0153294 Ga0495612_0153294_24_524 166
1638 3300053083 Ga0495655_0204502 Ga0495655_0204502_82_582 166
1639 3300053084 Ga0495595_0008237 Ga0495595_0008237_1980_2480 166
1640 3300053084 Ga0495595_0028049 Ga0495595_0028049_1427_1927 166
1641 3300053084 Ga0495595_0031444 Ga0495595_0031444_1783_2325 166
1642 3300053084 Ga0495595_0144015 Ga0495595_0144015_82_582 166
1643 3300053085 Ga0495619_0004247 Ga0495619_0004247_8363_8863 166
1644 3300053085 Ga0495619_0062043 Ga0495619_0062043_1667_2167 166
1645 3300053085 Ga0495619_0206890 Ga0495619_0206890_334_834 166
1646 3300053085 Ga0495619_0351091 Ga0495619_0351091_211_711 166
1647 3300053085 Ga0495619_0694468 Ga0495619_0694468_131_631 166
1648 3300053085 Ga0495619_0889847 Ga0495619_0889847_77_583 166
1649 3300053088 Ga0500644_0000029 Ga0500644_0000029_83242_83742 166
1650 3300053117 Ga0500593_000018 Ga0500593_000018_24575_25075 166
1651 3300053140 Ga0500573_0039297 Ga0500573_0039297_1880_2380 166
1652 3300054114 Ga0501084_0176448 Ga0501084_0176448_161_661 166
1653 3300054114 Ga0501084_0272241 Ga0501084_0272241_859_1413 166
1654 3300060353 Ga0501082_0098185 Ga0501082_0098185_1279_1779 166
1655 3300060353 Ga0501082_0782077 Ga0501082_0782077_199_699 166
1656 3300061719 Ga0466962_0063362 Ga0466962_0063362_237_737 166
1657 3300061719 Ga0466962_0154951 Ga0466962_0154951_338_838 166
1658 3300061734 Ga0530510_0314690 Ga0530510_0314690_424_1017 166
1659 3300061734 Ga0530510_0498279 Ga0530510_0498279_367_867 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01814

Hemerythrin

Hemerythrin HHE cation binding domain

45

165

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.8464 4 146
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.7323 4 146
2p0n-assembly2.cif.gz_B nmb1532 protein from neisseria meningitidis, unknown function 0.7289 4 145
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.7273 3 140
3cax-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein pf0695 0.7085 1 142
ID Description Score Start End Superfamily
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.9085 3 144 1.20.120.520
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8615 3 144 1.20.120.520
af_A0A1D6NF49_102_201_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8105 55 141 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8059 1 143 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.7956 1 143 1.20.120.520
ID Description Score Start End GO Terms
AF-A0A7V9V5N2-F1-model_v4 Hemerythrin domain-containing protein 0.9936 4 151
AF-A0A4Q3HTP6-F1-model_v4 deleted 0.9782 4 105
AF-A0A354SBD8-F1-model_v4 Hemerythrin 0.9746 4 147
AF-A0A345P753-F1-model_v4 Hemerythrin domain-containing protein 0.9744 4 146
AF-A0A197SIB1-F1-model_v4 Hemerythrin-like domain-containing protein 0.9728 1 154

Feature Viewer

pLDDT pTM Quality
93.75 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map